F459111

General Info

Members Datasets Scaffolds Average Seq Length
524 375 486 121

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_102544860|Ga0068852_1025448601
Length 135
Sequence MTNAAVHVEGQATQHALHTYVHDAVASGATHAEGQQHPIKLYLVVWGWLFVLSTCSYLVDYFGFHGYLRWSLILLFMVLKAGLIVAVFMHMAWERLALTYAILLPPTLVLVFVAIMVFESDYTHLLRTIFFAPAA

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2643221629 Devosia sp. Root105 Isolate Unclassified
10 2643221662 Devosia sp. Root413D1 Isolate Unclassified
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2738543024 Aminobacter sp. AP02 Isolate Unclassified
13 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
14 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
15 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
16 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
17 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
18 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
19 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
20 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
21 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
22 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
23 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
24 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
25 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
26 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
27 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
28 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
29 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
30 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
31 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
32 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
33 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
143 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
144 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
145 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
336 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
337 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
338 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
361 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
362 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
365 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
368 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
374 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
375 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.76
Metatranscriptomes 1.34
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 4.96
Rhizoplane 4.58
Rhizosphere 76.91
Stem 0
Stem Tuber 0
Unclassified 6.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006178 3300000549 Bacteria 1500
2 JGI24742J22300_10053170 3300002244 Bacteria 736
3 JGI25406J46586_10009805 3300003203 Bacteria 4276
4 JGI25160J50197_1016585 3300003354 Bacteria 2369
5 Ga0055539_1007298 3300003752 Bacteria 1402
6 Ga0055529_1032847 3300003763 Bacteria 634
7 JGI25405J52794_10065461 3300003911 Bacteria 789
8 Ga0058859_11759064 3300004798 Bacteria 779
9 Ga0058859_11814239 3300004798 Bacteria 1825
10 Ga0058860_11752966 3300004801 Bacteria 714
11 Ga0058862_12336261 3300004803 Bacteria 796
12 Ga0058862_12639219 3300004803 Bacteria 1045
13 Ga0065165_1085466 3300005262 Bacteria 812
14 Ga0065716_1009675 3300005277 Bacteria 671
15 Ga0065707_11057986 3300005295 Bacteria 525
16 Ga0070658_11367860 3300005327 Bacteria 614
17 Ga0070690_100387874 3300005330 Bacteria 1023
18 Ga0070670_100806223 3300005331 Bacteria 848
19 Ga0070677_10412084 3300005333 Bacteria 715
20 Ga0068869_100402146 3300005334 Bacteria 1127
21 Ga0070680_100008151 3300005336 Bacteria 8004
22 Ga0070680_100737727 3300005336 Bacteria 848
23 Ga0070682_100562001 3300005337 Bacteria 895
24 Ga0068868_100654957 3300005338 Bacteria 935
25 Ga0070660_100006027 3300005339 Bacteria 8383
26 Ga0070660_100068185 3300005339 Bacteria 2772
27 Ga0070660_100839132 3300005339 Bacteria 774
28 Ga0070660_101428936 3300005339 Bacteria 588
29 Ga0070660_101749844 3300005339 Bacteria 529
30 Ga0070691_10048366 3300005341 Bacteria 2024
31 Ga0070692_10511778 3300005345 Bacteria 780
32 Ga0070668_100029541 3300005347 Bacteria 4164
33 Ga0070668_100439601 3300005347 Bacteria 1119
34 Ga0070668_100547434 3300005347 Bacteria 1007
35 Ga0070669_100601918 3300005353 Bacteria 921
36 Ga0070674_100005738 3300005356 Bacteria 7203
37 Ga0070659_100022917 3300005366 Bacteria 4773
38 Ga0070667_100072578 3300005367 Bacteria 2933
39 Ga0070703_10068032 3300005406 Bacteria 1182
40 Ga0070709_11624099 3300005434 Bacteria 527
41 Ga0070714_100467216 3300005435 Bacteria 1200
42 Ga0070714_100832161 3300005435 Bacteria 895
43 Ga0070714_100879229 3300005435 Bacteria 870
44 Ga0070713_100035183 3300005436 Bacteria 4029
45 Ga0070713_100828651 3300005436 Bacteria 888
46 Ga0070710_10064775 3300005437 Bacteria 2091
47 Ga0070710_10447431 3300005437 Bacteria 875
48 Ga0070710_10551771 3300005437 Bacteria 796
49 Ga0070701_10561049 3300005438 Bacteria 751
50 Ga0070711_100909270 3300005439 Bacteria 751
51 Ga0070705_100303930 3300005440 Bacteria 1144
52 Ga0070700_100458484 3300005441 Bacteria 972
53 Ga0070700_100964741 3300005441 Bacteria 698
54 Ga0070694_100691422 3300005444 Bacteria 829
55 Ga0070708_100148425 3300005445 Bacteria 2179
56 Ga0070708_100357990 3300005445 Bacteria 1375
57 Ga0070663_100589389 3300005455 Bacteria 934
58 Ga0070678_100275881 3300005456 Bacteria 1420
59 Ga0070662_100183148 3300005457 Bacteria 1652
60 Ga0070681_10024150 3300005458 Bacteria 6120
61 Ga0070681_10089558 3300005458 Bacteria 3029
62 Ga0070681_11474173 3300005458 Bacteria 605
63 Ga0068867_100178353 3300005459 Bacteria 1687
64 Ga0070679_100020888 3300005530 Bacteria 6387
65 Ga0070679_100100615 3300005530 Bacteria 2876
66 Ga0070684_100030174 3300005535 Bacteria 4604
67 Ga0068853_100021864 3300005539 Bacteria 5335
68 Ga0068853_100175345 3300005539 Bacteria 1942
69 Ga0068853_100746832 3300005539 Bacteria 935
70 Ga0070672_100025077 3300005543 Bacteria 4417
71 Ga0070686_100120485 3300005544 Bacteria 1801
72 Ga0070686_100924770 3300005544 Bacteria 711
73 Ga0070695_100494835 3300005545 Bacteria 945
74 Ga0070696_100057901 3300005546 Bacteria 2705
75 Ga0070693_100327261 3300005547 Bacteria 1042
76 Ga0070665_100694545 3300005548 Bacteria 1030
77 Ga0070665_102195586 3300005548 Bacteria 556
78 Ga0070704_100279893 3300005549 Bacteria 1382
79 Ga0070704_100943867 3300005549 Bacteria 778
80 Ga0068855_100082367 3300005563 Bacteria 3729
81 Ga0068855_100163194 3300005563 Bacteria 2527
82 Ga0068855_101773669 3300005563 Bacteria 628
83 Ga0068857_100205221 3300005577 Bacteria 1798
84 Ga0068856_100752466 3300005614 Bacteria 994
85 Ga0070702_100411285 3300005615 Bacteria 971
86 Ga0068852_100315150 3300005616 Bacteria 1518
87 Ga0068852_102544860 3300005616 Bacteria 532
88 Ga0068866_10098123 3300005718 Bacteria 1610
89 Ga0068851_10012797 3300005834 Bacteria 3963
90 Ga0068870_10768063 3300005840 Bacteria 671
91 Ga0068860_100417201 3300005843 Bacteria 1330
92 Ga0068862_100508389 3300005844 Bacteria 1145
93 Ga0081455_10011421 3300005937 Bacteria 8926
94 Ga0081455_10115734 3300005937 Bacteria 2122
95 Ga0081538_10037877 3300005981 Bacteria 3119
96 Ga0081540_1006168 3300005983 Bacteria 8792
97 Ga0081540_1037952 3300005983 Bacteria 2546
98 Ga0081540_1041606 3300005983 Bacteria 2380
99 Ga0081539_10001498 3300005985 Bacteria 39469
100 Ga0081539_10088597 3300005985 Bacteria 1605
101 Ga0070717_10877522 3300006028 Bacteria 817
102 Ga0070717_11707076 3300006028 Bacteria 570
103 Ga0075363_100435290 3300006048 Bacteria 773
104 Ga0070716_100250440 3300006173 Bacteria 1206
105 Ga0070716_100624507 3300006173 Bacteria 814
106 Ga0070712_100057347 3300006175 Bacteria 2735
107 Ga0075367_10224107 3300006178 Bacteria 1177
108 Ga0075367_10581006 3300006178 Bacteria 712
109 Ga0075366_10239926 3300006195 Bacteria 1105
110 Ga0075370_10407713 3300006353 Bacteria 816
111 Ga0075428_100111834 3300006844 Bacteria 2975
112 Ga0075431_102178207 3300006847 Bacteria 509
113 Ga0075433_10326017 3300006852 Bacteria 1358
114 Ga0075433_10632320 3300006852 Bacteria 939
115 Ga0075434_100053677 3300006871 Bacteria 4004
116 Ga0075429_100204204 3300006880 Bacteria 1731
117 Ga0068865_100021082 3300006881 Bacteria 4235
118 Ga0075435_100340810 3300007076 Bacteria 1284
119 Ga0099794_10011698 3300007265 Bacteria 3765
120 Ga0099794_10098265 3300007265 Bacteria 1459
121 Ga0099794_10484394 3300007265 Bacteria 650
122 Ga0099795_10160129 3300007788 Bacteria 928
123 Ga0099795_10264345 3300007788 Bacteria 746
124 Ga0105240_10014043 3300009093 Bacteria 10954
125 Ga0111539_10697485 3300009094 Bacteria 1182
126 Ga0111539_11161118 3300009094 Bacteria 897
127 Ga0105245_10596056 3300009098 Bacteria 1131
128 Ga0105245_11145680 3300009098 Bacteria 825
129 Ga0105245_11825516 3300009098 Bacteria 661
130 Ga0105247_10047833 3300009101 Bacteria 2627
131 Ga0105247_10496130 3300009101 Bacteria 889
132 Ga0105247_10702916 3300009101 Bacteria 761
133 Ga0114129_10527554 3300009147 Bacteria 1539
134 Ga0114129_12567341 3300009147 Bacteria 608
135 Ga0114129_13010029 3300009147 Bacteria 554
136 Ga0105243_10672842 3300009148 Bacteria 1006
137 Ga0105242_10677219 3300009176 Bacteria 1006
138 Ga0105237_10008632 3300009545 Bacteria 11016
139 Ga0105237_10186749 3300009545 Bacteria 2073
140 Ga0105238_10013209 3300009551 Bacteria 8333
141 Ga0105238_10792584 3300009551 Bacteria 963
142 Ga0105249_10216736 3300009553 Bacteria 1882
143 Ga0105249_10603646 3300009553 Bacteria 1152
144 Ga0099796_10067925 3300010159 Bacteria 1280
145 Ga0105239_10049420 3300010375 Bacteria 4612
146 Ga0105239_10090215 3300010375 Bacteria 3382
147 Ga0105239_10213195 3300010375 Bacteria 2165
148 Ga0105239_10684934 3300010375 Bacteria 1172
149 Ga0105239_12794751 3300010375 Bacteria 570
150 Ga0105246_10357233 3300011119 Bacteria 1199
151 Ga0157370_10589574 3300013104 Bacteria 1018
152 Ga0157370_11685192 3300013104 Bacteria 569
153 Ga0157369_10016214 3300013105 Bacteria 8386
154 Ga0157374_11577427 3300013296 Bacteria 680
155 Ga0157374_11985841 3300013296 Bacteria 608
156 Ga0157378_10588202 3300013297 Bacteria 1123
157 Ga0157378_11966149 3300013297 Bacteria 634
158 Ga0163162_10131787 3300013306 Bacteria 2608
159 Ga0163162_10920077 3300013306 Bacteria 987
160 Ga0163162_12320954 3300013306 Bacteria 616
161 Ga0157372_10480933 3300013307 Bacteria 1448
162 Ga0157372_12900741 3300013307 Bacteria 549
163 Ga0157375_10904317 3300013308 Bacteria 1026
164 Ga0157375_12704040 3300013308 Bacteria 593
165 Ga0157380_10011551 3300014326 Bacteria 6382
166 Ga0157380_10806260 3300014326 Bacteria 956
167 Ga0157380_11376991 3300014326 Bacteria 755
168 Ga0182008_10015180 3300014497 Bacteria 4023
169 Ga0182008_10514703 3300014497 Bacteria 660
170 Ga0157379_10780246 3300014968 Bacteria 901
171 Ga0182005_1026567 3300015265 Bacteria 1579
172 Ga0182005_1219863 3300015265 Bacteria 577
173 Ga0163161_10738268 3300017792 Bacteria 823
174 Ga0163161_10809755 3300017792 Bacteria 788
175 Ga0214544_1000002 3300021320 Bacteria 753857
176 Ga0214542_1000001 3300021321 Bacteria 1018696
177 Ga0214545_1000001 3300021324 Bacteria 1092817
178 Ga0214543_1000001 3300021327 Bacteria 776921
179 Ga0209677_105071 3300025253 Bacteria 3561
180 Ga0209233_1004223 3300025261 Bacteria 4922
181 Ga0209455_1002025 3300025272 Bacteria 8274
182 Ga0209455_1027621 3300025272 Bacteria 1002
183 Ga0209130_1000565 3300025284 Bacteria 36601
184 Ga0209025_1000099 3300025294 Bacteria 231353
185 Ga0209758_1002834 3300025297 Bacteria 16851
186 Ga0207426_1000065 3300025302 Bacteria 353625
187 Ga0207656_10010305 3300025321 Bacteria 3498
188 Ga0207653_10002361 3300025885 Bacteria 6017
189 Ga0207692_10223249 3300025898 Bacteria 1118
190 Ga0207692_10960714 3300025898 Bacteria 563
191 Ga0207642_10433401 3300025899 Bacteria 793
192 Ga0207688_10357397 3300025901 Bacteria 901
193 Ga0207685_10499445 3300025905 Bacteria 640
194 Ga0207699_10405483 3300025906 Bacteria 971
195 Ga0207699_10797981 3300025906 Bacteria 694
196 Ga0207643_10172979 3300025908 Bacteria 1304
197 Ga0207643_10544632 3300025908 Bacteria 744
198 Ga0207684_10005128 3300025910 Bacteria 12201
199 Ga0207707_10007364 3300025912 Bacteria 9583
200 Ga0207707_11243518 3300025912 Bacteria 601
201 Ga0207695_10057445 3300025913 Bacteria 4042
202 Ga0207671_10147831 3300025914 Bacteria 1814
203 Ga0207693_10115338 3300025915 Bacteria 2109
204 Ga0207693_10267214 3300025915 Bacteria 1340
205 Ga0207693_10645318 3300025915 Bacteria 822
206 Ga0207663_10244090 3300025916 Bacteria 1319
207 Ga0207660_10003393 3300025917 Bacteria 10382
208 Ga0207657_10005499 3300025919 Bacteria 13230
209 Ga0207657_10012946 3300025919 Bacteria 8202
210 Ga0207652_10003525 3300025921 Bacteria 12905
211 Ga0207652_10103027 3300025921 Bacteria 2523
212 Ga0207646_10009547 3300025922 Bacteria 9580
213 Ga0207681_10381309 3300025923 Bacteria 1135
214 Ga0207694_10081625 3300025924 Bacteria 2540
215 Ga0207694_10622530 3300025924 Bacteria 908
216 Ga0207687_10587768 3300025927 Bacteria 937
217 Ga0207664_10156933 3300025929 Bacteria 1938
218 Ga0207664_11528145 3300025929 Bacteria 589
219 Ga0207706_10100115 3300025933 Bacteria 2550
220 Ga0207706_10758581 3300025933 Bacteria 826
221 Ga0207709_10011619 3300025935 Bacteria 4855
222 Ga0207709_10297911 3300025935 Bacteria 1198
223 Ga0207669_10594548 3300025937 Bacteria 898
224 Ga0207669_11536446 3300025937 Bacteria 568
225 Ga0207665_10089693 3300025939 Bacteria 2130
226 Ga0207665_10946835 3300025939 Bacteria 684
227 Ga0207691_10072869 3300025940 Bacteria 3098
228 Ga0207679_11451412 3300025945 Bacteria 629
229 Ga0207667_10011485 3300025949 Bacteria 10287
230 Ga0207667_10233898 3300025949 Bacteria 1881
231 Ga0207651_10073900 3300025960 Bacteria 2426
232 Ga0207712_10108407 3300025961 Bacteria 2078
233 Ga0207712_10419739 3300025961 Bacteria 1128
234 Ga0207712_11347630 3300025961 Bacteria 638
235 Ga0207668_10139776 3300025972 Bacteria 1860
236 Ga0207668_10370367 3300025972 Bacteria 1203
237 Ga0207668_10615566 3300025972 Bacteria 947
238 Ga0207640_11500683 3300025981 Bacteria 606
239 Ga0207677_10129867 3300026023 Bacteria 1911
240 Ga0207677_10197481 3300026023 Bacteria 1596
241 Ga0207703_10176371 3300026035 Bacteria 1883
242 Ga0207639_10040700 3300026041 Bacteria 3470
243 Ga0207639_11116562 3300026041 Bacteria 739
244 Ga0207678_10830281 3300026067 Bacteria 816
245 Ga0207702_10193667 3300026078 Bacteria 1880
246 Ga0207641_11594772 3300026088 Bacteria 655
247 Ga0207648_10188404 3300026089 Bacteria 1828
248 Ga0207648_10523933 3300026089 Bacteria 1086
249 Ga0207674_10075973 3300026116 Bacteria 3368
250 Ga0207698_10043253 3300026142 Bacteria 3373
251 Ga0207698_11133650 3300026142 Bacteria 795
252 Ga0209179_1033704 3300027512 Bacteria 1060
253 Ga0209179_1092266 3300027512 Bacteria 672
254 Ga0209588_1008591 3300027671 Bacteria 3031
255 Ga0268265_10672347 3300028380 Bacteria 997
256 Ga0268264_10577484 3300028381 Bacteria 1105
257 Ga0307517_10296419 3300028786 Bacteria 910
258 Ga0307515_10473701 3300028794 Bacteria 865
259 Ga0265328_10265981 3300031239 Bacteria 658
260 Ga0265327_10008003 3300031251 Bacteria 7981
261 Ga0265316_10163786 3300031344 Bacteria 1662
262 Ga0307408_100101998 3300031548 Bacteria 2188
263 Ga0307408_100366579 3300031548 Bacteria 1227
264 Ga0307408_100415066 3300031548 Bacteria 1159
265 Ga0307408_101777318 3300031548 Bacteria 589
266 Ga0307413_10883749 3300031824 Bacteria 758
267 Ga0307406_10299527 3300031901 Bacteria 1235
268 Ga0307406_10397907 3300031901 Bacteria 1091
269 Ga0307406_10516029 3300031901 Bacteria 972
270 Ga0307406_10876277 3300031901 Bacteria 763
271 Ga0307407_10636701 3300031903 Bacteria 797
272 Ga0307412_10658231 3300031911 Bacteria 894
273 Ga0307412_10858579 3300031911 Bacteria 792
274 Ga0307409_100294384 3300031995 Bacteria 1507
275 Ga0307409_100895825 3300031995 Bacteria 900
276 Ga0307416_100049781 3300032002 Bacteria 3334
277 Ga0307416_100123710 3300032002 Bacteria 2312
278 Ga0307416_100577392 3300032002 Bacteria 1201
279 Ga0307416_101369547 3300032002 Bacteria 813
280 Ga0307416_101685928 3300032002 Bacteria 739
281 Ga0307416_101749538 3300032002 Bacteria 726
282 Ga0307414_10755670 3300032004 Bacteria 884
283 Ga0307414_11473261 3300032004 Bacteria 633
284 Ga0307415_100138775 3300032126 Bacteria 1853
285 Ga0307415_100291016 3300032126 Bacteria 1348
286 Ga0307415_100759200 3300032126 Bacteria 881
287 Ga0307415_101148261 3300032126 Bacteria 729
288 Ga0315911_1000009 3300033442 Bacteria 379354
289 Ga0373923_0235622 3300035111 Bacteria 854
290 Ga0373945_0060589 3300035116 Bacteria 1412
291 Ga0373954_0227944 3300035118 Bacteria 917
292 Ga0373943_0052460 3300035170 Bacteria 2011
293 Ga0373943_0094638 3300035170 Bacteria 1553
294 Ga0373955_0030305 3300035172 Bacteria 2823
295 Ga0373935_0192602 3300035692 Bacteria 1405
296 Ga0373927_0028596 3300035695 Bacteria 3636
297 Ga0373927_0042274 3300035695 Bacteria 2953
298 Ga0373927_0370321 3300035695 Bacteria 944
299 Ga0373927_1059579 3300035695 Bacteria 535
300 Ga0373947_0059315 3300035725 Bacteria 2320
301 Ga0373925_0308472 3300037068 Bacteria 1279
302 Ga0395900_0099451 3300037418 Bacteria 2988
303 Ga0395900_0137113 3300037418 Bacteria 2507
304 Ga0395898_0033916 3300037466 Bacteria 5091
305 Ga0395901_0036715 3300038443 Bacteria 5065
306 Ga0395901_0377898 3300038443 Bacteria 1459
307 Ga0242420_005082 3300038996 Bacteria 2021
308 Ga0436360_1366726 3300039438 Bacteria 2269
309 Ga0436361_0060433 3300039447 Bacteria 16066
310 Ga0436361_0135686 3300039447 Bacteria 1560
311 Ga0436361_1009582 3300039447 Bacteria 3528
312 Ga0439465_0043400 3300041413 Bacteria 1459
313 Ga0451795_0701693 3300041456 Bacteria 515
314 Ga0451802_1018590 3300041460 Bacteria 779
315 Ga0439445_0133568 3300042004 Bacteria 717
316 Ga0439432_105518 3300042006 Bacteria 841
317 Ga0450900_083457 3300042136 Bacteria 515
318 Ga0439458_0045626 3300042157 Bacteria 1072
319 Ga0466969_0088693 3300044656 Bacteria 1468
320 Ga0466972_0136223 3300044658 Bacteria 1156
321 Ga0466966_0152513 3300044684 Bacteria 1409
322 Ga0466966_0165307 3300044684 Bacteria 1346
323 Ga0466970_0155115 3300044765 Bacteria 1265
324 Ga0466970_0429498 3300044765 Bacteria 756
325 Ga0466970_0786431 3300044765 Bacteria 557
326 Ga0466957_0487295 3300044842 Bacteria 853
327 Ga0466967_0673331 3300045976 Bacteria 1024
328 Ga0466967_1573302 3300045976 Bacteria 655
329 Ga0495603_0064724 3300046455 Bacteria 2155
330 Ga0495629_0109490 3300046459 Bacteria 1926
331 Ga0495638_0011225 3300046460 Bacteria 6182
332 Ga0495641_0293061 3300046461 Bacteria 733
333 Ga0495641_0492546 3300046461 Bacteria 559
334 Ga0495653_0109117 3300046463 Bacteria 1992
335 Ga0495580_0622365 3300046472 Bacteria 712
336 Ga0495580_0660792 3300046472 Bacteria 687
337 Ga0495605_0020857 3300046474 Bacteria 3477
338 Ga0495662_0229531 3300046476 Bacteria 915
339 Ga0495664_0260211 3300046477 Bacteria 1049
340 Ga0495584_0004237 3300046491 Bacteria 7736
341 Ga0495585_0124172 3300046492 Bacteria 1363
342 Ga0495594_0267238 3300046499 Bacteria 974
343 Ga0495616_0121192 3300046513 Bacteria 1207
344 Ga0495618_0017817 3300046514 Bacteria 4358
345 Ga0495620_0066141 3300046515 Bacteria 1490
346 Ga0495628_0083936 3300046516 Bacteria 2472
347 Ga0495630_0036826 3300046517 Bacteria 3657
348 Ga0495631_0011013 3300046518 Bacteria 4464
349 Ga0495637_0034570 3300046520 Bacteria 2212
350 Ga0495637_0161978 3300046520 Bacteria 839
351 Ga0495644_0016846 3300046523 Bacteria 2796
352 Ga0495648_0201144 3300046524 Bacteria 997
353 Ga0495663_0001423 3300046525 Bacteria 7552
354 Ga0495666_0192277 3300046526 Bacteria 940
355 Ga0495652_0030532 3300046529 Bacteria 4725
356 Ga0495640_0048473 3300046533 Bacteria 2935
357 Ga0495587_0012614 3300046536 Bacteria 5315
358 Ga0495598_0000455 3300046537 Bacteria 7448
359 Ga0495609_0138533 3300046538 Bacteria 1039
360 Ga0495621_0143203 3300046539 Bacteria 936
361 Ga0495597_0390608 3300046542 Bacteria 530
362 Ga0495633_0075780 3300046558 Bacteria 1566
363 Ga0495667_0165643 3300046559 Bacteria 1421
364 Ga0495656_0002385 3300046615 Bacteria 6228
365 Ga0495668_0007245 3300046616 Bacteria 7117
366 Ga0495634_0010343 3300046642 Bacteria 6836
367 Ga0495611_0006444 3300046648 Bacteria 5005
368 Ga0495635_0088404 3300046663 Bacteria 2120
369 Ga0495659_0190282 3300046664 Bacteria 838
370 Ga0495661_0020592 3300046665 Bacteria 4304
371 Ga0495599_0019202 3300046678 Bacteria 4262
372 Ga0495623_0137482 3300046679 Bacteria 1457
373 Ga0495646_0165314 3300046680 Bacteria 1222
374 Ga0495647_0171298 3300046681 Bacteria 940
375 Ga0495658_0014776 3300046683 Bacteria 3994
376 Ga0495658_0156820 3300046683 Bacteria 1401
377 Ga0495669_0007762 3300046684 Bacteria 4505
378 Ga0495669_0015487 3300046684 Bacteria 3266
379 Ga0495613_0080074 3300046689 Bacteria 2375
380 Ga0495624_0598065 3300046690 Bacteria 657
381 Ga0495624_0754533 3300046690 Bacteria 576
382 Ga0495670_0164820 3300046691 Bacteria 1165
383 Ga0495671_0005180 3300046692 Bacteria 7670
384 Ga0495671_0460312 3300046692 Bacteria 608
385 Ga0495660_0074144 3300046810 Bacteria 1798
386 Ga0495604_0078148 3300047317 Bacteria 2484
387 Ga0495636_0206868 3300047318 Bacteria 897
388 Ga0495674_0117406 3300047319 Bacteria 2250
389 Ga0495672_0080207 3300047320 Bacteria 1821
390 Ga0495672_0106137 3300047320 Bacteria 1514
391 Ga0495672_0295024 3300047320 Bacteria 770
392 Ga0495676_0211815 3300047321 Bacteria 1340
393 Ga0495680_0066552 3300047322 Bacteria 2757
394 Ga0495675_0059618 3300047444 Bacteria 2420
395 Ga0495677_0013807 3300047445 Bacteria 2940
396 Ga0495679_044877 3300047446 Bacteria 1352
397 Ga0495673_0186138 3300047469 Bacteria 784
398 Ga0495684_0446021 3300047471 Bacteria 900
399 Ga0495686_0275259 3300047472 Bacteria 937
400 Ga0495593_0358398 3300047673 Bacteria 729
401 Ga0495602_0039597 3300048088 Bacteria 4338
402 Ga0495626_0187386 3300048091 Bacteria 855
403 Ga0496101_0224719 3300048904 Bacteria 1458
404 Ga0496101_0484918 3300048904 Bacteria 976
405 Ga0496102_0457608 3300048905 Bacteria 1197
406 Ga0496102_0562109 3300048905 Bacteria 1063
407 Ga0496102_0661458 3300048905 Bacteria 968
408 Ga0496105_0854648 3300048908 Bacteria 688
409 Ga0496106_0951871 3300048909 Bacteria 677
410 Ga0496107_0213239 3300048910 Bacteria 1436
411 Ga0496107_0433229 3300048910 Bacteria 977
412 Ga0496108_0082076 3300048911 Bacteria 2733
413 Ga0496109_0040022 3300048912 Bacteria 4245
414 Ga0496110_0169179 3300048913 Bacteria 1982
415 Ga0496110_0872015 3300048913 Bacteria 806
416 Ga0496111_0007449 3300048914 Bacteria 7176
417 Ga0496111_0313031 3300048914 Bacteria 1163
418 Ga0496112_0152437 3300048915 Bacteria 2279
419 Ga0496113_0999472 3300048916 Bacteria 659
420 Ga0496114_0707278 3300048917 Bacteria 883
421 Ga0496114_1096525 3300048917 Bacteria 681
422 Ga0496115_0211115 3300048918 Bacteria 1603
423 Ga0496115_0348103 3300048918 Bacteria 1209
424 Ga0496115_1427948 3300048918 Bacteria 510
425 Ga0496116_0203912 3300048919 Bacteria 1032
426 Ga0496118_0092392 3300048921 Bacteria 2077
427 Ga0496121_0052002 3300048924 Bacteria 3445
428 Ga0496121_0116822 3300048924 Bacteria 2022
429 Ga0496122_0364244 3300048925 Bacteria 749
430 Ga0496125_0094138 3300048928 Bacteria 2233
431 Ga0496126_0237138 3300048929 Bacteria 1526
432 Ga0496126_0249698 3300048929 Bacteria 1479
433 Ga0496126_0497411 3300048929 Bacteria 975
434 Ga0496126_0841165 3300048929 Bacteria 701
435 Ga0501032_0430035 3300049569 Bacteria 847
436 Ga0501034_0891910 3300049571 Bacteria 778
437 Ga0501038_0140995 3300049574 Bacteria 1972
438 Ga0501039_0311911 3300049575 Bacteria 1237
439 Ga0501047_0034832 3300049581 Bacteria 4861
440 Ga0501067_0032780 3300049583 Bacteria 2883
441 Ga0501069_0020859 3300049585 Bacteria 3553
442 Ga0501074_1239625 3300049590 Bacteria 523
443 Ga0501076_1297946 3300049592 Bacteria 599
444 Ga0501238_001956 3300049671 Bacteria 2414
445 Ga0501252_002633 3300049682 Bacteria 1798
446 Ga0501253_108796 3300049683 Bacteria 658
447 Ga0501269_021109 3300049766 Bacteria 813
448 Ga0501044_0043293 3300049823 Bacteria 4678
449 nmdc:mga03n38_25931_c1 3300050490 Bacteria 2414
450 nmdc:mga00v17_424793_c1 3300050491 Bacteria 863
451 nmdc:mga0k408_161240_c1 3300050493 Bacteria 1336
452 nmdc:mga06z11_240788_c1 3300050494 Bacteria 1062
453 nmdc:mga06z11_591543_c1 3300050494 Bacteria 675
454 nmdc:mga06z11_994925_c1 3300050494 Bacteria 511
455 nmdc:mga07m45_211772_c1 3300050496 Bacteria 1127
456 nmdc:mga07m45_32404_c1 3300050496 Bacteria 2474
457 nmdc:mga05p37_496504_c1 3300050507 Bacteria 1402
458 nmdc:mga09592_241464_c1 3300050508 Bacteria 1565
459 nmdc:mga0qj67_965871_c1 3300050509 Bacteria 669
460 nmdc:mga06r32_331505_c1 3300050510 Bacteria 1507
461 nmdc:mga08y16_1887773_c1 3300050511 Bacteria 548
462 nmdc:mga0n895_125177_c1 3300050512 Bacteria 2594
463 nmdc:mga0n895_2057225_c1 3300050512 Bacteria 528
464 nmdc:mga0a205_92846_c1 3300050515 Bacteria 2916
465 Ga0495601_0044625 3300053077 Bacteria 2786
466 Ga0495612_0011383 3300053078 Bacteria 3587
467 Ga0500610_0338120 3300053079 Bacteria 644
468 Ga0495655_0003591 3300053083 Bacteria 2572
469 Ga0495595_0023049 3300053084 Bacteria 2738
470 Ga0495619_0082025 3300053085 Bacteria 2172
471 Ga0500646_0154072 3300053090 Bacteria 763
472 Ga0500641_0004116 3300053096 Bacteria 5134
473 Ga0500556_0000130 3300053104 Bacteria 63676
474 Ga0500577_0000790 3300053142 Bacteria 8156
475 Ga0500603_176099 3300053150 Bacteria 672
476 Ga0500616_0011185 3300053153 Bacteria 5323
477 Ga0500616_0015905 3300053153 Bacteria 4293
478 Ga0500616_0365363 3300053153 Bacteria 584
479 Ga0500622_0288863 3300053156 Bacteria 704
480 Ga0500636_0043890 3300053177 Bacteria 2638
481 Ga0500636_0156123 3300053177 Bacteria 1249
482 Ga0500645_090877 3300053730 Bacteria 866
483 Ga0500601_013850 3300053737 Bacteria 914
484 Ga0587070_220047 3300059491 Bacteria 514
485 Ga0587079_212267 3300059647 Bacteria 534
486 Ga0466962_0288761 3300061719 Bacteria 810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10809755 Ga0163161_108097552 107
2 3300025981 Ga0207640_11500683 Ga0207640_115006832 109
3 3300039447 Ga0436361_0060433 Ga0436361_0060433_7592_7921 109
4 3300005339 Ga0070660_101428936 Ga0070660_1014289361 110
5 3300005458 Ga0070681_11474173 Ga0070681_114741731 110
6 3300006178 Ga0075367_10581006 Ga0075367_105810062 110
7 3300007265 Ga0099794_10484394 Ga0099794_104843941 110
8 3300025912 Ga0207707_11243518 Ga0207707_112435182 110
9 3300031239 Ga0265328_10265981 Ga0265328_102659811 110
10 3300031251 Ga0265327_10008003 Ga0265327_100080035 110
11 3300031344 Ga0265316_10163786 Ga0265316_101637861 110
12 3300031824 Ga0307413_10883749 Ga0307413_108837492 110
13 3300047320 Ga0495672_0080207 Ga0495672_0080207_456_791 110
14 3300053153 Ga0500616_0011185 Ga0500616_0011185_450_800 110
15 3300053153 Ga0500616_0015905 Ga0500616_0015905_2385_2717 110
16 3300053153 Ga0500616_0365363 Ga0500616_0365363_53_388 110
17 3300053156 Ga0500622_0288863 Ga0500622_0288863_149_484 110
18 3300004798 Ga0058859_11814239 Ga0058859_118142393 111
19 3300004801 Ga0058860_11752966 Ga0058860_117529661 111
20 3300005345 Ga0070692_10511778 Ga0070692_105117782 111
21 3300005353 Ga0070669_100601918 Ga0070669_1006019181 111
22 3300005434 Ga0070709_11624099 Ga0070709_116240991 111
23 3300005435 Ga0070714_100467216 Ga0070714_1004672161 111
24 3300005435 Ga0070714_100832161 Ga0070714_1008321611 111
25 3300005436 Ga0070713_100828651 Ga0070713_1008286512 111
26 3300005437 Ga0070710_10447431 Ga0070710_104474312 111
27 3300005437 Ga0070710_10551771 Ga0070710_105517711 111
28 3300005441 Ga0070700_100458484 Ga0070700_1004584842 111
29 3300005445 Ga0070708_100357990 Ga0070708_1003579902 111
30 3300005544 Ga0070686_100924770 Ga0070686_1009247702 111
31 3300005549 Ga0070704_100943867 Ga0070704_1009438672 111
32 3300005563 Ga0068855_101773669 Ga0068855_1017736691 111
33 3300005614 Ga0068856_100752466 Ga0068856_1007524663 111
34 3300006028 Ga0070717_10877522 Ga0070717_108775221 111
35 3300006173 Ga0070716_100624507 Ga0070716_1006245072 111
36 3300006178 Ga0075367_10224107 Ga0075367_102241072 111
37 3300006852 Ga0075433_10632320 Ga0075433_106323202 111
38 3300007788 Ga0099795_10160129 Ga0099795_101601291 111
39 3300009094 Ga0111539_10697485 Ga0111539_106974851 111
40 3300009098 Ga0105245_11145680 Ga0105245_111456802 111
41 3300009101 Ga0105247_10496130 Ga0105247_104961302 111
42 3300009147 Ga0114129_12567341 Ga0114129_125673412 111
43 3300009176 Ga0105242_10677219 Ga0105242_106772192 111
44 3300010159 Ga0099796_10067925 Ga0099796_100679252 111
45 3300010375 Ga0105239_10090215 Ga0105239_100902153 111
46 3300011119 Ga0105246_10357233 Ga0105246_103572332 111
47 3300013296 Ga0157374_11577427 Ga0157374_115774272 111
48 3300013297 Ga0157378_11966149 Ga0157378_119661491 111
49 3300013306 Ga0163162_10131787 Ga0163162_101317871 111
50 3300013306 Ga0163162_12320954 Ga0163162_123209541 111
51 3300013307 Ga0157372_12900741 Ga0157372_129007411 111
52 3300013308 Ga0157375_12704040 Ga0157375_127040401 111
53 3300014326 Ga0157380_10011551 Ga0157380_100115513 111
54 3300014326 Ga0157380_10806260 Ga0157380_108062602 111
55 3300014497 Ga0182008_10015180 Ga0182008_100151805 111
56 3300014497 Ga0182008_10514703 Ga0182008_105147032 111
57 3300015265 Ga0182005_1026567 Ga0182005_10265671 111
58 3300017792 Ga0163161_10738268 Ga0163161_107382681 111
59 3300025898 Ga0207692_10223249 Ga0207692_102232492 111
60 3300025898 Ga0207692_10960714 Ga0207692_109607141 111
61 3300025906 Ga0207699_10405483 Ga0207699_104054832 111
62 3300025915 Ga0207693_10645318 Ga0207693_106453182 111
63 3300025929 Ga0207664_11528145 Ga0207664_115281451 111
64 3300025935 Ga0207709_10297911 Ga0207709_102979112 111
65 3300025937 Ga0207669_11536446 Ga0207669_115364461 111
66 3300025939 Ga0207665_10946835 Ga0207665_109468352 111
67 3300025961 Ga0207712_10108407 Ga0207712_101084072 111
68 3300025961 Ga0207712_11347630 Ga0207712_113476302 111
69 3300026023 Ga0207677_10129867 Ga0207677_101298672 111
70 3300026078 Ga0207702_10193667 Ga0207702_101936672 111
71 3300026142 Ga0207698_11133650 Ga0207698_111336501 111
72 3300031901 Ga0307406_10299527 Ga0307406_102995272 111
73 3300031903 Ga0307407_10636701 Ga0307407_106367011 111
74 3300031911 Ga0307412_10858579 Ga0307412_108585792 111
75 3300031995 Ga0307409_100294384 Ga0307409_1002943842 111
76 3300031995 Ga0307409_100895825 Ga0307409_1008958252 111
77 3300032002 Ga0307416_100049781 Ga0307416_1000497812 111
78 3300032002 Ga0307416_100123710 Ga0307416_1001237103 111
79 3300032002 Ga0307416_101685928 Ga0307416_1016859282 111
80 3300032002 Ga0307416_101749538 Ga0307416_1017495382 111
81 3300032004 Ga0307414_10755670 Ga0307414_107556702 111
82 3300032004 Ga0307414_11473261 Ga0307414_114732612 111
83 3300032126 Ga0307415_100138775 Ga0307415_1001387753 111
84 3300032126 Ga0307415_101148261 Ga0307415_1011482612 111
85 3300035111 Ga0373923_0235622 Ga0373923_0235622_453_806 111
86 3300035118 Ga0373954_0227944 Ga0373954_0227944_494_847 111
87 3300035170 Ga0373943_0094638 Ga0373943_0094638_289_642 111
88 3300035172 Ga0373955_0030305 Ga0373955_0030305_929_1282 111
89 3300035692 Ga0373935_0192602 Ga0373935_0192602_826_1179 111
90 3300035695 Ga0373927_0042274 Ga0373927_0042274_1882_2223 111
91 3300035695 Ga0373927_0370321 Ga0373927_0370321_183_518 111
92 3300035695 Ga0373927_1059579 Ga0373927_1059579_88_441 111
93 3300037068 Ga0373925_0308472 Ga0373925_0308472_221_562 111
94 3300042136 Ga0450900_083457 Ga0450900_083457_124_459 111
95 3300044658 Ga0466972_0136223 Ga0466972_0136223_729_1064 111
96 3300045976 Ga0466967_0673331 Ga0466967_0673331_58_399 111
97 3300046459 Ga0495629_0109490 Ga0495629_0109490_1356_1709 111
98 3300046460 Ga0495638_0011225 Ga0495638_0011225_690_1025 111
99 3300046461 Ga0495641_0492546 Ga0495641_0492546_66_419 111
100 3300046463 Ga0495653_0109117 Ga0495653_0109117_1467_1820 111
101 3300046472 Ga0495580_0660792 Ga0495580_0660792_174_527 111
102 3300046476 Ga0495662_0229531 Ga0495662_0229531_531_884 111
103 3300046477 Ga0495664_0260211 Ga0495664_0260211_679_1032 111
104 3300046514 Ga0495618_0017817 Ga0495618_0017817_1810_2163 111
105 3300046516 Ga0495628_0083936 Ga0495628_0083936_646_999 111
106 3300046517 Ga0495630_0036826 Ga0495630_0036826_1868_2221 111
107 3300046529 Ga0495652_0030532 Ga0495652_0030532_1115_1468 111
108 3300046533 Ga0495640_0048473 Ga0495640_0048473_339_692 111
109 3300046536 Ga0495587_0012614 Ga0495587_0012614_1351_1704 111
110 3300046559 Ga0495667_0165643 Ga0495667_0165643_573_926 111
111 3300046642 Ga0495634_0010343 Ga0495634_0010343_4394_4747 111
112 3300046663 Ga0495635_0088404 Ga0495635_0088404_1386_1739 111
113 3300046678 Ga0495599_0019202 Ga0495599_0019202_2825_3178 111
114 3300046679 Ga0495623_0137482 Ga0495623_0137482_777_1130 111
115 3300046680 Ga0495646_0165314 Ga0495646_0165314_479_832 111
116 3300046683 Ga0495658_0014776 Ga0495658_0014776_2000_2353 111
117 3300046689 Ga0495613_0080074 Ga0495613_0080074_665_1018 111
118 3300046690 Ga0495624_0598065 Ga0495624_0598065_174_527 111
119 3300046690 Ga0495624_0754533 Ga0495624_0754533_49_384 111
120 3300047317 Ga0495604_0078148 Ga0495604_0078148_326_679 111
121 3300047319 Ga0495674_0117406 Ga0495674_0117406_368_721 111
122 3300047320 Ga0495672_0295024 Ga0495672_0295024_113_448 111
123 3300047322 Ga0495680_0066552 Ga0495680_0066552_2139_2492 111
124 3300047444 Ga0495675_0059618 Ga0495675_0059618_560_913 111
125 3300047471 Ga0495684_0446021 Ga0495684_0446021_238_591 111
126 3300047673 Ga0495593_0358398 Ga0495593_0358398_117_470 111
127 3300048088 Ga0495602_0039597 Ga0495602_0039597_989_1342 111
128 3300048091 Ga0495626_0187386 Ga0495626_0187386_132_467 111
129 3300048905 Ga0496102_0562109 Ga0496102_0562109_319_660 111
130 3300048905 Ga0496102_0661458 Ga0496102_0661458_463_798 111
131 3300048908 Ga0496105_0854648 Ga0496105_0854648_102_443 111
132 3300048911 Ga0496108_0082076 Ga0496108_0082076_1161_1502 111
133 3300048912 Ga0496109_0040022 Ga0496109_0040022_1519_1860 111
134 3300048914 Ga0496111_0313031 Ga0496111_0313031_480_821 111
135 3300048915 Ga0496112_0152437 Ga0496112_0152437_71_412 111
136 3300048917 Ga0496114_1096525 Ga0496114_1096525_263_604 111
137 3300048918 Ga0496115_0348103 Ga0496115_0348103_407_748 111
138 3300048929 Ga0496126_0497411 Ga0496126_0497411_348_683 111
139 3300049683 Ga0501253_108796 Ga0501253_108796_242_577 111
140 3300050494 nmdc:mga06z11_240788_c1 nmdc:mga06z11_240788_c1_311_646 111
141 3300050494 nmdc:mga06z11_994925_c1 nmdc:mga06z11_994925_c1_30_365 111
142 3300050512 nmdc:mga0n895_2057225_c1 nmdc:mga0n895_2057225_c1_97_432 111
143 3300053077 Ga0495601_0044625 Ga0495601_0044625_315_668 111
144 3300053078 Ga0495612_0011383 Ga0495612_0011383_2935_3288 111
145 3300053079 Ga0500610_0338120 Ga0500610_0338120_61_396 111
146 3300053084 Ga0495595_0023049 Ga0495595_0023049_2091_2444 111
147 3300053085 Ga0495619_0082025 Ga0495619_0082025_1539_1892 111
148 3300053090 Ga0500646_0154072 Ga0500646_0154072_97_432 111
149 3300053096 Ga0500641_0004116 Ga0500641_0004116_2947_3282 111
150 3300059491 Ga0587070_220047 Ga0587070_220047_84_425 111
151 3300059647 Ga0587079_212267 Ga0587079_212267_71_412 111
152 3300003203 JGI25406J46586_10009805 JGI25406J46586_100098051 112
153 3300005406 Ga0070703_10068032 Ga0070703_100680321 112
154 3300005435 Ga0070714_100879229 Ga0070714_1008792292 112
155 3300005436 Ga0070713_100035183 Ga0070713_1000351832 112
156 3300005437 Ga0070710_10064775 Ga0070710_100647752 112
157 3300005439 Ga0070711_100909270 Ga0070711_1009092701 112
158 3300005440 Ga0070705_100303930 Ga0070705_1003039302 112
159 3300005444 Ga0070694_100691422 Ga0070694_1006914222 112
160 3300005445 Ga0070708_100148425 Ga0070708_1001484252 112
161 3300005546 Ga0070696_100057901 Ga0070696_1000579012 112
162 3300005549 Ga0070704_100279893 Ga0070704_1002798932 112
163 3300005937 Ga0081455_10011421 Ga0081455_100114219 112
164 3300005985 Ga0081539_10001498 Ga0081539_100014986 112
165 3300006173 Ga0070716_100250440 Ga0070716_1002504402 112
166 3300006175 Ga0070712_100057347 Ga0070712_1000573472 112
167 3300006195 Ga0075366_10239926 Ga0075366_102399261 112
168 3300006844 Ga0075428_100111834 Ga0075428_1001118344 112
169 3300006852 Ga0075433_10326017 Ga0075433_103260172 112
170 3300006871 Ga0075434_100053677 Ga0075434_1000536776 112
171 3300006880 Ga0075429_100204204 Ga0075429_1002042042 112
172 3300007076 Ga0075435_100340810 Ga0075435_1003408102 112
173 3300007265 Ga0099794_10098265 Ga0099794_100982652 112
174 3300007788 Ga0099795_10264345 Ga0099795_102643452 112
175 3300009098 Ga0105245_11825516 Ga0105245_118255162 112
176 3300010375 Ga0105239_12794751 Ga0105239_127947511 112
177 3300025885 Ga0207653_10002361 Ga0207653_100023615 112
178 3300025905 Ga0207685_10499445 Ga0207685_104994451 112
179 3300025910 Ga0207684_10005128 Ga0207684_1000512812 112
180 3300025915 Ga0207693_10115338 Ga0207693_101153381 112
181 3300025915 Ga0207693_10267214 Ga0207693_102672142 112
182 3300025916 Ga0207663_10244090 Ga0207663_102440902 112
183 3300025922 Ga0207646_10009547 Ga0207646_100095479 112
184 3300025929 Ga0207664_10156933 Ga0207664_101569333 112
185 3300025933 Ga0207706_10758581 Ga0207706_107585811 112
186 3300025939 Ga0207665_10089693 Ga0207665_100896933 112
187 3300027512 Ga0209179_1033704 Ga0209179_10337042 112
188 3300027671 Ga0209588_1008591 Ga0209588_10085914 112
189 3300035116 Ga0373945_0060589 Ga0373945_0060589_878_1216 112
190 3300035170 Ga0373943_0052460 Ga0373943_0052460_1592_1930 112
191 3300035695 Ga0373927_0028596 Ga0373927_0028596_337_675 112
192 3300035725 Ga0373947_0059315 Ga0373947_0059315_1668_2006 112
193 3300037418 Ga0395900_0137113 Ga0395900_0137113_674_1012 112
194 3300037466 Ga0395898_0033916 Ga0395898_0033916_723_1061 112
195 3300038443 Ga0395901_0036715 Ga0395901_0036715_456_794 112
196 3300038996 Ga0242420_005082 Ga0242420_005082_220_558 112
197 3300039447 Ga0436361_1009582 Ga0436361_1009582_1551_1889 112
198 3300046455 Ga0495603_0064724 Ga0495603_0064724_318_656 112
199 3300046461 Ga0495641_0293061 Ga0495641_0293061_89_427 112
200 3300046472 Ga0495580_0622365 Ga0495580_0622365_15_353 112
201 3300046474 Ga0495605_0020857 Ga0495605_0020857_1884_2222 112
202 3300046491 Ga0495584_0004237 Ga0495584_0004237_310_648 112
203 3300046492 Ga0495585_0124172 Ga0495585_0124172_146_484 112
204 3300046499 Ga0495594_0267238 Ga0495594_0267238_440_778 112
205 3300046513 Ga0495616_0121192 Ga0495616_0121192_643_981 112
206 3300046515 Ga0495620_0066141 Ga0495620_0066141_280_618 112
207 3300046518 Ga0495631_0011013 Ga0495631_0011013_3372_3710 112
208 3300046520 Ga0495637_0034570 Ga0495637_0034570_485_823 112
209 3300046523 Ga0495644_0016846 Ga0495644_0016846_846_1184 112
210 3300046524 Ga0495648_0201144 Ga0495648_0201144_279_617 112
211 3300046525 Ga0495663_0001423 Ga0495663_0001423_6269_6607 112
212 3300046526 Ga0495666_0192277 Ga0495666_0192277_219_557 112
213 3300046537 Ga0495598_0000455 Ga0495598_0000455_7061_7399 112
214 3300046538 Ga0495609_0138533 Ga0495609_0138533_258_596 112
215 3300046539 Ga0495621_0143203 Ga0495621_0143203_233_571 112
216 3300046542 Ga0495597_0390608 Ga0495597_0390608_110_448 112
217 3300046558 Ga0495633_0075780 Ga0495633_0075780_214_552 112
218 3300046615 Ga0495656_0002385 Ga0495656_0002385_5571_5909 112
219 3300046616 Ga0495668_0007245 Ga0495668_0007245_5704_6042 112
220 3300046648 Ga0495611_0006444 Ga0495611_0006444_1927_2265 112
221 3300046665 Ga0495661_0020592 Ga0495661_0020592_213_551 112
222 3300046681 Ga0495647_0171298 Ga0495647_0171298_318_656 112
223 3300046683 Ga0495658_0156820 Ga0495658_0156820_1040_1378 112
224 3300046684 Ga0495669_0007762 Ga0495669_0007762_4153_4491 112
225 3300046691 Ga0495670_0164820 Ga0495670_0164820_525_863 112
226 3300046692 Ga0495671_0005180 Ga0495671_0005180_1662_2000 112
227 3300046810 Ga0495660_0074144 Ga0495660_0074144_1005_1343 112
228 3300047318 Ga0495636_0206868 Ga0495636_0206868_391_729 112
229 3300047321 Ga0495676_0211815 Ga0495676_0211815_197_535 112
230 3300047445 Ga0495677_0013807 Ga0495677_0013807_245_583 112
231 3300047446 Ga0495679_044877 Ga0495679_044877_713_1051 112
232 3300047469 Ga0495673_0186138 Ga0495673_0186138_383_721 112
233 3300048909 Ga0496106_0951871 Ga0496106_0951871_273_611 112
234 3300048913 Ga0496110_0169179 Ga0496110_0169179_1402_1740 112
235 3300048914 Ga0496111_0007449 Ga0496111_0007449_2303_2641 112
236 3300048916 Ga0496113_0999472 Ga0496113_0999472_276_614 112
237 3300048918 Ga0496115_1427948 Ga0496115_1427948_17_355 112
238 3300050508 nmdc:mga09592_241464_c1 nmdc:mga09592_241464_c1_785_1123 112
239 3300050509 nmdc:mga0qj67_965871_c1 nmdc:mga0qj67_965871_c1_171_509 112
240 3300050510 nmdc:mga06r32_331505_c1 nmdc:mga06r32_331505_c1_494_832 112
241 3300050511 nmdc:mga08y16_1887773_c1 nmdc:mga08y16_1887773_c1_132_470 112
242 3300050512 nmdc:mga0n895_125177_c1 nmdc:mga0n895_125177_c1_250_588 112
243 3300050515 nmdc:mga0a205_92846_c1 nmdc:mga0a205_92846_c1_235_573 112
244 3300053083 Ga0495655_0003591 Ga0495655_0003591_604_942 112
245 3300006048 Ga0075363_100435290 Ga0075363_1004352901 113
246 3300014968 Ga0157379_10780246 Ga0157379_107802461 113
247 3300027512 Ga0209179_1092266 Ga0209179_10922661 113
248 3300048913 Ga0496110_0872015 Ga0496110_0872015_366_716 113
249 3300026088 Ga0207641_11594772 Ga0207641_115947721 114
250 3300044765 Ga0466970_0786431 Ga0466970_0786431_26_370 114
251 3300005295 Ga0065707_11057986 Ga0065707_110579862 115
252 3300005456 Ga0070678_100275881 Ga0070678_1002758812 115
253 3300005544 Ga0070686_100120485 Ga0070686_1001204852 115
254 3300005548 Ga0070665_100694545 Ga0070665_1006945452 115
255 3300005840 Ga0068870_10768063 Ga0068870_107680632 115
256 3300005983 Ga0081540_1041606 Ga0081540_10416062 115
257 3300007265 Ga0099794_10011698 Ga0099794_100116984 115
258 3300009101 Ga0105247_10702916 Ga0105247_107029162 115
259 3300009553 Ga0105249_10216736 Ga0105249_102167362 115
260 3300010375 Ga0105239_10213195 Ga0105239_102131952 115
261 3300013297 Ga0157378_10588202 Ga0157378_105882022 115
262 3300013306 Ga0163162_10920077 Ga0163162_109200772 115
263 3300013308 Ga0157375_10904317 Ga0157375_109043172 115
264 3300025899 Ga0207642_10433401 Ga0207642_104334012 115
265 3300025901 Ga0207688_10357397 Ga0207688_103573972 115
266 3300025923 Ga0207681_10381309 Ga0207681_103813091 115
267 3300026023 Ga0207677_10197481 Ga0207677_101974812 115
268 3300046520 Ga0495637_0161978 Ga0495637_0161978_225_572 115
269 3300046664 Ga0495659_0190282 Ga0495659_0190282_64_411 115
270 3300046684 Ga0495669_0015487 Ga0495669_0015487_2667_3014 115
271 3300046692 Ga0495671_0460312 Ga0495671_0460312_13_360 115
272 3300048904 Ga0496101_0224719 Ga0496101_0224719_179_526 115
273 3300048910 Ga0496107_0213239 Ga0496107_0213239_418_765 115
274 3300049671 Ga0501238_001956 Ga0501238_001956_1983_2330 115
275 3300049682 Ga0501252_002633 Ga0501252_002633_437_784 115
276 3300049766 Ga0501269_021109 Ga0501269_021109_103_450 115
277 3300050490 nmdc:mga03n38_25931_c1 nmdc:mga03n38_25931_c1_1581_1928 115
278 3300050493 nmdc:mga0k408_161240_c1 nmdc:mga0k408_161240_c1_424_771 115
279 3300050494 nmdc:mga06z11_591543_c1 nmdc:mga06z11_591543_c1_310_657 115
280 3300050496 nmdc:mga07m45_32404_c1 nmdc:mga07m45_32404_c1_678_1025 115
281 3300050507 nmdc:mga05p37_496504_c1 nmdc:mga05p37_496504_c1_881_1228 115
282 iso_pu_bacteria 2844533157 2844539984 115
283 3300041456 Ga0451795_0701693 Ga0451795_0701693_93_467 116
284 iso_pu_bacteria 2821443989 2821446338 116
285 3300031901 Ga0307406_10516029 Ga0307406_105160292 117
286 3300047472 Ga0495686_0275259 Ga0495686_0275259_260_622 117
287 iso_pu_bacteria 2643221629 2644169738 117
288 iso_pu_bacteria 2643221662 2644350371 117
289 3300044684 Ga0466966_0165307 Ga0466966_0165307_523_924 118
290 3300061719 Ga0466962_0288761 Ga0466962_0288761_123_524 118
291 3300003354 JGI25160J50197_1016585 JGI25160J50197_10165852 119
292 3300005262 Ga0065165_1085466 Ga0065165_10854662 119
293 3300005331 Ga0070670_100806223 Ga0070670_1008062232 119
294 3300005347 Ga0070668_100547434 Ga0070668_1005474342 119
295 3300005548 Ga0070665_102195586 Ga0070665_1021955861 119
296 3300005843 Ga0068860_100417201 Ga0068860_1004172013 119
297 3300009093 Ga0105240_10014043 Ga0105240_1001404313 119
298 3300009545 Ga0105237_10008632 Ga0105237_100086328 119
299 3300009551 Ga0105238_10013209 Ga0105238_1001320911 119
300 3300010375 Ga0105239_10049420 Ga0105239_100494204 119
301 3300013105 Ga0157369_10016214 Ga0157369_1001621411 119
302 3300025284 Ga0209130_1000565 Ga0209130_100056521 119
303 3300025294 Ga0209025_1000099 Ga0209025_100009972 119
304 3300025297 Ga0209758_1002834 Ga0209758_10028344 119
305 3300025302 Ga0207426_1000065 Ga0207426_1000065197 119
306 3300025908 Ga0207643_10172979 Ga0207643_101729792 119
307 3300025945 Ga0207679_11451412 Ga0207679_114514121 119
308 3300025972 Ga0207668_10370367 Ga0207668_103703672 119
309 3300031548 Ga0307408_101777318 Ga0307408_1017773182 119
310 3300031901 Ga0307406_10397907 Ga0307406_103979072 119
311 3300031911 Ga0307412_10658231 Ga0307412_106582311 119
312 3300032002 Ga0307416_100577392 Ga0307416_1005773922 119
313 3300032126 Ga0307415_100291016 Ga0307415_1002910162 119
314 3300037418 Ga0395900_0099451 Ga0395900_0099451_783_1145 119
315 3300039447 Ga0436361_0135686 Ga0436361_0135686_746_1108 119
316 3300045976 Ga0466967_1573302 Ga0466967_1573302_230_598 119
317 iso_pu_bacteria 2888419890 2888424967 119
318 iso_pu_bacteria 2908775508 2908780574 119
319 3300048929 Ga0496126_0237138 Ga0496126_0237138_799_1173 120
320 3300053104 Ga0500556_0000130 Ga0500556_0000130_51669_52031 120
321 3300053730 Ga0500645_090877 Ga0500645_090877_92_454 120
322 3300005985 Ga0081539_10088597 Ga0081539_100885972 121
323 3300006353 Ga0075370_10407713 Ga0075370_104077131 121
324 3300006847 Ga0075431_102178207 Ga0075431_1021782072 121
325 3300009147 Ga0114129_13010029 Ga0114129_130100291 121
326 3300009148 Ga0105243_10672842 Ga0105243_106728422 121
327 3300015265 Ga0182005_1219863 Ga0182005_12198632 121
328 3300041413 Ga0439465_0043400 Ga0439465_0043400_642_1031 121
329 3300042004 Ga0439445_0133568 Ga0439445_0133568_108_497 121
330 3300042006 Ga0439432_105518 Ga0439432_105518_267_656 121
331 iso_pu_bacteria 2738543024 2739309755 121
332 iso_pu_bacteria 2958064165 2958069492 121
333 3300028794 Ga0307515_10473701 Ga0307515_104737012 122
334 3300053142 Ga0500577_0000790 Ga0500577_0000790_5559_5930 122
335 3300031548 Ga0307408_100101998 Ga0307408_1001019983 123
336 3300031901 Ga0307406_10876277 Ga0307406_108762772 123
337 3300039438 Ga0436360_1366726 Ga0436360_1366726_1799_2170 123
338 3300050496 nmdc:mga07m45_211772_c1 nmdc:mga07m45_211772_c1_46_417 123
339 3300009545 Ga0105237_10186749 Ga0105237_101867492 124
340 3300026035 Ga0207703_10176371 Ga0207703_101763711 124
341 3300047320 Ga0495672_0106137 Ga0495672_0106137_73_453 125
342 3300049569 Ga0501032_0430035 Ga0501032_0430035_71_451 125
343 3300049571 Ga0501034_0891910 Ga0501034_0891910_273_650 125
344 3300049574 Ga0501038_0140995 Ga0501038_0140995_398_778 125
345 3300049575 Ga0501039_0311911 Ga0501039_0311911_719_1099 125
346 3300049581 Ga0501047_0034832 Ga0501047_0034832_4023_4403 125
347 3300049823 Ga0501044_0043293 Ga0501044_0043293_4138_4518 125
348 3300005277 Ga0065716_1009675 Ga0065716_10096751 126
349 3300005327 Ga0070658_11367860 Ga0070658_113678601 126
350 3300005336 Ga0070680_100737727 Ga0070680_1007377271 126
351 3300005339 Ga0070660_100068185 Ga0070660_1000681851 126
352 3300005339 Ga0070660_101749844 Ga0070660_1017498441 126
353 3300005366 Ga0070659_100022917 Ga0070659_1000229177 126
354 3300005458 Ga0070681_10089558 Ga0070681_100895583 126
355 3300005530 Ga0070679_100100615 Ga0070679_1001006154 126
356 3300005539 Ga0068853_100175345 Ga0068853_1001753453 126
357 3300005563 Ga0068855_100163194 Ga0068855_1001631944 126
358 3300013104 Ga0157370_10589574 Ga0157370_105895742 126
359 3300013104 Ga0157370_11685192 Ga0157370_116851922 126
360 3300013307 Ga0157372_10480933 Ga0157372_104809332 126
361 3300025919 Ga0207657_10012946 Ga0207657_100129468 126
362 3300025921 Ga0207652_10103027 Ga0207652_101030272 126
363 3300025949 Ga0207667_10233898 Ga0207667_102338983 126
364 3300038443 Ga0395901_0377898 Ga0395901_0377898_395_778 126
365 iso_pu_bacteria 2617270741 2617375370 126
366 iso_pu_bacteria 2824600985 2824602313 126
367 iso_pu_bacteria 2824609381 2824610593 126
368 iso_pu_bacteria 2824732956 2824734559 126
369 iso_pu_bacteria 2824746037 2824749851 126
370 iso_pu_bacteria 8056673599 8056676984 126
371 iso_pu_bacteria 2513237094 2513638829 128
372 iso_pu_bacteria 2513237096 2513658246 128
373 iso_pu_bacteria 2513237101 2513694234 128
374 iso_pu_bacteria 2513237137 2513861711 128
375 iso_pu_bacteria 2513237145 2513920262 128
376 iso_pu_bacteria 2517572143 2517893688 128
377 iso_pu_bacteria 2524023228 2524535915 128
378 iso_pu_bacteria 2721755755 2723846600 128
379 iso_pu_bacteria 2904690495 2904697632 128
380 iso_pu_bacteria 2904699407 2904701416 128
381 iso_pu_bacteria 2906635258 2906638573 128
382 iso_pu_bacteria 2906660503 2906666074 128
383 iso_pu_bacteria 2908756301 2908757739 128
384 iso_pu_bacteria 2922361189 2922365802 128
385 iso_pu_bacteria 2922425934 2922428770 128
386 iso_pu_bacteria 2935630451 2935635562 128
387 iso_pu_bacteria 2941507105 2941509211 128
388 iso_pu_bacteria 2941515067 2941517040 128
389 iso_pu_bacteria 2941523033 2941524865 128
390 iso_pu_bacteria 3005474847 3005478896 128
391 iso_pu_bacteria 8006933436 8006942441 128
392 iso_pu_bacteria 8006973647 8006982168 128
393 iso_pu_bacteria 8019555841 8019558204 128
394 iso_pu_bacteria 8019565922 8019567090 128
395 3300003752 Ga0055539_1007298 Ga0055539_10072982 130
396 3300003911 JGI25405J52794_10065461 JGI25405J52794_100654611 130
397 3300005937 Ga0081455_10115734 Ga0081455_101157342 130
398 3300005983 Ga0081540_1037952 Ga0081540_10379522 130
399 3300021320 Ga0214544_1000002 Ga0214544_100000247 130
400 3300021321 Ga0214542_1000001 Ga0214542_1000001397 130
401 3300021324 Ga0214545_1000001 Ga0214545_1000001463 130
402 3300021327 Ga0214543_1000001 Ga0214543_1000001733 130
403 3300025253 Ga0209677_105071 Ga0209677_1050714 130
404 3300025272 Ga0209455_1027621 Ga0209455_10276212 130
405 3300044656 Ga0466969_0088693 Ga0466969_0088693_629_1027 130
406 3300044684 Ga0466966_0152513 Ga0466966_0152513_712_1110 130
407 3300044765 Ga0466970_0155115 Ga0466970_0155115_182_580 130
408 3300048919 Ga0496116_0203912 Ga0496116_0203912_132_527 130
409 3300048924 Ga0496121_0116822 Ga0496121_0116822_282_677 130
410 3300048929 Ga0496126_0249698 Ga0496126_0249698_323_721 130
411 3300048929 Ga0496126_0841165 Ga0496126_0841165_109_504 130
412 3300049590 Ga0501074_1239625 Ga0501074_1239625_19_414 130
413 3300049592 Ga0501076_1297946 Ga0501076_1297946_13_411 130
414 3300005983 Ga0081540_1006168 Ga0081540_10061689 131
415 3300049583 Ga0501067_0032780 Ga0501067_0032780_1215_1613 131
416 3300049585 Ga0501069_0020859 Ga0501069_0020859_959_1357 131
417 3300000549 LJQas_1006178 LJQas_10061782 132
418 3300002244 JGI24742J22300_10053170 JGI24742J22300_100531701 132
419 3300003763 Ga0055529_1032847 Ga0055529_10328471 132
420 3300004798 Ga0058859_11759064 Ga0058859_117590641 132
421 3300004803 Ga0058862_12336261 Ga0058862_123362612 132
422 3300004803 Ga0058862_12639219 Ga0058862_126392193 132
423 3300005330 Ga0070690_100387874 Ga0070690_1003878742 132
424 3300005333 Ga0070677_10412084 Ga0070677_104120842 132
425 3300005334 Ga0068869_100402146 Ga0068869_1004021461 132
426 3300005336 Ga0070680_100008151 Ga0070680_1000081516 132
427 3300005337 Ga0070682_100562001 Ga0070682_1005620012 132
428 3300005338 Ga0068868_100654957 Ga0068868_1006549572 132
429 3300005339 Ga0070660_100006027 Ga0070660_1000060279 132
430 3300005339 Ga0070660_100839132 Ga0070660_1008391322 132
431 3300005341 Ga0070691_10048366 Ga0070691_100483663 132
432 3300005347 Ga0070668_100029541 Ga0070668_1000295414 132
433 3300005347 Ga0070668_100439601 Ga0070668_1004396012 132
434 3300005356 Ga0070674_100005738 Ga0070674_1000057384 132
435 3300005367 Ga0070667_100072578 Ga0070667_1000725782 132
436 3300005438 Ga0070701_10561049 Ga0070701_105610492 132
437 3300005441 Ga0070700_100964741 Ga0070700_1009647412 132
438 3300005455 Ga0070663_100589389 Ga0070663_1005893892 132
439 3300005457 Ga0070662_100183148 Ga0070662_1001831483 132
440 3300005458 Ga0070681_10024150 Ga0070681_100241502 132
441 3300005459 Ga0068867_100178353 Ga0068867_1001783532 132
442 3300005530 Ga0070679_100020888 Ga0070679_1000208882 132
443 3300005535 Ga0070684_100030174 Ga0070684_1000301744 132
444 3300005539 Ga0068853_100021864 Ga0068853_1000218644 132
445 3300005539 Ga0068853_100746832 Ga0068853_1007468322 132
446 3300005543 Ga0070672_100025077 Ga0070672_1000250774 132
447 3300005545 Ga0070695_100494835 Ga0070695_1004948351 132
448 3300005547 Ga0070693_100327261 Ga0070693_1003272612 132
449 3300005563 Ga0068855_100082367 Ga0068855_1000823672 132
450 3300005577 Ga0068857_100205221 Ga0068857_1002052212 132
451 3300005615 Ga0070702_100411285 Ga0070702_1004112852 132
452 3300005616 Ga0068852_100315150 Ga0068852_1003151502 132
453 3300005616 Ga0068852_102544860 Ga0068852_1025448601 132
454 3300005718 Ga0068866_10098123 Ga0068866_100981233 132
455 3300005834 Ga0068851_10012797 Ga0068851_100127973 132
456 3300005844 Ga0068862_100508389 Ga0068862_1005083892 132
457 3300005981 Ga0081538_10037877 Ga0081538_100378772 132
458 3300006028 Ga0070717_11707076 Ga0070717_117070761 132
459 3300006881 Ga0068865_100021082 Ga0068865_1000210822 132
460 3300009094 Ga0111539_11161118 Ga0111539_111611182 132
461 3300009098 Ga0105245_10596056 Ga0105245_105960562 132
462 3300009101 Ga0105247_10047833 Ga0105247_100478334 132
463 3300009147 Ga0114129_10527554 Ga0114129_105275543 132
464 3300009551 Ga0105238_10792584 Ga0105238_107925842 132
465 3300009553 Ga0105249_10603646 Ga0105249_106036462 132
466 3300010375 Ga0105239_10684934 Ga0105239_106849342 132
467 3300013296 Ga0157374_11985841 Ga0157374_119858412 132
468 3300014326 Ga0157380_11376991 Ga0157380_113769911 132
469 3300025261 Ga0209233_1004223 Ga0209233_10042231 132
470 3300025272 Ga0209455_1002025 Ga0209455_10020252 132
471 3300025321 Ga0207656_10010305 Ga0207656_100103054 132
472 3300025906 Ga0207699_10797981 Ga0207699_107979811 132
473 3300025908 Ga0207643_10544632 Ga0207643_105446322 132
474 3300025912 Ga0207707_10007364 Ga0207707_100073646 132
475 3300025913 Ga0207695_10057445 Ga0207695_100574454 132
476 3300025914 Ga0207671_10147831 Ga0207671_101478312 132
477 3300025917 Ga0207660_10003393 Ga0207660_100033938 132
478 3300025919 Ga0207657_10005499 Ga0207657_100054994 132
479 3300025921 Ga0207652_10003525 Ga0207652_1000352510 132
480 3300025924 Ga0207694_10081625 Ga0207694_100816253 132
481 3300025924 Ga0207694_10622530 Ga0207694_106225301 132
482 3300025927 Ga0207687_10587768 Ga0207687_105877682 132
483 3300025933 Ga0207706_10100115 Ga0207706_101001152 132
484 3300025935 Ga0207709_10011619 Ga0207709_100116194 132
485 3300025937 Ga0207669_10594548 Ga0207669_105945482 132
486 3300025940 Ga0207691_10072869 Ga0207691_100728693 132
487 3300025949 Ga0207667_10011485 Ga0207667_100114853 132
488 3300025960 Ga0207651_10073900 Ga0207651_100739003 132
489 3300025961 Ga0207712_10419739 Ga0207712_104197392 132
490 3300025972 Ga0207668_10139776 Ga0207668_101397762 132
491 3300025972 Ga0207668_10615566 Ga0207668_106155662 132
492 3300026041 Ga0207639_10040700 Ga0207639_100407005 132
493 3300026041 Ga0207639_11116562 Ga0207639_111165622 132
494 3300026067 Ga0207678_10830281 Ga0207678_108302812 132
495 3300026089 Ga0207648_10188404 Ga0207648_101884042 132
496 3300026089 Ga0207648_10523933 Ga0207648_105239332 132
497 3300026116 Ga0207674_10075973 Ga0207674_100759734 132
498 3300026142 Ga0207698_10043253 Ga0207698_100432535 132
499 3300028380 Ga0268265_10672347 Ga0268265_106723472 132
500 3300028381 Ga0268264_10577484 Ga0268264_105774842 132
501 3300028786 Ga0307517_10296419 Ga0307517_102964192 132
502 3300031548 Ga0307408_100366579 Ga0307408_1003665792 132
503 3300031548 Ga0307408_100415066 Ga0307408_1004150662 132
504 3300032002 Ga0307416_101369547 Ga0307416_1013695471 132
505 3300032126 Ga0307415_100759200 Ga0307415_1007592001 132
506 3300033442 Ga0315911_1000009 Ga0315911_1000009270 132
507 3300041460 Ga0451802_1018590 Ga0451802_1018590_179_580 132
508 3300042157 Ga0439458_0045626 Ga0439458_0045626_522_929 132
509 3300044765 Ga0466970_0429498 Ga0466970_0429498_247_648 132
510 3300044842 Ga0466957_0487295 Ga0466957_0487295_178_579 132
511 3300048904 Ga0496101_0484918 Ga0496101_0484918_477_884 132
512 3300048905 Ga0496102_0457608 Ga0496102_0457608_468_875 132
513 3300048910 Ga0496107_0433229 Ga0496107_0433229_218_625 132
514 3300048917 Ga0496114_0707278 Ga0496114_0707278_210_611 132
515 3300048918 Ga0496115_0211115 Ga0496115_0211115_1008_1415 132
516 3300048921 Ga0496118_0092392 Ga0496118_0092392_1551_1952 132
517 3300048924 Ga0496121_0052002 Ga0496121_0052002_1921_2328 132
518 3300048925 Ga0496122_0364244 Ga0496122_0364244_311_712 132
519 3300048928 Ga0496125_0094138 Ga0496125_0094138_1601_2002 132
520 3300050491 nmdc:mga00v17_424793_c1 nmdc:mga00v17_424793_c1_122_523 132
521 3300053150 Ga0500603_176099 Ga0500603_176099_23_424 132
522 3300053177 Ga0500636_0043890 Ga0500636_0043890_1184_1585 132
523 3300053177 Ga0500636_0156123 Ga0500636_0156123_121_522 132
524 3300053737 Ga0500601_013850 Ga0500601_013850_217_618 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

43

114

0.91

Feature Viewer

pLDDT pTM Quality
71.44 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map