F456624

General Info

Members Datasets Scaffolds Average Seq Length
507 263 1014 97

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10479746|Ga0070658_104797462
Length 109
Sequence MNDILFNIGYGHFLALAAVLFLIGMAGVLIRRNALIILMSVELMLNAANMTLIAFSRMWGGMGALSAHTFALIVIGVAAAEASVGLAIVVAVFRGRRNVDVDRLTTLRH

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
216 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
221 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
247 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
248 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
250 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
251 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
252 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
256 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
257 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
258 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
263 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.2
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.54
Nodule 0
Rhizoplane 1.38
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10479746 3300005327 Bacteria 1073
2 JGI24744J21845_10100923 3300002077 Bacteria 533
3 JGI25406J46586_10088760 3300003203 Unclassified 936
4 JGI25407J50210_10134524 3300003373 Bacteria 609
5 Ga0065704_10197801 3300005289 Bacteria 1160
6 Ga0065704_10643597 3300005289 Unclassified 586
7 Ga0065715_10256341 3300005293 Bacteria 1151
8 Ga0065707_10085965 3300005295 Bacteria 5758
9 Ga0065707_10086358 3300005295 Bacteria 5512
10 Ga0065707_10098277 3300005295 Bacteria 3085
11 Ga0065707_10111372 3300005295 Bacteria 2383
12 Ga0065707_10585430 3300005295 Bacteria 699
13 Ga0070658_10525835 3300005327 Bacteria 1023
14 Ga0070683_100961114 3300005329 Bacteria 820
15 Ga0070690_100050292 3300005330 Bacteria 2658
16 Ga0070670_100262078 3300005331 Bacteria 1507
17 Ga0070670_101322897 3300005331 Bacteria 660
18 Ga0068869_100085724 3300005334 Bacteria 2359
19 Ga0068869_100156889 3300005334 Bacteria 1769
20 Ga0068869_100168470 3300005334 Bacteria 1710
21 Ga0068869_101348801 3300005334 Bacteria 630
22 Ga0068869_102042253 3300005334 Bacteria 515
23 Ga0070680_100612211 3300005336 Bacteria 935
24 Ga0070680_100699940 3300005336 Bacteria 872
25 Ga0070680_101255553 3300005336 Bacteria 641
26 Ga0070682_100218190 3300005337 Bacteria 1356
27 Ga0070682_102076553 3300005337 Bacteria 501
28 Ga0068868_101269753 3300005338 Bacteria 683
29 Ga0070689_100048256 3300005340 Bacteria 3284
30 Ga0070689_100079267 3300005340 Bacteria 2576
31 Ga0070689_100108934 3300005340 Bacteria 2201
32 Ga0070689_100317758 3300005340 Bacteria 1299
33 Ga0070689_100417461 3300005340 Bacteria 1137
34 Ga0070687_100081832 3300005343 Bacteria 1764
35 Ga0070687_100431447 3300005343 Bacteria 872
36 Ga0070692_10288646 3300005345 Bacteria 997
37 Ga0070669_100374404 3300005353 Bacteria 1160
38 Ga0070674_100097746 3300005356 Bacteria 2133
39 Ga0070688_100110815 3300005365 Bacteria 1825
40 Ga0070688_100182230 3300005365 Bacteria 1458
41 Ga0070688_100424784 3300005365 Bacteria 989
42 Ga0070667_100210994 3300005367 Bacteria 1726
43 Ga0070714_100818932 3300005435 Bacteria 902
44 Ga0070701_10184107 3300005438 Bacteria 1225
45 Ga0070711_100019805 3300005439 Bacteria 4324
46 Ga0070705_100081050 3300005440 Bacteria 1993
47 Ga0070700_100133300 3300005441 Bacteria 1679
48 Ga0070700_101316488 3300005441 Archaea 608
49 Ga0070700_101819536 3300005441 Unclassified 525
50 Ga0070700_101971708 3300005441 Bacteria 506
51 Ga0070694_100295685 3300005444 Bacteria 1239
52 Ga0070694_100313972 3300005444 Bacteria 1204
53 Ga0070694_100427952 3300005444 Bacteria 1041
54 Ga0070694_100874381 3300005444 Archaea 741
55 Ga0070694_101467599 3300005444 Bacteria 577
56 Ga0070681_11080881 3300005458 Bacteria 723
57 Ga0068867_101780091 3300005459 Bacteria 579
58 Ga0070685_10200784 3300005466 Bacteria 1296
59 Ga0070685_11012599 3300005466 Bacteria 624
60 Ga0070706_100653774 3300005467 Bacteria 976
61 Ga0070706_100752245 3300005467 Bacteria 903
62 Ga0070706_101519421 3300005467 Bacteria 612
63 Ga0070698_100001379 3300005471 Bacteria 26917
64 Ga0070698_100045793 3300005471 Bacteria 4476
65 Ga0070698_100339580 3300005471 Bacteria 1433
66 Ga0070698_100778217 3300005471 Bacteria 900
67 Ga0070698_101378561 3300005471 Bacteria 656
68 Ga0070699_100001759 3300005518 Bacteria 19742
69 Ga0070699_100057924 3300005518 Bacteria 3355
70 Ga0070699_100062834 3300005518 Bacteria 3219
71 Ga0070699_100356292 3300005518 Bacteria 1318
72 Ga0070699_101787332 3300005518 Bacteria 563
73 Ga0070679_100035300 3300005530 Bacteria 4960
74 Ga0070679_100544059 3300005530 Bacteria 1105
75 Ga0070684_100908027 3300005535 Bacteria 825
76 Ga0070684_101069395 3300005535 Bacteria 758
77 Ga0070697_101033183 3300005536 Bacteria 731
78 Ga0070672_100898579 3300005543 Bacteria 782
79 Ga0070695_100439006 3300005545 Bacteria 998
80 Ga0070693_100839997 3300005547 Bacteria 684
81 Ga0070693_101468931 3300005547 Bacteria 532
82 Ga0070665_100006794 3300005548 Bacteria 11631
83 Ga0070704_100044009 3300005549 Bacteria 3099
84 Ga0070704_100537821 3300005549 Bacteria 1019
85 Ga0068855_101497822 3300005563 Unclassified 693
86 Ga0068857_100156771 3300005577 Bacteria 2065
87 Ga0068857_100335440 3300005577 Bacteria 1398
88 Ga0068857_100820523 3300005577 Bacteria 889
89 Ga0068857_101572255 3300005577 Bacteria 642
90 Ga0068856_100040870 3300005614 Bacteria 4555
91 Ga0070702_100139773 3300005615 Bacteria 1541
92 Ga0070702_100694301 3300005615 Unclassified 775
93 Ga0068852_101365245 3300005616 Bacteria 731
94 Ga0068852_102694894 3300005616 Unclassified 516
95 Ga0068859_100079290 3300005617 Bacteria 3323
96 Ga0068859_100184140 3300005617 Bacteria 2172
97 Ga0068859_100201521 3300005617 Bacteria 2075
98 Ga0068864_100151936 3300005618 Bacteria 2098
99 Ga0068864_100246866 3300005618 Bacteria 1656
100 Ga0068864_100351646 3300005618 Bacteria 1390
101 Ga0068864_100535018 3300005618 Bacteria 1131
102 Ga0068864_102489700 3300005618 Bacteria 524
103 Ga0068866_10906801 3300005718 Unclassified 620
104 Ga0068861_100050863 3300005719 Bacteria 3144
105 Ga0068861_100179336 3300005719 Bacteria 1762
106 Ga0068861_101128842 3300005719 Bacteria 755
107 Ga0068863_100036393 3300005841 Bacteria 4688
108 Ga0068863_100740209 3300005841 Bacteria 979
109 Ga0068860_100286488 3300005843 Bacteria 1611
110 Ga0068862_100256224 3300005844 Bacteria 1596
111 Ga0068862_100278607 3300005844 Bacteria 1532
112 Ga0068862_100409856 3300005844 Unclassified 1269
113 Ga0068862_100498086 3300005844 Bacteria 1156
114 Ga0081455_10327992 3300005937 Bacteria 1087
115 Ga0081539_10008948 3300005985 Bacteria 8532
116 Ga0070717_10144430 3300006028 Bacteria 2054
117 Ga0075363_100720777 3300006048 Bacteria 603
118 Ga0070712_102060086 3300006175 Unclassified 500
119 Ga0075427_10000689 3300006194 Unclassified 4038
120 Ga0097621_100064711 3300006237 Bacteria 3008
121 Ga0097621_100220704 3300006237 Bacteria 1652
122 Ga0097621_100447718 3300006237 Bacteria 1163
123 Ga0075428_100162131 3300006844 Bacteria 2427
124 Ga0075428_100286870 3300006844 Bacteria 1771
125 Ga0075428_100749964 3300006844 Bacteria 1039
126 Ga0075428_100931040 3300006844 Bacteria 921
127 Ga0075430_100565017 3300006846 Bacteria 938
128 Ga0075430_101400014 3300006846 Unclassified 575
129 Ga0075431_100122209 3300006847 Bacteria 2686
130 Ga0075431_100671245 3300006847 Bacteria 1015
131 Ga0075431_101280893 3300006847 Bacteria 694
132 Ga0075431_101798335 3300006847 Unclassified 569
133 Ga0075433_10942083 3300006852 Unclassified 753
134 Ga0075429_100005538 3300006880 Bacteria 10879
135 Ga0075429_100123336 3300006880 Bacteria 2265
136 Ga0075429_100136740 3300006880 Bacteria 2145
137 Ga0075429_100218766 3300006880 Bacteria 1669
138 Ga0075429_100233795 3300006880 Bacteria 1610
139 Ga0075429_100331405 3300006880 Bacteria 1332
140 Ga0075429_101512999 3300006880 Bacteria 584
141 Ga0068865_100817541 3300006881 Bacteria 805
142 Ga0068865_101134157 3300006881 Bacteria 690
143 Ga0097620_100079290 3300006931 Bacteria 3323
144 Ga0097620_100184141 3300006931 Bacteria 2172
145 Ga0097620_100201520 3300006931 Bacteria 2075
146 Ga0075435_100455296 3300007076 Bacteria 1104
147 Ga0075435_101884440 3300007076 Bacteria 525
148 Ga0099795_10242702 3300007788 Bacteria 774
149 Ga0105240_11023716 3300009093 Unclassified 882
150 Ga0111539_10464943 3300009094 Bacteria 1473
151 Ga0111539_10493520 3300009094 Bacteria 1426
152 Ga0105245_10000123 3300009098 Bacteria 74737
153 Ga0105245_10060039 3300009098 Bacteria 3425
154 Ga0105245_10517539 3300009098 Bacteria 1211
155 Ga0105245_12867201 3300009098 Bacteria 534
156 Ga0105245_12976155 3300009098 Archaea 525
157 Ga0114129_10026462 3300009147 Bacteria 8213
158 Ga0114129_10177677 3300009147 Bacteria 2899
159 Ga0114129_10236063 3300009147 Unclassified 2460
160 Ga0114129_10433524 3300009147 Bacteria 1727
161 Ga0114129_10463742 3300009147 Bacteria 1660
162 Ga0105243_10048922 3300009148 Bacteria 3334
163 Ga0105243_12715440 3300009148 Unclassified 535
164 Ga0105242_10195776 3300009176 Bacteria 1792
165 Ga0105242_10398502 3300009176 Bacteria 1284
166 Ga0105242_11528731 3300009176 Bacteria 699
167 Ga0105237_11231903 3300009545 Bacteria 755
168 Ga0105238_10420955 3300009551 Bacteria 1330
169 Ga0105249_10004883 3300009553 Bacteria 11571
170 Ga0105249_10204385 3300009553 Bacteria 1934
171 Ga0105249_10343811 3300009553 Bacteria 1509
172 Ga0105249_10765249 3300009553 Bacteria 1028
173 Ga0105239_10030713 3300010375 Bacteria 5909
174 Ga0105246_11184294 3300011119 Bacteria 702
175 Ga0105246_12247066 3300011119 Archaea 532
176 Ga0157371_10110248 3300013102 Bacteria 1953
177 Ga0157374_10051905 3300013296 Bacteria 3817
178 Ga0157378_10259043 3300013297 Bacteria 1668
179 Ga0157378_11858286 3300013297 Bacteria 651
180 Ga0157380_11001206 3300014326 Bacteria 869
181 Ga0157380_11088389 3300014326 Bacteria 838
182 Ga0157379_11518961 3300014968 Bacteria 652
183 Ga0157376_10020482 3300014969 Bacteria 5116
184 Ga0157376_10115849 3300014969 Bacteria 2367
185 Ga0157376_12543126 3300014969 Bacteria 552
186 Ga0157376_12718111 3300014969 Unclassified 535
187 Ga0163161_10802464 3300017792 Unclassified 791
188 Ga0163161_10986739 3300017792 Bacteria 718
189 Ga0207642_10054805 3300025899 Bacteria 1820
190 Ga0207705_10160726 3300025909 Bacteria 1687
191 Ga0207705_10394504 3300025909 Bacteria 1070
192 Ga0207705_11340478 3300025909 Bacteria 545
193 Ga0207684_10394326 3300025910 Bacteria 1190
194 Ga0207684_11061237 3300025910 Bacteria 676
195 Ga0207684_11435293 3300025910 Bacteria 564
196 Ga0207707_10905939 3300025912 Bacteria 729
197 Ga0207707_11395297 3300025912 Bacteria 559
198 Ga0207695_10959113 3300025913 Unclassified 735
199 Ga0207671_11301776 3300025914 Bacteria 566
200 Ga0207660_10310420 3300025917 Bacteria 1257
201 Ga0207660_11295727 3300025917 Bacteria 592
202 Ga0207662_10142141 3300025918 Bacteria 1521
203 Ga0207662_10480912 3300025918 Bacteria 853
204 Ga0207652_10014808 3300025921 Bacteria 6323
205 Ga0207652_11575841 3300025921 Bacteria 561
206 Ga0207646_10194954 3300025922 Bacteria 1829
207 Ga0207646_10590140 3300025922 Unclassified 998
208 Ga0207646_10810048 3300025922 Bacteria 834
209 Ga0207646_10825611 3300025922 Bacteria 825
210 Ga0207681_10367208 3300025923 Bacteria 1156
211 Ga0207650_10188823 3300025925 Bacteria 1646
212 Ga0207687_10000597 3300025927 Bacteria 24476
213 Ga0207687_11803615 3300025927 Bacteria 524
214 Ga0207700_11077703 3300025928 Bacteria 718
215 Ga0207709_10109420 3300025935 Bacteria 1845
216 Ga0207709_10450838 3300025935 Bacteria 994
217 Ga0207709_10869255 3300025935 Bacteria 731
218 Ga0207709_11260143 3300025935 Bacteria 610
219 Ga0207670_10029887 3300025936 Bacteria 3476
220 Ga0207670_10125544 3300025936 Bacteria 1872
221 Ga0207670_10220975 3300025936 Bacteria 1450
222 Ga0207670_10721132 3300025936 Bacteria 827
223 Ga0207669_10238946 3300025937 Bacteria 1345
224 Ga0207689_10005206 3300025942 Bacteria 11673
225 Ga0207689_10326047 3300025942 Bacteria 1275
226 Ga0207667_11854708 3300025949 Unclassified 566
227 Ga0207712_10070099 3300025961 Bacteria 2517
228 Ga0207712_10100523 3300025961 Bacteria 2149
229 Ga0207712_10406985 3300025961 Bacteria 1145
230 Ga0207712_10447816 3300025961 Bacteria 1094
231 Ga0207712_10917925 3300025961 Bacteria 774
232 Ga0207640_11023332 3300025981 Unclassified 728
233 Ga0207640_11257711 3300025981 Unclassified 660
234 Ga0207658_10086726 3300025986 Bacteria 2415
235 Ga0207677_11239992 3300026023 Bacteria 683
236 Ga0207708_10341970 3300026075 Bacteria 1226
237 Ga0207708_10375277 3300026075 Bacteria 1171
238 Ga0207708_11563890 3300026075 Unclassified 580
239 Ga0207641_10018881 3300026088 Bacteria 5656
240 Ga0207641_11321390 3300026088 Bacteria 722
241 Ga0207676_10153031 3300026095 Bacteria 1989
242 Ga0207676_11326036 3300026095 Bacteria 715
243 Ga0207676_11659699 3300026095 Bacteria 637
244 Ga0207676_12300670 3300026095 Bacteria 536
245 Ga0207674_10094230 3300026116 Bacteria 2981
246 Ga0207674_10172736 3300026116 Bacteria 2114
247 Ga0207674_10202258 3300026116 Bacteria 1935
248 Ga0207674_10503464 3300026116 Bacteria 1170
249 Ga0207675_100249308 3300026118 Bacteria 1718
250 Ga0207675_100252983 3300026118 Bacteria 1705
251 Ga0207675_101154458 3300026118 Bacteria 795
252 Ga0207683_10043585 3300026121 Bacteria 3921
253 Ga0207698_11169153 3300026142 Bacteria 783
254 Ga0209999_1033475 3300027543 Bacteria 955
255 Ga0209971_1168875 3300027682 Unclassified 539
256 Ga0207428_10750093 3300027907 Bacteria 696
257 Ga0268266_10444547 3300028379 Bacteria 1231
258 Ga0268265_10729132 3300028380 Bacteria 960
259 Ga0268265_10955461 3300028380 Bacteria 844
260 Ga0268265_11909719 3300028380 Bacteria 601
261 Ga0268264_10401457 3300028381 Bacteria 1317
262 Ga0268264_12302374 3300028381 Bacteria 546
263 Ga0265336_10019816 3300028666 Bacteria 2167
264 Ga0307515_10012558 3300028794 Bacteria 15928
265 Ga0307515_10199856 3300028794 Bacteria 1878
266 Ga0265338_10059370 3300028800 Bacteria 3370
267 Ga0265320_10029992 3300031240 Bacteria 2810
268 Ga0265327_10012042 3300031251 Bacteria 5880
269 Ga0265327_10152450 3300031251 Bacteria 1072
270 Ga0265327_10157021 3300031251 Bacteria 1053
271 Ga0265327_10187624 3300031251 Bacteria 942
272 Ga0265316_10108998 3300031344 Bacteria 2099
273 Ga0265316_11149068 3300031344 Bacteria 538
274 Ga0307513_10048980 3300031456 Bacteria 4580
275 Ga0307513_10086487 3300031456 Bacteria 3213
276 Ga0307509_10000011 3300031507 Bacteria 298257
277 Ga0307509_10007347 3300031507 Bacteria 14438
278 Ga0307509_10017024 3300031507 Bacteria 8381
279 Ga0307509_10108434 3300031507 Bacteria 2790
280 Ga0307509_10158427 3300031507 Bacteria 2166
281 Ga0307408_100832969 3300031548 Bacteria 840
282 Ga0265313_10202527 3300031595 Bacteria 825
283 Ga0307508_10082926 3300031616 Bacteria 2788
284 Ga0307508_10225950 3300031616 Bacteria 1471
285 Ga0316579_10036790 3300031691 Bacteria 2259
286 Ga0316579_10642550 3300031691 Unclassified 514
287 Ga0265314_10228158 3300031711 Bacteria 1082
288 Ga0316576_11327640 3300031727 Bacteria 506
289 Ga0316578_10183041 3300031728 Bacteria 1263
290 Ga0316578_10600189 3300031728 Bacteria 645
291 Ga0307405_10814927 3300031731 Unclassified 783
292 Ga0316577_10022299 3300031733 Bacteria 3516
293 Ga0316577_10062332 3300031733 Bacteria 2082
294 Ga0316577_10344507 3300031733 Bacteria 846
295 Ga0316577_10355945 3300031733 Bacteria 831
296 Ga0316577_10883838 3300031733 Unclassified 507
297 Ga0307413_10097661 3300031824 Unclassified 1932
298 Ga0307413_10139330 3300031824 Bacteria 1674
299 Ga0307406_10832672 3300031901 Unclassified 781
300 Ga0307406_11796939 3300031901 Bacteria 545
301 Ga0307407_10823207 3300031903 Unclassified 708
302 Ga0307409_100558733 3300031995 Bacteria 1125
303 Ga0307409_101678369 3300031995 Bacteria 664
304 Ga0307416_101224931 3300032002 Bacteria 856
305 Ga0307411_10707907 3300032005 Bacteria 878
306 Ga0307415_100483926 3300032126 Bacteria 1078
307 Ga0307415_100844480 3300032126 Bacteria 840
308 Ga0307415_102068284 3300032126 Bacteria 555
309 Ga0316593_10040262 3300032168 Bacteria 1553
310 Ga0307507_10273555 3300033179 Bacteria 1064
311 Ga0373949_0000013 3300035090 Bacteria 63301
312 Ga0373951_0004552 3300035091 Bacteria 3285
313 Ga0373923_0632190 3300035111 Unclassified 528
314 Ga0373936_0000011 3300035113 Bacteria 248623
315 Ga0373941_0049287 3300035115 Bacteria 1333
316 Ga0373953_0200051 3300035117 Bacteria 864
317 Ga0373957_0448352 3300035120 Bacteria 558
318 Ga0373960_0031671 3300035121 Bacteria 1481
319 Ga0373961_0000027 3300035241 Bacteria 96348
320 Ga0373937_0789803 3300036401 Bacteria 897
321 Ga0373937_1723047 3300036401 Bacteria 573
322 Ga0316582_0193469 3300036647 Bacteria 1386
323 Ga0316582_0697742 3300036647 Bacteria 697
324 Ga0316584_0064499 3300036712 Bacteria 2743
325 Ga0316584_0077497 3300036712 Bacteria 2490
326 Ga0316584_0205920 3300036712 Bacteria 1450
327 Ga0395899_0009967 3300037312 Bacteria 7287
328 Ga0395899_0853656 3300037312 Bacteria 559
329 Ga0395900_0030677 3300037418 Bacteria 5520
330 Ga0395900_0212481 3300037418 Bacteria 1953
331 Ga0395900_0440283 3300037418 Bacteria 1261
332 Ga0395905_0183774 3300037471 Bacteria 1963
333 Ga0395905_0530591 3300037471 Bacteria 1078
334 Ga0316581_0111190 3300037588 Bacteria 844
335 Ga0395901_0041190 3300038443 Bacteria 4785
336 Ga0395901_1763628 3300038443 Bacteria 569
337 Ga0436365_1095800 3300039437 Bacteria 4963
338 Ga0436360_0020399 3300039438 Bacteria 1141
339 Ga0451793_0253177 3300041452 Bacteria 1277
340 Ga0451807_1998491 3300041486 Bacteria 1083
341 Ga0451837_0300182 3300041494 Bacteria 564
342 Ga0451853_3494586 3300041512 Bacteria 902
343 Ga0451577_0000306 3300042876 Bacteria 94213
344 Ga0451577_0032743 3300042876 Bacteria 4684
345 Ga0451577_0117299 3300042876 Bacteria 2384
346 Ga0451577_0138665 3300042876 Bacteria 2184
347 Ga0451577_0251878 3300042876 Bacteria 1598
348 Ga0451577_0695377 3300042876 Bacteria 921
349 Ga0451577_1335127 3300042876 Bacteria 637
350 Ga0453683_0004999 3300044673 Bacteria 9315
351 Ga0453683_0418631 3300044673 Bacteria 864
352 Ga0453683_0480164 3300044673 Bacteria 806
353 Ga0453683_1122944 3300044673 Bacteria 524
354 Ga0466961_0824570 3300044693 Bacteria 553
355 Ga0453684_0002219 3300044712 Bacteria 48222
356 Ga0453684_0004002 3300044712 Bacteria 32129
357 Ga0453684_0006856 3300044712 Bacteria 21403
358 Ga0453684_0013249 3300044712 Bacteria 13430
359 Ga0453684_0024537 3300044712 Bacteria 8808
360 Ga0453684_0045673 3300044712 Bacteria 5838
361 Ga0453684_0067161 3300044712 Bacteria 4562
362 Ga0453684_0236245 3300044712 Bacteria 2107
363 Ga0453684_0251666 3300044712 Bacteria 2028
364 Ga0453684_0340179 3300044712 Bacteria 1694
365 Ga0453684_0351193 3300044712 Bacteria 1663
366 Ga0453684_0558160 3300044712 Bacteria 1260
367 Ga0453684_0866960 3300044712 Bacteria 969
368 Ga0453684_1645629 3300044712 Bacteria 657
369 Ga0453684_2494040 3300044712 Unclassified 510
370 Ga0451576_0096974 3300045051 Bacteria 3067
371 Ga0451576_0187267 3300045051 Bacteria 2161
372 Ga0451576_0803674 3300045051 Bacteria 987
373 Ga0451576_0879954 3300045051 Bacteria 940
374 Ga0451576_1068401 3300045051 Bacteria 845
375 Ga0451576_1149309 3300045051 Bacteria 812
376 Ga0451576_1156786 3300045051 Bacteria 809
377 Ga0451576_1526056 3300045051 Bacteria 694
378 Ga0495603_0011098 3300046455 Bacteria 5462
379 Ga0495650_0027768 3300046471 Bacteria 2609
380 Ga0495662_0373114 3300046476 Bacteria 701
381 Ga0495596_0046204 3300046500 Bacteria 1711
382 Ga0495618_0797295 3300046514 Bacteria 550
383 Ga0495632_0139018 3300046519 Bacteria 1127
384 Ga0495632_0164245 3300046519 Bacteria 1022
385 Ga0495632_0406312 3300046519 Bacteria 594
386 Ga0495666_0190044 3300046526 Bacteria 946
387 Ga0495613_0533595 3300046689 Bacteria 787
388 Ga0495649_0061488 3300046694 Bacteria 2019
389 Ga0495674_0103628 3300047319 Bacteria 2419
390 Ga0495676_0196080 3300047321 Bacteria 1406
391 Ga0495680_0824358 3300047322 Bacteria 604
392 Ga0496100_0627241 3300048903 Bacteria 836
393 Ga0496101_1246311 3300048904 Bacteria 582
394 Ga0496105_0776172 3300048908 Bacteria 730
395 Ga0496112_0904362 3300048915 Bacteria 805
396 Ga0496114_0019499 3300048917 Bacteria 5495
397 Ga0501298_001685 3300049521 Bacteria 3279
398 Ga0501032_0423483 3300049569 Bacteria 854
399 Ga0501034_0064335 3300049571 Bacteria 3682
400 Ga0501036_1136991 3300049572 Bacteria 637
401 Ga0501039_0944782 3300049575 Bacteria 671
402 Ga0501039_1235992 3300049575 Bacteria 577
403 Ga0501041_0592740 3300049577 Bacteria 707
404 Ga0501041_0680838 3300049577 Bacteria 658
405 Ga0501042_0669172 3300049578 Bacteria 755
406 Ga0501046_0036188 3300049580 Bacteria 3975
407 Ga0501047_0050556 3300049581 Bacteria 4014
408 Ga0501047_0496305 3300049581 Bacteria 1047
409 Ga0501047_0570239 3300049581 Bacteria 955
410 Ga0501048_0085550 3300049582 Bacteria 2224
411 Ga0501048_0253406 3300049582 Bacteria 1250
412 Ga0501048_0315774 3300049582 Bacteria 1113
413 Ga0501067_0146678 3300049583 Bacteria 1315
414 Ga0501067_0170402 3300049583 Bacteria 1213
415 Ga0501068_0216276 3300049584 Bacteria 1217
416 Ga0501069_0467468 3300049585 Bacteria 751
417 Ga0501070_0204772 3300049586 Bacteria 1620
418 Ga0501070_0733502 3300049586 Bacteria 779
419 Ga0501070_1249331 3300049586 Bacteria 568
420 Ga0501072_0230927 3300049588 Bacteria 1474
421 Ga0501072_0904513 3300049588 Bacteria 689
422 Ga0501073_0224667 3300049589 Bacteria 1297
423 Ga0501073_0411197 3300049589 Bacteria 935
424 Ga0501073_0921376 3300049589 Bacteria 602
425 Ga0501074_0192562 3300049590 Bacteria 1454
426 Ga0501076_0797971 3300049592 Bacteria 779
427 Ga0501076_1516560 3300049592 Bacteria 550
428 Ga0501077_0812980 3300049593 Bacteria 601
429 Ga0501202_036072 3300049652 Bacteria 1052
430 Ga0501209_064655 3300049656 Bacteria 1028
431 Ga0501216_000329 3300049660 Bacteria 5354
432 Ga0501217_014866 3300049661 Bacteria 1764
433 Ga0501217_112442 3300049661 Bacteria 784
434 Ga0501223_070265 3300049663 Unclassified 691
435 Ga0501227_000298 3300049665 Bacteria 10252
436 Ga0501230_057285 3300049667 Archaea 783
437 Ga0501233_003132 3300049668 Bacteria 2962
438 Ga0501235_010013 3300049669 Bacteria 2073
439 Ga0501236_071074 3300049670 Bacteria 636
440 Ga0501253_131979 3300049683 Bacteria 615
441 Ga0501221_006518 3300049704 Bacteria 1978
442 Ga0501225_0011429 3300049705 Bacteria 2496
443 Ga0501225_0039972 3300049705 Unclassified 1292
444 Ga0501229_009674 3300049706 Bacteria 1212
445 Ga0501234_018668 3300049707 Bacteria 1098
446 Ga0501079_0699399 3300049741 Bacteria 798
447 Ga0501080_0579980 3300049742 Bacteria 997
448 Ga0501080_1678091 3300049742 Bacteria 536
449 Ga0501083_0056792 3300049744 Bacteria 2622
450 Ga0501083_0232485 3300049744 Bacteria 1201
451 Ga0501083_0924183 3300049744 Bacteria 568
452 Ga0501035_0448969 3300049822 Bacteria 1067
453 Ga0501035_0761056 3300049822 Bacteria 776
454 Ga0501044_0293279 3300049823 Bacteria 1557
455 Ga0501045_0189206 3300049824 Bacteria 1534
456 nmdc:mga03n38_618064_c1 3300050490 Bacteria 618
457 nmdc:mga05p37_225339_c1 3300050507 Bacteria 2261
458 nmdc:mga05p37_2543_c1 3300050507 Bacteria 21204
459 nmdc:mga05p37_314248_c1 3300050507 Bacteria 1856
460 nmdc:mga05p37_337841_c1 3300050507 Bacteria 1777
461 nmdc:mga05p37_412224_c1 3300050507 Bacteria 1575
462 nmdc:mga05p37_501510_c1 3300050507 Bacteria 1393
463 nmdc:mga09592_11407_c1 3300050508 Bacteria 7226
464 nmdc:mga09592_161743_c1 3300050508 Bacteria 1934
465 nmdc:mga09592_194043_c1 3300050508 Bacteria 1758
466 nmdc:mga09592_325230_c1 3300050508 Bacteria 1332
467 nmdc:mga09592_4614_c1 3300050508 Bacteria 11159
468 nmdc:mga09592_524498_c1 3300050508 Bacteria 1019
469 nmdc:mga09592_66277_c1 3300050508 Bacteria 3060
470 nmdc:mga09592_962755_c1 3300050508 Bacteria 715
471 nmdc:mga09592_967015_c1 3300050508 Bacteria 713
472 nmdc:mga0qj67_1072114_c1 3300050509 Bacteria 630
473 nmdc:mga0qj67_283248_c1 3300050509 Bacteria 1343
474 nmdc:mga06r32_1474810_c1 3300050510 Bacteria 621
475 nmdc:mga06r32_319784_c1 3300050510 Unclassified 1537
476 nmdc:mga08y16_886319_c1 3300050511 Bacteria 879
477 nmdc:mga0rr50_1478494_c1 3300050513 Bacteria 574
478 Ga0500635_0006317 3300053080 Bacteria 3159
479 Ga0500578_0226210 3300053086 Bacteria 1135
480 Ga0500583_0173028 3300053092 Bacteria 1075
481 Ga0500566_0002070 3300053094 Bacteria 11851
482 Ga0500566_0027470 3300053094 Bacteria 3331
483 Ga0500566_0253128 3300053094 Bacteria 855
484 Ga0500640_148149 3300053095 Bacteria 899
485 Ga0500554_001056 3300053102 Bacteria 5351
486 Ga0500572_001875 3300053111 Bacteria 5305
487 Ga0500595_000065 3300053119 Bacteria 74208
488 Ga0500597_266891 3300053120 Bacteria 695
489 Ga0500607_104887 3300053121 Bacteria 1397
490 Ga0500614_212631 3300053123 Bacteria 598
491 Ga0500642_0089458 3300053130 Bacteria 1422
492 Ga0500559_0015006 3300053136 Bacteria 3275
493 Ga0500559_0173242 3300053136 Bacteria 1015
494 Ga0500564_182173 3300053138 Bacteria 875
495 Ga0500564_276749 3300053138 Bacteria 654
496 Ga0500573_0507899 3300053140 Bacteria 543
497 Ga0500603_001496 3300053150 Bacteria 5327
498 Ga0500601_030966 3300053737 Bacteria 635
499 Ga0501084_0323588 3300054114 Bacteria 1302
500 Ga0501084_0571450 3300054114 Unclassified 955
501 Ga0501084_1549065 3300054114 Bacteria 554
502 Ga0501082_0326734 3300060353 Bacteria 1336
503 Ga0501082_1985765 3300060353 Unclassified 507
504 Ga0530510_0315253 3300061734 Bacteria 1172
505 Ga0530510_0636276 3300061734 Bacteria 812
506 2688068759 2687453257 Bacteria 6784659
507 2837268960 2837268691 Bacteria 7850704
508 Ga0070658_10479746
509 JGI24744J21845_10100923
510 JGI25406J46586_10088760
511 JGI25407J50210_10134524
512 Ga0065704_10197801
513 Ga0065704_10643597
514 Ga0065715_10256341
515 Ga0065707_10085965
516 Ga0065707_10086358
517 Ga0065707_10098277
518 Ga0065707_10111372
519 Ga0065707_10585430
520 Ga0070658_10525835
521 Ga0070683_100961114
522 Ga0070690_100050292
523 Ga0070670_100262078
524 Ga0070670_101322897
525 Ga0068869_100085724
526 Ga0068869_100156889
527 Ga0068869_100168470
528 Ga0068869_101348801
529 Ga0068869_102042253
530 Ga0070680_100612211
531 Ga0070680_100699940
532 Ga0070680_101255553
533 Ga0070682_100218190
534 Ga0070682_102076553
535 Ga0068868_101269753
536 Ga0070689_100048256
537 Ga0070689_100079267
538 Ga0070689_100108934
539 Ga0070689_100317758
540 Ga0070689_100417461
541 Ga0070687_100081832
542 Ga0070687_100431447
543 Ga0070692_10288646
544 Ga0070669_100374404
545 Ga0070674_100097746
546 Ga0070688_100110815
547 Ga0070688_100182230
548 Ga0070688_100424784
549 Ga0070667_100210994
550 Ga0070714_100818932
551 Ga0070701_10184107
552 Ga0070711_100019805
553 Ga0070705_100081050
554 Ga0070700_100133300
555 Ga0070700_101316488
556 Ga0070700_101819536
557 Ga0070700_101971708
558 Ga0070694_100295685
559 Ga0070694_100313972
560 Ga0070694_100427952
561 Ga0070694_100874381
562 Ga0070694_101467599
563 Ga0070681_11080881
564 Ga0068867_101780091
565 Ga0070685_10200784
566 Ga0070685_11012599
567 Ga0070706_100653774
568 Ga0070706_100752245
569 Ga0070706_101519421
570 Ga0070698_100001379
571 Ga0070698_100045793
572 Ga0070698_100339580
573 Ga0070698_100778217
574 Ga0070698_101378561
575 Ga0070699_100001759
576 Ga0070699_100057924
577 Ga0070699_100062834
578 Ga0070699_100356292
579 Ga0070699_101787332
580 Ga0070679_100035300
581 Ga0070679_100544059
582 Ga0070684_100908027
583 Ga0070684_101069395
584 Ga0070697_101033183
585 Ga0070672_100898579
586 Ga0070695_100439006
587 Ga0070693_100839997
588 Ga0070693_101468931
589 Ga0070665_100006794
590 Ga0070704_100044009
591 Ga0070704_100537821
592 Ga0068855_101497822
593 Ga0068857_100156771
594 Ga0068857_100335440
595 Ga0068857_100820523
596 Ga0068857_101572255
597 Ga0068856_100040870
598 Ga0070702_100139773
599 Ga0070702_100694301
600 Ga0068852_101365245
601 Ga0068852_102694894
602 Ga0068859_100079290
603 Ga0068859_100184140
604 Ga0068859_100201521
605 Ga0068864_100151936
606 Ga0068864_100246866
607 Ga0068864_100351646
608 Ga0068864_100535018
609 Ga0068864_102489700
610 Ga0068866_10906801
611 Ga0068861_100050863
612 Ga0068861_100179336
613 Ga0068861_101128842
614 Ga0068863_100036393
615 Ga0068863_100740209
616 Ga0068860_100286488
617 Ga0068862_100256224
618 Ga0068862_100278607
619 Ga0068862_100409856
620 Ga0068862_100498086
621 Ga0081455_10327992
622 Ga0081539_10008948
623 Ga0070717_10144430
624 Ga0075363_100720777
625 Ga0070712_102060086
626 Ga0075427_10000689
627 Ga0097621_100064711
628 Ga0097621_100220704
629 Ga0097621_100447718
630 Ga0075428_100162131
631 Ga0075428_100286870
632 Ga0075428_100749964
633 Ga0075428_100931040
634 Ga0075430_100565017
635 Ga0075430_101400014
636 Ga0075431_100122209
637 Ga0075431_100671245
638 Ga0075431_101280893
639 Ga0075431_101798335
640 Ga0075433_10942083
641 Ga0075429_100005538
642 Ga0075429_100123336
643 Ga0075429_100136740
644 Ga0075429_100218766
645 Ga0075429_100233795
646 Ga0075429_100331405
647 Ga0075429_101512999
648 Ga0068865_100817541
649 Ga0068865_101134157
650 Ga0097620_100079290
651 Ga0097620_100184141
652 Ga0097620_100201520
653 Ga0075435_100455296
654 Ga0075435_101884440
655 Ga0099795_10242702
656 Ga0105240_11023716
657 Ga0111539_10464943
658 Ga0111539_10493520
659 Ga0105245_10000123
660 Ga0105245_10060039
661 Ga0105245_10517539
662 Ga0105245_12867201
663 Ga0105245_12976155
664 Ga0114129_10026462
665 Ga0114129_10177677
666 Ga0114129_10236063
667 Ga0114129_10433524
668 Ga0114129_10463742
669 Ga0105243_10048922
670 Ga0105243_12715440
671 Ga0105242_10195776
672 Ga0105242_10398502
673 Ga0105242_11528731
674 Ga0105237_11231903
675 Ga0105238_10420955
676 Ga0105249_10004883
677 Ga0105249_10204385
678 Ga0105249_10343811
679 Ga0105249_10765249
680 Ga0105239_10030713
681 Ga0105246_11184294
682 Ga0105246_12247066
683 Ga0157371_10110248
684 Ga0157374_10051905
685 Ga0157378_10259043
686 Ga0157378_11858286
687 Ga0157380_11001206
688 Ga0157380_11088389
689 Ga0157379_11518961
690 Ga0157376_10020482
691 Ga0157376_10115849
692 Ga0157376_12543126
693 Ga0157376_12718111
694 Ga0163161_10802464
695 Ga0163161_10986739
696 Ga0207642_10054805
697 Ga0207705_10160726
698 Ga0207705_10394504
699 Ga0207705_11340478
700 Ga0207684_10394326
701 Ga0207684_11061237
702 Ga0207684_11435293
703 Ga0207707_10905939
704 Ga0207707_11395297
705 Ga0207695_10959113
706 Ga0207671_11301776
707 Ga0207660_10310420
708 Ga0207660_11295727
709 Ga0207662_10142141
710 Ga0207662_10480912
711 Ga0207652_10014808
712 Ga0207652_11575841
713 Ga0207646_10194954
714 Ga0207646_10590140
715 Ga0207646_10810048
716 Ga0207646_10825611
717 Ga0207681_10367208
718 Ga0207650_10188823
719 Ga0207687_10000597
720 Ga0207687_11803615
721 Ga0207700_11077703
722 Ga0207709_10109420
723 Ga0207709_10450838
724 Ga0207709_10869255
725 Ga0207709_11260143
726 Ga0207670_10029887
727 Ga0207670_10125544
728 Ga0207670_10220975
729 Ga0207670_10721132
730 Ga0207669_10238946
731 Ga0207689_10005206
732 Ga0207689_10326047
733 Ga0207667_11854708
734 Ga0207712_10070099
735 Ga0207712_10100523
736 Ga0207712_10406985
737 Ga0207712_10447816
738 Ga0207712_10917925
739 Ga0207640_11023332
740 Ga0207640_11257711
741 Ga0207658_10086726
742 Ga0207677_11239992
743 Ga0207708_10341970
744 Ga0207708_10375277
745 Ga0207708_11563890
746 Ga0207641_10018881
747 Ga0207641_11321390
748 Ga0207676_10153031
749 Ga0207676_11326036
750 Ga0207676_11659699
751 Ga0207676_12300670
752 Ga0207674_10094230
753 Ga0207674_10172736
754 Ga0207674_10202258
755 Ga0207674_10503464
756 Ga0207675_100249308
757 Ga0207675_100252983
758 Ga0207675_101154458
759 Ga0207683_10043585
760 Ga0207698_11169153
761 Ga0209999_1033475
762 Ga0209971_1168875
763 Ga0207428_10750093
764 Ga0268266_10444547
765 Ga0268265_10729132
766 Ga0268265_10955461
767 Ga0268265_11909719
768 Ga0268264_10401457
769 Ga0268264_12302374
770 Ga0265336_10019816
771 Ga0307515_10012558
772 Ga0307515_10199856
773 Ga0265338_10059370
774 Ga0265320_10029992
775 Ga0265327_10012042
776 Ga0265327_10152450
777 Ga0265327_10157021
778 Ga0265327_10187624
779 Ga0265316_10108998
780 Ga0265316_11149068
781 Ga0307513_10048980
782 Ga0307513_10086487
783 Ga0307509_10000011
784 Ga0307509_10007347
785 Ga0307509_10017024
786 Ga0307509_10108434
787 Ga0307509_10158427
788 Ga0307408_100832969
789 Ga0265313_10202527
790 Ga0307508_10082926
791 Ga0307508_10225950
792 Ga0316579_10036790
793 Ga0316579_10642550
794 Ga0265314_10228158
795 Ga0316576_11327640
796 Ga0316578_10183041
797 Ga0316578_10600189
798 Ga0307405_10814927
799 Ga0316577_10022299
800 Ga0316577_10062332
801 Ga0316577_10344507
802 Ga0316577_10355945
803 Ga0316577_10883838
804 Ga0307413_10097661
805 Ga0307413_10139330
806 Ga0307406_10832672
807 Ga0307406_11796939
808 Ga0307407_10823207
809 Ga0307409_100558733
810 Ga0307409_101678369
811 Ga0307416_101224931
812 Ga0307411_10707907
813 Ga0307415_100483926
814 Ga0307415_100844480
815 Ga0307415_102068284
816 Ga0316593_10040262
817 Ga0307507_10273555
818 Ga0373949_0000013
819 Ga0373951_0004552
820 Ga0373923_0632190
821 Ga0373936_0000011
822 Ga0373941_0049287
823 Ga0373953_0200051
824 Ga0373957_0448352
825 Ga0373960_0031671
826 Ga0373961_0000027
827 Ga0373937_0789803
828 Ga0373937_1723047
829 Ga0316582_0193469
830 Ga0316582_0697742
831 Ga0316584_0064499
832 Ga0316584_0077497
833 Ga0316584_0205920
834 Ga0395899_0009967
835 Ga0395899_0853656
836 Ga0395900_0030677
837 Ga0395900_0212481
838 Ga0395900_0440283
839 Ga0395905_0183774
840 Ga0395905_0530591
841 Ga0316581_0111190
842 Ga0395901_0041190
843 Ga0395901_1763628
844 Ga0436365_1095800
845 Ga0436360_0020399
846 Ga0451793_0253177
847 Ga0451807_1998491
848 Ga0451837_0300182
849 Ga0451853_3494586
850 Ga0451577_0000306
851 Ga0451577_0032743
852 Ga0451577_0117299
853 Ga0451577_0138665
854 Ga0451577_0251878
855 Ga0451577_0695377
856 Ga0451577_1335127
857 Ga0453683_0004999
858 Ga0453683_0418631
859 Ga0453683_0480164
860 Ga0453683_1122944
861 Ga0466961_0824570
862 Ga0453684_0002219
863 Ga0453684_0004002
864 Ga0453684_0006856
865 Ga0453684_0013249
866 Ga0453684_0024537
867 Ga0453684_0045673
868 Ga0453684_0067161
869 Ga0453684_0236245
870 Ga0453684_0251666
871 Ga0453684_0340179
872 Ga0453684_0351193
873 Ga0453684_0558160
874 Ga0453684_0866960
875 Ga0453684_1645629
876 Ga0453684_2494040
877 Ga0451576_0096974
878 Ga0451576_0187267
879 Ga0451576_0803674
880 Ga0451576_0879954
881 Ga0451576_1068401
882 Ga0451576_1149309
883 Ga0451576_1156786
884 Ga0451576_1526056
885 Ga0495603_0011098
886 Ga0495650_0027768
887 Ga0495662_0373114
888 Ga0495596_0046204
889 Ga0495618_0797295
890 Ga0495632_0139018
891 Ga0495632_0164245
892 Ga0495632_0406312
893 Ga0495666_0190044
894 Ga0495613_0533595
895 Ga0495649_0061488
896 Ga0495674_0103628
897 Ga0495676_0196080
898 Ga0495680_0824358
899 Ga0496100_0627241
900 Ga0496101_1246311
901 Ga0496105_0776172
902 Ga0496112_0904362
903 Ga0496114_0019499
904 Ga0501298_001685
905 Ga0501032_0423483
906 Ga0501034_0064335
907 Ga0501036_1136991
908 Ga0501039_0944782
909 Ga0501039_1235992
910 Ga0501041_0592740
911 Ga0501041_0680838
912 Ga0501042_0669172
913 Ga0501046_0036188
914 Ga0501047_0050556
915 Ga0501047_0496305
916 Ga0501047_0570239
917 Ga0501048_0085550
918 Ga0501048_0253406
919 Ga0501048_0315774
920 Ga0501067_0146678
921 Ga0501067_0170402
922 Ga0501068_0216276
923 Ga0501069_0467468
924 Ga0501070_0204772
925 Ga0501070_0733502
926 Ga0501070_1249331
927 Ga0501072_0230927
928 Ga0501072_0904513
929 Ga0501073_0224667
930 Ga0501073_0411197
931 Ga0501073_0921376
932 Ga0501074_0192562
933 Ga0501076_0797971
934 Ga0501076_1516560
935 Ga0501077_0812980
936 Ga0501202_036072
937 Ga0501209_064655
938 Ga0501216_000329
939 Ga0501217_014866
940 Ga0501217_112442
941 Ga0501223_070265
942 Ga0501227_000298
943 Ga0501230_057285
944 Ga0501233_003132
945 Ga0501235_010013
946 Ga0501236_071074
947 Ga0501253_131979
948 Ga0501221_006518
949 Ga0501225_0011429
950 Ga0501225_0039972
951 Ga0501229_009674
952 Ga0501234_018668
953 Ga0501079_0699399
954 Ga0501080_0579980
955 Ga0501080_1678091
956 Ga0501083_0056792
957 Ga0501083_0232485
958 Ga0501083_0924183
959 Ga0501035_0448969
960 Ga0501035_0761056
961 Ga0501044_0293279
962 Ga0501045_0189206
963 nmdc:mga03n38_618064_c1
964 nmdc:mga05p37_225339_c1
965 nmdc:mga05p37_2543_c1
966 nmdc:mga05p37_314248_c1
967 nmdc:mga05p37_337841_c1
968 nmdc:mga05p37_412224_c1
969 nmdc:mga05p37_501510_c1
970 nmdc:mga09592_11407_c1
971 nmdc:mga09592_161743_c1
972 nmdc:mga09592_194043_c1
973 nmdc:mga09592_325230_c1
974 nmdc:mga09592_4614_c1
975 nmdc:mga09592_524498_c1
976 nmdc:mga09592_66277_c1
977 nmdc:mga09592_962755_c1
978 nmdc:mga09592_967015_c1
979 nmdc:mga0qj67_1072114_c1
980 nmdc:mga0qj67_283248_c1
981 nmdc:mga06r32_1474810_c1
982 nmdc:mga06r32_319784_c1
983 nmdc:mga08y16_886319_c1
984 nmdc:mga0rr50_1478494_c1
985 Ga0500635_0006317
986 Ga0500578_0226210
987 Ga0500583_0173028
988 Ga0500566_0002070
989 Ga0500566_0027470
990 Ga0500566_0253128
991 Ga0500640_148149
992 Ga0500554_001056
993 Ga0500572_001875
994 Ga0500595_000065
995 Ga0500597_266891
996 Ga0500607_104887
997 Ga0500614_212631
998 Ga0500642_0089458
999 Ga0500559_0015006
1000 Ga0500559_0173242
1001 Ga0500564_182173
1002 Ga0500564_276749
1003 Ga0500573_0507899
1004 Ga0500603_001496
1005 Ga0500601_030966
1006 Ga0501084_0323588
1007 Ga0501084_0571450
1008 Ga0501084_1549065
1009 Ga0501082_0326734
1010 Ga0501082_1985765
1011 Ga0530510_0315253
1012 Ga0530510_0636276
1013 2688068759
1014 2837268960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

12

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k2p-assembly3.cif.gz_C the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.8732 2 48
4k2p-assembly4.cif.gz_D the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.8713 2 48
4k2p-assembly2.cif.gz_B the structure of a quintuple mutant of the tiam1 ph-cc-ex domain 0.8666 2 48
2rai-assembly1.cif.gz_B the px-bar membrane remodeling unit of sorting nexin 9 0.8567 2 48
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8441 2 51
ID Description Score Start End Superfamily
af_P32913_271_465_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9497 2 48 1.20.1270.60
af_K7VGQ7_271_504_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9422 2 48 1.20.1270.60
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.916 3 48 1.20.5.1930
af_Q96M86_1187_1351_1.20.140.100 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Dynein motor heavy chain, linker domain, N-terminal subdomain 0.882 3 49 1.20.140.100
af_I1KBS3_176_275_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8405 6 52 1.20.58.160
ID Description Score Start End GO Terms
AF-A0A497IER7-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9527 1 83 GO:0016020
AF-A0A2E3NKM2-F1-model_v4 NADH dehydrogenase I subunit K 0.9133 2 80 GO:0016020
AF-A0A7W0F0U6-F1-model_v4 Cation:proton antiporter 0.9066 2 84 GO:0005886
GO:0015385
AF-A0A4Y8RRF6-F1-model_v4 Sodium:proton antiporter 0.8987 2 97 GO:0005886
GO:0015385
AF-A0A133V251-F1-model_v4 NADH dehydrogenase 0.8888 2 84 GO:0016651
GO:0030964
GO:0042773

Map