F451899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 478 | 227 | 475 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100445860|Ga0307408_1004458602 |
| Length | 249 |
| Sequence | MRPDRLSLQKWARLAIGARPCQSAASMSSPASPPKSSRPILIAVDGPAASGKGTIARALAQHFGLPHMDTGILYRAVALTMVRFGGDPANEFEAVRACEGTPQVDPTDPDLRTEIVGSIASRISAYPGVRAALLERQRNFAAQPSGAVLDGRDIGTVIAPNATAKLFVTASAEVRARRRVAELLARGIQAHLPDVLIDIRARDERDSGRDTAPLKQAEDADLLDTSEMDIDEAIAAAIELVETRIAARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 3 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 4 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 134 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 135 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 161 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 162 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 223 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 226 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 227 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 0 |
| Rhizoplane | 3.35 |
| Rhizosphere | 90.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2430896 | 2162886006 | Bacteria | 984 |
| 2 | JGI24736J21556_1000458 | 3300001904 | Bacteria | 7671 |
| 3 | JGI24740J21852_10004923 | 3300001979 | Bacteria | 5681 |
| 4 | JGI24740J21852_10020181 | 3300001979 | Bacteria | 2331 |
| 5 | JGI24740J21852_10027561 | 3300001979 | Bacteria | 1889 |
| 6 | JGI24740J21852_10049214 | 3300001979 | Bacteria | 1219 |
| 7 | JGI24739J22299_10003612 | 3300001989 | Bacteria | 5909 |
| 8 | JGI24737J22298_10010040 | 3300001990 | Bacteria | 3135 |
| 9 | JGI24737J22298_10025276 | 3300001990 | Bacteria | 1878 |
| 10 | JGI24735J21928_10003940 | 3300002067 | Bacteria | 5022 |
| 11 | JGI24735J21928_10044593 | 3300002067 | Bacteria | 1288 |
| 12 | JGI25150J39212_1000126 | 3300002774 | Bacteria | 42982 |
| 13 | JGI25153J46596_10000305 | 3300003215 | Bacteria | 36679 |
| 14 | rootH1_10152439 | 3300003323 | Bacteria | 1215 |
| 15 | Ga0055526_1007718 | 3300003771 | Bacteria | 5523 |
| 16 | Ga0055537_1004112 | 3300003773 | Bacteria | 4251 |
| 17 | Ga0055536_1019790 | 3300003781 | Bacteria | 2103 |
| 18 | Ga0055540_1000521 | 3300003792 | Bacteria | 29043 |
| 19 | JGI25405J52794_10005305 | 3300003911 | Bacteria | 2321 |
| 20 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 21 | Ga0070658_10069571 | 3300005327 | Bacteria | 2880 |
| 22 | Ga0070658_10084531 | 3300005327 | Bacteria | 2609 |
| 23 | Ga0070658_10110755 | 3300005327 | Bacteria | 2274 |
| 24 | Ga0070683_100135987 | 3300005329 | Bacteria | 2327 |
| 25 | Ga0070683_100197311 | 3300005329 | Bacteria | 1911 |
| 26 | Ga0070670_100150058 | 3300005331 | Bacteria | 2017 |
| 27 | Ga0070677_10036575 | 3300005333 | Bacteria | 1911 |
| 28 | Ga0068869_100348593 | 3300005334 | Bacteria | 1206 |
| 29 | Ga0070680_100028641 | 3300005336 | Bacteria | 4469 |
| 30 | Ga0068868_100094302 | 3300005338 | Bacteria | 2414 |
| 31 | Ga0070660_100004038 | 3300005339 | Bacteria | 10136 |
| 32 | Ga0070660_100079246 | 3300005339 | Bacteria | 2577 |
| 33 | Ga0070660_100173617 | 3300005339 | Bacteria | 1742 |
| 34 | Ga0070660_100252499 | 3300005339 | Bacteria | 1438 |
| 35 | Ga0070660_100264823 | 3300005339 | Bacteria | 1404 |
| 36 | Ga0070660_100830395 | 3300005339 | Bacteria | 778 |
| 37 | Ga0070689_100800056 | 3300005340 | Bacteria | 829 |
| 38 | Ga0070691_10011238 | 3300005341 | Bacteria | 4085 |
| 39 | Ga0070661_100000041 | 3300005344 | Bacteria | 99916 |
| 40 | Ga0070661_100001752 | 3300005344 | Bacteria | 15061 |
| 41 | Ga0070661_100007298 | 3300005344 | Bacteria | 7622 |
| 42 | Ga0070661_100094810 | 3300005344 | Bacteria | 2212 |
| 43 | Ga0070668_100062336 | 3300005347 | Bacteria | 2889 |
| 44 | Ga0070669_100053045 | 3300005353 | Bacteria | 2968 |
| 45 | Ga0070669_100055238 | 3300005353 | Bacteria | 2910 |
| 46 | Ga0070675_100079783 | 3300005354 | Bacteria | 2727 |
| 47 | Ga0070675_100127814 | 3300005354 | Bacteria | 2164 |
| 48 | Ga0070675_100374627 | 3300005354 | Bacteria | 1266 |
| 49 | Ga0070671_100041419 | 3300005355 | Bacteria | 3828 |
| 50 | Ga0070671_100073478 | 3300005355 | Bacteria | 2856 |
| 51 | Ga0070659_100012271 | 3300005366 | Bacteria | 6354 |
| 52 | Ga0070659_100312928 | 3300005366 | Bacteria | 1311 |
| 53 | Ga0070667_100067450 | 3300005367 | Bacteria | 3042 |
| 54 | Ga0070667_100362779 | 3300005367 | Bacteria | 1313 |
| 55 | Ga0070714_100044626 | 3300005435 | Bacteria | 3753 |
| 56 | Ga0070714_100174987 | 3300005435 | Bacteria | 1950 |
| 57 | Ga0070663_100070851 | 3300005455 | Bacteria | 2536 |
| 58 | Ga0070663_100152726 | 3300005455 | Bacteria | 1772 |
| 59 | Ga0070662_100011232 | 3300005457 | Bacteria | 5903 |
| 60 | Ga0070662_100052264 | 3300005457 | Bacteria | 2952 |
| 61 | Ga0070662_100136175 | 3300005457 | Bacteria | 1899 |
| 62 | Ga0070662_100415892 | 3300005457 | Unclassified | 1111 |
| 63 | Ga0070681_10045388 | 3300005458 | Bacteria | 4397 |
| 64 | Ga0070681_10392441 | 3300005458 | Bacteria | 1299 |
| 65 | Ga0070679_100212360 | 3300005530 | Bacteria | 1899 |
| 66 | Ga0070684_100146000 | 3300005535 | Bacteria | 2141 |
| 67 | Ga0068853_100017003 | 3300005539 | Bacteria | 5997 |
| 68 | Ga0068853_100020412 | 3300005539 | Bacteria | 5510 |
| 69 | Ga0068853_100031229 | 3300005539 | Bacteria | 4505 |
| 70 | Ga0068853_100043581 | 3300005539 | Bacteria | 3838 |
| 71 | Ga0070672_100186843 | 3300005543 | Bacteria | 1728 |
| 72 | Ga0070665_100007276 | 3300005548 | Bacteria | 11250 |
| 73 | Ga0070665_100200794 | 3300005548 | Bacteria | 1994 |
| 74 | Ga0068855_100478182 | 3300005563 | Bacteria | 1356 |
| 75 | Ga0070664_100011210 | 3300005564 | Bacteria | 7270 |
| 76 | Ga0068857_100028699 | 3300005577 | Bacteria | 4909 |
| 77 | Ga0068854_100004251 | 3300005578 | Bacteria | 9020 |
| 78 | Ga0068854_100018212 | 3300005578 | Bacteria | 4712 |
| 79 | Ga0068854_100056403 | 3300005578 | Bacteria | 2831 |
| 80 | Ga0068854_100770042 | 3300005578 | Bacteria | 836 |
| 81 | Ga0068856_100007943 | 3300005614 | Bacteria | 10360 |
| 82 | Ga0068856_100071995 | 3300005614 | Bacteria | 3422 |
| 83 | Ga0068856_100086923 | 3300005614 | Bacteria | 3107 |
| 84 | Ga0068856_100339871 | 3300005614 | Bacteria | 1519 |
| 85 | Ga0068856_100818848 | 3300005614 | Bacteria | 950 |
| 86 | Ga0068852_100999716 | 3300005616 | Bacteria | 855 |
| 87 | Ga0068859_100123766 | 3300005617 | Bacteria | 2653 |
| 88 | Ga0068864_100001105 | 3300005618 | Bacteria | 22558 |
| 89 | Ga0068864_100010992 | 3300005618 | Bacteria | 7485 |
| 90 | Ga0068866_10139064 | 3300005718 | Bacteria | 1392 |
| 91 | Ga0068863_100007010 | 3300005841 | Bacteria | 11048 |
| 92 | Ga0068863_100019009 | 3300005841 | Bacteria | 6576 |
| 93 | Ga0068860_100000944 | 3300005843 | Bacteria | 32201 |
| 94 | Ga0068860_100120291 | 3300005843 | Bacteria | 2514 |
| 95 | Ga0068862_100000280 | 3300005844 | Bacteria | 56780 |
| 96 | Ga0068862_100014177 | 3300005844 | Bacteria | 6609 |
| 97 | Ga0068862_100041438 | 3300005844 | Bacteria | 3917 |
| 98 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 99 | Ga0075370_10074500 | 3300006353 | Bacteria | 1945 |
| 100 | Ga0068871_100150217 | 3300006358 | Bacteria | 1986 |
| 101 | Ga0068865_100142304 | 3300006881 | Bacteria | 1810 |
| 102 | Ga0097620_100123766 | 3300006931 | Bacteria | 2653 |
| 103 | Ga0105240_10028067 | 3300009093 | Bacteria | 7359 |
| 104 | Ga0105240_10556578 | 3300009093 | Bacteria | 1268 |
| 105 | Ga0111539_10386723 | 3300009094 | Bacteria | 1629 |
| 106 | Ga0105243_10017813 | 3300009148 | Bacteria | 5374 |
| 107 | Ga0105241_10147136 | 3300009174 | Bacteria | 1923 |
| 108 | Ga0105241_10367059 | 3300009174 | Bacteria | 1254 |
| 109 | Ga0105248_10025650 | 3300009177 | Bacteria | 6555 |
| 110 | Ga0105248_10081532 | 3300009177 | Bacteria | 3636 |
| 111 | Ga0105238_10267270 | 3300009551 | Bacteria | 1691 |
| 112 | Ga0105238_10377741 | 3300009551 | Bacteria | 1408 |
| 113 | Ga0105238_10460163 | 3300009551 | Bacteria | 1270 |
| 114 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 115 | Ga0157373_10014018 | 3300013100 | Bacteria | 5877 |
| 116 | Ga0157373_10053279 | 3300013100 | Bacteria | 2877 |
| 117 | Ga0157373_10083688 | 3300013100 | Bacteria | 2249 |
| 118 | Ga0157373_10095064 | 3300013100 | Bacteria | 2098 |
| 119 | Ga0157373_10349771 | 3300013100 | Bacteria | 1054 |
| 120 | Ga0157371_10063498 | 3300013102 | Bacteria | 2617 |
| 121 | Ga0157371_10147436 | 3300013102 | Bacteria | 1677 |
| 122 | Ga0157371_10176559 | 3300013102 | Bacteria | 1527 |
| 123 | Ga0157371_10176678 | 3300013102 | Bacteria | 1527 |
| 124 | Ga0157370_10007637 | 3300013104 | Bacteria | 11739 |
| 125 | Ga0157370_10007721 | 3300013104 | Bacteria | 11663 |
| 126 | Ga0157370_10062685 | 3300013104 | Bacteria | 3525 |
| 127 | Ga0157370_10068173 | 3300013104 | Bacteria | 3362 |
| 128 | Ga0157370_10121075 | 3300013104 | Bacteria | 2443 |
| 129 | Ga0157369_10010712 | 3300013105 | Bacteria | 10433 |
| 130 | Ga0157369_10102647 | 3300013105 | Bacteria | 3047 |
| 131 | Ga0157369_10172849 | 3300013105 | Bacteria | 2276 |
| 132 | Ga0157369_10184226 | 3300013105 | Bacteria | 2196 |
| 133 | Ga0157369_10349735 | 3300013105 | Bacteria | 1535 |
| 134 | Ga0163162_10302177 | 3300013306 | Bacteria | 1732 |
| 135 | Ga0157372_10014336 | 3300013307 | Bacteria | 8475 |
| 136 | Ga0157372_10110780 | 3300013307 | Bacteria | 3144 |
| 137 | Ga0157372_10367412 | 3300013307 | Bacteria | 1676 |
| 138 | Ga0157375_10066063 | 3300013308 | Bacteria | 3609 |
| 139 | Ga0157375_11012889 | 3300013308 | Bacteria | 970 |
| 140 | Ga0157375_11389172 | 3300013308 | Bacteria | 827 |
| 141 | Ga0157380_10110229 | 3300014326 | Bacteria | 2311 |
| 142 | Ga0157380_10209029 | 3300014326 | Bacteria | 1738 |
| 143 | Ga0157380_10232345 | 3300014326 | Bacteria | 1657 |
| 144 | Ga0157380_10340797 | 3300014326 | Bacteria | 1398 |
| 145 | Ga0157376_10138893 | 3300014969 | Bacteria | 2177 |
| 146 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 147 | Ga0209129_1000359 | 3300025258 | Bacteria | 37937 |
| 148 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 149 | Ga0209676_1020341 | 3300025292 | Bacteria | 2257 |
| 150 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 151 | Ga0209564_1001020 | 3300025295 | Bacteria | 34568 |
| 152 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 153 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 154 | Ga0207426_1025518 | 3300025302 | Bacteria | 1989 |
| 155 | Ga0209051_1000232 | 3300025303 | Bacteria | 93680 |
| 156 | Ga0209257_1019016 | 3300025304 | Bacteria | 2608 |
| 157 | Ga0209257_1019023 | 3300025304 | Bacteria | 2607 |
| 158 | Ga0207697_10028378 | 3300025315 | Bacteria | 2289 |
| 159 | Ga0207656_10116322 | 3300025321 | Bacteria | 1241 |
| 160 | Ga0207642_10100452 | 3300025899 | Bacteria | 1451 |
| 161 | Ga0207688_10014422 | 3300025901 | Bacteria | 4296 |
| 162 | Ga0207647_10002253 | 3300025904 | Bacteria | 14695 |
| 163 | Ga0207647_10011905 | 3300025904 | Bacteria | 6077 |
| 164 | Ga0207647_10012651 | 3300025904 | Bacteria | 5866 |
| 165 | Ga0207645_10031820 | 3300025907 | Bacteria | 3392 |
| 166 | Ga0207705_10010133 | 3300025909 | Bacteria | 6861 |
| 167 | Ga0207705_10082101 | 3300025909 | Bacteria | 2350 |
| 168 | Ga0207654_10330956 | 3300025911 | Bacteria | 1044 |
| 169 | Ga0207707_10110130 | 3300025912 | Bacteria | 2407 |
| 170 | Ga0207707_10281119 | 3300025912 | Bacteria | 1442 |
| 171 | Ga0207695_10001859 | 3300025913 | Bacteria | 33075 |
| 172 | Ga0207695_10012204 | 3300025913 | Bacteria | 10320 |
| 173 | Ga0207695_10021549 | 3300025913 | Bacteria | 7349 |
| 174 | Ga0207693_10097682 | 3300025915 | Bacteria | 2303 |
| 175 | Ga0207657_10003172 | 3300025919 | Bacteria | 17595 |
| 176 | Ga0207657_10003570 | 3300025919 | Bacteria | 16599 |
| 177 | Ga0207657_10024573 | 3300025919 | Bacteria | 5574 |
| 178 | Ga0207657_10236893 | 3300025919 | Bacteria | 1458 |
| 179 | Ga0207649_10000285 | 3300025920 | Bacteria | 39556 |
| 180 | Ga0207649_10000968 | 3300025920 | Bacteria | 17785 |
| 181 | Ga0207649_10012781 | 3300025920 | Bacteria | 4670 |
| 182 | Ga0207649_10019105 | 3300025920 | Bacteria | 3912 |
| 183 | Ga0207649_10128443 | 3300025920 | Bacteria | 1718 |
| 184 | Ga0207652_10228711 | 3300025921 | Bacteria | 1676 |
| 185 | Ga0207681_10107174 | 3300025923 | Bacteria | 2026 |
| 186 | Ga0207694_10041889 | 3300025924 | Bacteria | 3530 |
| 187 | Ga0207694_10120918 | 3300025924 | Bacteria | 2091 |
| 188 | Ga0207694_10123150 | 3300025924 | Bacteria | 2072 |
| 189 | Ga0207694_10745564 | 3300025924 | Bacteria | 826 |
| 190 | Ga0207659_10086378 | 3300025926 | Bacteria | 2332 |
| 191 | Ga0207659_10608600 | 3300025926 | Bacteria | 932 |
| 192 | Ga0207700_10131070 | 3300025928 | Bacteria | 2047 |
| 193 | Ga0207664_10372257 | 3300025929 | Bacteria | 1267 |
| 194 | Ga0207644_10006412 | 3300025931 | Bacteria | 7667 |
| 195 | Ga0207644_10043358 | 3300025931 | Bacteria | 3192 |
| 196 | Ga0207644_10101049 | 3300025931 | Bacteria | 2166 |
| 197 | Ga0207644_10310152 | 3300025931 | Bacteria | 1274 |
| 198 | Ga0207690_10009750 | 3300025932 | Bacteria | 5705 |
| 199 | Ga0207690_10035205 | 3300025932 | Bacteria | 3232 |
| 200 | Ga0207690_10036083 | 3300025932 | Bacteria | 3199 |
| 201 | Ga0207706_10000920 | 3300025933 | Bacteria | 30195 |
| 202 | Ga0207706_10003677 | 3300025933 | Bacteria | 14643 |
| 203 | Ga0207706_10064210 | 3300025933 | Bacteria | 3232 |
| 204 | Ga0207706_10178827 | 3300025933 | Bacteria | 1863 |
| 205 | Ga0207706_10576797 | 3300025933 | Bacteria | 967 |
| 206 | Ga0207691_10150751 | 3300025940 | Bacteria | 2044 |
| 207 | Ga0207691_10507424 | 3300025940 | Bacteria | 1024 |
| 208 | Ga0207711_10000567 | 3300025941 | Bacteria | 37685 |
| 209 | Ga0207711_10000762 | 3300025941 | Bacteria | 31637 |
| 210 | Ga0207689_10148457 | 3300025942 | Bacteria | 1932 |
| 211 | Ga0207679_10024177 | 3300025945 | Bacteria | 4163 |
| 212 | Ga0207667_10010740 | 3300025949 | Bacteria | 10680 |
| 213 | Ga0207667_10020973 | 3300025949 | Bacteria | 7246 |
| 214 | Ga0207667_10367635 | 3300025949 | Bacteria | 1466 |
| 215 | Ga0207651_10062894 | 3300025960 | Bacteria | 2589 |
| 216 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 217 | Ga0207668_10038696 | 3300025972 | Bacteria | 3204 |
| 218 | Ga0207640_10000260 | 3300025981 | Bacteria | 35737 |
| 219 | Ga0207640_10017180 | 3300025981 | Bacteria | 4226 |
| 220 | Ga0207640_10066381 | 3300025981 | Bacteria | 2411 |
| 221 | Ga0207640_10130616 | 3300025981 | Bacteria | 1815 |
| 222 | Ga0207640_10150897 | 3300025981 | Bacteria | 1707 |
| 223 | Ga0207658_10195747 | 3300025986 | Bacteria | 1684 |
| 224 | Ga0207658_10199817 | 3300025986 | Bacteria | 1668 |
| 225 | Ga0207658_10414515 | 3300025986 | Bacteria | 1186 |
| 226 | Ga0207677_10163329 | 3300026023 | Bacteria | 1733 |
| 227 | Ga0207639_10017393 | 3300026041 | Bacteria | 5097 |
| 228 | Ga0207639_10114486 | 3300026041 | Bacteria | 2204 |
| 229 | Ga0207639_10225124 | 3300026041 | Bacteria | 1622 |
| 230 | Ga0207639_10288378 | 3300026041 | Bacteria | 1446 |
| 231 | Ga0207678_10005397 | 3300026067 | Bacteria | 11453 |
| 232 | Ga0207678_10041420 | 3300026067 | Bacteria | 3994 |
| 233 | Ga0207678_10066065 | 3300026067 | Bacteria | 3106 |
| 234 | Ga0207678_10354466 | 3300026067 | Bacteria | 1266 |
| 235 | Ga0207678_10886798 | 3300026067 | Bacteria | 789 |
| 236 | Ga0207702_10008403 | 3300026078 | Bacteria | 8712 |
| 237 | Ga0207702_10036938 | 3300026078 | Bacteria | 4086 |
| 238 | Ga0207702_10037971 | 3300026078 | Bacteria | 4034 |
| 239 | Ga0207702_10113830 | 3300026078 | Bacteria | 2410 |
| 240 | Ga0207702_10146951 | 3300026078 | Bacteria | 2140 |
| 241 | Ga0207702_10693547 | 3300026078 | Bacteria | 1003 |
| 242 | Ga0207641_10002917 | 3300026088 | Bacteria | 15486 |
| 243 | Ga0207641_10005629 | 3300026088 | Bacteria | 10676 |
| 244 | Ga0207676_10003955 | 3300026095 | Bacteria | 10462 |
| 245 | Ga0207676_10092132 | 3300026095 | Bacteria | 2491 |
| 246 | Ga0207674_10002803 | 3300026116 | Bacteria | 21702 |
| 247 | Ga0207674_10005074 | 3300026116 | Bacteria | 15715 |
| 248 | Ga0207674_10027999 | 3300026116 | Bacteria | 5955 |
| 249 | Ga0207674_10081707 | 3300026116 | Bacteria | 3233 |
| 250 | Ga0207674_10125499 | 3300026116 | Bacteria | 2532 |
| 251 | Ga0207683_10301192 | 3300026121 | Bacteria | 1467 |
| 252 | Ga0207698_10002590 | 3300026142 | Bacteria | 10755 |
| 253 | Ga0207698_10018532 | 3300026142 | Bacteria | 4745 |
| 254 | Ga0207698_10223596 | 3300026142 | Bacteria | 1703 |
| 255 | Ga0207698_10395844 | 3300026142 | Bacteria | 1319 |
| 256 | Ga0268266_10006044 | 3300028379 | Bacteria | 11158 |
| 257 | Ga0268266_10012945 | 3300028379 | Bacteria | 7194 |
| 258 | Ga0268265_10000739 | 3300028380 | Bacteria | 31842 |
| 259 | Ga0268265_10005687 | 3300028380 | Bacteria | 8513 |
| 260 | Ga0268265_10220119 | 3300028380 | Bacteria | 1660 |
| 261 | Ga0268265_10671583 | 3300028380 | Bacteria | 998 |
| 262 | Ga0268264_10002308 | 3300028381 | Bacteria | 16874 |
| 263 | Ga0268264_10002751 | 3300028381 | Bacteria | 15360 |
| 264 | Ga0314311_1225350 | 3300030733 | Bacteria | 1498 |
| 265 | Ga0316183_1184565 | 3300030742 | Bacteria | 2673 |
| 266 | Ga0316182_1062397 | 3300030745 | Bacteria | 1580 |
| 267 | Ga0265340_10142593 | 3300031247 | Bacteria | 1095 |
| 268 | Ga0265331_10000020 | 3300031250 | Bacteria | 258149 |
| 269 | Ga0265331_10021274 | 3300031250 | Bacteria | 3322 |
| 270 | Ga0265327_10000869 | 3300031251 | Bacteria | 44810 |
| 271 | Ga0307513_10005226 | 3300031456 | Bacteria | 17195 |
| 272 | Ga0307408_100020741 | 3300031548 | Bacteria | 4439 |
| 273 | Ga0307408_100145755 | 3300031548 | Bacteria | 1863 |
| 274 | Ga0307408_100445860 | 3300031548 | Bacteria | 1122 |
| 275 | Ga0265314_10010899 | 3300031711 | Bacteria | 7557 |
| 276 | Ga0265314_10127543 | 3300031711 | Bacteria | 1591 |
| 277 | Ga0307405_10138279 | 3300031731 | Bacteria | 1694 |
| 278 | Ga0307405_10275166 | 3300031731 | Bacteria | 1264 |
| 279 | Ga0307413_10051474 | 3300031824 | Bacteria | 2482 |
| 280 | Ga0307413_10171559 | 3300031824 | Bacteria | 1536 |
| 281 | Ga0307413_10211716 | 3300031824 | Bacteria | 1408 |
| 282 | Ga0307413_10216967 | 3300031824 | Bacteria | 1394 |
| 283 | Ga0307413_10260503 | 3300031824 | Bacteria | 1292 |
| 284 | Ga0307413_10300177 | 3300031824 | Bacteria | 1217 |
| 285 | Ga0307410_10011694 | 3300031852 | Bacteria | 5033 |
| 286 | Ga0307410_10029035 | 3300031852 | Bacteria | 3516 |
| 287 | Ga0307410_10135789 | 3300031852 | Bacteria | 1813 |
| 288 | Ga0307410_10300640 | 3300031852 | Bacteria | 1266 |
| 289 | Ga0307406_10109186 | 3300031901 | Bacteria | 1901 |
| 290 | Ga0307406_10140353 | 3300031901 | Bacteria | 1709 |
| 291 | Ga0307407_10007248 | 3300031903 | Bacteria | 5010 |
| 292 | Ga0307407_10252317 | 3300031903 | Bacteria | 1209 |
| 293 | Ga0307412_10084252 | 3300031911 | Bacteria | 2206 |
| 294 | Ga0307412_10142472 | 3300031911 | Bacteria | 1757 |
| 295 | Ga0307412_10199453 | 3300031911 | Bacteria | 1518 |
| 296 | Ga0307409_100007710 | 3300031995 | Bacteria | 6467 |
| 297 | Ga0307409_100059207 | 3300031995 | Bacteria | 2980 |
| 298 | Ga0307409_100106602 | 3300031995 | Bacteria | 2339 |
| 299 | Ga0307409_100107865 | 3300031995 | Bacteria | 2327 |
| 300 | Ga0307416_100096896 | 3300032002 | Bacteria | 2552 |
| 301 | Ga0307416_100365066 | 3300032002 | Bacteria | 1468 |
| 302 | Ga0307416_100913316 | 3300032002 | Bacteria | 978 |
| 303 | Ga0307416_101174093 | 3300032002 | Bacteria | 873 |
| 304 | Ga0307414_10015043 | 3300032004 | Bacteria | 4661 |
| 305 | Ga0307414_10016847 | 3300032004 | Bacteria | 4456 |
| 306 | Ga0307414_10078454 | 3300032004 | Bacteria | 2407 |
| 307 | Ga0307414_10180666 | 3300032004 | Bacteria | 1696 |
| 308 | Ga0307414_10311430 | 3300032004 | Bacteria | 1336 |
| 309 | Ga0307411_10016586 | 3300032005 | Bacteria | 4171 |
| 310 | Ga0307411_10115829 | 3300032005 | Bacteria | 1928 |
| 311 | Ga0307411_10255307 | 3300032005 | Bacteria | 1381 |
| 312 | Ga0307415_100010576 | 3300032126 | Bacteria | 5232 |
| 313 | Ga0307415_100120992 | 3300032126 | Bacteria | 1963 |
| 314 | Ga0307415_101184000 | 3300032126 | Bacteria | 719 |
| 315 | Ga0373933_0048810 | 3300035724 | Bacteria | 2522 |
| 316 | Ga0373937_0017416 | 3300036401 | Bacteria | 6400 |
| 317 | Ga0395899_0003327 | 3300037312 | Bacteria | 12741 |
| 318 | Ga0395899_0022685 | 3300037312 | Bacteria | 4755 |
| 319 | Ga0395899_0036016 | 3300037312 | Bacteria | 3713 |
| 320 | Ga0395899_0084916 | 3300037312 | Bacteria | 2301 |
| 321 | Ga0395899_0089926 | 3300037312 | Bacteria | 2226 |
| 322 | Ga0395899_0094003 | 3300037312 | Bacteria | 2170 |
| 323 | Ga0395899_0100953 | 3300037312 | Bacteria | 2083 |
| 324 | Ga0395899_0120687 | 3300037312 | Bacteria | 1878 |
| 325 | Ga0395900_0003073 | 3300037418 | Bacteria | 18154 |
| 326 | Ga0395900_0014574 | 3300037418 | Bacteria | 8020 |
| 327 | Ga0395900_0017888 | 3300037418 | Bacteria | 7234 |
| 328 | Ga0395900_0018181 | 3300037418 | Bacteria | 7170 |
| 329 | Ga0395900_0070989 | 3300037418 | Bacteria | 3579 |
| 330 | Ga0395900_0080712 | 3300037418 | Bacteria | 3343 |
| 331 | Ga0395900_0085924 | 3300037418 | Bacteria | 3233 |
| 332 | Ga0395900_0108598 | 3300037418 | Bacteria | 2850 |
| 333 | Ga0395900_0130558 | 3300037418 | Bacteria | 2575 |
| 334 | Ga0395900_0172284 | 3300037418 | Bacteria | 2202 |
| 335 | Ga0395900_0172296 | 3300037418 | Bacteria | 2202 |
| 336 | Ga0395900_0192553 | 3300037418 | Bacteria | 2067 |
| 337 | Ga0395900_0278611 | 3300037418 | Bacteria | 1665 |
| 338 | Ga0395900_0515844 | 3300037418 | Bacteria | 1144 |
| 339 | Ga0395900_0700206 | 3300037418 | Bacteria | 947 |
| 340 | Ga0395900_0830544 | 3300037418 | Bacteria | 850 |
| 341 | Ga0395900_1050989 | 3300037418 | Bacteria | 733 |
| 342 | Ga0395898_0035179 | 3300037466 | Bacteria | 4985 |
| 343 | Ga0395898_0048695 | 3300037466 | Bacteria | 4154 |
| 344 | Ga0395898_0056562 | 3300037466 | Bacteria | 3823 |
| 345 | Ga0395898_0064297 | 3300037466 | Bacteria | 3558 |
| 346 | Ga0395898_0078115 | 3300037466 | Bacteria | 3194 |
| 347 | Ga0395898_0160724 | 3300037466 | Bacteria | 2148 |
| 348 | Ga0395898_0252888 | 3300037466 | Bacteria | 1680 |
| 349 | Ga0395898_0286793 | 3300037466 | Bacteria | 1570 |
| 350 | Ga0395898_0486298 | 3300037466 | Bacteria | 1174 |
| 351 | Ga0395905_0003006 | 3300037471 | Bacteria | 18282 |
| 352 | Ga0395905_0004108 | 3300037471 | Bacteria | 15252 |
| 353 | Ga0395905_0005974 | 3300037471 | Bacteria | 12329 |
| 354 | Ga0395905_0007579 | 3300037471 | Bacteria | 10784 |
| 355 | Ga0395905_0012053 | 3300037471 | Bacteria | 8334 |
| 356 | Ga0395905_0019827 | 3300037471 | Bacteria | 6372 |
| 357 | Ga0395905_0025027 | 3300037471 | Bacteria | 5630 |
| 358 | Ga0395905_0037015 | 3300037471 | Bacteria | 4583 |
| 359 | Ga0395905_0052370 | 3300037471 | Bacteria | 3821 |
| 360 | Ga0395905_0053499 | 3300037471 | Bacteria | 3778 |
| 361 | Ga0395905_0086422 | 3300037471 | Bacteria | 2939 |
| 362 | Ga0395905_0117483 | 3300037471 | Bacteria | 2499 |
| 363 | Ga0395905_0153732 | 3300037471 | Bacteria | 2164 |
| 364 | Ga0395905_0194575 | 3300037471 | Bacteria | 1901 |
| 365 | Ga0395905_0290612 | 3300037471 | Bacteria | 1521 |
| 366 | Ga0395905_0322958 | 3300037471 | Bacteria | 1433 |
| 367 | Ga0395905_0556902 | 3300037471 | Bacteria | 1048 |
| 368 | Ga0395901_0012271 | 3300038443 | Bacteria | 8696 |
| 369 | Ga0395901_0014166 | 3300038443 | Bacteria | 8119 |
| 370 | Ga0395901_0014621 | 3300038443 | Bacteria | 7977 |
| 371 | Ga0395901_0042144 | 3300038443 | Bacteria | 4732 |
| 372 | Ga0395901_0045192 | 3300038443 | Bacteria | 4569 |
| 373 | Ga0395901_0070354 | 3300038443 | Bacteria | 3645 |
| 374 | Ga0395901_0093445 | 3300038443 | Bacteria | 3149 |
| 375 | Ga0395901_0189021 | 3300038443 | Bacteria | 2160 |
| 376 | Ga0395901_0342794 | 3300038443 | Bacteria | 1543 |
| 377 | Ga0395901_0376558 | 3300038443 | Unclassified | 1462 |
| 378 | Ga0395901_0687742 | 3300038443 | Bacteria | 1022 |
| 379 | Ga0436361_0278225 | 3300039447 | Bacteria | 1387 |
| 380 | Ga0439458_0000201 | 3300042157 | Bacteria | 13777 |
| 381 | Ga0466969_0003298 | 3300044656 | Bacteria | 8579 |
| 382 | Ga0466966_0000001 | 3300044684 | Bacteria | 410376 |
| 383 | Ga0466966_0008406 | 3300044684 | Bacteria | 6828 |
| 384 | Ga0466966_0021628 | 3300044684 | Bacteria | 4223 |
| 385 | Ga0466966_0164484 | 3300044684 | Bacteria | 1350 |
| 386 | Ga0466961_0010598 | 3300044693 | Bacteria | 5881 |
| 387 | Ga0466961_0023070 | 3300044693 | Bacteria | 4001 |
| 388 | Ga0466963_0039134 | 3300044694 | Bacteria | 3104 |
| 389 | Ga0466963_0077120 | 3300044694 | Bacteria | 2251 |
| 390 | Ga0466963_0150447 | 3300044694 | Bacteria | 1616 |
| 391 | Ga0466964_0248736 | 3300044706 | Unclassified | 875 |
| 392 | Ga0466971_0020307 | 3300044719 | Bacteria | 2953 |
| 393 | Ga0466971_0095590 | 3300044719 | Bacteria | 1362 |
| 394 | Ga0466970_0052170 | 3300044765 | Bacteria | 2183 |
| 395 | Ga0466970_0065666 | 3300044765 | Bacteria | 1947 |
| 396 | Ga0466957_0060194 | 3300044842 | Bacteria | 2328 |
| 397 | Ga0466957_0404899 | 3300044842 | Bacteria | 934 |
| 398 | Ga0466957_0454185 | 3300044842 | Unclassified | 883 |
| 399 | Ga0466959_0023633 | 3300045049 | Bacteria | 4549 |
| 400 | Ga0466959_0031963 | 3300045049 | Bacteria | 3895 |
| 401 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 402 | Ga0466958_0000281 | 3300045836 | Bacteria | 19782 |
| 403 | Ga0466958_0093794 | 3300045836 | Bacteria | 1859 |
| 404 | Ga0466958_0128495 | 3300045836 | Bacteria | 1590 |
| 405 | Ga0466958_0328018 | 3300045836 | Bacteria | 984 |
| 406 | Ga0466967_0954231 | 3300045976 | Bacteria | 853 |
| 407 | Ga0495663_0010363 | 3300046525 | Bacteria | 2592 |
| 408 | Ga0495663_0089012 | 3300046525 | Bacteria | 1004 |
| 409 | Ga0495642_0091478 | 3300046528 | Bacteria | 1288 |
| 410 | Ga0495654_0010002 | 3300046530 | Bacteria | 5180 |
| 411 | Ga0495621_0035718 | 3300046539 | Bacteria | 1722 |
| 412 | Ga0495633_0127230 | 3300046558 | Bacteria | 1179 |
| 413 | Ga0495668_0011758 | 3300046616 | Bacteria | 5222 |
| 414 | Ga0495668_0028910 | 3300046616 | Bacteria | 3133 |
| 415 | Ga0495668_0076653 | 3300046616 | Bacteria | 1835 |
| 416 | Ga0495625_0275959 | 3300046660 | Bacteria | 1083 |
| 417 | Ga0495669_0006918 | 3300046684 | Bacteria | 4751 |
| 418 | Ga0495669_0067851 | 3300046684 | Bacteria | 1622 |
| 419 | Ga0495669_0182097 | 3300046684 | Bacteria | 1002 |
| 420 | Ga0495589_0011649 | 3300046794 | Bacteria | 4565 |
| 421 | Ga0495602_0019233 | 3300048088 | Bacteria | 6790 |
| 422 | Ga0496101_0259588 | 3300048904 | Bacteria | 1355 |
| 423 | Ga0496106_0128932 | 3300048909 | Bacteria | 1982 |
| 424 | Ga0496107_0019944 | 3300048910 | Bacteria | 4734 |
| 425 | Ga0496108_0002291 | 3300048911 | Bacteria | 15334 |
| 426 | Ga0496108_0013000 | 3300048911 | Bacteria | 6782 |
| 427 | Ga0496108_0040562 | 3300048911 | Bacteria | 3881 |
| 428 | Ga0496109_0003046 | 3300048912 | Bacteria | 13969 |
| 429 | Ga0496109_0003157 | 3300048912 | Bacteria | 13734 |
| 430 | Ga0496110_0002679 | 3300048913 | Bacteria | 13443 |
| 431 | Ga0496110_0818909 | 3300048913 | Bacteria | 836 |
| 432 | Ga0496111_0002348 | 3300048914 | Bacteria | 11406 |
| 433 | Ga0496111_0238001 | 3300048914 | Bacteria | 1352 |
| 434 | Ga0496112_0001210 | 3300048915 | Bacteria | 19388 |
| 435 | Ga0496112_0011765 | 3300048915 | Bacteria | 8013 |
| 436 | Ga0496113_0013293 | 3300048916 | Bacteria | 5570 |
| 437 | Ga0496115_0001130 | 3300048918 | Bacteria | 19264 |
| 438 | Ga0496122_0220668 | 3300048925 | Bacteria | 1088 |
| 439 | Ga0496123_0152245 | 3300048926 | Bacteria | 1246 |
| 440 | Ga0496124_0426401 | 3300048927 | Bacteria | 912 |
| 441 | Ga0496126_0002015 | 3300048929 | Bacteria | 28714 |
| 442 | Ga0501032_0077365 | 3300049569 | Bacteria | 2215 |
| 443 | Ga0501033_0005866 | 3300049570 | Bacteria | 9654 |
| 444 | Ga0501034_0002130 | 3300049571 | Bacteria | 24593 |
| 445 | Ga0501034_0058816 | 3300049571 | Bacteria | 3861 |
| 446 | Ga0501036_0323002 | 3300049572 | Bacteria | 1289 |
| 447 | Ga0501038_0055680 | 3300049574 | Bacteria | 3397 |
| 448 | Ga0501039_0169233 | 3300049575 | Bacteria | 1718 |
| 449 | Ga0501042_0087687 | 3300049578 | Bacteria | 2233 |
| 450 | Ga0501046_0114192 | 3300049580 | Bacteria | 2060 |
| 451 | Ga0501046_0136745 | 3300049580 | Bacteria | 1856 |
| 452 | Ga0501047_0097660 | 3300049581 | Bacteria | 2815 |
| 453 | Ga0501047_0267161 | 3300049581 | Bacteria | 1557 |
| 454 | Ga0501068_0056564 | 3300049584 | Bacteria | 2378 |
| 455 | Ga0501069_0095164 | 3300049585 | Bacteria | 1687 |
| 456 | Ga0501070_0071776 | 3300049586 | Bacteria | 2866 |
| 457 | Ga0501073_0045022 | 3300049589 | Bacteria | 3109 |
| 458 | Ga0501223_000367 | 3300049663 | Bacteria | 11110 |
| 459 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 460 | Ga0501233_000183 | 3300049668 | Bacteria | 9154 |
| 461 | Ga0501234_007228 | 3300049707 | Bacteria | 1738 |
| 462 | Ga0501080_0296678 | 3300049742 | Bacteria | 1467 |
| 463 | Ga0501081_0383348 | 3300049743 | Unclassified | 1039 |
| 464 | Ga0501035_0060114 | 3300049822 | Bacteria | 3383 |
| 465 | Ga0501044_0063974 | 3300049823 | Bacteria | 3756 |
| 466 | Ga0501045_0184334 | 3300049824 | Bacteria | 1555 |
| 467 | Ga0501226_000191 | 3300049853 | Bacteria | 9822 |
| 468 | nmdc:mga07m45_186491_c1 | 3300050496 | Bacteria | 1206 |
| 469 | Ga0500562_045540 | 3300053108 | Bacteria | 1169 |
| 470 | Ga0500592_001060 | 3300053116 | Bacteria | 4499 |
| 471 | Ga0500595_002230 | 3300053119 | Bacteria | 9841 |
| 472 | Ga0500559_0224129 | 3300053136 | Bacteria | 886 |
| 473 | Ga0500627_0000889 | 3300053158 | Bacteria | 8007 |
| 474 | Ga0466962_0049177 | 3300061719 | Bacteria | 2015 |
| 475 | Ga0466962_0297413 | 3300061719 | Bacteria | 798 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_11012889 | Ga0157375_110128892 | 175 |
| 2 | 3300005458 | Ga0070681_10045388 | Ga0070681_100453885 | 176 |
| 3 | 3300025912 | Ga0207707_10110130 | Ga0207707_101101303 | 176 |
| 4 | 3300025933 | Ga0207706_10000920 | Ga0207706_1000092017 | 176 |
| 5 | 3300037312 | Ga0395899_0084916 | Ga0395899_0084916_720_1385 | 185 |
| 6 | 3300037418 | Ga0395900_0108598 | Ga0395900_0108598_609_1274 | 185 |
| 7 | 3300049578 | Ga0501042_0087687 | Ga0501042_0087687_966_1640 | 185 |
| 8 | 3300049743 | Ga0501081_0383348 | Ga0501081_0383348_91_765 | 185 |
| 9 | 3300049824 | Ga0501045_0184334 | Ga0501045_0184334_796_1470 | 185 |
| 10 | 3300031711 | Ga0265314_10127543 | Ga0265314_101275433 | 192 |
| 11 | 3300037471 | Ga0395905_0153732 | Ga0395905_0153732_387_1082 | 196 |
| 12 | 3300009093 | Ga0105240_10556578 | Ga0105240_105565781 | 200 |
| 13 | 3300044684 | Ga0466966_0000001 | Ga0466966_0000001_246380_246997 | 200 |
| 14 | 3300001904 | JGI24736J21556_1000458 | JGI24736J21556_10004584 | 203 |
| 15 | 3300001979 | JGI24740J21852_10004923 | JGI24740J21852_100049232 | 203 |
| 16 | 3300003323 | rootH1_10152439 | rootH1_101524391 | 203 |
| 17 | 3300005331 | Ga0070670_100150058 | Ga0070670_1001500583 | 203 |
| 18 | 3300005339 | Ga0070660_100004038 | Ga0070660_10000403812 | 203 |
| 19 | 3300005339 | Ga0070660_100173617 | Ga0070660_1001736173 | 203 |
| 20 | 3300005344 | Ga0070661_100001752 | Ga0070661_1000017522 | 203 |
| 21 | 3300005353 | Ga0070669_100053045 | Ga0070669_1000530453 | 203 |
| 22 | 3300005354 | Ga0070675_100079783 | Ga0070675_1000797833 | 203 |
| 23 | 3300005354 | Ga0070675_100374627 | Ga0070675_1003746272 | 203 |
| 24 | 3300005457 | Ga0070662_100415892 | Ga0070662_1004158921 | 203 |
| 25 | 3300005578 | Ga0068854_100004251 | Ga0068854_10000425111 | 203 |
| 26 | 3300005578 | Ga0068854_100770042 | Ga0068854_1007700421 | 203 |
| 27 | 3300005614 | Ga0068856_100339871 | Ga0068856_1003398713 | 203 |
| 28 | 3300005614 | Ga0068856_100818848 | Ga0068856_1008188481 | 203 |
| 29 | 3300025315 | Ga0207697_10028378 | Ga0207697_100283784 | 203 |
| 30 | 3300025904 | Ga0207647_10011905 | Ga0207647_100119056 | 203 |
| 31 | 3300025909 | Ga0207705_10010133 | Ga0207705_1001013310 | 203 |
| 32 | 3300025913 | Ga0207695_10001859 | Ga0207695_1000185917 | 203 |
| 33 | 3300025913 | Ga0207695_10021549 | Ga0207695_100215496 | 203 |
| 34 | 3300025915 | Ga0207693_10097682 | Ga0207693_100976823 | 203 |
| 35 | 3300025919 | Ga0207657_10003172 | Ga0207657_1000317212 | 203 |
| 36 | 3300025926 | Ga0207659_10608600 | Ga0207659_106086002 | 203 |
| 37 | 3300025932 | Ga0207690_10009750 | Ga0207690_100097507 | 203 |
| 38 | 3300025933 | Ga0207706_10178827 | Ga0207706_101788273 | 203 |
| 39 | 3300025940 | Ga0207691_10507424 | Ga0207691_105074242 | 203 |
| 40 | 3300025949 | Ga0207667_10020973 | Ga0207667_1002097310 | 203 |
| 41 | 3300025981 | Ga0207640_10000260 | Ga0207640_1000026020 | 203 |
| 42 | 3300025981 | Ga0207640_10130616 | Ga0207640_101306161 | 203 |
| 43 | 3300026067 | Ga0207678_10005397 | Ga0207678_100053977 | 203 |
| 44 | 3300026078 | Ga0207702_10113830 | Ga0207702_101138302 | 203 |
| 45 | 3300026116 | Ga0207674_10125499 | Ga0207674_101254992 | 203 |
| 46 | 3300031548 | Ga0307408_100020741 | Ga0307408_1000207413 | 203 |
| 47 | 3300031824 | Ga0307413_10051474 | Ga0307413_100514742 | 203 |
| 48 | 3300031824 | Ga0307413_10171559 | Ga0307413_101715592 | 203 |
| 49 | 3300031852 | Ga0307410_10300640 | Ga0307410_103006401 | 203 |
| 50 | 3300031903 | Ga0307407_10252317 | Ga0307407_102523172 | 203 |
| 51 | 3300031995 | Ga0307409_100107865 | Ga0307409_1001078652 | 203 |
| 52 | 3300032004 | Ga0307414_10311430 | Ga0307414_103114302 | 203 |
| 53 | 3300032005 | Ga0307411_10255307 | Ga0307411_102553071 | 203 |
| 54 | 3300037418 | Ga0395900_0700206 | Ga0395900_0700206_38_673 | 203 |
| 55 | iso_pu_bacteria | 2928526807 | 2928528473 | 203 |
| 56 | 3300001979 | JGI24740J21852_10020181 | JGI24740J21852_100201812 | 204 |
| 57 | 3300001979 | JGI24740J21852_10049214 | JGI24740J21852_100492142 | 204 |
| 58 | 3300001990 | JGI24737J22298_10010040 | JGI24737J22298_100100403 | 204 |
| 59 | 3300001990 | JGI24737J22298_10025276 | JGI24737J22298_100252761 | 204 |
| 60 | 3300002067 | JGI24735J21928_10003940 | JGI24735J21928_100039406 | 204 |
| 61 | 3300002067 | JGI24735J21928_10044593 | JGI24735J21928_100445932 | 204 |
| 62 | 3300005327 | Ga0070658_10069571 | Ga0070658_100695711 | 204 |
| 63 | 3300005327 | Ga0070658_10084531 | Ga0070658_100845312 | 204 |
| 64 | 3300005327 | Ga0070658_10110755 | Ga0070658_101107552 | 204 |
| 65 | 3300005329 | Ga0070683_100135987 | Ga0070683_1001359872 | 204 |
| 66 | 3300005329 | Ga0070683_100197311 | Ga0070683_1001973114 | 204 |
| 67 | 3300005333 | Ga0070677_10036575 | Ga0070677_100365752 | 204 |
| 68 | 3300005334 | Ga0068869_100348593 | Ga0068869_1003485931 | 204 |
| 69 | 3300005336 | Ga0070680_100028641 | Ga0070680_1000286412 | 204 |
| 70 | 3300005338 | Ga0068868_100094302 | Ga0068868_1000943022 | 204 |
| 71 | 3300005339 | Ga0070660_100079246 | Ga0070660_1000792463 | 204 |
| 72 | 3300005339 | Ga0070660_100252499 | Ga0070660_1002524991 | 204 |
| 73 | 3300005339 | Ga0070660_100264823 | Ga0070660_1002648232 | 204 |
| 74 | 3300005339 | Ga0070660_100830395 | Ga0070660_1008303951 | 204 |
| 75 | 3300005340 | Ga0070689_100800056 | Ga0070689_1008000561 | 204 |
| 76 | 3300005341 | Ga0070691_10011238 | Ga0070691_100112382 | 204 |
| 77 | 3300005344 | Ga0070661_100007298 | Ga0070661_1000072989 | 204 |
| 78 | 3300005344 | Ga0070661_100094810 | Ga0070661_1000948102 | 204 |
| 79 | 3300005347 | Ga0070668_100062336 | Ga0070668_1000623363 | 204 |
| 80 | 3300005353 | Ga0070669_100055238 | Ga0070669_1000552384 | 204 |
| 81 | 3300005354 | Ga0070675_100127814 | Ga0070675_1001278143 | 204 |
| 82 | 3300005355 | Ga0070671_100041419 | Ga0070671_1000414192 | 204 |
| 83 | 3300005355 | Ga0070671_100073478 | Ga0070671_1000734782 | 204 |
| 84 | 3300005366 | Ga0070659_100012271 | Ga0070659_1000122715 | 204 |
| 85 | 3300005366 | Ga0070659_100312928 | Ga0070659_1003129282 | 204 |
| 86 | 3300005367 | Ga0070667_100067450 | Ga0070667_1000674502 | 204 |
| 87 | 3300005367 | Ga0070667_100362779 | Ga0070667_1003627792 | 204 |
| 88 | 3300005435 | Ga0070714_100044626 | Ga0070714_1000446262 | 204 |
| 89 | 3300005435 | Ga0070714_100174987 | Ga0070714_1001749872 | 204 |
| 90 | 3300005455 | Ga0070663_100070851 | Ga0070663_1000708512 | 204 |
| 91 | 3300005455 | Ga0070663_100152726 | Ga0070663_1001527262 | 204 |
| 92 | 3300005457 | Ga0070662_100011232 | Ga0070662_1000112327 | 204 |
| 93 | 3300005457 | Ga0070662_100052264 | Ga0070662_1000522644 | 204 |
| 94 | 3300005457 | Ga0070662_100136175 | Ga0070662_1001361752 | 204 |
| 95 | 3300005458 | Ga0070681_10392441 | Ga0070681_103924412 | 204 |
| 96 | 3300005530 | Ga0070679_100212360 | Ga0070679_1002123604 | 204 |
| 97 | 3300005535 | Ga0070684_100146000 | Ga0070684_1001460002 | 204 |
| 98 | 3300005539 | Ga0068853_100020412 | Ga0068853_1000204125 | 204 |
| 99 | 3300005539 | Ga0068853_100031229 | Ga0068853_1000312296 | 204 |
| 100 | 3300005539 | Ga0068853_100043581 | Ga0068853_1000435817 | 204 |
| 101 | 3300005543 | Ga0070672_100186843 | Ga0070672_1001868432 | 204 |
| 102 | 3300005548 | Ga0070665_100007276 | Ga0070665_1000072763 | 204 |
| 103 | 3300005548 | Ga0070665_100200794 | Ga0070665_1002007942 | 204 |
| 104 | 3300005563 | Ga0068855_100478182 | Ga0068855_1004781822 | 204 |
| 105 | 3300005564 | Ga0070664_100011210 | Ga0070664_1000112106 | 204 |
| 106 | 3300005577 | Ga0068857_100028699 | Ga0068857_1000286992 | 204 |
| 107 | 3300005578 | Ga0068854_100018212 | Ga0068854_1000182126 | 204 |
| 108 | 3300005614 | Ga0068856_100007943 | Ga0068856_10000794311 | 204 |
| 109 | 3300005614 | Ga0068856_100071995 | Ga0068856_1000719951 | 204 |
| 110 | 3300005614 | Ga0068856_100086923 | Ga0068856_1000869232 | 204 |
| 111 | 3300005618 | Ga0068864_100001105 | Ga0068864_10000110516 | 204 |
| 112 | 3300005618 | Ga0068864_100010992 | Ga0068864_1000109927 | 204 |
| 113 | 3300005718 | Ga0068866_10139064 | Ga0068866_101390642 | 204 |
| 114 | 3300005841 | Ga0068863_100019009 | Ga0068863_1000190096 | 204 |
| 115 | 3300005843 | Ga0068860_100120291 | Ga0068860_1001202914 | 204 |
| 116 | 3300005844 | Ga0068862_100014177 | Ga0068862_1000141777 | 204 |
| 117 | 3300005844 | Ga0068862_100041438 | Ga0068862_1000414381 | 204 |
| 118 | 3300006358 | Ga0068871_100150217 | Ga0068871_1001502172 | 204 |
| 119 | 3300006881 | Ga0068865_100142304 | Ga0068865_1001423044 | 204 |
| 120 | 3300009093 | Ga0105240_10028067 | Ga0105240_100280679 | 204 |
| 121 | 3300009094 | Ga0111539_10386723 | Ga0111539_103867231 | 204 |
| 122 | 3300009148 | Ga0105243_10017813 | Ga0105243_100178134 | 204 |
| 123 | 3300009174 | Ga0105241_10147136 | Ga0105241_101471362 | 204 |
| 124 | 3300009174 | Ga0105241_10367059 | Ga0105241_103670593 | 204 |
| 125 | 3300009177 | Ga0105248_10025650 | Ga0105248_100256502 | 204 |
| 126 | 3300009177 | Ga0105248_10081532 | Ga0105248_100815322 | 204 |
| 127 | 3300009551 | Ga0105238_10377741 | Ga0105238_103777413 | 204 |
| 128 | 3300009551 | Ga0105238_10460163 | Ga0105238_104601631 | 204 |
| 129 | 3300013100 | Ga0157373_10014018 | Ga0157373_100140184 | 204 |
| 130 | 3300013100 | Ga0157373_10053279 | Ga0157373_100532792 | 204 |
| 131 | 3300013100 | Ga0157373_10083688 | Ga0157373_100836884 | 204 |
| 132 | 3300013100 | Ga0157373_10095064 | Ga0157373_100950642 | 204 |
| 133 | 3300013100 | Ga0157373_10349771 | Ga0157373_103497711 | 204 |
| 134 | 3300013102 | Ga0157371_10063498 | Ga0157371_100634982 | 204 |
| 135 | 3300013102 | Ga0157371_10147436 | Ga0157371_101474364 | 204 |
| 136 | 3300013102 | Ga0157371_10176559 | Ga0157371_101765591 | 204 |
| 137 | 3300013102 | Ga0157371_10176678 | Ga0157371_101766781 | 204 |
| 138 | 3300013104 | Ga0157370_10007637 | Ga0157370_1000763710 | 204 |
| 139 | 3300013104 | Ga0157370_10007721 | Ga0157370_1000772112 | 204 |
| 140 | 3300013104 | Ga0157370_10062685 | Ga0157370_100626853 | 204 |
| 141 | 3300013104 | Ga0157370_10068173 | Ga0157370_100681735 | 204 |
| 142 | 3300013104 | Ga0157370_10121075 | Ga0157370_101210753 | 204 |
| 143 | 3300013105 | Ga0157369_10010712 | Ga0157369_1001071213 | 204 |
| 144 | 3300013105 | Ga0157369_10102647 | Ga0157369_101026473 | 204 |
| 145 | 3300013105 | Ga0157369_10172849 | Ga0157369_101728496 | 204 |
| 146 | 3300013105 | Ga0157369_10184226 | Ga0157369_101842262 | 204 |
| 147 | 3300013105 | Ga0157369_10349735 | Ga0157369_103497352 | 204 |
| 148 | 3300013306 | Ga0163162_10302177 | Ga0163162_103021773 | 204 |
| 149 | 3300013307 | Ga0157372_10014336 | Ga0157372_100143367 | 204 |
| 150 | 3300013307 | Ga0157372_10110780 | Ga0157372_101107804 | 204 |
| 151 | 3300013307 | Ga0157372_10367412 | Ga0157372_103674122 | 204 |
| 152 | 3300013308 | Ga0157375_10066063 | Ga0157375_100660632 | 204 |
| 153 | 3300013308 | Ga0157375_11389172 | Ga0157375_113891721 | 204 |
| 154 | 3300014326 | Ga0157380_10209029 | Ga0157380_102090294 | 204 |
| 155 | 3300014326 | Ga0157380_10232345 | Ga0157380_102323452 | 204 |
| 156 | 3300025321 | Ga0207656_10116322 | Ga0207656_101163222 | 204 |
| 157 | 3300025899 | Ga0207642_10100452 | Ga0207642_101004522 | 204 |
| 158 | 3300025901 | Ga0207688_10014422 | Ga0207688_100144226 | 204 |
| 159 | 3300025904 | Ga0207647_10002253 | Ga0207647_1000225316 | 204 |
| 160 | 3300025904 | Ga0207647_10012651 | Ga0207647_100126514 | 204 |
| 161 | 3300025907 | Ga0207645_10031820 | Ga0207645_100318204 | 204 |
| 162 | 3300025909 | Ga0207705_10082101 | Ga0207705_100821012 | 204 |
| 163 | 3300025911 | Ga0207654_10330956 | Ga0207654_103309561 | 204 |
| 164 | 3300025912 | Ga0207707_10281119 | Ga0207707_102811193 | 204 |
| 165 | 3300025913 | Ga0207695_10012204 | Ga0207695_100122049 | 204 |
| 166 | 3300025919 | Ga0207657_10003570 | Ga0207657_100035705 | 204 |
| 167 | 3300025919 | Ga0207657_10024573 | Ga0207657_100245733 | 204 |
| 168 | 3300025919 | Ga0207657_10236893 | Ga0207657_102368932 | 204 |
| 169 | 3300025920 | Ga0207649_10000285 | Ga0207649_1000028539 | 204 |
| 170 | 3300025920 | Ga0207649_10012781 | Ga0207649_100127816 | 204 |
| 171 | 3300025920 | Ga0207649_10019105 | Ga0207649_100191055 | 204 |
| 172 | 3300025920 | Ga0207649_10128443 | Ga0207649_101284432 | 204 |
| 173 | 3300025921 | Ga0207652_10228711 | Ga0207652_102287112 | 204 |
| 174 | 3300025923 | Ga0207681_10107174 | Ga0207681_101071743 | 204 |
| 175 | 3300025924 | Ga0207694_10041889 | Ga0207694_100418896 | 204 |
| 176 | 3300025924 | Ga0207694_10123150 | Ga0207694_101231502 | 204 |
| 177 | 3300025924 | Ga0207694_10745564 | Ga0207694_107455641 | 204 |
| 178 | 3300025926 | Ga0207659_10086378 | Ga0207659_100863782 | 204 |
| 179 | 3300025928 | Ga0207700_10131070 | Ga0207700_101310702 | 204 |
| 180 | 3300025929 | Ga0207664_10372257 | Ga0207664_103722572 | 204 |
| 181 | 3300025931 | Ga0207644_10006412 | Ga0207644_1000641210 | 204 |
| 182 | 3300025931 | Ga0207644_10043358 | Ga0207644_100433582 | 204 |
| 183 | 3300025931 | Ga0207644_10101049 | Ga0207644_101010491 | 204 |
| 184 | 3300025931 | Ga0207644_10310152 | Ga0207644_103101522 | 204 |
| 185 | 3300025932 | Ga0207690_10035205 | Ga0207690_100352056 | 204 |
| 186 | 3300025932 | Ga0207690_10036083 | Ga0207690_100360831 | 204 |
| 187 | 3300025933 | Ga0207706_10064210 | Ga0207706_100642102 | 204 |
| 188 | 3300025933 | Ga0207706_10576797 | Ga0207706_105767972 | 204 |
| 189 | 3300025940 | Ga0207691_10150751 | Ga0207691_101507513 | 204 |
| 190 | 3300025941 | Ga0207711_10000567 | Ga0207711_1000056725 | 204 |
| 191 | 3300025941 | Ga0207711_10000762 | Ga0207711_1000076226 | 204 |
| 192 | 3300025942 | Ga0207689_10148457 | Ga0207689_101484572 | 204 |
| 193 | 3300025945 | Ga0207679_10024177 | Ga0207679_100241773 | 204 |
| 194 | 3300025949 | Ga0207667_10010740 | Ga0207667_1001074013 | 204 |
| 195 | 3300025949 | Ga0207667_10367635 | Ga0207667_103676352 | 204 |
| 196 | 3300025960 | Ga0207651_10062894 | Ga0207651_100628941 | 204 |
| 197 | 3300025972 | Ga0207668_10038696 | Ga0207668_100386963 | 204 |
| 198 | 3300025981 | Ga0207640_10017180 | Ga0207640_100171803 | 204 |
| 199 | 3300025981 | Ga0207640_10150897 | Ga0207640_101508973 | 204 |
| 200 | 3300025986 | Ga0207658_10195747 | Ga0207658_101957472 | 204 |
| 201 | 3300025986 | Ga0207658_10199817 | Ga0207658_101998172 | 204 |
| 202 | 3300025986 | Ga0207658_10414515 | Ga0207658_104145152 | 204 |
| 203 | 3300026023 | Ga0207677_10163329 | Ga0207677_101633292 | 204 |
| 204 | 3300026041 | Ga0207639_10017393 | Ga0207639_100173933 | 204 |
| 205 | 3300026041 | Ga0207639_10114486 | Ga0207639_101144863 | 204 |
| 206 | 3300026041 | Ga0207639_10225124 | Ga0207639_102251243 | 204 |
| 207 | 3300026067 | Ga0207678_10041420 | Ga0207678_100414205 | 204 |
| 208 | 3300026067 | Ga0207678_10066065 | Ga0207678_100660653 | 204 |
| 209 | 3300026067 | Ga0207678_10354466 | Ga0207678_103544663 | 204 |
| 210 | 3300026067 | Ga0207678_10886798 | Ga0207678_108867981 | 204 |
| 211 | 3300026078 | Ga0207702_10008403 | Ga0207702_1000840310 | 204 |
| 212 | 3300026078 | Ga0207702_10036938 | Ga0207702_100369385 | 204 |
| 213 | 3300026078 | Ga0207702_10037971 | Ga0207702_100379713 | 204 |
| 214 | 3300026078 | Ga0207702_10146951 | Ga0207702_101469514 | 204 |
| 215 | 3300026078 | Ga0207702_10693547 | Ga0207702_106935472 | 204 |
| 216 | 3300026088 | Ga0207641_10005629 | Ga0207641_100056295 | 204 |
| 217 | 3300026095 | Ga0207676_10003955 | Ga0207676_100039558 | 204 |
| 218 | 3300026095 | Ga0207676_10092132 | Ga0207676_100921326 | 204 |
| 219 | 3300026116 | Ga0207674_10002803 | Ga0207674_1000280324 | 204 |
| 220 | 3300026116 | Ga0207674_10005074 | Ga0207674_1000507416 | 204 |
| 221 | 3300026116 | Ga0207674_10081707 | Ga0207674_100817074 | 204 |
| 222 | 3300026142 | Ga0207698_10002590 | Ga0207698_100025908 | 204 |
| 223 | 3300026142 | Ga0207698_10018532 | Ga0207698_100185324 | 204 |
| 224 | 3300026142 | Ga0207698_10223596 | Ga0207698_102235961 | 204 |
| 225 | 3300028379 | Ga0268266_10006044 | Ga0268266_100060443 | 204 |
| 226 | 3300028379 | Ga0268266_10012945 | Ga0268266_100129456 | 204 |
| 227 | 3300028380 | Ga0268265_10005687 | Ga0268265_100056874 | 204 |
| 228 | 3300028380 | Ga0268265_10220119 | Ga0268265_102201191 | 204 |
| 229 | 3300028380 | Ga0268265_10671583 | Ga0268265_106715832 | 204 |
| 230 | 3300028381 | Ga0268264_10002751 | Ga0268264_100027517 | 204 |
| 231 | 3300030733 | Ga0314311_1225350 | Ga0314311_12253502 | 204 |
| 232 | 3300030742 | Ga0316183_1184565 | Ga0316183_11845654 | 204 |
| 233 | 3300030745 | Ga0316182_1062397 | Ga0316182_10623974 | 204 |
| 234 | 3300031548 | Ga0307408_100445860 | Ga0307408_1004458602 | 204 |
| 235 | 3300031731 | Ga0307405_10138279 | Ga0307405_101382792 | 204 |
| 236 | 3300031731 | Ga0307405_10275166 | Ga0307405_102751661 | 204 |
| 237 | 3300031824 | Ga0307413_10211716 | Ga0307413_102117162 | 204 |
| 238 | 3300031824 | Ga0307413_10216967 | Ga0307413_102169671 | 204 |
| 239 | 3300031824 | Ga0307413_10260503 | Ga0307413_102605031 | 204 |
| 240 | 3300031824 | Ga0307413_10300177 | Ga0307413_103001771 | 204 |
| 241 | 3300031852 | Ga0307410_10011694 | Ga0307410_100116942 | 204 |
| 242 | 3300031852 | Ga0307410_10029035 | Ga0307410_100290354 | 204 |
| 243 | 3300031852 | Ga0307410_10135789 | Ga0307410_101357893 | 204 |
| 244 | 3300031901 | Ga0307406_10109186 | Ga0307406_101091861 | 204 |
| 245 | 3300031903 | Ga0307407_10007248 | Ga0307407_100072482 | 204 |
| 246 | 3300031911 | Ga0307412_10142472 | Ga0307412_101424722 | 204 |
| 247 | 3300031911 | Ga0307412_10199453 | Ga0307412_101994532 | 204 |
| 248 | 3300031995 | Ga0307409_100007710 | Ga0307409_1000077107 | 204 |
| 249 | 3300031995 | Ga0307409_100059207 | Ga0307409_1000592074 | 204 |
| 250 | 3300031995 | Ga0307409_100106602 | Ga0307409_1001066022 | 204 |
| 251 | 3300032002 | Ga0307416_100096896 | Ga0307416_1000968964 | 204 |
| 252 | 3300032002 | Ga0307416_100365066 | Ga0307416_1003650663 | 204 |
| 253 | 3300032002 | Ga0307416_100913316 | Ga0307416_1009133162 | 204 |
| 254 | 3300032002 | Ga0307416_101174093 | Ga0307416_1011740931 | 204 |
| 255 | 3300032004 | Ga0307414_10015043 | Ga0307414_100150432 | 204 |
| 256 | 3300032004 | Ga0307414_10078454 | Ga0307414_100784544 | 204 |
| 257 | 3300032004 | Ga0307414_10180666 | Ga0307414_101806662 | 204 |
| 258 | 3300032005 | Ga0307411_10016586 | Ga0307411_100165861 | 204 |
| 259 | 3300032005 | Ga0307411_10115829 | Ga0307411_101158291 | 204 |
| 260 | 3300032126 | Ga0307415_100010576 | Ga0307415_1000105762 | 204 |
| 261 | 3300032126 | Ga0307415_100120992 | Ga0307415_1001209922 | 204 |
| 262 | 3300032126 | Ga0307415_101184000 | Ga0307415_1011840001 | 204 |
| 263 | 3300035724 | Ga0373933_0048810 | Ga0373933_0048810_374_1000 | 204 |
| 264 | 3300036401 | Ga0373937_0017416 | Ga0373937_0017416_4284_4910 | 204 |
| 265 | 3300037312 | Ga0395899_0003327 | Ga0395899_0003327_506_1186 | 204 |
| 266 | 3300037312 | Ga0395899_0022685 | Ga0395899_0022685_1426_2106 | 204 |
| 267 | 3300037312 | Ga0395899_0036016 | Ga0395899_0036016_2143_2808 | 204 |
| 268 | 3300037312 | Ga0395899_0089926 | Ga0395899_0089926_42_740 | 204 |
| 269 | 3300037312 | Ga0395899_0094003 | Ga0395899_0094003_77_742 | 204 |
| 270 | 3300037312 | Ga0395899_0100953 | Ga0395899_0100953_100_726 | 204 |
| 271 | 3300037312 | Ga0395899_0120687 | Ga0395899_0120687_447_1073 | 204 |
| 272 | 3300037418 | Ga0395900_0003073 | Ga0395900_0003073_17140_17808 | 204 |
| 273 | 3300037418 | Ga0395900_0014574 | Ga0395900_0014574_5291_5944 | 204 |
| 274 | 3300037418 | Ga0395900_0017888 | Ga0395900_0017888_4838_5503 | 204 |
| 275 | 3300037418 | Ga0395900_0018181 | Ga0395900_0018181_3072_3725 | 204 |
| 276 | 3300037418 | Ga0395900_0070989 | Ga0395900_0070989_2588_3292 | 204 |
| 277 | 3300037418 | Ga0395900_0080712 | Ga0395900_0080712_1518_2147 | 204 |
| 278 | 3300037418 | Ga0395900_0085924 | Ga0395900_0085924_1985_2647 | 204 |
| 279 | 3300037418 | Ga0395900_0130558 | Ga0395900_0130558_1158_1820 | 204 |
| 280 | 3300037418 | Ga0395900_0172284 | Ga0395900_0172284_18_716 | 204 |
| 281 | 3300037418 | Ga0395900_0172296 | Ga0395900_0172296_1487_2185 | 204 |
| 282 | 3300037418 | Ga0395900_0192553 | Ga0395900_0192553_534_1214 | 204 |
| 283 | 3300037418 | Ga0395900_0278611 | Ga0395900_0278611_220_885 | 204 |
| 284 | 3300037418 | Ga0395900_0515844 | Ga0395900_0515844_260_928 | 204 |
| 285 | 3300037418 | Ga0395900_0830544 | Ga0395900_0830544_80_745 | 204 |
| 286 | 3300037418 | Ga0395900_1050989 | Ga0395900_1050989_34_666 | 204 |
| 287 | 3300037466 | Ga0395898_0035179 | Ga0395898_0035179_1632_2300 | 204 |
| 288 | 3300037466 | Ga0395898_0048695 | Ga0395898_0048695_42_740 | 204 |
| 289 | 3300037466 | Ga0395898_0056562 | Ga0395898_0056562_268_972 | 204 |
| 290 | 3300037466 | Ga0395898_0064297 | Ga0395898_0064297_657_1337 | 204 |
| 291 | 3300037466 | Ga0395898_0078115 | Ga0395898_0078115_1437_2102 | 204 |
| 292 | 3300037466 | Ga0395898_0160724 | Ga0395898_0160724_794_1459 | 204 |
| 293 | 3300037466 | Ga0395898_0252888 | Ga0395898_0252888_782_1462 | 204 |
| 294 | 3300037466 | Ga0395898_0286793 | Ga0395898_0286793_831_1529 | 204 |
| 295 | 3300037466 | Ga0395898_0486298 | Ga0395898_0486298_339_1001 | 204 |
| 296 | 3300037471 | Ga0395905_0003006 | Ga0395905_0003006_1056_1724 | 204 |
| 297 | 3300037471 | Ga0395905_0004108 | Ga0395905_0004108_8015_8677 | 204 |
| 298 | 3300037471 | Ga0395905_0005974 | Ga0395905_0005974_3368_4021 | 204 |
| 299 | 3300037471 | Ga0395905_0007579 | Ga0395905_0007579_7149_7814 | 204 |
| 300 | 3300037471 | Ga0395905_0012053 | Ga0395905_0012053_3464_4090 | 204 |
| 301 | 3300037471 | Ga0395905_0019827 | Ga0395905_0019827_3866_4528 | 204 |
| 302 | 3300037471 | Ga0395905_0025027 | Ga0395905_0025027_1724_2350 | 204 |
| 303 | 3300037471 | Ga0395905_0037015 | Ga0395905_0037015_1315_1968 | 204 |
| 304 | 3300037471 | Ga0395905_0053499 | Ga0395905_0053499_792_1421 | 204 |
| 305 | 3300037471 | Ga0395905_0086422 | Ga0395905_0086422_1899_2654 | 204 |
| 306 | 3300037471 | Ga0395905_0117483 | Ga0395905_0117483_1079_1741 | 204 |
| 307 | 3300037471 | Ga0395905_0194575 | Ga0395905_0194575_348_1013 | 204 |
| 308 | 3300037471 | Ga0395905_0290612 | Ga0395905_0290612_213_917 | 204 |
| 309 | 3300037471 | Ga0395905_0322958 | Ga0395905_0322958_435_1061 | 204 |
| 310 | 3300037471 | Ga0395905_0556902 | Ga0395905_0556902_142_807 | 204 |
| 311 | 3300038443 | Ga0395901_0012271 | Ga0395901_0012271_2451_3116 | 204 |
| 312 | 3300038443 | Ga0395901_0014166 | Ga0395901_0014166_2283_2936 | 204 |
| 313 | 3300038443 | Ga0395901_0014621 | Ga0395901_0014621_1027_1653 | 204 |
| 314 | 3300038443 | Ga0395901_0042144 | Ga0395901_0042144_24_686 | 204 |
| 315 | 3300038443 | Ga0395901_0045192 | Ga0395901_0045192_1254_1907 | 204 |
| 316 | 3300038443 | Ga0395901_0070354 | Ga0395901_0070354_202_882 | 204 |
| 317 | 3300038443 | Ga0395901_0093445 | Ga0395901_0093445_268_972 | 204 |
| 318 | 3300038443 | Ga0395901_0189021 | Ga0395901_0189021_882_1544 | 204 |
| 319 | 3300038443 | Ga0395901_0342794 | Ga0395901_0342794_543_1208 | 204 |
| 320 | 3300038443 | Ga0395901_0376558 | Ga0395901_0376558_80_745 | 204 |
| 321 | 3300038443 | Ga0395901_0687742 | Ga0395901_0687742_250_921 | 204 |
| 322 | 3300042157 | Ga0439458_0000201 | Ga0439458_0000201_5346_6008 | 204 |
| 323 | 3300044656 | Ga0466969_0003298 | Ga0466969_0003298_7346_8026 | 204 |
| 324 | 3300044684 | Ga0466966_0008406 | Ga0466966_0008406_872_1552 | 204 |
| 325 | 3300044684 | Ga0466966_0021628 | Ga0466966_0021628_2931_3596 | 204 |
| 326 | 3300044684 | Ga0466966_0164484 | Ga0466966_0164484_380_1045 | 204 |
| 327 | 3300044693 | Ga0466961_0010598 | Ga0466961_0010598_2816_3481 | 204 |
| 328 | 3300044693 | Ga0466961_0023070 | Ga0466961_0023070_36_716 | 204 |
| 329 | 3300044694 | Ga0466963_0039134 | Ga0466963_0039134_2042_2746 | 204 |
| 330 | 3300044694 | Ga0466963_0077120 | Ga0466963_0077120_989_1669 | 204 |
| 331 | 3300044694 | Ga0466963_0150447 | Ga0466963_0150447_809_1444 | 204 |
| 332 | 3300044706 | Ga0466964_0248736 | Ga0466964_0248736_149_814 | 204 |
| 333 | 3300044719 | Ga0466971_0020307 | Ga0466971_0020307_1499_2164 | 204 |
| 334 | 3300044719 | Ga0466971_0095590 | Ga0466971_0095590_66_746 | 204 |
| 335 | 3300044765 | Ga0466970_0052170 | Ga0466970_0052170_565_1245 | 204 |
| 336 | 3300044765 | Ga0466970_0065666 | Ga0466970_0065666_729_1394 | 204 |
| 337 | 3300044842 | Ga0466957_0060194 | Ga0466957_0060194_625_1305 | 204 |
| 338 | 3300044842 | Ga0466957_0404899 | Ga0466957_0404899_227_895 | 204 |
| 339 | 3300044842 | Ga0466957_0454185 | Ga0466957_0454185_202_864 | 204 |
| 340 | 3300045049 | Ga0466959_0023633 | Ga0466959_0023633_1551_2216 | 204 |
| 341 | 3300045049 | Ga0466959_0031963 | Ga0466959_0031963_3180_3860 | 204 |
| 342 | 3300045836 | Ga0466958_0000281 | Ga0466958_0000281_12576_13256 | 204 |
| 343 | 3300045836 | Ga0466958_0093794 | Ga0466958_0093794_776_1444 | 204 |
| 344 | 3300045836 | Ga0466958_0128495 | Ga0466958_0128495_592_1257 | 204 |
| 345 | 3300045836 | Ga0466958_0328018 | Ga0466958_0328018_264_893 | 204 |
| 346 | 3300045976 | Ga0466967_0954231 | Ga0466967_0954231_177_812 | 204 |
| 347 | 3300046525 | Ga0495663_0089012 | Ga0495663_0089012_106_747 | 204 |
| 348 | 3300046528 | Ga0495642_0091478 | Ga0495642_0091478_445_1086 | 204 |
| 349 | 3300046539 | Ga0495621_0035718 | Ga0495621_0035718_336_965 | 204 |
| 350 | 3300046558 | Ga0495633_0127230 | Ga0495633_0127230_291_920 | 204 |
| 351 | 3300046616 | Ga0495668_0011758 | Ga0495668_0011758_1602_2231 | 204 |
| 352 | 3300046616 | Ga0495668_0076653 | Ga0495668_0076653_931_1560 | 204 |
| 353 | 3300046684 | Ga0495669_0006918 | Ga0495669_0006918_2973_3602 | 204 |
| 354 | 3300046684 | Ga0495669_0067851 | Ga0495669_0067851_301_945 | 204 |
| 355 | 3300046684 | Ga0495669_0182097 | Ga0495669_0182097_227_856 | 204 |
| 356 | 3300048088 | Ga0495602_0019233 | Ga0495602_0019233_5938_6564 | 204 |
| 357 | 3300048904 | Ga0496101_0259588 | Ga0496101_0259588_496_1155 | 204 |
| 358 | 3300048909 | Ga0496106_0128932 | Ga0496106_0128932_1159_1800 | 204 |
| 359 | 3300048910 | Ga0496107_0019944 | Ga0496107_0019944_1819_2460 | 204 |
| 360 | 3300048911 | Ga0496108_0002291 | Ga0496108_0002291_5177_5839 | 204 |
| 361 | 3300048911 | Ga0496108_0013000 | Ga0496108_0013000_5536_6189 | 204 |
| 362 | 3300048911 | Ga0496108_0040562 | Ga0496108_0040562_1629_2270 | 204 |
| 363 | 3300048912 | Ga0496109_0003046 | Ga0496109_0003046_9408_10061 | 204 |
| 364 | 3300048912 | Ga0496109_0003157 | Ga0496109_0003157_10122_10763 | 204 |
| 365 | 3300048913 | Ga0496110_0002679 | Ga0496110_0002679_12164_12805 | 204 |
| 366 | 3300048913 | Ga0496110_0818909 | Ga0496110_0818909_65_721 | 204 |
| 367 | 3300048914 | Ga0496111_0002348 | Ga0496111_0002348_5566_6207 | 204 |
| 368 | 3300048914 | Ga0496111_0238001 | Ga0496111_0238001_96_764 | 204 |
| 369 | 3300048915 | Ga0496112_0001210 | Ga0496112_0001210_1166_1807 | 204 |
| 370 | 3300048915 | Ga0496112_0011765 | Ga0496112_0011765_4040_4693 | 204 |
| 371 | 3300048916 | Ga0496113_0013293 | Ga0496113_0013293_1771_2424 | 204 |
| 372 | 3300049742 | Ga0501080_0296678 | Ga0501080_0296678_696_1328 | 204 |
| 373 | 3300061719 | Ga0466962_0049177 | Ga0466962_0049177_395_1060 | 204 |
| 374 | 3300061719 | Ga0466962_0297413 | Ga0466962_0297413_71_736 | 204 |
| 375 | iso_pu_bacteria | 2896429255 | 2896430926 | 204 |
| 376 | 3300037471 | Ga0395905_0052370 | Ga0395905_0052370_1119_1739 | 206 |
| 377 | iso_pu_bacteria | 2885429604 | 2885430332 | 206 |
| 378 | 2162886006 | SwRhRL3b_contig_2430896 | SwRhRL3b_0957.00001520 | 207 |
| 379 | 3300001979 | JGI24740J21852_10027561 | JGI24740J21852_100275612 | 207 |
| 380 | 3300001989 | JGI24739J22299_10003612 | JGI24739J22299_100036126 | 207 |
| 381 | 3300002774 | JGI25150J39212_1000126 | JGI25150J39212_100012612 | 207 |
| 382 | 3300003215 | JGI25153J46596_10000305 | JGI25153J46596_100003052 | 207 |
| 383 | 3300003771 | Ga0055526_1007718 | Ga0055526_10077184 | 207 |
| 384 | 3300003773 | Ga0055537_1004112 | Ga0055537_10041122 | 207 |
| 385 | 3300003781 | Ga0055536_1019790 | Ga0055536_10197903 | 207 |
| 386 | 3300003792 | Ga0055540_1000521 | Ga0055540_10005213 | 207 |
| 387 | 3300003911 | JGI25405J52794_10005305 | JGI25405J52794_100053052 | 207 |
| 388 | 3300005295 | Ga0065707_10000505 | Ga0065707_1000050549 | 207 |
| 389 | 3300005344 | Ga0070661_100000041 | Ga0070661_10000004161 | 207 |
| 390 | 3300005539 | Ga0068853_100017003 | Ga0068853_1000170035 | 207 |
| 391 | 3300005578 | Ga0068854_100056403 | Ga0068854_1000564032 | 207 |
| 392 | 3300005616 | Ga0068852_100999716 | Ga0068852_1009997161 | 207 |
| 393 | 3300005617 | Ga0068859_100123766 | Ga0068859_1001237662 | 207 |
| 394 | 3300005841 | Ga0068863_100007010 | Ga0068863_1000070105 | 207 |
| 395 | 3300005843 | Ga0068860_100000944 | Ga0068860_10000094426 | 207 |
| 396 | 3300005844 | Ga0068862_100000280 | Ga0068862_10000028027 | 207 |
| 397 | 3300005937 | Ga0081455_10000255 | Ga0081455_1000025568 | 207 |
| 398 | 3300006353 | Ga0075370_10074500 | Ga0075370_100745002 | 207 |
| 399 | 3300006931 | Ga0097620_100123766 | Ga0097620_1001237662 | 207 |
| 400 | 3300009551 | Ga0105238_10267270 | Ga0105238_102672702 | 207 |
| 401 | 3300009553 | Ga0105249_10000103 | Ga0105249_1000010353 | 207 |
| 402 | 3300014326 | Ga0157380_10110229 | Ga0157380_101102292 | 207 |
| 403 | 3300014326 | Ga0157380_10340797 | Ga0157380_103407972 | 207 |
| 404 | 3300014969 | Ga0157376_10138893 | Ga0157376_101388932 | 207 |
| 405 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004180 | 207 |
| 406 | 3300025258 | Ga0209129_1000359 | Ga0209129_10003597 | 207 |
| 407 | 3300025263 | Ga0209565_1000134 | Ga0209565_100013472 | 207 |
| 408 | 3300025292 | Ga0209676_1020341 | Ga0209676_10203412 | 207 |
| 409 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068249 | 207 |
| 410 | 3300025295 | Ga0209564_1001020 | Ga0209564_100102014 | 207 |
| 411 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004148 | 207 |
| 412 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012097 | 207 |
| 413 | 3300025302 | Ga0207426_1025518 | Ga0207426_10255182 | 207 |
| 414 | 3300025303 | Ga0209051_1000232 | Ga0209051_100023230 | 207 |
| 415 | 3300025304 | Ga0209257_1019016 | Ga0209257_10190163 | 207 |
| 416 | 3300025304 | Ga0209257_1019023 | Ga0209257_10190233 | 207 |
| 417 | 3300025920 | Ga0207649_10000968 | Ga0207649_1000096820 | 207 |
| 418 | 3300025924 | Ga0207694_10120918 | Ga0207694_101209182 | 207 |
| 419 | 3300025933 | Ga0207706_10003677 | Ga0207706_1000367718 | 207 |
| 420 | 3300025961 | Ga0207712_10000069 | Ga0207712_1000006955 | 207 |
| 421 | 3300025981 | Ga0207640_10066381 | Ga0207640_100663812 | 207 |
| 422 | 3300026041 | Ga0207639_10288378 | Ga0207639_102883782 | 207 |
| 423 | 3300026088 | Ga0207641_10002917 | Ga0207641_100029176 | 207 |
| 424 | 3300026116 | Ga0207674_10027999 | Ga0207674_100279995 | 207 |
| 425 | 3300026121 | Ga0207683_10301192 | Ga0207683_103011922 | 207 |
| 426 | 3300026142 | Ga0207698_10395844 | Ga0207698_103958441 | 207 |
| 427 | 3300028380 | Ga0268265_10000739 | Ga0268265_1000073925 | 207 |
| 428 | 3300028381 | Ga0268264_10002308 | Ga0268264_100023082 | 207 |
| 429 | 3300031247 | Ga0265340_10142593 | Ga0265340_101425932 | 207 |
| 430 | 3300031250 | Ga0265331_10000020 | Ga0265331_10000020107 | 207 |
| 431 | 3300031250 | Ga0265331_10021274 | Ga0265331_100212742 | 207 |
| 432 | 3300031251 | Ga0265327_10000869 | Ga0265327_1000086927 | 207 |
| 433 | 3300031456 | Ga0307513_10005226 | Ga0307513_100052265 | 207 |
| 434 | 3300031548 | Ga0307408_100145755 | Ga0307408_1001457552 | 207 |
| 435 | 3300031711 | Ga0265314_10010899 | Ga0265314_100108992 | 207 |
| 436 | 3300031901 | Ga0307406_10140353 | Ga0307406_101403532 | 207 |
| 437 | 3300031911 | Ga0307412_10084252 | Ga0307412_100842523 | 207 |
| 438 | 3300032004 | Ga0307414_10016847 | Ga0307414_100168472 | 207 |
| 439 | 3300039447 | Ga0436361_0278225 | Ga0436361_0278225_604_1242 | 207 |
| 440 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_204216_204842 | 207 |
| 441 | 3300046525 | Ga0495663_0010363 | Ga0495663_0010363_411_1034 | 207 |
| 442 | 3300046530 | Ga0495654_0010002 | Ga0495654_0010002_3920_4543 | 207 |
| 443 | 3300046616 | Ga0495668_0028910 | Ga0495668_0028910_1948_2571 | 207 |
| 444 | 3300046660 | Ga0495625_0275959 | Ga0495625_0275959_282_914 | 207 |
| 445 | 3300046794 | Ga0495589_0011649 | Ga0495589_0011649_678_1301 | 207 |
| 446 | 3300048918 | Ga0496115_0001130 | Ga0496115_0001130_14977_15606 | 207 |
| 447 | 3300048925 | Ga0496122_0220668 | Ga0496122_0220668_150_776 | 207 |
| 448 | 3300048926 | Ga0496123_0152245 | Ga0496123_0152245_232_870 | 207 |
| 449 | 3300048927 | Ga0496124_0426401 | Ga0496124_0426401_197_838 | 207 |
| 450 | 3300048929 | Ga0496126_0002015 | Ga0496126_0002015_26643_27308 | 207 |
| 451 | 3300049569 | Ga0501032_0077365 | Ga0501032_0077365_1494_2156 | 207 |
| 452 | 3300049570 | Ga0501033_0005866 | Ga0501033_0005866_3078_3740 | 207 |
| 453 | 3300049571 | Ga0501034_0002130 | Ga0501034_0002130_23284_23919 | 207 |
| 454 | 3300049571 | Ga0501034_0058816 | Ga0501034_0058816_1918_2580 | 207 |
| 455 | 3300049572 | Ga0501036_0323002 | Ga0501036_0323002_267_929 | 207 |
| 456 | 3300049574 | Ga0501038_0055680 | Ga0501038_0055680_1935_2597 | 207 |
| 457 | 3300049575 | Ga0501039_0169233 | Ga0501039_0169233_451_1113 | 207 |
| 458 | 3300049580 | Ga0501046_0114192 | Ga0501046_0114192_83_739 | 207 |
| 459 | 3300049580 | Ga0501046_0136745 | Ga0501046_0136745_994_1656 | 207 |
| 460 | 3300049581 | Ga0501047_0097660 | Ga0501047_0097660_695_1357 | 207 |
| 461 | 3300049581 | Ga0501047_0267161 | Ga0501047_0267161_181_861 | 207 |
| 462 | 3300049584 | Ga0501068_0056564 | Ga0501068_0056564_486_1148 | 207 |
| 463 | 3300049585 | Ga0501069_0095164 | Ga0501069_0095164_119_781 | 207 |
| 464 | 3300049586 | Ga0501070_0071776 | Ga0501070_0071776_776_1438 | 207 |
| 465 | 3300049589 | Ga0501073_0045022 | Ga0501073_0045022_774_1436 | 207 |
| 466 | 3300049663 | Ga0501223_000367 | Ga0501223_000367_869_1504 | 207 |
| 467 | 3300049664 | Ga0501224_000028 | Ga0501224_000028_8324_8959 | 207 |
| 468 | 3300049668 | Ga0501233_000183 | Ga0501233_000183_7820_8455 | 207 |
| 469 | 3300049707 | Ga0501234_007228 | Ga0501234_007228_746_1381 | 207 |
| 470 | 3300049822 | Ga0501035_0060114 | Ga0501035_0060114_1918_2580 | 207 |
| 471 | 3300049823 | Ga0501044_0063974 | Ga0501044_0063974_1406_2068 | 207 |
| 472 | 3300049853 | Ga0501226_000191 | Ga0501226_000191_869_1504 | 207 |
| 473 | 3300050496 | nmdc:mga07m45_186491_c1 | nmdc:mga07m45_186491_c1_283_909 | 207 |
| 474 | 3300053108 | Ga0500562_045540 | Ga0500562_045540_466_1098 | 207 |
| 475 | 3300053116 | Ga0500592_001060 | Ga0500592_001060_554_1177 | 207 |
| 476 | 3300053119 | Ga0500595_002230 | Ga0500595_002230_8774_9415 | 207 |
| 477 | 3300053136 | Ga0500559_0224129 | Ga0500559_0224129_76_717 | 207 |
| 478 | 3300053158 | Ga0500627_0000889 | Ga0500627_0000889_6561_7184 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.9053 | 1 | 200 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.8884 | 2 | 205 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.8785 | 1 | 203 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.8722 | 2 | 205 |
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.8722 | 1 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8544 | 1 | 203 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8353 | 1 | 203 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8324 | 1 | 203 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8207 | 1 | 203 | 3.40.50.300 |
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8164 | 2 | 207 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520GVC1-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9942 | 1 | 134 |
GO:0005524
GO:0036430 GO:0036431 |
| AF-A0A520GVC1-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9796 | 1 | 134 |
GO:0005524
GO:0036430 GO:0036431 |
| AF-A0A7W6RZH5-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9771 | 1 | 205 |
GO:0004127
GO:0005524 GO:0005737 GO:0006220 GO:0016765 |
| AF-A0A1G6Z0F0-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9713 | 1 | 206 |
GO:0005524
GO:0005737 GO:0006220 GO:0016765 GO:0036430 GO:0036431 |
| AF-A0A1Q3JMQ5-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9705 | 1 | 160 |
GO:0004127
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar