F451899

General Info

Members Datasets Scaffolds Average Seq Length
478 227 475 218

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100445860|Ga0307408_1004458602
Length 249
Sequence MRPDRLSLQKWARLAIGARPCQSAASMSSPASPPKSSRPILIAVDGPAASGKGTIARALAQHFGLPHMDTGILYRAVALTMVRFGGDPANEFEAVRACEGTPQVDPTDPDLRTEIVGSIASRISAYPGVRAALLERQRNFAAQPSGAVLDGRDIGTVIAPNATAKLFVTASAEVRARRRVAELLARGIQAHLPDVLIDIRARDERDSGRDTAPLKQAEDADLLDTSEMDIDEAIAAAIELVETRIAARA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
3 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
4 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 3.35
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2430896 2162886006 Bacteria 984
2 JGI24736J21556_1000458 3300001904 Bacteria 7671
3 JGI24740J21852_10004923 3300001979 Bacteria 5681
4 JGI24740J21852_10020181 3300001979 Bacteria 2331
5 JGI24740J21852_10027561 3300001979 Bacteria 1889
6 JGI24740J21852_10049214 3300001979 Bacteria 1219
7 JGI24739J22299_10003612 3300001989 Bacteria 5909
8 JGI24737J22298_10010040 3300001990 Bacteria 3135
9 JGI24737J22298_10025276 3300001990 Bacteria 1878
10 JGI24735J21928_10003940 3300002067 Bacteria 5022
11 JGI24735J21928_10044593 3300002067 Bacteria 1288
12 JGI25150J39212_1000126 3300002774 Bacteria 42982
13 JGI25153J46596_10000305 3300003215 Bacteria 36679
14 rootH1_10152439 3300003323 Bacteria 1215
15 Ga0055526_1007718 3300003771 Bacteria 5523
16 Ga0055537_1004112 3300003773 Bacteria 4251
17 Ga0055536_1019790 3300003781 Bacteria 2103
18 Ga0055540_1000521 3300003792 Bacteria 29043
19 JGI25405J52794_10005305 3300003911 Bacteria 2321
20 Ga0065707_10000505 3300005295 Bacteria 50569
21 Ga0070658_10069571 3300005327 Bacteria 2880
22 Ga0070658_10084531 3300005327 Bacteria 2609
23 Ga0070658_10110755 3300005327 Bacteria 2274
24 Ga0070683_100135987 3300005329 Bacteria 2327
25 Ga0070683_100197311 3300005329 Bacteria 1911
26 Ga0070670_100150058 3300005331 Bacteria 2017
27 Ga0070677_10036575 3300005333 Bacteria 1911
28 Ga0068869_100348593 3300005334 Bacteria 1206
29 Ga0070680_100028641 3300005336 Bacteria 4469
30 Ga0068868_100094302 3300005338 Bacteria 2414
31 Ga0070660_100004038 3300005339 Bacteria 10136
32 Ga0070660_100079246 3300005339 Bacteria 2577
33 Ga0070660_100173617 3300005339 Bacteria 1742
34 Ga0070660_100252499 3300005339 Bacteria 1438
35 Ga0070660_100264823 3300005339 Bacteria 1404
36 Ga0070660_100830395 3300005339 Bacteria 778
37 Ga0070689_100800056 3300005340 Bacteria 829
38 Ga0070691_10011238 3300005341 Bacteria 4085
39 Ga0070661_100000041 3300005344 Bacteria 99916
40 Ga0070661_100001752 3300005344 Bacteria 15061
41 Ga0070661_100007298 3300005344 Bacteria 7622
42 Ga0070661_100094810 3300005344 Bacteria 2212
43 Ga0070668_100062336 3300005347 Bacteria 2889
44 Ga0070669_100053045 3300005353 Bacteria 2968
45 Ga0070669_100055238 3300005353 Bacteria 2910
46 Ga0070675_100079783 3300005354 Bacteria 2727
47 Ga0070675_100127814 3300005354 Bacteria 2164
48 Ga0070675_100374627 3300005354 Bacteria 1266
49 Ga0070671_100041419 3300005355 Bacteria 3828
50 Ga0070671_100073478 3300005355 Bacteria 2856
51 Ga0070659_100012271 3300005366 Bacteria 6354
52 Ga0070659_100312928 3300005366 Bacteria 1311
53 Ga0070667_100067450 3300005367 Bacteria 3042
54 Ga0070667_100362779 3300005367 Bacteria 1313
55 Ga0070714_100044626 3300005435 Bacteria 3753
56 Ga0070714_100174987 3300005435 Bacteria 1950
57 Ga0070663_100070851 3300005455 Bacteria 2536
58 Ga0070663_100152726 3300005455 Bacteria 1772
59 Ga0070662_100011232 3300005457 Bacteria 5903
60 Ga0070662_100052264 3300005457 Bacteria 2952
61 Ga0070662_100136175 3300005457 Bacteria 1899
62 Ga0070662_100415892 3300005457 Unclassified 1111
63 Ga0070681_10045388 3300005458 Bacteria 4397
64 Ga0070681_10392441 3300005458 Bacteria 1299
65 Ga0070679_100212360 3300005530 Bacteria 1899
66 Ga0070684_100146000 3300005535 Bacteria 2141
67 Ga0068853_100017003 3300005539 Bacteria 5997
68 Ga0068853_100020412 3300005539 Bacteria 5510
69 Ga0068853_100031229 3300005539 Bacteria 4505
70 Ga0068853_100043581 3300005539 Bacteria 3838
71 Ga0070672_100186843 3300005543 Bacteria 1728
72 Ga0070665_100007276 3300005548 Bacteria 11250
73 Ga0070665_100200794 3300005548 Bacteria 1994
74 Ga0068855_100478182 3300005563 Bacteria 1356
75 Ga0070664_100011210 3300005564 Bacteria 7270
76 Ga0068857_100028699 3300005577 Bacteria 4909
77 Ga0068854_100004251 3300005578 Bacteria 9020
78 Ga0068854_100018212 3300005578 Bacteria 4712
79 Ga0068854_100056403 3300005578 Bacteria 2831
80 Ga0068854_100770042 3300005578 Bacteria 836
81 Ga0068856_100007943 3300005614 Bacteria 10360
82 Ga0068856_100071995 3300005614 Bacteria 3422
83 Ga0068856_100086923 3300005614 Bacteria 3107
84 Ga0068856_100339871 3300005614 Bacteria 1519
85 Ga0068856_100818848 3300005614 Bacteria 950
86 Ga0068852_100999716 3300005616 Bacteria 855
87 Ga0068859_100123766 3300005617 Bacteria 2653
88 Ga0068864_100001105 3300005618 Bacteria 22558
89 Ga0068864_100010992 3300005618 Bacteria 7485
90 Ga0068866_10139064 3300005718 Bacteria 1392
91 Ga0068863_100007010 3300005841 Bacteria 11048
92 Ga0068863_100019009 3300005841 Bacteria 6576
93 Ga0068860_100000944 3300005843 Bacteria 32201
94 Ga0068860_100120291 3300005843 Bacteria 2514
95 Ga0068862_100000280 3300005844 Bacteria 56780
96 Ga0068862_100014177 3300005844 Bacteria 6609
97 Ga0068862_100041438 3300005844 Bacteria 3917
98 Ga0081455_10000255 3300005937 Bacteria 69927
99 Ga0075370_10074500 3300006353 Bacteria 1945
100 Ga0068871_100150217 3300006358 Bacteria 1986
101 Ga0068865_100142304 3300006881 Bacteria 1810
102 Ga0097620_100123766 3300006931 Bacteria 2653
103 Ga0105240_10028067 3300009093 Bacteria 7359
104 Ga0105240_10556578 3300009093 Bacteria 1268
105 Ga0111539_10386723 3300009094 Bacteria 1629
106 Ga0105243_10017813 3300009148 Bacteria 5374
107 Ga0105241_10147136 3300009174 Bacteria 1923
108 Ga0105241_10367059 3300009174 Bacteria 1254
109 Ga0105248_10025650 3300009177 Bacteria 6555
110 Ga0105248_10081532 3300009177 Bacteria 3636
111 Ga0105238_10267270 3300009551 Bacteria 1691
112 Ga0105238_10377741 3300009551 Bacteria 1408
113 Ga0105238_10460163 3300009551 Bacteria 1270
114 Ga0105249_10000103 3300009553 Bacteria 118397
115 Ga0157373_10014018 3300013100 Bacteria 5877
116 Ga0157373_10053279 3300013100 Bacteria 2877
117 Ga0157373_10083688 3300013100 Bacteria 2249
118 Ga0157373_10095064 3300013100 Bacteria 2098
119 Ga0157373_10349771 3300013100 Bacteria 1054
120 Ga0157371_10063498 3300013102 Bacteria 2617
121 Ga0157371_10147436 3300013102 Bacteria 1677
122 Ga0157371_10176559 3300013102 Bacteria 1527
123 Ga0157371_10176678 3300013102 Bacteria 1527
124 Ga0157370_10007637 3300013104 Bacteria 11739
125 Ga0157370_10007721 3300013104 Bacteria 11663
126 Ga0157370_10062685 3300013104 Bacteria 3525
127 Ga0157370_10068173 3300013104 Bacteria 3362
128 Ga0157370_10121075 3300013104 Bacteria 2443
129 Ga0157369_10010712 3300013105 Bacteria 10433
130 Ga0157369_10102647 3300013105 Bacteria 3047
131 Ga0157369_10172849 3300013105 Bacteria 2276
132 Ga0157369_10184226 3300013105 Bacteria 2196
133 Ga0157369_10349735 3300013105 Bacteria 1535
134 Ga0163162_10302177 3300013306 Bacteria 1732
135 Ga0157372_10014336 3300013307 Bacteria 8475
136 Ga0157372_10110780 3300013307 Bacteria 3144
137 Ga0157372_10367412 3300013307 Bacteria 1676
138 Ga0157375_10066063 3300013308 Bacteria 3609
139 Ga0157375_11012889 3300013308 Bacteria 970
140 Ga0157375_11389172 3300013308 Bacteria 827
141 Ga0157380_10110229 3300014326 Bacteria 2311
142 Ga0157380_10209029 3300014326 Bacteria 1738
143 Ga0157380_10232345 3300014326 Bacteria 1657
144 Ga0157380_10340797 3300014326 Bacteria 1398
145 Ga0157376_10138893 3300014969 Bacteria 2177
146 Ga0207425_1000041 3300025245 Bacteria 210441
147 Ga0209129_1000359 3300025258 Bacteria 37937
148 Ga0209565_1000134 3300025263 Bacteria 104013
149 Ga0209676_1020341 3300025292 Bacteria 2257
150 Ga0209025_1000068 3300025294 Bacteria 294129
151 Ga0209564_1001020 3300025295 Bacteria 34568
152 Ga0209758_1000004 3300025297 Bacteria 1375322
153 Ga0209050_1000001 3300025298 Bacteria 3563507
154 Ga0207426_1025518 3300025302 Bacteria 1989
155 Ga0209051_1000232 3300025303 Bacteria 93680
156 Ga0209257_1019016 3300025304 Bacteria 2608
157 Ga0209257_1019023 3300025304 Bacteria 2607
158 Ga0207697_10028378 3300025315 Bacteria 2289
159 Ga0207656_10116322 3300025321 Bacteria 1241
160 Ga0207642_10100452 3300025899 Bacteria 1451
161 Ga0207688_10014422 3300025901 Bacteria 4296
162 Ga0207647_10002253 3300025904 Bacteria 14695
163 Ga0207647_10011905 3300025904 Bacteria 6077
164 Ga0207647_10012651 3300025904 Bacteria 5866
165 Ga0207645_10031820 3300025907 Bacteria 3392
166 Ga0207705_10010133 3300025909 Bacteria 6861
167 Ga0207705_10082101 3300025909 Bacteria 2350
168 Ga0207654_10330956 3300025911 Bacteria 1044
169 Ga0207707_10110130 3300025912 Bacteria 2407
170 Ga0207707_10281119 3300025912 Bacteria 1442
171 Ga0207695_10001859 3300025913 Bacteria 33075
172 Ga0207695_10012204 3300025913 Bacteria 10320
173 Ga0207695_10021549 3300025913 Bacteria 7349
174 Ga0207693_10097682 3300025915 Bacteria 2303
175 Ga0207657_10003172 3300025919 Bacteria 17595
176 Ga0207657_10003570 3300025919 Bacteria 16599
177 Ga0207657_10024573 3300025919 Bacteria 5574
178 Ga0207657_10236893 3300025919 Bacteria 1458
179 Ga0207649_10000285 3300025920 Bacteria 39556
180 Ga0207649_10000968 3300025920 Bacteria 17785
181 Ga0207649_10012781 3300025920 Bacteria 4670
182 Ga0207649_10019105 3300025920 Bacteria 3912
183 Ga0207649_10128443 3300025920 Bacteria 1718
184 Ga0207652_10228711 3300025921 Bacteria 1676
185 Ga0207681_10107174 3300025923 Bacteria 2026
186 Ga0207694_10041889 3300025924 Bacteria 3530
187 Ga0207694_10120918 3300025924 Bacteria 2091
188 Ga0207694_10123150 3300025924 Bacteria 2072
189 Ga0207694_10745564 3300025924 Bacteria 826
190 Ga0207659_10086378 3300025926 Bacteria 2332
191 Ga0207659_10608600 3300025926 Bacteria 932
192 Ga0207700_10131070 3300025928 Bacteria 2047
193 Ga0207664_10372257 3300025929 Bacteria 1267
194 Ga0207644_10006412 3300025931 Bacteria 7667
195 Ga0207644_10043358 3300025931 Bacteria 3192
196 Ga0207644_10101049 3300025931 Bacteria 2166
197 Ga0207644_10310152 3300025931 Bacteria 1274
198 Ga0207690_10009750 3300025932 Bacteria 5705
199 Ga0207690_10035205 3300025932 Bacteria 3232
200 Ga0207690_10036083 3300025932 Bacteria 3199
201 Ga0207706_10000920 3300025933 Bacteria 30195
202 Ga0207706_10003677 3300025933 Bacteria 14643
203 Ga0207706_10064210 3300025933 Bacteria 3232
204 Ga0207706_10178827 3300025933 Bacteria 1863
205 Ga0207706_10576797 3300025933 Bacteria 967
206 Ga0207691_10150751 3300025940 Bacteria 2044
207 Ga0207691_10507424 3300025940 Bacteria 1024
208 Ga0207711_10000567 3300025941 Bacteria 37685
209 Ga0207711_10000762 3300025941 Bacteria 31637
210 Ga0207689_10148457 3300025942 Bacteria 1932
211 Ga0207679_10024177 3300025945 Bacteria 4163
212 Ga0207667_10010740 3300025949 Bacteria 10680
213 Ga0207667_10020973 3300025949 Bacteria 7246
214 Ga0207667_10367635 3300025949 Bacteria 1466
215 Ga0207651_10062894 3300025960 Bacteria 2589
216 Ga0207712_10000069 3300025961 Bacteria 127318
217 Ga0207668_10038696 3300025972 Bacteria 3204
218 Ga0207640_10000260 3300025981 Bacteria 35737
219 Ga0207640_10017180 3300025981 Bacteria 4226
220 Ga0207640_10066381 3300025981 Bacteria 2411
221 Ga0207640_10130616 3300025981 Bacteria 1815
222 Ga0207640_10150897 3300025981 Bacteria 1707
223 Ga0207658_10195747 3300025986 Bacteria 1684
224 Ga0207658_10199817 3300025986 Bacteria 1668
225 Ga0207658_10414515 3300025986 Bacteria 1186
226 Ga0207677_10163329 3300026023 Bacteria 1733
227 Ga0207639_10017393 3300026041 Bacteria 5097
228 Ga0207639_10114486 3300026041 Bacteria 2204
229 Ga0207639_10225124 3300026041 Bacteria 1622
230 Ga0207639_10288378 3300026041 Bacteria 1446
231 Ga0207678_10005397 3300026067 Bacteria 11453
232 Ga0207678_10041420 3300026067 Bacteria 3994
233 Ga0207678_10066065 3300026067 Bacteria 3106
234 Ga0207678_10354466 3300026067 Bacteria 1266
235 Ga0207678_10886798 3300026067 Bacteria 789
236 Ga0207702_10008403 3300026078 Bacteria 8712
237 Ga0207702_10036938 3300026078 Bacteria 4086
238 Ga0207702_10037971 3300026078 Bacteria 4034
239 Ga0207702_10113830 3300026078 Bacteria 2410
240 Ga0207702_10146951 3300026078 Bacteria 2140
241 Ga0207702_10693547 3300026078 Bacteria 1003
242 Ga0207641_10002917 3300026088 Bacteria 15486
243 Ga0207641_10005629 3300026088 Bacteria 10676
244 Ga0207676_10003955 3300026095 Bacteria 10462
245 Ga0207676_10092132 3300026095 Bacteria 2491
246 Ga0207674_10002803 3300026116 Bacteria 21702
247 Ga0207674_10005074 3300026116 Bacteria 15715
248 Ga0207674_10027999 3300026116 Bacteria 5955
249 Ga0207674_10081707 3300026116 Bacteria 3233
250 Ga0207674_10125499 3300026116 Bacteria 2532
251 Ga0207683_10301192 3300026121 Bacteria 1467
252 Ga0207698_10002590 3300026142 Bacteria 10755
253 Ga0207698_10018532 3300026142 Bacteria 4745
254 Ga0207698_10223596 3300026142 Bacteria 1703
255 Ga0207698_10395844 3300026142 Bacteria 1319
256 Ga0268266_10006044 3300028379 Bacteria 11158
257 Ga0268266_10012945 3300028379 Bacteria 7194
258 Ga0268265_10000739 3300028380 Bacteria 31842
259 Ga0268265_10005687 3300028380 Bacteria 8513
260 Ga0268265_10220119 3300028380 Bacteria 1660
261 Ga0268265_10671583 3300028380 Bacteria 998
262 Ga0268264_10002308 3300028381 Bacteria 16874
263 Ga0268264_10002751 3300028381 Bacteria 15360
264 Ga0314311_1225350 3300030733 Bacteria 1498
265 Ga0316183_1184565 3300030742 Bacteria 2673
266 Ga0316182_1062397 3300030745 Bacteria 1580
267 Ga0265340_10142593 3300031247 Bacteria 1095
268 Ga0265331_10000020 3300031250 Bacteria 258149
269 Ga0265331_10021274 3300031250 Bacteria 3322
270 Ga0265327_10000869 3300031251 Bacteria 44810
271 Ga0307513_10005226 3300031456 Bacteria 17195
272 Ga0307408_100020741 3300031548 Bacteria 4439
273 Ga0307408_100145755 3300031548 Bacteria 1863
274 Ga0307408_100445860 3300031548 Bacteria 1122
275 Ga0265314_10010899 3300031711 Bacteria 7557
276 Ga0265314_10127543 3300031711 Bacteria 1591
277 Ga0307405_10138279 3300031731 Bacteria 1694
278 Ga0307405_10275166 3300031731 Bacteria 1264
279 Ga0307413_10051474 3300031824 Bacteria 2482
280 Ga0307413_10171559 3300031824 Bacteria 1536
281 Ga0307413_10211716 3300031824 Bacteria 1408
282 Ga0307413_10216967 3300031824 Bacteria 1394
283 Ga0307413_10260503 3300031824 Bacteria 1292
284 Ga0307413_10300177 3300031824 Bacteria 1217
285 Ga0307410_10011694 3300031852 Bacteria 5033
286 Ga0307410_10029035 3300031852 Bacteria 3516
287 Ga0307410_10135789 3300031852 Bacteria 1813
288 Ga0307410_10300640 3300031852 Bacteria 1266
289 Ga0307406_10109186 3300031901 Bacteria 1901
290 Ga0307406_10140353 3300031901 Bacteria 1709
291 Ga0307407_10007248 3300031903 Bacteria 5010
292 Ga0307407_10252317 3300031903 Bacteria 1209
293 Ga0307412_10084252 3300031911 Bacteria 2206
294 Ga0307412_10142472 3300031911 Bacteria 1757
295 Ga0307412_10199453 3300031911 Bacteria 1518
296 Ga0307409_100007710 3300031995 Bacteria 6467
297 Ga0307409_100059207 3300031995 Bacteria 2980
298 Ga0307409_100106602 3300031995 Bacteria 2339
299 Ga0307409_100107865 3300031995 Bacteria 2327
300 Ga0307416_100096896 3300032002 Bacteria 2552
301 Ga0307416_100365066 3300032002 Bacteria 1468
302 Ga0307416_100913316 3300032002 Bacteria 978
303 Ga0307416_101174093 3300032002 Bacteria 873
304 Ga0307414_10015043 3300032004 Bacteria 4661
305 Ga0307414_10016847 3300032004 Bacteria 4456
306 Ga0307414_10078454 3300032004 Bacteria 2407
307 Ga0307414_10180666 3300032004 Bacteria 1696
308 Ga0307414_10311430 3300032004 Bacteria 1336
309 Ga0307411_10016586 3300032005 Bacteria 4171
310 Ga0307411_10115829 3300032005 Bacteria 1928
311 Ga0307411_10255307 3300032005 Bacteria 1381
312 Ga0307415_100010576 3300032126 Bacteria 5232
313 Ga0307415_100120992 3300032126 Bacteria 1963
314 Ga0307415_101184000 3300032126 Bacteria 719
315 Ga0373933_0048810 3300035724 Bacteria 2522
316 Ga0373937_0017416 3300036401 Bacteria 6400
317 Ga0395899_0003327 3300037312 Bacteria 12741
318 Ga0395899_0022685 3300037312 Bacteria 4755
319 Ga0395899_0036016 3300037312 Bacteria 3713
320 Ga0395899_0084916 3300037312 Bacteria 2301
321 Ga0395899_0089926 3300037312 Bacteria 2226
322 Ga0395899_0094003 3300037312 Bacteria 2170
323 Ga0395899_0100953 3300037312 Bacteria 2083
324 Ga0395899_0120687 3300037312 Bacteria 1878
325 Ga0395900_0003073 3300037418 Bacteria 18154
326 Ga0395900_0014574 3300037418 Bacteria 8020
327 Ga0395900_0017888 3300037418 Bacteria 7234
328 Ga0395900_0018181 3300037418 Bacteria 7170
329 Ga0395900_0070989 3300037418 Bacteria 3579
330 Ga0395900_0080712 3300037418 Bacteria 3343
331 Ga0395900_0085924 3300037418 Bacteria 3233
332 Ga0395900_0108598 3300037418 Bacteria 2850
333 Ga0395900_0130558 3300037418 Bacteria 2575
334 Ga0395900_0172284 3300037418 Bacteria 2202
335 Ga0395900_0172296 3300037418 Bacteria 2202
336 Ga0395900_0192553 3300037418 Bacteria 2067
337 Ga0395900_0278611 3300037418 Bacteria 1665
338 Ga0395900_0515844 3300037418 Bacteria 1144
339 Ga0395900_0700206 3300037418 Bacteria 947
340 Ga0395900_0830544 3300037418 Bacteria 850
341 Ga0395900_1050989 3300037418 Bacteria 733
342 Ga0395898_0035179 3300037466 Bacteria 4985
343 Ga0395898_0048695 3300037466 Bacteria 4154
344 Ga0395898_0056562 3300037466 Bacteria 3823
345 Ga0395898_0064297 3300037466 Bacteria 3558
346 Ga0395898_0078115 3300037466 Bacteria 3194
347 Ga0395898_0160724 3300037466 Bacteria 2148
348 Ga0395898_0252888 3300037466 Bacteria 1680
349 Ga0395898_0286793 3300037466 Bacteria 1570
350 Ga0395898_0486298 3300037466 Bacteria 1174
351 Ga0395905_0003006 3300037471 Bacteria 18282
352 Ga0395905_0004108 3300037471 Bacteria 15252
353 Ga0395905_0005974 3300037471 Bacteria 12329
354 Ga0395905_0007579 3300037471 Bacteria 10784
355 Ga0395905_0012053 3300037471 Bacteria 8334
356 Ga0395905_0019827 3300037471 Bacteria 6372
357 Ga0395905_0025027 3300037471 Bacteria 5630
358 Ga0395905_0037015 3300037471 Bacteria 4583
359 Ga0395905_0052370 3300037471 Bacteria 3821
360 Ga0395905_0053499 3300037471 Bacteria 3778
361 Ga0395905_0086422 3300037471 Bacteria 2939
362 Ga0395905_0117483 3300037471 Bacteria 2499
363 Ga0395905_0153732 3300037471 Bacteria 2164
364 Ga0395905_0194575 3300037471 Bacteria 1901
365 Ga0395905_0290612 3300037471 Bacteria 1521
366 Ga0395905_0322958 3300037471 Bacteria 1433
367 Ga0395905_0556902 3300037471 Bacteria 1048
368 Ga0395901_0012271 3300038443 Bacteria 8696
369 Ga0395901_0014166 3300038443 Bacteria 8119
370 Ga0395901_0014621 3300038443 Bacteria 7977
371 Ga0395901_0042144 3300038443 Bacteria 4732
372 Ga0395901_0045192 3300038443 Bacteria 4569
373 Ga0395901_0070354 3300038443 Bacteria 3645
374 Ga0395901_0093445 3300038443 Bacteria 3149
375 Ga0395901_0189021 3300038443 Bacteria 2160
376 Ga0395901_0342794 3300038443 Bacteria 1543
377 Ga0395901_0376558 3300038443 Unclassified 1462
378 Ga0395901_0687742 3300038443 Bacteria 1022
379 Ga0436361_0278225 3300039447 Bacteria 1387
380 Ga0439458_0000201 3300042157 Bacteria 13777
381 Ga0466969_0003298 3300044656 Bacteria 8579
382 Ga0466966_0000001 3300044684 Bacteria 410376
383 Ga0466966_0008406 3300044684 Bacteria 6828
384 Ga0466966_0021628 3300044684 Bacteria 4223
385 Ga0466966_0164484 3300044684 Bacteria 1350
386 Ga0466961_0010598 3300044693 Bacteria 5881
387 Ga0466961_0023070 3300044693 Bacteria 4001
388 Ga0466963_0039134 3300044694 Bacteria 3104
389 Ga0466963_0077120 3300044694 Bacteria 2251
390 Ga0466963_0150447 3300044694 Bacteria 1616
391 Ga0466964_0248736 3300044706 Unclassified 875
392 Ga0466971_0020307 3300044719 Bacteria 2953
393 Ga0466971_0095590 3300044719 Bacteria 1362
394 Ga0466970_0052170 3300044765 Bacteria 2183
395 Ga0466970_0065666 3300044765 Bacteria 1947
396 Ga0466957_0060194 3300044842 Bacteria 2328
397 Ga0466957_0404899 3300044842 Bacteria 934
398 Ga0466957_0454185 3300044842 Unclassified 883
399 Ga0466959_0023633 3300045049 Bacteria 4549
400 Ga0466959_0031963 3300045049 Bacteria 3895
401 Ga0451576_0000023 3300045051 Bacteria 477965
402 Ga0466958_0000281 3300045836 Bacteria 19782
403 Ga0466958_0093794 3300045836 Bacteria 1859
404 Ga0466958_0128495 3300045836 Bacteria 1590
405 Ga0466958_0328018 3300045836 Bacteria 984
406 Ga0466967_0954231 3300045976 Bacteria 853
407 Ga0495663_0010363 3300046525 Bacteria 2592
408 Ga0495663_0089012 3300046525 Bacteria 1004
409 Ga0495642_0091478 3300046528 Bacteria 1288
410 Ga0495654_0010002 3300046530 Bacteria 5180
411 Ga0495621_0035718 3300046539 Bacteria 1722
412 Ga0495633_0127230 3300046558 Bacteria 1179
413 Ga0495668_0011758 3300046616 Bacteria 5222
414 Ga0495668_0028910 3300046616 Bacteria 3133
415 Ga0495668_0076653 3300046616 Bacteria 1835
416 Ga0495625_0275959 3300046660 Bacteria 1083
417 Ga0495669_0006918 3300046684 Bacteria 4751
418 Ga0495669_0067851 3300046684 Bacteria 1622
419 Ga0495669_0182097 3300046684 Bacteria 1002
420 Ga0495589_0011649 3300046794 Bacteria 4565
421 Ga0495602_0019233 3300048088 Bacteria 6790
422 Ga0496101_0259588 3300048904 Bacteria 1355
423 Ga0496106_0128932 3300048909 Bacteria 1982
424 Ga0496107_0019944 3300048910 Bacteria 4734
425 Ga0496108_0002291 3300048911 Bacteria 15334
426 Ga0496108_0013000 3300048911 Bacteria 6782
427 Ga0496108_0040562 3300048911 Bacteria 3881
428 Ga0496109_0003046 3300048912 Bacteria 13969
429 Ga0496109_0003157 3300048912 Bacteria 13734
430 Ga0496110_0002679 3300048913 Bacteria 13443
431 Ga0496110_0818909 3300048913 Bacteria 836
432 Ga0496111_0002348 3300048914 Bacteria 11406
433 Ga0496111_0238001 3300048914 Bacteria 1352
434 Ga0496112_0001210 3300048915 Bacteria 19388
435 Ga0496112_0011765 3300048915 Bacteria 8013
436 Ga0496113_0013293 3300048916 Bacteria 5570
437 Ga0496115_0001130 3300048918 Bacteria 19264
438 Ga0496122_0220668 3300048925 Bacteria 1088
439 Ga0496123_0152245 3300048926 Bacteria 1246
440 Ga0496124_0426401 3300048927 Bacteria 912
441 Ga0496126_0002015 3300048929 Bacteria 28714
442 Ga0501032_0077365 3300049569 Bacteria 2215
443 Ga0501033_0005866 3300049570 Bacteria 9654
444 Ga0501034_0002130 3300049571 Bacteria 24593
445 Ga0501034_0058816 3300049571 Bacteria 3861
446 Ga0501036_0323002 3300049572 Bacteria 1289
447 Ga0501038_0055680 3300049574 Bacteria 3397
448 Ga0501039_0169233 3300049575 Bacteria 1718
449 Ga0501042_0087687 3300049578 Bacteria 2233
450 Ga0501046_0114192 3300049580 Bacteria 2060
451 Ga0501046_0136745 3300049580 Bacteria 1856
452 Ga0501047_0097660 3300049581 Bacteria 2815
453 Ga0501047_0267161 3300049581 Bacteria 1557
454 Ga0501068_0056564 3300049584 Bacteria 2378
455 Ga0501069_0095164 3300049585 Bacteria 1687
456 Ga0501070_0071776 3300049586 Bacteria 2866
457 Ga0501073_0045022 3300049589 Bacteria 3109
458 Ga0501223_000367 3300049663 Bacteria 11110
459 Ga0501224_000028 3300049664 Bacteria 53596
460 Ga0501233_000183 3300049668 Bacteria 9154
461 Ga0501234_007228 3300049707 Bacteria 1738
462 Ga0501080_0296678 3300049742 Bacteria 1467
463 Ga0501081_0383348 3300049743 Unclassified 1039
464 Ga0501035_0060114 3300049822 Bacteria 3383
465 Ga0501044_0063974 3300049823 Bacteria 3756
466 Ga0501045_0184334 3300049824 Bacteria 1555
467 Ga0501226_000191 3300049853 Bacteria 9822
468 nmdc:mga07m45_186491_c1 3300050496 Bacteria 1206
469 Ga0500562_045540 3300053108 Bacteria 1169
470 Ga0500592_001060 3300053116 Bacteria 4499
471 Ga0500595_002230 3300053119 Bacteria 9841
472 Ga0500559_0224129 3300053136 Bacteria 886
473 Ga0500627_0000889 3300053158 Bacteria 8007
474 Ga0466962_0049177 3300061719 Bacteria 2015
475 Ga0466962_0297413 3300061719 Bacteria 798

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11012889 Ga0157375_110128892 175
2 3300005458 Ga0070681_10045388 Ga0070681_100453885 176
3 3300025912 Ga0207707_10110130 Ga0207707_101101303 176
4 3300025933 Ga0207706_10000920 Ga0207706_1000092017 176
5 3300037312 Ga0395899_0084916 Ga0395899_0084916_720_1385 185
6 3300037418 Ga0395900_0108598 Ga0395900_0108598_609_1274 185
7 3300049578 Ga0501042_0087687 Ga0501042_0087687_966_1640 185
8 3300049743 Ga0501081_0383348 Ga0501081_0383348_91_765 185
9 3300049824 Ga0501045_0184334 Ga0501045_0184334_796_1470 185
10 3300031711 Ga0265314_10127543 Ga0265314_101275433 192
11 3300037471 Ga0395905_0153732 Ga0395905_0153732_387_1082 196
12 3300009093 Ga0105240_10556578 Ga0105240_105565781 200
13 3300044684 Ga0466966_0000001 Ga0466966_0000001_246380_246997 200
14 3300001904 JGI24736J21556_1000458 JGI24736J21556_10004584 203
15 3300001979 JGI24740J21852_10004923 JGI24740J21852_100049232 203
16 3300003323 rootH1_10152439 rootH1_101524391 203
17 3300005331 Ga0070670_100150058 Ga0070670_1001500583 203
18 3300005339 Ga0070660_100004038 Ga0070660_10000403812 203
19 3300005339 Ga0070660_100173617 Ga0070660_1001736173 203
20 3300005344 Ga0070661_100001752 Ga0070661_1000017522 203
21 3300005353 Ga0070669_100053045 Ga0070669_1000530453 203
22 3300005354 Ga0070675_100079783 Ga0070675_1000797833 203
23 3300005354 Ga0070675_100374627 Ga0070675_1003746272 203
24 3300005457 Ga0070662_100415892 Ga0070662_1004158921 203
25 3300005578 Ga0068854_100004251 Ga0068854_10000425111 203
26 3300005578 Ga0068854_100770042 Ga0068854_1007700421 203
27 3300005614 Ga0068856_100339871 Ga0068856_1003398713 203
28 3300005614 Ga0068856_100818848 Ga0068856_1008188481 203
29 3300025315 Ga0207697_10028378 Ga0207697_100283784 203
30 3300025904 Ga0207647_10011905 Ga0207647_100119056 203
31 3300025909 Ga0207705_10010133 Ga0207705_1001013310 203
32 3300025913 Ga0207695_10001859 Ga0207695_1000185917 203
33 3300025913 Ga0207695_10021549 Ga0207695_100215496 203
34 3300025915 Ga0207693_10097682 Ga0207693_100976823 203
35 3300025919 Ga0207657_10003172 Ga0207657_1000317212 203
36 3300025926 Ga0207659_10608600 Ga0207659_106086002 203
37 3300025932 Ga0207690_10009750 Ga0207690_100097507 203
38 3300025933 Ga0207706_10178827 Ga0207706_101788273 203
39 3300025940 Ga0207691_10507424 Ga0207691_105074242 203
40 3300025949 Ga0207667_10020973 Ga0207667_1002097310 203
41 3300025981 Ga0207640_10000260 Ga0207640_1000026020 203
42 3300025981 Ga0207640_10130616 Ga0207640_101306161 203
43 3300026067 Ga0207678_10005397 Ga0207678_100053977 203
44 3300026078 Ga0207702_10113830 Ga0207702_101138302 203
45 3300026116 Ga0207674_10125499 Ga0207674_101254992 203
46 3300031548 Ga0307408_100020741 Ga0307408_1000207413 203
47 3300031824 Ga0307413_10051474 Ga0307413_100514742 203
48 3300031824 Ga0307413_10171559 Ga0307413_101715592 203
49 3300031852 Ga0307410_10300640 Ga0307410_103006401 203
50 3300031903 Ga0307407_10252317 Ga0307407_102523172 203
51 3300031995 Ga0307409_100107865 Ga0307409_1001078652 203
52 3300032004 Ga0307414_10311430 Ga0307414_103114302 203
53 3300032005 Ga0307411_10255307 Ga0307411_102553071 203
54 3300037418 Ga0395900_0700206 Ga0395900_0700206_38_673 203
55 iso_pu_bacteria 2928526807 2928528473 203
56 3300001979 JGI24740J21852_10020181 JGI24740J21852_100201812 204
57 3300001979 JGI24740J21852_10049214 JGI24740J21852_100492142 204
58 3300001990 JGI24737J22298_10010040 JGI24737J22298_100100403 204
59 3300001990 JGI24737J22298_10025276 JGI24737J22298_100252761 204
60 3300002067 JGI24735J21928_10003940 JGI24735J21928_100039406 204
61 3300002067 JGI24735J21928_10044593 JGI24735J21928_100445932 204
62 3300005327 Ga0070658_10069571 Ga0070658_100695711 204
63 3300005327 Ga0070658_10084531 Ga0070658_100845312 204
64 3300005327 Ga0070658_10110755 Ga0070658_101107552 204
65 3300005329 Ga0070683_100135987 Ga0070683_1001359872 204
66 3300005329 Ga0070683_100197311 Ga0070683_1001973114 204
67 3300005333 Ga0070677_10036575 Ga0070677_100365752 204
68 3300005334 Ga0068869_100348593 Ga0068869_1003485931 204
69 3300005336 Ga0070680_100028641 Ga0070680_1000286412 204
70 3300005338 Ga0068868_100094302 Ga0068868_1000943022 204
71 3300005339 Ga0070660_100079246 Ga0070660_1000792463 204
72 3300005339 Ga0070660_100252499 Ga0070660_1002524991 204
73 3300005339 Ga0070660_100264823 Ga0070660_1002648232 204
74 3300005339 Ga0070660_100830395 Ga0070660_1008303951 204
75 3300005340 Ga0070689_100800056 Ga0070689_1008000561 204
76 3300005341 Ga0070691_10011238 Ga0070691_100112382 204
77 3300005344 Ga0070661_100007298 Ga0070661_1000072989 204
78 3300005344 Ga0070661_100094810 Ga0070661_1000948102 204
79 3300005347 Ga0070668_100062336 Ga0070668_1000623363 204
80 3300005353 Ga0070669_100055238 Ga0070669_1000552384 204
81 3300005354 Ga0070675_100127814 Ga0070675_1001278143 204
82 3300005355 Ga0070671_100041419 Ga0070671_1000414192 204
83 3300005355 Ga0070671_100073478 Ga0070671_1000734782 204
84 3300005366 Ga0070659_100012271 Ga0070659_1000122715 204
85 3300005366 Ga0070659_100312928 Ga0070659_1003129282 204
86 3300005367 Ga0070667_100067450 Ga0070667_1000674502 204
87 3300005367 Ga0070667_100362779 Ga0070667_1003627792 204
88 3300005435 Ga0070714_100044626 Ga0070714_1000446262 204
89 3300005435 Ga0070714_100174987 Ga0070714_1001749872 204
90 3300005455 Ga0070663_100070851 Ga0070663_1000708512 204
91 3300005455 Ga0070663_100152726 Ga0070663_1001527262 204
92 3300005457 Ga0070662_100011232 Ga0070662_1000112327 204
93 3300005457 Ga0070662_100052264 Ga0070662_1000522644 204
94 3300005457 Ga0070662_100136175 Ga0070662_1001361752 204
95 3300005458 Ga0070681_10392441 Ga0070681_103924412 204
96 3300005530 Ga0070679_100212360 Ga0070679_1002123604 204
97 3300005535 Ga0070684_100146000 Ga0070684_1001460002 204
98 3300005539 Ga0068853_100020412 Ga0068853_1000204125 204
99 3300005539 Ga0068853_100031229 Ga0068853_1000312296 204
100 3300005539 Ga0068853_100043581 Ga0068853_1000435817 204
101 3300005543 Ga0070672_100186843 Ga0070672_1001868432 204
102 3300005548 Ga0070665_100007276 Ga0070665_1000072763 204
103 3300005548 Ga0070665_100200794 Ga0070665_1002007942 204
104 3300005563 Ga0068855_100478182 Ga0068855_1004781822 204
105 3300005564 Ga0070664_100011210 Ga0070664_1000112106 204
106 3300005577 Ga0068857_100028699 Ga0068857_1000286992 204
107 3300005578 Ga0068854_100018212 Ga0068854_1000182126 204
108 3300005614 Ga0068856_100007943 Ga0068856_10000794311 204
109 3300005614 Ga0068856_100071995 Ga0068856_1000719951 204
110 3300005614 Ga0068856_100086923 Ga0068856_1000869232 204
111 3300005618 Ga0068864_100001105 Ga0068864_10000110516 204
112 3300005618 Ga0068864_100010992 Ga0068864_1000109927 204
113 3300005718 Ga0068866_10139064 Ga0068866_101390642 204
114 3300005841 Ga0068863_100019009 Ga0068863_1000190096 204
115 3300005843 Ga0068860_100120291 Ga0068860_1001202914 204
116 3300005844 Ga0068862_100014177 Ga0068862_1000141777 204
117 3300005844 Ga0068862_100041438 Ga0068862_1000414381 204
118 3300006358 Ga0068871_100150217 Ga0068871_1001502172 204
119 3300006881 Ga0068865_100142304 Ga0068865_1001423044 204
120 3300009093 Ga0105240_10028067 Ga0105240_100280679 204
121 3300009094 Ga0111539_10386723 Ga0111539_103867231 204
122 3300009148 Ga0105243_10017813 Ga0105243_100178134 204
123 3300009174 Ga0105241_10147136 Ga0105241_101471362 204
124 3300009174 Ga0105241_10367059 Ga0105241_103670593 204
125 3300009177 Ga0105248_10025650 Ga0105248_100256502 204
126 3300009177 Ga0105248_10081532 Ga0105248_100815322 204
127 3300009551 Ga0105238_10377741 Ga0105238_103777413 204
128 3300009551 Ga0105238_10460163 Ga0105238_104601631 204
129 3300013100 Ga0157373_10014018 Ga0157373_100140184 204
130 3300013100 Ga0157373_10053279 Ga0157373_100532792 204
131 3300013100 Ga0157373_10083688 Ga0157373_100836884 204
132 3300013100 Ga0157373_10095064 Ga0157373_100950642 204
133 3300013100 Ga0157373_10349771 Ga0157373_103497711 204
134 3300013102 Ga0157371_10063498 Ga0157371_100634982 204
135 3300013102 Ga0157371_10147436 Ga0157371_101474364 204
136 3300013102 Ga0157371_10176559 Ga0157371_101765591 204
137 3300013102 Ga0157371_10176678 Ga0157371_101766781 204
138 3300013104 Ga0157370_10007637 Ga0157370_1000763710 204
139 3300013104 Ga0157370_10007721 Ga0157370_1000772112 204
140 3300013104 Ga0157370_10062685 Ga0157370_100626853 204
141 3300013104 Ga0157370_10068173 Ga0157370_100681735 204
142 3300013104 Ga0157370_10121075 Ga0157370_101210753 204
143 3300013105 Ga0157369_10010712 Ga0157369_1001071213 204
144 3300013105 Ga0157369_10102647 Ga0157369_101026473 204
145 3300013105 Ga0157369_10172849 Ga0157369_101728496 204
146 3300013105 Ga0157369_10184226 Ga0157369_101842262 204
147 3300013105 Ga0157369_10349735 Ga0157369_103497352 204
148 3300013306 Ga0163162_10302177 Ga0163162_103021773 204
149 3300013307 Ga0157372_10014336 Ga0157372_100143367 204
150 3300013307 Ga0157372_10110780 Ga0157372_101107804 204
151 3300013307 Ga0157372_10367412 Ga0157372_103674122 204
152 3300013308 Ga0157375_10066063 Ga0157375_100660632 204
153 3300013308 Ga0157375_11389172 Ga0157375_113891721 204
154 3300014326 Ga0157380_10209029 Ga0157380_102090294 204
155 3300014326 Ga0157380_10232345 Ga0157380_102323452 204
156 3300025321 Ga0207656_10116322 Ga0207656_101163222 204
157 3300025899 Ga0207642_10100452 Ga0207642_101004522 204
158 3300025901 Ga0207688_10014422 Ga0207688_100144226 204
159 3300025904 Ga0207647_10002253 Ga0207647_1000225316 204
160 3300025904 Ga0207647_10012651 Ga0207647_100126514 204
161 3300025907 Ga0207645_10031820 Ga0207645_100318204 204
162 3300025909 Ga0207705_10082101 Ga0207705_100821012 204
163 3300025911 Ga0207654_10330956 Ga0207654_103309561 204
164 3300025912 Ga0207707_10281119 Ga0207707_102811193 204
165 3300025913 Ga0207695_10012204 Ga0207695_100122049 204
166 3300025919 Ga0207657_10003570 Ga0207657_100035705 204
167 3300025919 Ga0207657_10024573 Ga0207657_100245733 204
168 3300025919 Ga0207657_10236893 Ga0207657_102368932 204
169 3300025920 Ga0207649_10000285 Ga0207649_1000028539 204
170 3300025920 Ga0207649_10012781 Ga0207649_100127816 204
171 3300025920 Ga0207649_10019105 Ga0207649_100191055 204
172 3300025920 Ga0207649_10128443 Ga0207649_101284432 204
173 3300025921 Ga0207652_10228711 Ga0207652_102287112 204
174 3300025923 Ga0207681_10107174 Ga0207681_101071743 204
175 3300025924 Ga0207694_10041889 Ga0207694_100418896 204
176 3300025924 Ga0207694_10123150 Ga0207694_101231502 204
177 3300025924 Ga0207694_10745564 Ga0207694_107455641 204
178 3300025926 Ga0207659_10086378 Ga0207659_100863782 204
179 3300025928 Ga0207700_10131070 Ga0207700_101310702 204
180 3300025929 Ga0207664_10372257 Ga0207664_103722572 204
181 3300025931 Ga0207644_10006412 Ga0207644_1000641210 204
182 3300025931 Ga0207644_10043358 Ga0207644_100433582 204
183 3300025931 Ga0207644_10101049 Ga0207644_101010491 204
184 3300025931 Ga0207644_10310152 Ga0207644_103101522 204
185 3300025932 Ga0207690_10035205 Ga0207690_100352056 204
186 3300025932 Ga0207690_10036083 Ga0207690_100360831 204
187 3300025933 Ga0207706_10064210 Ga0207706_100642102 204
188 3300025933 Ga0207706_10576797 Ga0207706_105767972 204
189 3300025940 Ga0207691_10150751 Ga0207691_101507513 204
190 3300025941 Ga0207711_10000567 Ga0207711_1000056725 204
191 3300025941 Ga0207711_10000762 Ga0207711_1000076226 204
192 3300025942 Ga0207689_10148457 Ga0207689_101484572 204
193 3300025945 Ga0207679_10024177 Ga0207679_100241773 204
194 3300025949 Ga0207667_10010740 Ga0207667_1001074013 204
195 3300025949 Ga0207667_10367635 Ga0207667_103676352 204
196 3300025960 Ga0207651_10062894 Ga0207651_100628941 204
197 3300025972 Ga0207668_10038696 Ga0207668_100386963 204
198 3300025981 Ga0207640_10017180 Ga0207640_100171803 204
199 3300025981 Ga0207640_10150897 Ga0207640_101508973 204
200 3300025986 Ga0207658_10195747 Ga0207658_101957472 204
201 3300025986 Ga0207658_10199817 Ga0207658_101998172 204
202 3300025986 Ga0207658_10414515 Ga0207658_104145152 204
203 3300026023 Ga0207677_10163329 Ga0207677_101633292 204
204 3300026041 Ga0207639_10017393 Ga0207639_100173933 204
205 3300026041 Ga0207639_10114486 Ga0207639_101144863 204
206 3300026041 Ga0207639_10225124 Ga0207639_102251243 204
207 3300026067 Ga0207678_10041420 Ga0207678_100414205 204
208 3300026067 Ga0207678_10066065 Ga0207678_100660653 204
209 3300026067 Ga0207678_10354466 Ga0207678_103544663 204
210 3300026067 Ga0207678_10886798 Ga0207678_108867981 204
211 3300026078 Ga0207702_10008403 Ga0207702_1000840310 204
212 3300026078 Ga0207702_10036938 Ga0207702_100369385 204
213 3300026078 Ga0207702_10037971 Ga0207702_100379713 204
214 3300026078 Ga0207702_10146951 Ga0207702_101469514 204
215 3300026078 Ga0207702_10693547 Ga0207702_106935472 204
216 3300026088 Ga0207641_10005629 Ga0207641_100056295 204
217 3300026095 Ga0207676_10003955 Ga0207676_100039558 204
218 3300026095 Ga0207676_10092132 Ga0207676_100921326 204
219 3300026116 Ga0207674_10002803 Ga0207674_1000280324 204
220 3300026116 Ga0207674_10005074 Ga0207674_1000507416 204
221 3300026116 Ga0207674_10081707 Ga0207674_100817074 204
222 3300026142 Ga0207698_10002590 Ga0207698_100025908 204
223 3300026142 Ga0207698_10018532 Ga0207698_100185324 204
224 3300026142 Ga0207698_10223596 Ga0207698_102235961 204
225 3300028379 Ga0268266_10006044 Ga0268266_100060443 204
226 3300028379 Ga0268266_10012945 Ga0268266_100129456 204
227 3300028380 Ga0268265_10005687 Ga0268265_100056874 204
228 3300028380 Ga0268265_10220119 Ga0268265_102201191 204
229 3300028380 Ga0268265_10671583 Ga0268265_106715832 204
230 3300028381 Ga0268264_10002751 Ga0268264_100027517 204
231 3300030733 Ga0314311_1225350 Ga0314311_12253502 204
232 3300030742 Ga0316183_1184565 Ga0316183_11845654 204
233 3300030745 Ga0316182_1062397 Ga0316182_10623974 204
234 3300031548 Ga0307408_100445860 Ga0307408_1004458602 204
235 3300031731 Ga0307405_10138279 Ga0307405_101382792 204
236 3300031731 Ga0307405_10275166 Ga0307405_102751661 204
237 3300031824 Ga0307413_10211716 Ga0307413_102117162 204
238 3300031824 Ga0307413_10216967 Ga0307413_102169671 204
239 3300031824 Ga0307413_10260503 Ga0307413_102605031 204
240 3300031824 Ga0307413_10300177 Ga0307413_103001771 204
241 3300031852 Ga0307410_10011694 Ga0307410_100116942 204
242 3300031852 Ga0307410_10029035 Ga0307410_100290354 204
243 3300031852 Ga0307410_10135789 Ga0307410_101357893 204
244 3300031901 Ga0307406_10109186 Ga0307406_101091861 204
245 3300031903 Ga0307407_10007248 Ga0307407_100072482 204
246 3300031911 Ga0307412_10142472 Ga0307412_101424722 204
247 3300031911 Ga0307412_10199453 Ga0307412_101994532 204
248 3300031995 Ga0307409_100007710 Ga0307409_1000077107 204
249 3300031995 Ga0307409_100059207 Ga0307409_1000592074 204
250 3300031995 Ga0307409_100106602 Ga0307409_1001066022 204
251 3300032002 Ga0307416_100096896 Ga0307416_1000968964 204
252 3300032002 Ga0307416_100365066 Ga0307416_1003650663 204
253 3300032002 Ga0307416_100913316 Ga0307416_1009133162 204
254 3300032002 Ga0307416_101174093 Ga0307416_1011740931 204
255 3300032004 Ga0307414_10015043 Ga0307414_100150432 204
256 3300032004 Ga0307414_10078454 Ga0307414_100784544 204
257 3300032004 Ga0307414_10180666 Ga0307414_101806662 204
258 3300032005 Ga0307411_10016586 Ga0307411_100165861 204
259 3300032005 Ga0307411_10115829 Ga0307411_101158291 204
260 3300032126 Ga0307415_100010576 Ga0307415_1000105762 204
261 3300032126 Ga0307415_100120992 Ga0307415_1001209922 204
262 3300032126 Ga0307415_101184000 Ga0307415_1011840001 204
263 3300035724 Ga0373933_0048810 Ga0373933_0048810_374_1000 204
264 3300036401 Ga0373937_0017416 Ga0373937_0017416_4284_4910 204
265 3300037312 Ga0395899_0003327 Ga0395899_0003327_506_1186 204
266 3300037312 Ga0395899_0022685 Ga0395899_0022685_1426_2106 204
267 3300037312 Ga0395899_0036016 Ga0395899_0036016_2143_2808 204
268 3300037312 Ga0395899_0089926 Ga0395899_0089926_42_740 204
269 3300037312 Ga0395899_0094003 Ga0395899_0094003_77_742 204
270 3300037312 Ga0395899_0100953 Ga0395899_0100953_100_726 204
271 3300037312 Ga0395899_0120687 Ga0395899_0120687_447_1073 204
272 3300037418 Ga0395900_0003073 Ga0395900_0003073_17140_17808 204
273 3300037418 Ga0395900_0014574 Ga0395900_0014574_5291_5944 204
274 3300037418 Ga0395900_0017888 Ga0395900_0017888_4838_5503 204
275 3300037418 Ga0395900_0018181 Ga0395900_0018181_3072_3725 204
276 3300037418 Ga0395900_0070989 Ga0395900_0070989_2588_3292 204
277 3300037418 Ga0395900_0080712 Ga0395900_0080712_1518_2147 204
278 3300037418 Ga0395900_0085924 Ga0395900_0085924_1985_2647 204
279 3300037418 Ga0395900_0130558 Ga0395900_0130558_1158_1820 204
280 3300037418 Ga0395900_0172284 Ga0395900_0172284_18_716 204
281 3300037418 Ga0395900_0172296 Ga0395900_0172296_1487_2185 204
282 3300037418 Ga0395900_0192553 Ga0395900_0192553_534_1214 204
283 3300037418 Ga0395900_0278611 Ga0395900_0278611_220_885 204
284 3300037418 Ga0395900_0515844 Ga0395900_0515844_260_928 204
285 3300037418 Ga0395900_0830544 Ga0395900_0830544_80_745 204
286 3300037418 Ga0395900_1050989 Ga0395900_1050989_34_666 204
287 3300037466 Ga0395898_0035179 Ga0395898_0035179_1632_2300 204
288 3300037466 Ga0395898_0048695 Ga0395898_0048695_42_740 204
289 3300037466 Ga0395898_0056562 Ga0395898_0056562_268_972 204
290 3300037466 Ga0395898_0064297 Ga0395898_0064297_657_1337 204
291 3300037466 Ga0395898_0078115 Ga0395898_0078115_1437_2102 204
292 3300037466 Ga0395898_0160724 Ga0395898_0160724_794_1459 204
293 3300037466 Ga0395898_0252888 Ga0395898_0252888_782_1462 204
294 3300037466 Ga0395898_0286793 Ga0395898_0286793_831_1529 204
295 3300037466 Ga0395898_0486298 Ga0395898_0486298_339_1001 204
296 3300037471 Ga0395905_0003006 Ga0395905_0003006_1056_1724 204
297 3300037471 Ga0395905_0004108 Ga0395905_0004108_8015_8677 204
298 3300037471 Ga0395905_0005974 Ga0395905_0005974_3368_4021 204
299 3300037471 Ga0395905_0007579 Ga0395905_0007579_7149_7814 204
300 3300037471 Ga0395905_0012053 Ga0395905_0012053_3464_4090 204
301 3300037471 Ga0395905_0019827 Ga0395905_0019827_3866_4528 204
302 3300037471 Ga0395905_0025027 Ga0395905_0025027_1724_2350 204
303 3300037471 Ga0395905_0037015 Ga0395905_0037015_1315_1968 204
304 3300037471 Ga0395905_0053499 Ga0395905_0053499_792_1421 204
305 3300037471 Ga0395905_0086422 Ga0395905_0086422_1899_2654 204
306 3300037471 Ga0395905_0117483 Ga0395905_0117483_1079_1741 204
307 3300037471 Ga0395905_0194575 Ga0395905_0194575_348_1013 204
308 3300037471 Ga0395905_0290612 Ga0395905_0290612_213_917 204
309 3300037471 Ga0395905_0322958 Ga0395905_0322958_435_1061 204
310 3300037471 Ga0395905_0556902 Ga0395905_0556902_142_807 204
311 3300038443 Ga0395901_0012271 Ga0395901_0012271_2451_3116 204
312 3300038443 Ga0395901_0014166 Ga0395901_0014166_2283_2936 204
313 3300038443 Ga0395901_0014621 Ga0395901_0014621_1027_1653 204
314 3300038443 Ga0395901_0042144 Ga0395901_0042144_24_686 204
315 3300038443 Ga0395901_0045192 Ga0395901_0045192_1254_1907 204
316 3300038443 Ga0395901_0070354 Ga0395901_0070354_202_882 204
317 3300038443 Ga0395901_0093445 Ga0395901_0093445_268_972 204
318 3300038443 Ga0395901_0189021 Ga0395901_0189021_882_1544 204
319 3300038443 Ga0395901_0342794 Ga0395901_0342794_543_1208 204
320 3300038443 Ga0395901_0376558 Ga0395901_0376558_80_745 204
321 3300038443 Ga0395901_0687742 Ga0395901_0687742_250_921 204
322 3300042157 Ga0439458_0000201 Ga0439458_0000201_5346_6008 204
323 3300044656 Ga0466969_0003298 Ga0466969_0003298_7346_8026 204
324 3300044684 Ga0466966_0008406 Ga0466966_0008406_872_1552 204
325 3300044684 Ga0466966_0021628 Ga0466966_0021628_2931_3596 204
326 3300044684 Ga0466966_0164484 Ga0466966_0164484_380_1045 204
327 3300044693 Ga0466961_0010598 Ga0466961_0010598_2816_3481 204
328 3300044693 Ga0466961_0023070 Ga0466961_0023070_36_716 204
329 3300044694 Ga0466963_0039134 Ga0466963_0039134_2042_2746 204
330 3300044694 Ga0466963_0077120 Ga0466963_0077120_989_1669 204
331 3300044694 Ga0466963_0150447 Ga0466963_0150447_809_1444 204
332 3300044706 Ga0466964_0248736 Ga0466964_0248736_149_814 204
333 3300044719 Ga0466971_0020307 Ga0466971_0020307_1499_2164 204
334 3300044719 Ga0466971_0095590 Ga0466971_0095590_66_746 204
335 3300044765 Ga0466970_0052170 Ga0466970_0052170_565_1245 204
336 3300044765 Ga0466970_0065666 Ga0466970_0065666_729_1394 204
337 3300044842 Ga0466957_0060194 Ga0466957_0060194_625_1305 204
338 3300044842 Ga0466957_0404899 Ga0466957_0404899_227_895 204
339 3300044842 Ga0466957_0454185 Ga0466957_0454185_202_864 204
340 3300045049 Ga0466959_0023633 Ga0466959_0023633_1551_2216 204
341 3300045049 Ga0466959_0031963 Ga0466959_0031963_3180_3860 204
342 3300045836 Ga0466958_0000281 Ga0466958_0000281_12576_13256 204
343 3300045836 Ga0466958_0093794 Ga0466958_0093794_776_1444 204
344 3300045836 Ga0466958_0128495 Ga0466958_0128495_592_1257 204
345 3300045836 Ga0466958_0328018 Ga0466958_0328018_264_893 204
346 3300045976 Ga0466967_0954231 Ga0466967_0954231_177_812 204
347 3300046525 Ga0495663_0089012 Ga0495663_0089012_106_747 204
348 3300046528 Ga0495642_0091478 Ga0495642_0091478_445_1086 204
349 3300046539 Ga0495621_0035718 Ga0495621_0035718_336_965 204
350 3300046558 Ga0495633_0127230 Ga0495633_0127230_291_920 204
351 3300046616 Ga0495668_0011758 Ga0495668_0011758_1602_2231 204
352 3300046616 Ga0495668_0076653 Ga0495668_0076653_931_1560 204
353 3300046684 Ga0495669_0006918 Ga0495669_0006918_2973_3602 204
354 3300046684 Ga0495669_0067851 Ga0495669_0067851_301_945 204
355 3300046684 Ga0495669_0182097 Ga0495669_0182097_227_856 204
356 3300048088 Ga0495602_0019233 Ga0495602_0019233_5938_6564 204
357 3300048904 Ga0496101_0259588 Ga0496101_0259588_496_1155 204
358 3300048909 Ga0496106_0128932 Ga0496106_0128932_1159_1800 204
359 3300048910 Ga0496107_0019944 Ga0496107_0019944_1819_2460 204
360 3300048911 Ga0496108_0002291 Ga0496108_0002291_5177_5839 204
361 3300048911 Ga0496108_0013000 Ga0496108_0013000_5536_6189 204
362 3300048911 Ga0496108_0040562 Ga0496108_0040562_1629_2270 204
363 3300048912 Ga0496109_0003046 Ga0496109_0003046_9408_10061 204
364 3300048912 Ga0496109_0003157 Ga0496109_0003157_10122_10763 204
365 3300048913 Ga0496110_0002679 Ga0496110_0002679_12164_12805 204
366 3300048913 Ga0496110_0818909 Ga0496110_0818909_65_721 204
367 3300048914 Ga0496111_0002348 Ga0496111_0002348_5566_6207 204
368 3300048914 Ga0496111_0238001 Ga0496111_0238001_96_764 204
369 3300048915 Ga0496112_0001210 Ga0496112_0001210_1166_1807 204
370 3300048915 Ga0496112_0011765 Ga0496112_0011765_4040_4693 204
371 3300048916 Ga0496113_0013293 Ga0496113_0013293_1771_2424 204
372 3300049742 Ga0501080_0296678 Ga0501080_0296678_696_1328 204
373 3300061719 Ga0466962_0049177 Ga0466962_0049177_395_1060 204
374 3300061719 Ga0466962_0297413 Ga0466962_0297413_71_736 204
375 iso_pu_bacteria 2896429255 2896430926 204
376 3300037471 Ga0395905_0052370 Ga0395905_0052370_1119_1739 206
377 iso_pu_bacteria 2885429604 2885430332 206
378 2162886006 SwRhRL3b_contig_2430896 SwRhRL3b_0957.00001520 207
379 3300001979 JGI24740J21852_10027561 JGI24740J21852_100275612 207
380 3300001989 JGI24739J22299_10003612 JGI24739J22299_100036126 207
381 3300002774 JGI25150J39212_1000126 JGI25150J39212_100012612 207
382 3300003215 JGI25153J46596_10000305 JGI25153J46596_100003052 207
383 3300003771 Ga0055526_1007718 Ga0055526_10077184 207
384 3300003773 Ga0055537_1004112 Ga0055537_10041122 207
385 3300003781 Ga0055536_1019790 Ga0055536_10197903 207
386 3300003792 Ga0055540_1000521 Ga0055540_10005213 207
387 3300003911 JGI25405J52794_10005305 JGI25405J52794_100053052 207
388 3300005295 Ga0065707_10000505 Ga0065707_1000050549 207
389 3300005344 Ga0070661_100000041 Ga0070661_10000004161 207
390 3300005539 Ga0068853_100017003 Ga0068853_1000170035 207
391 3300005578 Ga0068854_100056403 Ga0068854_1000564032 207
392 3300005616 Ga0068852_100999716 Ga0068852_1009997161 207
393 3300005617 Ga0068859_100123766 Ga0068859_1001237662 207
394 3300005841 Ga0068863_100007010 Ga0068863_1000070105 207
395 3300005843 Ga0068860_100000944 Ga0068860_10000094426 207
396 3300005844 Ga0068862_100000280 Ga0068862_10000028027 207
397 3300005937 Ga0081455_10000255 Ga0081455_1000025568 207
398 3300006353 Ga0075370_10074500 Ga0075370_100745002 207
399 3300006931 Ga0097620_100123766 Ga0097620_1001237662 207
400 3300009551 Ga0105238_10267270 Ga0105238_102672702 207
401 3300009553 Ga0105249_10000103 Ga0105249_1000010353 207
402 3300014326 Ga0157380_10110229 Ga0157380_101102292 207
403 3300014326 Ga0157380_10340797 Ga0157380_103407972 207
404 3300014969 Ga0157376_10138893 Ga0157376_101388932 207
405 3300025245 Ga0207425_1000041 Ga0207425_100004180 207
406 3300025258 Ga0209129_1000359 Ga0209129_10003597 207
407 3300025263 Ga0209565_1000134 Ga0209565_100013472 207
408 3300025292 Ga0209676_1020341 Ga0209676_10203412 207
409 3300025294 Ga0209025_1000068 Ga0209025_1000068249 207
410 3300025295 Ga0209564_1001020 Ga0209564_100102014 207
411 3300025297 Ga0209758_1000004 Ga0209758_1000004148 207
412 3300025298 Ga0209050_1000001 Ga0209050_10000012097 207
413 3300025302 Ga0207426_1025518 Ga0207426_10255182 207
414 3300025303 Ga0209051_1000232 Ga0209051_100023230 207
415 3300025304 Ga0209257_1019016 Ga0209257_10190163 207
416 3300025304 Ga0209257_1019023 Ga0209257_10190233 207
417 3300025920 Ga0207649_10000968 Ga0207649_1000096820 207
418 3300025924 Ga0207694_10120918 Ga0207694_101209182 207
419 3300025933 Ga0207706_10003677 Ga0207706_1000367718 207
420 3300025961 Ga0207712_10000069 Ga0207712_1000006955 207
421 3300025981 Ga0207640_10066381 Ga0207640_100663812 207
422 3300026041 Ga0207639_10288378 Ga0207639_102883782 207
423 3300026088 Ga0207641_10002917 Ga0207641_100029176 207
424 3300026116 Ga0207674_10027999 Ga0207674_100279995 207
425 3300026121 Ga0207683_10301192 Ga0207683_103011922 207
426 3300026142 Ga0207698_10395844 Ga0207698_103958441 207
427 3300028380 Ga0268265_10000739 Ga0268265_1000073925 207
428 3300028381 Ga0268264_10002308 Ga0268264_100023082 207
429 3300031247 Ga0265340_10142593 Ga0265340_101425932 207
430 3300031250 Ga0265331_10000020 Ga0265331_10000020107 207
431 3300031250 Ga0265331_10021274 Ga0265331_100212742 207
432 3300031251 Ga0265327_10000869 Ga0265327_1000086927 207
433 3300031456 Ga0307513_10005226 Ga0307513_100052265 207
434 3300031548 Ga0307408_100145755 Ga0307408_1001457552 207
435 3300031711 Ga0265314_10010899 Ga0265314_100108992 207
436 3300031901 Ga0307406_10140353 Ga0307406_101403532 207
437 3300031911 Ga0307412_10084252 Ga0307412_100842523 207
438 3300032004 Ga0307414_10016847 Ga0307414_100168472 207
439 3300039447 Ga0436361_0278225 Ga0436361_0278225_604_1242 207
440 3300045051 Ga0451576_0000023 Ga0451576_0000023_204216_204842 207
441 3300046525 Ga0495663_0010363 Ga0495663_0010363_411_1034 207
442 3300046530 Ga0495654_0010002 Ga0495654_0010002_3920_4543 207
443 3300046616 Ga0495668_0028910 Ga0495668_0028910_1948_2571 207
444 3300046660 Ga0495625_0275959 Ga0495625_0275959_282_914 207
445 3300046794 Ga0495589_0011649 Ga0495589_0011649_678_1301 207
446 3300048918 Ga0496115_0001130 Ga0496115_0001130_14977_15606 207
447 3300048925 Ga0496122_0220668 Ga0496122_0220668_150_776 207
448 3300048926 Ga0496123_0152245 Ga0496123_0152245_232_870 207
449 3300048927 Ga0496124_0426401 Ga0496124_0426401_197_838 207
450 3300048929 Ga0496126_0002015 Ga0496126_0002015_26643_27308 207
451 3300049569 Ga0501032_0077365 Ga0501032_0077365_1494_2156 207
452 3300049570 Ga0501033_0005866 Ga0501033_0005866_3078_3740 207
453 3300049571 Ga0501034_0002130 Ga0501034_0002130_23284_23919 207
454 3300049571 Ga0501034_0058816 Ga0501034_0058816_1918_2580 207
455 3300049572 Ga0501036_0323002 Ga0501036_0323002_267_929 207
456 3300049574 Ga0501038_0055680 Ga0501038_0055680_1935_2597 207
457 3300049575 Ga0501039_0169233 Ga0501039_0169233_451_1113 207
458 3300049580 Ga0501046_0114192 Ga0501046_0114192_83_739 207
459 3300049580 Ga0501046_0136745 Ga0501046_0136745_994_1656 207
460 3300049581 Ga0501047_0097660 Ga0501047_0097660_695_1357 207
461 3300049581 Ga0501047_0267161 Ga0501047_0267161_181_861 207
462 3300049584 Ga0501068_0056564 Ga0501068_0056564_486_1148 207
463 3300049585 Ga0501069_0095164 Ga0501069_0095164_119_781 207
464 3300049586 Ga0501070_0071776 Ga0501070_0071776_776_1438 207
465 3300049589 Ga0501073_0045022 Ga0501073_0045022_774_1436 207
466 3300049663 Ga0501223_000367 Ga0501223_000367_869_1504 207
467 3300049664 Ga0501224_000028 Ga0501224_000028_8324_8959 207
468 3300049668 Ga0501233_000183 Ga0501233_000183_7820_8455 207
469 3300049707 Ga0501234_007228 Ga0501234_007228_746_1381 207
470 3300049822 Ga0501035_0060114 Ga0501035_0060114_1918_2580 207
471 3300049823 Ga0501044_0063974 Ga0501044_0063974_1406_2068 207
472 3300049853 Ga0501226_000191 Ga0501226_000191_869_1504 207
473 3300050496 nmdc:mga07m45_186491_c1 nmdc:mga07m45_186491_c1_283_909 207
474 3300053108 Ga0500562_045540 Ga0500562_045540_466_1098 207
475 3300053116 Ga0500592_001060 Ga0500592_001060_554_1177 207
476 3300053119 Ga0500595_002230 Ga0500595_002230_8774_9415 207
477 3300053136 Ga0500559_0224129 Ga0500559_0224129_76_717 207
478 3300053158 Ga0500627_0000889 Ga0500627_0000889_6561_7184 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

42

243

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.9053 1 200
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8884 2 205
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8785 1 203
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8722 2 205
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8722 1 200
ID Description Score Start End Superfamily
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8544 1 203 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8353 1 203 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8324 1 203 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8207 1 203 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8164 2 207 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520GVC1-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9942 1 134 GO:0005524
GO:0036430
GO:0036431
AF-A0A520GVC1-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9796 1 134 GO:0005524
GO:0036430
GO:0036431
AF-A0A7W6RZH5-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9771 1 205 GO:0004127
GO:0005524
GO:0005737
GO:0006220
GO:0016765
AF-A0A1G6Z0F0-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9713 1 206 GO:0005524
GO:0005737
GO:0006220
GO:0016765
GO:0036430
GO:0036431
AF-A0A1Q3JMQ5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9705 1 160 GO:0004127
GO:0005524

Feature Viewer

pLDDT pTM Quality
94.54 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map