F458188

General Info

Members Datasets Scaffolds Average Seq Length
517 325 1034 170

Family's Representative Sequence

Representative Sequence 3300059652|Ga0587107_015185|Ga0587107_015185_407_937
Length 169
Sequence MGSESLQKKLDRVRKPRVHITYDVETEGAAVTKELPFVVGVLGDFSGQPTDRKFIQIDRDNFNDVMARMTPGLNMKVKNTLKDDGSELGVQLKFGHMDDFSPDKVAQQVEPVKKLLETRDKLRDLLTKVDRSEDLEGLLERVLQNTEELKKLSGELGTKDGGAAGEEAK

Samples

Sample ID Description Type Environment
1 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
204 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
325 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.68
Metatranscriptomes 7.93
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 1.55
Rhizosphere 81.24
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587107_015185 3300059652 Bacteria 1001
2 MRS1b_contig_1299021 2162886011 Bacteria 840
3 JGI25406J46586_10000305 3300003203 Bacteria 22022
4 JGI25406J46586_10034331 3300003203 Bacteria 1863
5 JGI25153J46596_10092116 3300003215 Bacteria 730
6 rootH1_10065167 3300003323 Bacteria 1872
7 JGI25160J50197_1000081 3300003354 Bacteria 99495
8 JGI25160J50197_1004980 3300003354 Bacteria 5635
9 JGI25161J50226_1000063 3300003374 Bacteria 99495
10 Ga0007417J51691_1018582 3300003544 Bacteria 1301
11 Ga0007410J51695_1016651 3300003574 Bacteria 714
12 Ga0007416J51690_1027107 3300003577 Bacteria 630
13 Ga0055543_1000088 3300004625 Bacteria 80513
14 Ga0058859_11770159 3300004798 Bacteria 1084
15 Ga0058863_11734984 3300004799 Bacteria 1341
16 Ga0058861_11656577 3300004800 Bacteria 1003
17 Ga0058861_11936851 3300004800 Bacteria 1314
18 Ga0058862_12378025 3300004803 Bacteria 910
19 Ga0058862_12572496 3300004803 Bacteria 1649
20 Ga0058862_12735166 3300004803 Bacteria 934
21 Ga0065165_1000426 3300005262 Bacteria 66367
22 Ga0065712_10098711 3300005290 Bacteria 2112
23 Ga0070658_10519257 3300005327 Bacteria 1030
24 Ga0070683_100166402 3300005329 Bacteria 2092
25 Ga0070683_100743793 3300005329 Bacteria 939
26 Ga0070670_100612475 3300005331 Bacteria 975
27 Ga0070689_100659061 3300005340 Bacteria 911
28 Ga0070661_100382114 3300005344 Unclassified 1110
29 Ga0070668_100410912 3300005347 Bacteria 1157
30 Ga0070669_100062757 3300005353 Bacteria 2733
31 Ga0070669_100432268 3300005353 Bacteria 1082
32 Ga0070675_100029669 3300005354 Bacteria 4412
33 Ga0070675_100463517 3300005354 Bacteria 1138
34 Ga0070675_101051664 3300005354 Bacteria 748
35 Ga0070671_100004670 3300005355 Bacteria 10867
36 Ga0070673_101019534 3300005364 Bacteria 771
37 Ga0070659_101706190 3300005366 Bacteria 563
38 Ga0070667_100000531 3300005367 Bacteria 38196
39 Ga0070667_100305534 3300005367 Bacteria 1433
40 Ga0070714_100039802 3300005435 Bacteria 3959
41 Ga0070714_100128385 3300005435 Unclassified 2263
42 Ga0070714_100433114 3300005435 Bacteria 1247
43 Ga0070714_101472876 3300005435 Bacteria 665
44 Ga0070713_100124103 3300005436 Bacteria 2269
45 Ga0070710_10111006 3300005437 Bacteria 1647
46 Ga0070711_100190214 3300005439 Bacteria 1577
47 Ga0070711_100667166 3300005439 Bacteria 873
48 Ga0070711_100888905 3300005439 Bacteria 760
49 Ga0070705_100168770 3300005440 Bacteria 1471
50 Ga0070708_100062387 3300005445 Bacteria 3333
51 Ga0070663_100219256 3300005455 Unclassified 1493
52 Ga0070663_100793413 3300005455 Bacteria 812
53 Ga0070663_101252927 3300005455 Bacteria 653
54 Ga0070678_100055433 3300005456 Bacteria 2894
55 Ga0070678_100442330 3300005456 Bacteria 1137
56 Ga0070681_10125356 3300005458 Bacteria 2501
57 Ga0070685_10113770 3300005466 Bacteria 1671
58 Ga0070706_100048257 3300005467 Bacteria 3930
59 Ga0070706_100209290 3300005467 Bacteria 1821
60 Ga0070707_100006370 3300005468 Bacteria 10975
61 Ga0070707_100244982 3300005468 Bacteria 1744
62 Ga0070698_100024358 3300005471 Bacteria 6316
63 Ga0070699_100017429 3300005518 Bacteria 6165
64 Ga0070699_100020618 3300005518 Bacteria 5688
65 Ga0070679_100136156 3300005530 Bacteria 2437
66 Ga0070679_100439142 3300005530 Bacteria 1250
67 Ga0070679_101197434 3300005530 Bacteria 705
68 Ga0070679_101208048 3300005530 Bacteria 701
69 Ga0070684_100223381 3300005535 Bacteria 1718
70 Ga0070697_100007582 3300005536 Bacteria 8448
71 Ga0070697_100112222 3300005536 Bacteria 2273
72 Ga0070695_100647554 3300005545 Bacteria 834
73 Ga0070665_100045440 3300005548 Bacteria 4411
74 Ga0070665_100049052 3300005548 Bacteria 4238
75 Ga0068855_100047894 3300005563 Bacteria 5048
76 Ga0068855_101500865 3300005563 Bacteria 692
77 Ga0068857_100450741 3300005577 Bacteria 1203
78 Ga0068857_101176848 3300005577 Bacteria 742
79 Ga0068856_100654686 3300005614 Bacteria 1071
80 Ga0068852_100288852 3300005616 Bacteria 1583
81 Ga0068852_101079052 3300005616 Bacteria 823
82 Ga0068859_100448425 3300005617 Bacteria 1386
83 Ga0068859_101540934 3300005617 Bacteria 734
84 Ga0068864_100777598 3300005618 Bacteria 940
85 Ga0068861_100814598 3300005719 Bacteria 877
86 Ga0068858_101324805 3300005842 Bacteria 709
87 Ga0068858_101398816 3300005842 Bacteria 689
88 Ga0068860_100024580 3300005843 Bacteria 5819
89 Ga0068860_100060174 3300005843 Bacteria 3610
90 Ga0068862_100239543 3300005844 Bacteria 1649
91 Ga0068862_101633384 3300005844 Bacteria 652
92 Ga0081455_10133020 3300005937 Bacteria 1942
93 Ga0081538_10044266 3300005981 Bacteria 2779
94 Ga0081540_1040957 3300005983 Bacteria 2407
95 Ga0081539_10000778 3300005985 Bacteria 62140
96 Ga0081539_10001101 3300005985 Bacteria 49064
97 Ga0081539_10004855 3300005985 Bacteria 14377
98 Ga0070717_10113787 3300006028 Bacteria 2310
99 Ga0070717_10145214 3300006028 Bacteria 2049
100 Ga0070717_10145889 3300006028 Bacteria 2044
101 Ga0075365_10087250 3300006038 Bacteria 2121
102 Ga0075365_10247464 3300006038 Bacteria 1252
103 Ga0075365_10358340 3300006038 Bacteria 1028
104 Ga0075365_10554043 3300006038 Bacteria 813
105 Ga0075368_10016791 3300006042 Bacteria 2731
106 Ga0075363_100003769 3300006048 Bacteria 6530
107 Ga0075363_100065421 3300006048 Bacteria 1966
108 Ga0075363_100155912 3300006048 Bacteria 1291
109 Ga0075363_100357474 3300006048 Bacteria 854
110 Ga0075432_10117847 3300006058 Bacteria 995
111 Ga0070712_100056596 3300006175 Bacteria 2751
112 Ga0070712_100078261 3300006175 Bacteria 2386
113 Ga0070712_100449115 3300006175 Bacteria 1073
114 Ga0070712_100499963 3300006175 Bacteria 1019
115 Ga0070712_101173203 3300006175 Unclassified 668
116 Ga0075362_10029669 3300006177 Bacteria 2358
117 Ga0075362_10099938 3300006177 Bacteria 1355
118 Ga0075362_10188343 3300006177 Bacteria 1001
119 Ga0075367_10004351 3300006178 Bacteria 6901
120 Ga0075367_10074414 3300006178 Bacteria 2048
121 Ga0075369_10003966 3300006186 Bacteria 5429
122 Ga0075366_10024430 3300006195 Bacteria 3526
123 Ga0075366_10045252 3300006195 Bacteria 2609
124 Ga0075366_10169397 3300006195 Bacteria 1325
125 Ga0097621_100793702 3300006237 Bacteria 877
126 Ga0075370_10026290 3300006353 Bacteria 3223
127 Ga0075370_10041900 3300006353 Bacteria 2585
128 Ga0068871_100399800 3300006358 Bacteria 1223
129 Ga0097620_100448454 3300006931 Bacteria 1386
130 Ga0097620_101541008 3300006931 Bacteria 734
131 Ga0099795_10028842 3300007788 Bacteria 1891
132 Ga0105240_10004391 3300009093 Bacteria 21528
133 Ga0105240_10306860 3300009093 Bacteria 1814
134 Ga0105245_10100476 3300009098 Bacteria 2675
135 Ga0105243_10140197 3300009148 Bacteria 2062
136 Ga0105243_10281862 3300009148 Bacteria 1497
137 Ga0105243_11079516 3300009148 Bacteria 810
138 Ga0105241_10093806 3300009174 Bacteria 2373
139 Ga0105248_10217678 3300009177 Bacteria 2151
140 Ga0105248_10700644 3300009177 Bacteria 1143
141 Ga0105248_10779933 3300009177 Bacteria 1079
142 Ga0105248_10971436 3300009177 Unclassified 959
143 Ga0105237_10478026 3300009545 Bacteria 1252
144 Ga0105238_10273106 3300009551 Bacteria 1671
145 Ga0105238_11085074 3300009551 Bacteria 823
146 Ga0105238_11577231 3300009551 Bacteria 686
147 Ga0105249_10225826 3300009553 Bacteria 1845
148 Ga0099796_10003304 3300010159 Bacteria 3719
149 Ga0099796_10071583 3300010159 Bacteria 1253
150 Ga0105239_10000073 3300010375 Bacteria 140771
151 Ga0105239_10358882 3300010375 Bacteria 1646
152 Ga0105239_10446910 3300010375 Bacteria 1466
153 Ga0105246_10552968 3300011119 Bacteria 987
154 Ga0157370_10069349 3300013104 Bacteria 3330
155 Ga0157370_10426444 3300013104 Bacteria 1220
156 Ga0157369_10049007 3300013105 Bacteria 4581
157 Ga0157378_10539060 3300013297 Bacteria 1171
158 Ga0163163_10361999 3300014325 Bacteria 1507
159 Ga0163163_11492481 3300014325 Bacteria 737
160 Ga0163163_11863233 3300014325 Bacteria 662
161 Ga0157380_10270879 3300014326 Bacteria 1548
162 Ga0182008_10069052 3300014497 Bacteria 1739
163 Ga0157376_10420583 3300014969 Bacteria 1297
164 Ga0197907_10319283 3300020069 Bacteria 823
165 Ga0206356_10342626 3300020070 Bacteria 843
166 Ga0206356_11365914 3300020070 Bacteria 694
167 Ga0206349_1321930 3300020075 Bacteria 680
168 Ga0206352_10827681 3300020078 Bacteria 938
169 Ga0154015_1440972 3300020610 Bacteria 751
170 Ga0213873_10029541 3300021358 Bacteria 1352
171 Ga0213872_10049370 3300021361 Bacteria 1911
172 Ga0213876_10001665 3300021384 Bacteria 13559
173 Ga0213876_10121628 3300021384 Bacteria 1386
174 Ga0213875_10003402 3300021388 Bacteria 9056
175 Ga0213875_10008267 3300021388 Bacteria 5337
176 Ga0213875_10055753 3300021388 Bacteria 1851
177 Ga0213875_10080419 3300021388 Bacteria 1520
178 Ga0213875_10153352 3300021388 Bacteria 1080
179 Ga0213875_10185561 3300021388 Bacteria 977
180 Ga0213871_10003769 3300021441 Bacteria 2964
181 Ga0213871_10011661 3300021441 Bacteria 2024
182 Ga0224712_10040788 3300022467 Bacteria 1749
183 Ga0224712_10048724 3300022467 Bacteria 1637
184 Ga0209233_1000010 3300025261 Bacteria 1194329
185 Ga0209130_1000160 3300025284 Bacteria 100965
186 Ga0209130_1000162 3300025284 Bacteria 99549
187 Ga0209025_1000299 3300025294 Bacteria 110988
188 Ga0209758_1041433 3300025297 Bacteria 1721
189 Ga0207426_1000098 3300025302 Bacteria 264264
190 Ga0207426_1000126 3300025302 Bacteria 213341
191 Ga0207692_10110391 3300025898 Bacteria 1524
192 Ga0207688_10054938 3300025901 Bacteria 2234
193 Ga0207685_10024863 3300025905 Bacteria 2060
194 Ga0207699_10031219 3300025906 Bacteria 2989
195 Ga0207643_10056379 3300025908 Bacteria 2235
196 Ga0207705_10184772 3300025909 Bacteria 1575
197 Ga0207684_10007944 3300025910 Bacteria 9481
198 Ga0207684_10092166 3300025910 Bacteria 2582
199 Ga0207707_10561139 3300025912 Bacteria 969
200 Ga0207695_10020374 3300025913 Bacteria 7598
201 Ga0207695_10417448 3300025913 Bacteria 1226
202 Ga0207671_10521722 3300025914 Bacteria 947
203 Ga0207693_10524538 3300025915 Bacteria 924
204 Ga0207693_10634194 3300025915 Bacteria 831
205 Ga0207693_10712724 3300025915 Bacteria 777
206 Ga0207663_10739610 3300025916 Bacteria 781
207 Ga0207663_10830701 3300025916 Bacteria 737
208 Ga0207657_10355237 3300025919 Bacteria 1156
209 Ga0207649_10397507 3300025920 Bacteria 1031
210 Ga0207649_10939353 3300025920 Bacteria 679
211 Ga0207652_10282869 3300025921 Bacteria 1496
212 Ga0207652_10585601 3300025921 Unclassified 1001
213 Ga0207681_10053001 3300025923 Bacteria 2753
214 Ga0207681_10501615 3300025923 Bacteria 994
215 Ga0207694_10674387 3300025924 Bacteria 871
216 Ga0207659_10616426 3300025926 Bacteria 926
217 Ga0207659_10899536 3300025926 Bacteria 761
218 Ga0207700_10018091 3300025928 Bacteria 4725
219 Ga0207700_10253096 3300025928 Bacteria 1505
220 Ga0207700_11268662 3300025928 Bacteria 657
221 Ga0207664_10083941 3300025929 Bacteria 2597
222 Ga0207664_10650012 3300025929 Bacteria 948
223 Ga0207664_10650057 3300025929 Bacteria 948
224 Ga0207644_10033526 3300025931 Bacteria 3589
225 Ga0207690_11089981 3300025932 Bacteria 666
226 Ga0207709_10504953 3300025935 Bacteria 944
227 Ga0207665_10150398 3300025939 Bacteria 1667
228 Ga0207711_10259393 3300025941 Bacteria 1597
229 Ga0207711_10408192 3300025941 Bacteria 1262
230 Ga0207689_10458899 3300025942 Bacteria 1065
231 Ga0207679_10325131 3300025945 Bacteria 1333
232 Ga0207667_10017274 3300025949 Bacteria 8127
233 Ga0207651_10151930 3300025960 Bacteria 1804
234 Ga0207651_10258147 3300025960 Bacteria 1429
235 Ga0207651_10425244 3300025960 Bacteria 1135
236 Ga0207668_11525658 3300025972 Bacteria 603
237 Ga0207668_11710893 3300025972 Bacteria 568
238 Ga0207658_10000993 3300025986 Bacteria 23279
239 Ga0207658_10253600 3300025986 Bacteria 1496
240 Ga0207677_10136707 3300026023 Bacteria 1870
241 Ga0207703_10035642 3300026035 Bacteria 3954
242 Ga0207703_10506923 3300026035 Bacteria 1133
243 Ga0207639_10965955 3300026041 Bacteria 797
244 Ga0207678_10042957 3300026067 Bacteria 3912
245 Ga0207678_11289105 3300026067 Bacteria 646
246 Ga0207678_11583518 3300026067 Bacteria 577
247 Ga0207641_10013954 3300026088 Bacteria 6588
248 Ga0207648_11014790 3300026089 Unclassified 777
249 Ga0207676_10652170 3300026095 Bacteria 1016
250 Ga0207674_10087201 3300026116 Bacteria 3115
251 Ga0207674_10193567 3300026116 Bacteria 1983
252 Ga0207675_100833203 3300026118 Bacteria 937
253 Ga0207683_10105008 3300026121 Bacteria 2525
254 Ga0207683_10988272 3300026121 Bacteria 781
255 Ga0207683_11112789 3300026121 Bacteria 733
256 Ga0207698_10105990 3300026142 Bacteria 2343
257 Ga0209179_1038668 3300027512 Bacteria 999
258 Ga0209974_10178382 3300027876 Bacteria 777
259 Ga0268266_10523202 3300028379 Bacteria 1134
260 Ga0268266_10810571 3300028379 Bacteria 904
261 Ga0268266_11037915 3300028379 Bacteria 793
262 Ga0268265_10220966 3300028380 Bacteria 1658
263 Ga0268265_10305743 3300028380 Bacteria 1434
264 Ga0268264_10026628 3300028381 Bacteria 4726
265 Ga0268264_10115302 3300028381 Bacteria 2360
266 Ga0265337_1001011 3300028556 Bacteria 14625
267 Ga0265337_1020409 3300028556 Bacteria 2076
268 Ga0265334_10000429 3300028573 Bacteria 22044
269 Ga0265334_10017547 3300028573 Bacteria 2955
270 Ga0265338_10044110 3300028800 Bacteria 4123
271 Ga0265338_10098320 3300028800 Bacteria 2395
272 Ga0265762_1028666 3300030760 Bacteria 1049
273 Ga0265777_100268 3300030877 Bacteria 2206
274 Ga0265325_10363046 3300031241 Bacteria 638
275 Ga0265331_10419607 3300031250 Bacteria 600
276 Ga0307408_100630342 3300031548 Bacteria 956
277 Ga0307508_10062659 3300031616 Bacteria 3282
278 Ga0316579_10000150 3300031691 Bacteria 19674
279 Ga0316579_10002127 3300031691 Bacteria 7425
280 Ga0316578_10113950 3300031728 Unclassified 1624
281 Ga0307516_10038052 3300031730 Bacteria 4804
282 Ga0307405_10158392 3300031731 Bacteria 1601
283 Ga0326468_10026794 3300031889 Bacteria 734
284 Ga0307409_101294825 3300031995 Bacteria 754
285 Ga0307416_100637705 3300032002 Bacteria 1149
286 Ga0307415_100108787 3300032126 Bacteria 2052
287 Ga0316583_10020861 3300032133 Bacteria 2348
288 Ga0316593_10017390 3300032168 Bacteria 2192
289 Ga0316593_10028742 3300032168 Bacteria 1794
290 Ga0316596_1032852 3300033541 Bacteria 1351
291 Ga0373944_0087785 3300035089 Bacteria 1036
292 Ga0373923_0083315 3300035111 Bacteria 1390
293 Ga0373936_0199119 3300035113 Bacteria 884
294 Ga0373953_0057474 3300035117 Bacteria 1584
295 Ga0373954_0408431 3300035118 Bacteria 671
296 Ga0373956_0080880 3300035119 Bacteria 1491
297 Ga0373956_0235875 3300035119 Bacteria 869
298 Ga0373943_0037195 3300035170 Bacteria 2336
299 Ga0373943_0523085 3300035170 Bacteria 695
300 Ga0373946_0160829 3300035171 Bacteria 1054
301 Ga0373946_0303853 3300035171 Bacteria 789
302 Ga0373955_0043785 3300035172 Bacteria 2409
303 Ga0373924_0009619 3300035410 Bacteria 3548
304 Ga0373935_0087236 3300035692 Bacteria 2037
305 Ga0373935_0119308 3300035692 Bacteria 1760
306 Ga0373935_0144527 3300035692 Bacteria 1609
307 Ga0373927_0034831 3300035695 Bacteria 3274
308 Ga0373927_0377115 3300035695 Bacteria 935
309 Ga0373933_0002437 3300035724 Bacteria 10488
310 Ga0373933_0037666 3300035724 Bacteria 2838
311 Ga0373947_0066013 3300035725 Bacteria 2208
312 Ga0373937_0040080 3300036401 Bacteria 4269
313 Ga0373937_0069881 3300036401 Bacteria 3238
314 Ga0373937_0250298 3300036401 Bacteria 1670
315 Ga0373937_0574806 3300036401 Bacteria 1070
316 Ga0373937_1231979 3300036401 Bacteria 697
317 Ga0316582_0002988 3300036647 Bacteria 8146
318 Ga0316582_0116746 3300036647 Bacteria 1782
319 Ga0316584_0006775 3300036712 Bacteria 7774
320 Ga0373925_0008091 3300037068 Bacteria 7657
321 Ga0373925_0019779 3300037068 Bacteria 4901
322 Ga0373925_0119128 3300037068 Bacteria 2048
323 Ga0373925_0469358 3300037068 Bacteria 1032
324 Ga0373925_0646583 3300037068 Bacteria 871
325 Ga0395900_1305619 3300037418 Bacteria 639
326 Ga0395898_0024319 3300037466 Bacteria 6109
327 Ga0395905_0045549 3300037471 Bacteria 4114
328 Ga0316581_0001955 3300037588 Unclassified 4824
329 Ga0436364_0197160 3300037853 Bacteria 1319
330 Ga0436364_0271401 3300037853 Bacteria 70772
331 Ga0436364_0635819 3300037853 Bacteria 4081
332 Ga0436364_1007676 3300037853 Bacteria 19097
333 Ga0436364_1035016 3300037853 Bacteria 904
334 Ga0436364_1190373 3300037853 Bacteria 2620
335 Ga0436364_1411404 3300037853 Bacteria 87403
336 Ga0395901_0563823 3300038443 Bacteria 1153
337 Ga0400483_092352 3300039062 Bacteria 246443
338 Ga0400483_222800 3300039062 Bacteria 244239
339 Ga0400487_56363 3300039110 Bacteria 3843
340 Ga0436365_0934609 3300039437 Bacteria 26465
341 Ga0436360_0483293 3300039438 Bacteria 14935
342 Ga0436360_0611086 3300039438 Bacteria 6580
343 Ga0436360_0931666 3300039438 Bacteria 3815
344 Ga0436360_1299118 3300039438 Bacteria 854
345 Ga0436360_1320324 3300039438 Bacteria 1040
346 Ga0436361_0083698 3300039447 Bacteria 33592
347 Ga0436361_0445859 3300039447 Bacteria 5455
348 Ga0436363_0293189 3300039450 Bacteria 1328
349 Ga0436363_0369712 3300039450 Bacteria 1125
350 Ga0436363_0403347 3300039450 Bacteria 691
351 Ga0436363_1199889 3300039450 Bacteria 1618
352 Ga0436363_1453318 3300039450 Bacteria 723
353 Ga0436363_1537161 3300039450 Bacteria 679
354 Ga0436363_1582087 3300039450 Bacteria 1297
355 Ga0436363_1654479 3300039450 Bacteria 680
356 Ga0436362_0422974 3300039453 Bacteria 4826
357 Ga0436362_0804175 3300039453 Bacteria 5401
358 Ga0439436_0071883 3300041404 Bacteria 964
359 Ga0451793_0962238 3300041452 Bacteria 1046
360 Ga0451806_755447 3300041462 Bacteria 1909
361 Ga0451807_2327368 3300041486 Bacteria 1600
362 Ga0451833_0954294 3300041491 Bacteria 1243
363 Ga0451849_0981587 3300041505 Bacteria 1553
364 Ga0451851_1326551 3300041507 Bacteria 1693
365 Ga0451843_0980748 3300041509 Bacteria 935
366 Ga0451853_0368896 3300041512 Bacteria 1261
367 Ga0450907_012621 3300042146 Bacteria 1407
368 Ga0451577_0785510 3300042876 Bacteria 860
369 Ga0466963_0353550 3300044694 Bacteria 1035
370 Ga0451576_0004592 3300045051 Bacteria 17824
371 Ga0451576_0540459 3300045051 Bacteria 1224
372 Ga0451576_0900126 3300045051 Bacteria 928
373 Ga0451576_1559658 3300045051 Bacteria 685
374 Ga0466967_1183624 3300045976 Bacteria 761
375 Ga0466967_1361667 3300045976 Bacteria 707
376 Ga0495627_000278 3300046453 Bacteria 51546
377 Ga0495592_0256383 3300046454 Bacteria 1154
378 Ga0495629_0473734 3300046459 Bacteria 846
379 Ga0495651_0172948 3300046462 Bacteria 1536
380 Ga0495653_0171741 3300046463 Bacteria 1496
381 Ga0495650_0002547 3300046471 Bacteria 14494
382 Ga0495664_0009877 3300046477 Bacteria 5351
383 Ga0495664_0388891 3300046477 Bacteria 838
384 Ga0495607_0001139 3300046501 Bacteria 24100
385 Ga0495606_0035323 3300046507 Bacteria 3418
386 Ga0495606_0264083 3300046507 Bacteria 949
387 Ga0495608_0044594 3300046511 Bacteria 2959
388 Ga0495610_0000022 3300046512 Bacteria 317107
389 Ga0495610_0000207 3300046512 Bacteria 65000
390 Ga0495610_0016169 3300046512 Bacteria 4309
391 Ga0495620_0008591 3300046515 Bacteria 5479
392 Ga0495628_0076160 3300046516 Bacteria 2611
393 Ga0495628_0120930 3300046516 Bacteria 2009
394 Ga0495632_0001043 3300046519 Bacteria 23893
395 Ga0495643_0000077 3300046522 Bacteria 163843
396 Ga0495643_0040694 3300046522 Bacteria 2537
397 Ga0495654_0076117 3300046530 Bacteria 1582
398 Ga0495587_0078911 3300046536 Bacteria 1909
399 Ga0495645_0162151 3300046543 Bacteria 1545
400 Ga0495645_0354709 3300046543 Bacteria 944
401 Ga0495667_0012239 3300046559 Bacteria 5814
402 Ga0495667_0262018 3300046559 Bacteria 1099
403 Ga0495625_0542725 3300046660 Bacteria 705
404 Ga0495635_0125829 3300046663 Bacteria 1748
405 Ga0495657_0137090 3300046675 Bacteria 1528
406 Ga0495657_0822873 3300046675 Bacteria 530
407 Ga0495599_0008141 3300046678 Bacteria 6367
408 Ga0495623_0484086 3300046679 Bacteria 655
409 Ga0495646_0011239 3300046680 Bacteria 5685
410 Ga0495647_0394396 3300046681 Bacteria 635
411 Ga0495613_0200071 3300046689 Bacteria 1409
412 Ga0495671_0326757 3300046692 Bacteria 736
413 Ga0495649_0193846 3300046694 Bacteria 1057
414 Ga0495600_0347518 3300046809 Bacteria 929
415 Ga0495600_0503399 3300046809 Bacteria 744
416 Ga0495581_0070345 3300047315 Bacteria 2024
417 Ga0495604_0399608 3300047317 Bacteria 905
418 Ga0495680_0087376 3300047322 Bacteria 2345
419 Ga0495680_0311846 3300047322 Bacteria 1102
420 Ga0495683_0298654 3300047323 Bacteria 692
421 Ga0495675_0032495 3300047444 Bacteria 3330
422 Ga0495681_0000010 3300047470 Bacteria 203548
423 Ga0495684_0181199 3300047471 Bacteria 1561
424 Ga0495684_0256503 3300047471 Bacteria 1270
425 Ga0495686_0000491 3300047472 Bacteria 58284
426 Ga0495593_0126168 3300047673 Bacteria 1301
427 Ga0495602_0002298 3300048088 Bacteria 19320
428 Ga0495602_0321192 3300048088 Bacteria 1126
429 Ga0496102_1156495 3300048905 Bacteria 693
430 Ga0496106_1398764 3300048909 Bacteria 541
431 Ga0496110_1023252 3300048913 Bacteria 734
432 Ga0496112_0900608 3300048915 Bacteria 807
433 Ga0496115_0502674 3300048918 Bacteria 974
434 Ga0496118_0225817 3300048921 Bacteria 1085
435 Ga0496119_0030470 3300048922 Bacteria 3636
436 Ga0496125_0043250 3300048928 Bacteria 3827
437 Ga0496126_0047991 3300048929 Bacteria 3907
438 Ga0501032_0095552 3300049569 Bacteria 1970
439 Ga0501032_0248216 3300049569 Bacteria 1156
440 Ga0501033_0003554 3300049570 Bacteria 12750
441 Ga0501033_0183118 3300049570 Bacteria 1501
442 Ga0501034_0260444 3300049571 Bacteria 1677
443 Ga0501034_0359330 3300049571 Bacteria 1384
444 Ga0501036_0228750 3300049572 Bacteria 1561
445 Ga0501037_0187351 3300049573 Bacteria 1466
446 Ga0501037_0792811 3300049573 Bacteria 626
447 Ga0501038_0145571 3300049574 Bacteria 1935
448 Ga0501043_0041279 3300049579 Bacteria 3625
449 Ga0501043_0197356 3300049579 Bacteria 1563
450 Ga0501043_0504943 3300049579 Bacteria 903
451 Ga0501043_0711254 3300049579 Bacteria 733
452 Ga0501046_0551145 3300049580 Bacteria 822
453 Ga0501047_0000475 3300049581 Bacteria 43718
454 Ga0501047_0625278 3300049581 Bacteria 897
455 Ga0501067_0079454 3300049583 Bacteria 1818
456 Ga0501069_0012569 3300049585 Bacteria 4502
457 Ga0501069_0404021 3300049585 Bacteria 808
458 Ga0501070_0000785 3300049586 Bacteria 28832
459 Ga0501070_0013197 3300049586 Bacteria 6964
460 Ga0501070_0080192 3300049586 Bacteria 2700
461 Ga0501070_0131730 3300049586 Bacteria 2065
462 Ga0501072_0244055 3300049588 Bacteria 1431
463 Ga0501073_0116073 3300049589 Bacteria 1855
464 Ga0501073_0304779 3300049589 Bacteria 1099
465 Ga0501079_0624577 3300049741 Bacteria 848
466 Ga0501080_0002692 3300049742 Bacteria 15565
467 Ga0501080_0280021 3300049742 Bacteria 1516
468 Ga0501083_0382844 3300049744 Bacteria 915
469 Ga0501035_0001012 3300049822 Bacteria 29624
470 Ga0501035_0002205 3300049822 Bacteria 19338
471 Ga0501035_0005478 3300049822 Bacteria 11996
472 Ga0501035_0006232 3300049822 Bacteria 11216
473 Ga0501035_0617485 3300049822 Bacteria 882
474 Ga0501044_0011941 3300049823 Bacteria 9413
475 Ga0501044_0080666 3300049823 Bacteria 3295
476 Ga0501044_0327063 3300049823 Bacteria 1456
477 Ga0501044_1085633 3300049823 Bacteria 670
478 nmdc:mga03n38_42270_c1 3300050490 Bacteria 1991
479 nmdc:mga0yw44_64364_c1 3300050492 Bacteria 2257
480 nmdc:mga0k408_353831_c1 3300050493 Bacteria 875
481 nmdc:mga0k408_9615_c1 3300050493 Bacteria 5216
482 nmdc:mga06z11_2145_c1 3300050494 Bacteria 7485
483 nmdc:mga04h51_222320_c1 3300050495 Bacteria 749
484 nmdc:mga07m45_243279_c1 3300050496 Bacteria 1047
485 nmdc:mga05p37_944764_c1 3300050507 Bacteria 923
486 nmdc:mga08y16_54177_c1 3300050511 Bacteria 4191
487 nmdc:mga0sz30_221341_c1 3300050516 Bacteria 841
488 Ga0495601_0001604 3300053077 Bacteria 12482
489 Ga0495612_0022861 3300053078 Bacteria 2506
490 Ga0495595_0247365 3300053084 Bacteria 892
491 Ga0495595_0307441 3300053084 Bacteria 798
492 Ga0500646_0184024 3300053090 Unclassified 709
493 Ga0500651_0106842 3300053093 Bacteria 1711
494 Ga0500658_0061888 3300053134 Bacteria 1558
495 Ga0500559_0468968 3300053136 Bacteria 581
496 Ga0500568_0014521 3300053139 Bacteria 3553
497 Ga0500588_0082172 3300053146 Unclassified 1080
498 Ga0501084_0309651 3300054114 Bacteria 1334
499 Ga0587073_0125751 3300059492 Bacteria 698
500 Ga0587077_034226 3300059493 Bacteria 986
501 Ga0587085_033511 3300059506 Bacteria 858
502 Ga0587085_072708 3300059506 Bacteria 676
503 Ga0587090_012713 3300059510 Bacteria 1205
504 Ga0587091_056933 3300059511 Bacteria 820
505 Ga0587092_016093 3300059512 Bacteria 1104
506 Ga0587094_065311 3300059513 Bacteria 645
507 Ga0587117_000818 3300059627 Bacteria 2356
508 Ga0587062_010938 3300059639 Bacteria 1136
509 Ga0587068_002186 3300059641 Bacteria 2340
510 Ga0587068_044769 3300059641 Bacteria 811
511 Ga0587076_046074 3300059645 Bacteria 833
512 Ga0587071_010611 3300060344 Bacteria 1540
513 Ga0587071_102374 3300060344 Bacteria 664
514 Ga0587111_0007474 3300060346 Bacteria 1777
515 Ga0587111_0124503 3300060346 Bacteria 667
516 2691330678 2690315857 Bacteria 4396207
517 2919535707 2919534386 Bacteria 4577686
518 Ga0587107_015185
519 MRS1b_contig_1299021
520 JGI25406J46586_10000305
521 JGI25406J46586_10034331
522 JGI25153J46596_10092116
523 rootH1_10065167
524 JGI25160J50197_1000081
525 JGI25160J50197_1004980
526 JGI25161J50226_1000063
527 Ga0007417J51691_1018582
528 Ga0007410J51695_1016651
529 Ga0007416J51690_1027107
530 Ga0055543_1000088
531 Ga0058859_11770159
532 Ga0058863_11734984
533 Ga0058861_11656577
534 Ga0058861_11936851
535 Ga0058862_12378025
536 Ga0058862_12572496
537 Ga0058862_12735166
538 Ga0065165_1000426
539 Ga0065712_10098711
540 Ga0070658_10519257
541 Ga0070683_100166402
542 Ga0070683_100743793
543 Ga0070670_100612475
544 Ga0070689_100659061
545 Ga0070661_100382114
546 Ga0070668_100410912
547 Ga0070669_100062757
548 Ga0070669_100432268
549 Ga0070675_100029669
550 Ga0070675_100463517
551 Ga0070675_101051664
552 Ga0070671_100004670
553 Ga0070673_101019534
554 Ga0070659_101706190
555 Ga0070667_100000531
556 Ga0070667_100305534
557 Ga0070714_100039802
558 Ga0070714_100128385
559 Ga0070714_100433114
560 Ga0070714_101472876
561 Ga0070713_100124103
562 Ga0070710_10111006
563 Ga0070711_100190214
564 Ga0070711_100667166
565 Ga0070711_100888905
566 Ga0070705_100168770
567 Ga0070708_100062387
568 Ga0070663_100219256
569 Ga0070663_100793413
570 Ga0070663_101252927
571 Ga0070678_100055433
572 Ga0070678_100442330
573 Ga0070681_10125356
574 Ga0070685_10113770
575 Ga0070706_100048257
576 Ga0070706_100209290
577 Ga0070707_100006370
578 Ga0070707_100244982
579 Ga0070698_100024358
580 Ga0070699_100017429
581 Ga0070699_100020618
582 Ga0070679_100136156
583 Ga0070679_100439142
584 Ga0070679_101197434
585 Ga0070679_101208048
586 Ga0070684_100223381
587 Ga0070697_100007582
588 Ga0070697_100112222
589 Ga0070695_100647554
590 Ga0070665_100045440
591 Ga0070665_100049052
592 Ga0068855_100047894
593 Ga0068855_101500865
594 Ga0068857_100450741
595 Ga0068857_101176848
596 Ga0068856_100654686
597 Ga0068852_100288852
598 Ga0068852_101079052
599 Ga0068859_100448425
600 Ga0068859_101540934
601 Ga0068864_100777598
602 Ga0068861_100814598
603 Ga0068858_101324805
604 Ga0068858_101398816
605 Ga0068860_100024580
606 Ga0068860_100060174
607 Ga0068862_100239543
608 Ga0068862_101633384
609 Ga0081455_10133020
610 Ga0081538_10044266
611 Ga0081540_1040957
612 Ga0081539_10000778
613 Ga0081539_10001101
614 Ga0081539_10004855
615 Ga0070717_10113787
616 Ga0070717_10145214
617 Ga0070717_10145889
618 Ga0075365_10087250
619 Ga0075365_10247464
620 Ga0075365_10358340
621 Ga0075365_10554043
622 Ga0075368_10016791
623 Ga0075363_100003769
624 Ga0075363_100065421
625 Ga0075363_100155912
626 Ga0075363_100357474
627 Ga0075432_10117847
628 Ga0070712_100056596
629 Ga0070712_100078261
630 Ga0070712_100449115
631 Ga0070712_100499963
632 Ga0070712_101173203
633 Ga0075362_10029669
634 Ga0075362_10099938
635 Ga0075362_10188343
636 Ga0075367_10004351
637 Ga0075367_10074414
638 Ga0075369_10003966
639 Ga0075366_10024430
640 Ga0075366_10045252
641 Ga0075366_10169397
642 Ga0097621_100793702
643 Ga0075370_10026290
644 Ga0075370_10041900
645 Ga0068871_100399800
646 Ga0097620_100448454
647 Ga0097620_101541008
648 Ga0099795_10028842
649 Ga0105240_10004391
650 Ga0105240_10306860
651 Ga0105245_10100476
652 Ga0105243_10140197
653 Ga0105243_10281862
654 Ga0105243_11079516
655 Ga0105241_10093806
656 Ga0105248_10217678
657 Ga0105248_10700644
658 Ga0105248_10779933
659 Ga0105248_10971436
660 Ga0105237_10478026
661 Ga0105238_10273106
662 Ga0105238_11085074
663 Ga0105238_11577231
664 Ga0105249_10225826
665 Ga0099796_10003304
666 Ga0099796_10071583
667 Ga0105239_10000073
668 Ga0105239_10358882
669 Ga0105239_10446910
670 Ga0105246_10552968
671 Ga0157370_10069349
672 Ga0157370_10426444
673 Ga0157369_10049007
674 Ga0157378_10539060
675 Ga0163163_10361999
676 Ga0163163_11492481
677 Ga0163163_11863233
678 Ga0157380_10270879
679 Ga0182008_10069052
680 Ga0157376_10420583
681 Ga0197907_10319283
682 Ga0206356_10342626
683 Ga0206356_11365914
684 Ga0206349_1321930
685 Ga0206352_10827681
686 Ga0154015_1440972
687 Ga0213873_10029541
688 Ga0213872_10049370
689 Ga0213876_10001665
690 Ga0213876_10121628
691 Ga0213875_10003402
692 Ga0213875_10008267
693 Ga0213875_10055753
694 Ga0213875_10080419
695 Ga0213875_10153352
696 Ga0213875_10185561
697 Ga0213871_10003769
698 Ga0213871_10011661
699 Ga0224712_10040788
700 Ga0224712_10048724
701 Ga0209233_1000010
702 Ga0209130_1000160
703 Ga0209130_1000162
704 Ga0209025_1000299
705 Ga0209758_1041433
706 Ga0207426_1000098
707 Ga0207426_1000126
708 Ga0207692_10110391
709 Ga0207688_10054938
710 Ga0207685_10024863
711 Ga0207699_10031219
712 Ga0207643_10056379
713 Ga0207705_10184772
714 Ga0207684_10007944
715 Ga0207684_10092166
716 Ga0207707_10561139
717 Ga0207695_10020374
718 Ga0207695_10417448
719 Ga0207671_10521722
720 Ga0207693_10524538
721 Ga0207693_10634194
722 Ga0207693_10712724
723 Ga0207663_10739610
724 Ga0207663_10830701
725 Ga0207657_10355237
726 Ga0207649_10397507
727 Ga0207649_10939353
728 Ga0207652_10282869
729 Ga0207652_10585601
730 Ga0207681_10053001
731 Ga0207681_10501615
732 Ga0207694_10674387
733 Ga0207659_10616426
734 Ga0207659_10899536
735 Ga0207700_10018091
736 Ga0207700_10253096
737 Ga0207700_11268662
738 Ga0207664_10083941
739 Ga0207664_10650012
740 Ga0207664_10650057
741 Ga0207644_10033526
742 Ga0207690_11089981
743 Ga0207709_10504953
744 Ga0207665_10150398
745 Ga0207711_10259393
746 Ga0207711_10408192
747 Ga0207689_10458899
748 Ga0207679_10325131
749 Ga0207667_10017274
750 Ga0207651_10151930
751 Ga0207651_10258147
752 Ga0207651_10425244
753 Ga0207668_11525658
754 Ga0207668_11710893
755 Ga0207658_10000993
756 Ga0207658_10253600
757 Ga0207677_10136707
758 Ga0207703_10035642
759 Ga0207703_10506923
760 Ga0207639_10965955
761 Ga0207678_10042957
762 Ga0207678_11289105
763 Ga0207678_11583518
764 Ga0207641_10013954
765 Ga0207648_11014790
766 Ga0207676_10652170
767 Ga0207674_10087201
768 Ga0207674_10193567
769 Ga0207675_100833203
770 Ga0207683_10105008
771 Ga0207683_10988272
772 Ga0207683_11112789
773 Ga0207698_10105990
774 Ga0209179_1038668
775 Ga0209974_10178382
776 Ga0268266_10523202
777 Ga0268266_10810571
778 Ga0268266_11037915
779 Ga0268265_10220966
780 Ga0268265_10305743
781 Ga0268264_10026628
782 Ga0268264_10115302
783 Ga0265337_1001011
784 Ga0265337_1020409
785 Ga0265334_10000429
786 Ga0265334_10017547
787 Ga0265338_10044110
788 Ga0265338_10098320
789 Ga0265762_1028666
790 Ga0265777_100268
791 Ga0265325_10363046
792 Ga0265331_10419607
793 Ga0307408_100630342
794 Ga0307508_10062659
795 Ga0316579_10000150
796 Ga0316579_10002127
797 Ga0316578_10113950
798 Ga0307516_10038052
799 Ga0307405_10158392
800 Ga0326468_10026794
801 Ga0307409_101294825
802 Ga0307416_100637705
803 Ga0307415_100108787
804 Ga0316583_10020861
805 Ga0316593_10017390
806 Ga0316593_10028742
807 Ga0316596_1032852
808 Ga0373944_0087785
809 Ga0373923_0083315
810 Ga0373936_0199119
811 Ga0373953_0057474
812 Ga0373954_0408431
813 Ga0373956_0080880
814 Ga0373956_0235875
815 Ga0373943_0037195
816 Ga0373943_0523085
817 Ga0373946_0160829
818 Ga0373946_0303853
819 Ga0373955_0043785
820 Ga0373924_0009619
821 Ga0373935_0087236
822 Ga0373935_0119308
823 Ga0373935_0144527
824 Ga0373927_0034831
825 Ga0373927_0377115
826 Ga0373933_0002437
827 Ga0373933_0037666
828 Ga0373947_0066013
829 Ga0373937_0040080
830 Ga0373937_0069881
831 Ga0373937_0250298
832 Ga0373937_0574806
833 Ga0373937_1231979
834 Ga0316582_0002988
835 Ga0316582_0116746
836 Ga0316584_0006775
837 Ga0373925_0008091
838 Ga0373925_0019779
839 Ga0373925_0119128
840 Ga0373925_0469358
841 Ga0373925_0646583
842 Ga0395900_1305619
843 Ga0395898_0024319
844 Ga0395905_0045549
845 Ga0316581_0001955
846 Ga0436364_0197160
847 Ga0436364_0271401
848 Ga0436364_0635819
849 Ga0436364_1007676
850 Ga0436364_1035016
851 Ga0436364_1190373
852 Ga0436364_1411404
853 Ga0395901_0563823
854 Ga0400483_092352
855 Ga0400483_222800
856 Ga0400487_56363
857 Ga0436365_0934609
858 Ga0436360_0483293
859 Ga0436360_0611086
860 Ga0436360_0931666
861 Ga0436360_1299118
862 Ga0436360_1320324
863 Ga0436361_0083698
864 Ga0436361_0445859
865 Ga0436363_0293189
866 Ga0436363_0369712
867 Ga0436363_0403347
868 Ga0436363_1199889
869 Ga0436363_1453318
870 Ga0436363_1537161
871 Ga0436363_1582087
872 Ga0436363_1654479
873 Ga0436362_0422974
874 Ga0436362_0804175
875 Ga0439436_0071883
876 Ga0451793_0962238
877 Ga0451806_755447
878 Ga0451807_2327368
879 Ga0451833_0954294
880 Ga0451849_0981587
881 Ga0451851_1326551
882 Ga0451843_0980748
883 Ga0451853_0368896
884 Ga0450907_012621
885 Ga0451577_0785510
886 Ga0466963_0353550
887 Ga0451576_0004592
888 Ga0451576_0540459
889 Ga0451576_0900126
890 Ga0451576_1559658
891 Ga0466967_1183624
892 Ga0466967_1361667
893 Ga0495627_000278
894 Ga0495592_0256383
895 Ga0495629_0473734
896 Ga0495651_0172948
897 Ga0495653_0171741
898 Ga0495650_0002547
899 Ga0495664_0009877
900 Ga0495664_0388891
901 Ga0495607_0001139
902 Ga0495606_0035323
903 Ga0495606_0264083
904 Ga0495608_0044594
905 Ga0495610_0000022
906 Ga0495610_0000207
907 Ga0495610_0016169
908 Ga0495620_0008591
909 Ga0495628_0076160
910 Ga0495628_0120930
911 Ga0495632_0001043
912 Ga0495643_0000077
913 Ga0495643_0040694
914 Ga0495654_0076117
915 Ga0495587_0078911
916 Ga0495645_0162151
917 Ga0495645_0354709
918 Ga0495667_0012239
919 Ga0495667_0262018
920 Ga0495625_0542725
921 Ga0495635_0125829
922 Ga0495657_0137090
923 Ga0495657_0822873
924 Ga0495599_0008141
925 Ga0495623_0484086
926 Ga0495646_0011239
927 Ga0495647_0394396
928 Ga0495613_0200071
929 Ga0495671_0326757
930 Ga0495649_0193846
931 Ga0495600_0347518
932 Ga0495600_0503399
933 Ga0495581_0070345
934 Ga0495604_0399608
935 Ga0495680_0087376
936 Ga0495680_0311846
937 Ga0495683_0298654
938 Ga0495675_0032495
939 Ga0495681_0000010
940 Ga0495684_0181199
941 Ga0495684_0256503
942 Ga0495686_0000491
943 Ga0495593_0126168
944 Ga0495602_0002298
945 Ga0495602_0321192
946 Ga0496102_1156495
947 Ga0496106_1398764
948 Ga0496110_1023252
949 Ga0496112_0900608
950 Ga0496115_0502674
951 Ga0496118_0225817
952 Ga0496119_0030470
953 Ga0496125_0043250
954 Ga0496126_0047991
955 Ga0501032_0095552
956 Ga0501032_0248216
957 Ga0501033_0003554
958 Ga0501033_0183118
959 Ga0501034_0260444
960 Ga0501034_0359330
961 Ga0501036_0228750
962 Ga0501037_0187351
963 Ga0501037_0792811
964 Ga0501038_0145571
965 Ga0501043_0041279
966 Ga0501043_0197356
967 Ga0501043_0504943
968 Ga0501043_0711254
969 Ga0501046_0551145
970 Ga0501047_0000475
971 Ga0501047_0625278
972 Ga0501067_0079454
973 Ga0501069_0012569
974 Ga0501069_0404021
975 Ga0501070_0000785
976 Ga0501070_0013197
977 Ga0501070_0080192
978 Ga0501070_0131730
979 Ga0501072_0244055
980 Ga0501073_0116073
981 Ga0501073_0304779
982 Ga0501079_0624577
983 Ga0501080_0002692
984 Ga0501080_0280021
985 Ga0501083_0382844
986 Ga0501035_0001012
987 Ga0501035_0002205
988 Ga0501035_0005478
989 Ga0501035_0006232
990 Ga0501035_0617485
991 Ga0501044_0011941
992 Ga0501044_0080666
993 Ga0501044_0327063
994 Ga0501044_1085633
995 nmdc:mga03n38_42270_c1
996 nmdc:mga0yw44_64364_c1
997 nmdc:mga0k408_353831_c1
998 nmdc:mga0k408_9615_c1
999 nmdc:mga06z11_2145_c1
1000 nmdc:mga04h51_222320_c1
1001 nmdc:mga07m45_243279_c1
1002 nmdc:mga05p37_944764_c1
1003 nmdc:mga08y16_54177_c1
1004 nmdc:mga0sz30_221341_c1
1005 Ga0495601_0001604
1006 Ga0495612_0022861
1007 Ga0495595_0247365
1008 Ga0495595_0307441
1009 Ga0500646_0184024
1010 Ga0500651_0106842
1011 Ga0500658_0061888
1012 Ga0500559_0468968
1013 Ga0500568_0014521
1014 Ga0500588_0082172
1015 Ga0501084_0309651
1016 Ga0587073_0125751
1017 Ga0587077_034226
1018 Ga0587085_033511
1019 Ga0587085_072708
1020 Ga0587090_012713
1021 Ga0587091_056933
1022 Ga0587092_016093
1023 Ga0587094_065311
1024 Ga0587117_000818
1025 Ga0587062_010938
1026 Ga0587068_002186
1027 Ga0587068_044769
1028 Ga0587076_046074
1029 Ga0587071_010611
1030 Ga0587071_102374
1031 Ga0587111_0007474
1032 Ga0587111_0124503
1033 2691330678
1034 2919535707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

10

157

0.98

Map