F449876

General Info

Members Datasets Scaffolds Average Seq Length
467 277 934 132

Family's Representative Sequence

Representative Sequence 3300030760|Ga0265762_1157185|Ga0265762_11571852
Length 128
Sequence MIQLAYARPIIAAAEKKAKSIGQSMKVAVVGEGGNHIAFERMATAWLGSIDVAQKRAWTARAFEITTKGLGANSRSGDQFFGIHACNNGKIMNFGSGIPLKKDGKVVGVSGGSGEQDHAVVEAGASAH

Samples

Sample ID Description Type Environment
1 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
145 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
244 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
254 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 1.07
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 12.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265762_1157185 3300030760 Unclassified 545
2 LJNas_1000217 3300000546 Bacteria 9829
3 rootH2_10015581 3300003320 Bacteria 7598
4 rootH2_10143326 3300003320 Bacteria 2872
5 rootH1_10191755 3300003323 Bacteria 4726
6 Ga0065704_10190284 3300005289 Bacteria 1193
7 Ga0065715_10247286 3300005293 Bacteria 1160
8 Ga0065707_10263396 3300005295 Bacteria 1091
9 Ga0065707_10548181 3300005295 Bacteria 723
10 Ga0070683_101037907 3300005329 Bacteria 787
11 Ga0070690_100225571 3300005330 Bacteria 1315
12 Ga0070670_100345735 3300005331 Bacteria 1306
13 Ga0068869_100572329 3300005334 Bacteria 951
14 Ga0070666_10495752 3300005335 Bacteria 885
15 Ga0070680_101681726 3300005336 Bacteria 550
16 Ga0070660_101113605 3300005339 Bacteria 668
17 Ga0070689_100013813 3300005340 Bacteria 5850
18 Ga0070669_100630855 3300005353 Unclassified 900
19 Ga0070675_100022554 3300005354 Bacteria 5032
20 Ga0070675_100695747 3300005354 Bacteria 926
21 Ga0070675_100711759 3300005354 Unclassified 915
22 Ga0070673_100090349 3300005364 Bacteria 2502
23 Ga0070688_100292120 3300005365 Bacteria 1175
24 Ga0070659_101858154 3300005366 Bacteria 540
25 Ga0070667_100130456 3300005367 Bacteria 2193
26 Ga0070705_100402689 3300005440 Bacteria 1014
27 Ga0070700_100276833 3300005441 Bacteria 1215
28 Ga0070694_100470582 3300005444 Bacteria 995
29 Ga0070708_100081255 3300005445 Bacteria 2934
30 Ga0070708_100536612 3300005445 Unclassified 1104
31 Ga0070708_101735175 3300005445 Bacteria 580
32 Ga0070663_100534775 3300005455 Unclassified 978
33 Ga0070678_101985217 3300005456 Bacteria 550
34 Ga0070681_10132708 3300005458 Bacteria 2422
35 Ga0070681_10554941 3300005458 Bacteria 1063
36 Ga0070681_11576355 3300005458 Bacteria 582
37 Ga0068867_100483836 3300005459 Bacteria 1061
38 Ga0068867_101911231 3300005459 Bacteria 560
39 Ga0070685_10024142 3300005466 Bacteria 3337
40 Ga0070706_100355277 3300005467 Unclassified 1366
41 Ga0070706_100789624 3300005467 Bacteria 879
42 Ga0070706_101424428 3300005467 Bacteria 634
43 Ga0070707_100034989 3300005468 Bacteria 4789
44 Ga0070707_100076912 3300005468 Bacteria 3220
45 Ga0070707_100432278 3300005468 Bacteria 1277
46 Ga0070698_100521067 3300005471 Bacteria 1127
47 Ga0070698_101065012 3300005471 Bacteria 757
48 Ga0070699_100037861 3300005518 Bacteria 4175
49 Ga0070699_100489211 3300005518 Bacteria 1117
50 Ga0070699_101128716 3300005518 Bacteria 719
51 Ga0070679_100030155 3300005530 Bacteria 5353
52 Ga0070679_100149027 3300005530 Bacteria 2317
53 Ga0070679_101727245 3300005530 Bacteria 574
54 Ga0070684_100051986 3300005535 Bacteria 3561
55 Ga0070697_100034927 3300005536 Bacteria 4055
56 Ga0070697_100083936 3300005536 Bacteria 2627
57 Ga0070697_100435927 3300005536 Bacteria 1140
58 Ga0070697_100625595 3300005536 Unclassified 947
59 Ga0068853_100011484 3300005539 Bacteria 7198
60 Ga0068853_100062397 3300005539 Bacteria 3225
61 Ga0068853_100901272 3300005539 Bacteria 849
62 Ga0070672_100142112 3300005543 Bacteria 1981
63 Ga0070672_101396698 3300005543 Bacteria 626
64 Ga0070695_100754341 3300005545 Bacteria 776
65 Ga0070693_101232159 3300005547 Unclassified 576
66 Ga0070665_100017992 3300005548 Bacteria 7095
67 Ga0070665_100034763 3300005548 Bacteria 5069
68 Ga0070665_100667207 3300005548 Unclassified 1053
69 Ga0070665_101152811 3300005548 Bacteria 786
70 Ga0070704_100232456 3300005549 Bacteria 1505
71 Ga0068855_100138127 3300005563 Bacteria 2780
72 Ga0068855_100411373 3300005563 Bacteria 1481
73 Ga0070664_100308807 3300005564 Bacteria 1431
74 Ga0068857_100073062 3300005577 Bacteria 3056
75 Ga0068854_101144319 3300005578 Bacteria 695
76 Ga0068854_101365076 3300005578 Bacteria 640
77 Ga0070702_100397211 3300005615 Bacteria 985
78 Ga0068852_102513766 3300005616 Bacteria 535
79 Ga0068859_100078287 3300005617 Bacteria 3346
80 Ga0068859_100860780 3300005617 Unclassified 992
81 Ga0068864_100111861 3300005618 Bacteria 2433
82 Ga0068864_100156162 3300005618 Bacteria 2071
83 Ga0068866_10271459 3300005718 Bacteria 1047
84 Ga0068863_100040004 3300005841 Bacteria 4459
85 Ga0068863_100610751 3300005841 Unclassified 1080
86 Ga0068858_100014953 3300005842 Bacteria 7303
87 Ga0068858_100402733 3300005842 Bacteria 1315
88 Ga0068860_100015064 3300005843 Bacteria 7555
89 Ga0068860_100079591 3300005843 Bacteria 3116
90 Ga0068860_100080715 3300005843 Bacteria 3093
91 Ga0068860_101240445 3300005843 Bacteria 766
92 Ga0068860_102475810 3300005843 Unclassified 539
93 Ga0068862_100970611 3300005844 Bacteria 839
94 Ga0068862_100978620 3300005844 Unclassified 836
95 Ga0081455_10811370 3300005937 Bacteria 587
96 Ga0081539_10018572 3300005985 Bacteria 4817
97 Ga0070717_10076390 3300006028 Bacteria 2803
98 Ga0070712_100616136 3300006175 Bacteria 920
99 Ga0075367_10291726 3300006178 Unclassified 1026
100 Ga0075427_10111049 3300006194 Bacteria 516
101 Ga0097621_100002203 3300006237 Bacteria 13340
102 Ga0097621_100085187 3300006237 Bacteria 2635
103 Ga0097621_101208301 3300006237 Unclassified 712
104 Ga0097621_101469548 3300006237 Unclassified 646
105 Ga0068871_100022942 3300006358 Bacteria 4819
106 Ga0068871_100134113 3300006358 Bacteria 2102
107 Ga0068871_101096524 3300006358 Bacteria 744
108 Ga0075428_100040202 3300006844 Bacteria 5147
109 Ga0075428_100200686 3300006844 Bacteria 2156
110 Ga0075428_100768670 3300006844 Bacteria 1025
111 Ga0075428_100981554 3300006844 Bacteria 894
112 Ga0075428_101132496 3300006844 Bacteria 826
113 Ga0075430_100028696 3300006846 Bacteria 4725
114 Ga0075430_100753173 3300006846 Bacteria 803
115 Ga0075431_100002494 3300006847 Bacteria 17746
116 Ga0075431_100244424 3300006847 Unclassified 1824
117 Ga0075431_100287663 3300006847 Bacteria 1663
118 Ga0075431_100329902 3300006847 Bacteria 1537
119 Ga0075433_10001345 3300006852 Bacteria 18011
120 Ga0075434_100009876 3300006871 Bacteria 8927
121 Ga0075434_100368292 3300006871 Bacteria 1458
122 Ga0075434_100710857 3300006871 Bacteria 1022
123 Ga0075434_101208026 3300006871 Unclassified 768
124 Ga0075429_100437439 3300006880 Bacteria 1146
125 Ga0068865_100132935 3300006881 Bacteria 1866
126 Ga0068865_100359892 3300006881 Bacteria 1181
127 Ga0068865_100811132 3300006881 Bacteria 808
128 Ga0068865_101952123 3300006881 Bacteria 532
129 Ga0075436_100636402 3300006914 Unclassified 787
130 Ga0075436_101014817 3300006914 Bacteria 623
131 Ga0097620_100078284 3300006931 Bacteria 3346
132 Ga0097620_100860696 3300006931 Unclassified 992
133 Ga0075435_100177085 3300007076 Bacteria 1801
134 Ga0075435_100275489 3300007076 Unclassified 1436
135 Ga0075435_100542419 3300007076 Unclassified 1007
136 Ga0105240_10028885 3300009093 Bacteria 7234
137 Ga0105240_10949050 3300009093 Unclassified 923
138 Ga0105240_12436459 3300009093 Bacteria 541
139 Ga0111539_10153343 3300009094 Bacteria 2696
140 Ga0111539_11319008 3300009094 Bacteria 837
141 Ga0111539_11916175 3300009094 Bacteria 687
142 Ga0111539_12541143 3300009094 Bacteria 594
143 Ga0111539_12821422 3300009094 Bacteria 563
144 Ga0105245_10002865 3300009098 Bacteria 15494
145 Ga0105247_10506040 3300009101 Bacteria 881
146 Ga0114129_10013123 3300009147 Bacteria 11801
147 Ga0114129_10145952 3300009147 Bacteria 3241
148 Ga0114129_11187833 3300009147 Bacteria 951
149 Ga0114129_11750180 3300009147 Bacteria 757
150 Ga0105243_10307969 3300009148 Bacteria 1438
151 Ga0105241_10005714 3300009174 Bacteria 9180
152 Ga0105242_10003235 3300009176 Bacteria 12699
153 Ga0105242_10052033 3300009176 Bacteria 3340
154 Ga0105248_10005082 3300009177 Bacteria 14516
155 Ga0105248_10060585 3300009177 Bacteria 4249
156 Ga0105248_10135444 3300009177 Bacteria 2778
157 Ga0105248_10229291 3300009177 Bacteria 2091
158 Ga0105237_10005518 3300009545 Bacteria 14258
159 Ga0105237_10008009 3300009545 Bacteria 11501
160 Ga0105237_11034260 3300009545 Bacteria 828
161 Ga0105237_11139974 3300009545 Bacteria 786
162 Ga0105238_10000854 3300009551 Bacteria 31404
163 Ga0105249_10074029 3300009553 Bacteria 3151
164 Ga0105249_10242669 3300009553 Bacteria 1782
165 Ga0105249_10863551 3300009553 Bacteria 971
166 Ga0105249_11665015 3300009553 Bacteria 711
167 Ga0105249_12810804 3300009553 Bacteria 558
168 Ga0105239_10005088 3300010375 Bacteria 15521
169 Ga0105239_10526530 3300010375 Bacteria 1345
170 Ga0105239_11056319 3300010375 Bacteria 934
171 Ga0105246_10009998 3300011119 Bacteria 5852
172 Ga0157370_10029065 3300013104 Bacteria 5431
173 Ga0157369_12269426 3300013105 Unclassified 550
174 Ga0157374_10002659 3300013296 Bacteria 15051
175 Ga0157374_10317132 3300013296 Bacteria 1544
176 Ga0157374_11358742 3300013296 Bacteria 733
177 Ga0157378_10149561 3300013297 Bacteria 2175
178 Ga0157378_10326030 3300013297 Bacteria 1493
179 Ga0163162_10020326 3300013306 Bacteria 6522
180 Ga0163162_10416211 3300013306 Bacteria 1476
181 Ga0163162_10421368 3300013306 Bacteria 1467
182 Ga0163162_11976029 3300013306 Bacteria 668
183 Ga0157372_10484694 3300013307 Bacteria 1442
184 Ga0157375_10057668 3300013308 Bacteria 3839
185 Ga0157375_10607602 3300013308 Bacteria 1252
186 Ga0163163_10040450 3300014325 Bacteria 4552
187 Ga0163163_11010187 3300014325 Bacteria 895
188 Ga0163163_11211791 3300014325 Bacteria 817
189 Ga0163163_11893564 3300014325 Bacteria 656
190 Ga0157380_10228809 3300014326 Bacteria 1668
191 Ga0157379_10091208 3300014968 Bacteria 2733
192 Ga0157379_10110142 3300014968 Bacteria 2473
193 Ga0157379_10675951 3300014968 Bacteria 968
194 Ga0157376_10024344 3300014969 Bacteria 4751
195 Ga0157376_10317967 3300014969 Bacteria 1479
196 Ga0157376_11233635 3300014969 Bacteria 776
197 Ga0157376_11779343 3300014969 Bacteria 652
198 Ga0206349_1869766 3300020075 Bacteria 513
199 Ga0206351_10950113 3300020077 Bacteria 583
200 Ga0206350_11065087 3300020080 Bacteria 598
201 Ga0206354_11083946 3300020081 Bacteria 557
202 Ga0213876_10152876 3300021384 Bacteria 1227
203 Ga0224712_10614444 3300022467 Bacteria 531
204 Ga0228598_1036342 3300024227 Bacteria 971
205 Ga0207653_10014916 3300025885 Bacteria 2439
206 Ga0207642_10157707 3300025899 Unclassified 1215
207 Ga0207680_10192950 3300025903 Bacteria 1384
208 Ga0207680_10761680 3300025903 Bacteria 694
209 Ga0207684_10311534 3300025910 Unclassified 1357
210 Ga0207684_10408188 3300025910 Bacteria 1167
211 Ga0207654_10010847 3300025911 Bacteria 4639
212 Ga0207707_10040412 3300025912 Unclassified 4074
213 Ga0207707_10487375 3300025912 Bacteria 1052
214 Ga0207707_11149106 3300025912 Bacteria 631
215 Ga0207671_10004882 3300025914 Bacteria 12606
216 Ga0207671_10098838 3300025914 Bacteria 2208
217 Ga0207671_10116517 3300025914 Bacteria 2038
218 Ga0207693_10388304 3300025915 Bacteria 1092
219 Ga0207663_11682088 3300025916 Bacteria 511
220 Ga0207657_11122447 3300025919 Bacteria 600
221 Ga0207652_10062218 3300025921 Bacteria 3225
222 Ga0207652_10459139 3300025921 Bacteria 1148
223 Ga0207646_10001462 3300025922 Bacteria 29242
224 Ga0207646_10017662 3300025922 Bacteria 6666
225 Ga0207694_10001849 3300025924 Bacteria 17623
226 Ga0207650_10811707 3300025925 Bacteria 793
227 Ga0207659_10000315 3300025926 Bacteria 29320
228 Ga0207687_10003540 3300025927 Bacteria 10507
229 Ga0207686_10096185 3300025934 Bacteria 1967
230 Ga0207686_10119998 3300025934 Bacteria 1788
231 Ga0207670_10004682 3300025936 Bacteria 7418
232 Ga0207704_10011917 3300025938 Bacteria 4299
233 Ga0207704_10422138 3300025938 Bacteria 1057
234 Ga0207704_10893146 3300025938 Bacteria 747
235 Ga0207691_10090466 3300025940 Bacteria 2743
236 Ga0207691_10715119 3300025940 Bacteria 844
237 Ga0207711_10061287 3300025941 Unclassified 3244
238 Ga0207711_10354362 3300025941 Bacteria 1359
239 Ga0207711_10516510 3300025941 Bacteria 1114
240 Ga0207661_11218800 3300025944 Bacteria 692
241 Ga0207679_10312621 3300025945 Bacteria 1358
242 Ga0207667_10403990 3300025949 Bacteria 1391
243 Ga0207667_10948443 3300025949 Bacteria 850
244 Ga0207667_11730518 3300025949 Bacteria 591
245 Ga0207651_10046769 3300025960 Bacteria 2913
246 Ga0207712_11970796 3300025961 Bacteria 523
247 Ga0207640_10258399 3300025981 Bacteria 1356
248 Ga0207658_10613848 3300025986 Bacteria 978
249 Ga0207677_10056293 3300026023 Bacteria 2693
250 Ga0207703_10017820 3300026035 Bacteria 5546
251 Ga0207703_10330244 3300026035 Bacteria 1399
252 Ga0207639_10134739 3300026041 Bacteria 2049
253 Ga0207639_10381215 3300026041 Bacteria 1266
254 Ga0207678_10343352 3300026067 Unclassified 1287
255 Ga0207678_10711948 3300026067 Bacteria 884
256 Ga0207708_10311783 3300026075 Bacteria 1282
257 Ga0207641_10246375 3300026088 Unclassified 1667
258 Ga0207641_10277873 3300026088 Bacteria 1574
259 Ga0207641_10307625 3300026088 Bacteria 1499
260 Ga0207641_11133141 3300026088 Unclassified 781
261 Ga0207641_11193800 3300026088 Bacteria 760
262 Ga0207648_10007005 3300026089 Bacteria 11149
263 Ga0207648_12002622 3300026089 Bacteria 540
264 Ga0207676_10050284 3300026095 Bacteria 3249
265 Ga0207674_10002640 3300026116 Bacteria 22397
266 Ga0207674_10903161 3300026116 Bacteria 851
267 Ga0265354_1017579 3300028016 Unclassified 677
268 Ga0265357_1019646 3300028023 Bacteria 734
269 Ga0268266_10000126 3300028379 Bacteria 150322
270 Ga0268266_10022824 3300028379 Bacteria 5327
271 Ga0268266_10077185 3300028379 Bacteria 2896
272 Ga0268266_10160179 3300028379 Bacteria 2035
273 Ga0268266_10315234 3300028379 Unclassified 1462
274 Ga0268265_10748774 3300028380 Unclassified 948
275 Ga0268264_10004340 3300028381 Bacteria 12108
276 Ga0268264_10050170 3300028381 Bacteria 3474
277 Ga0268264_10108292 3300028381 Bacteria 2429
278 Ga0268264_10655124 3300028381 Bacteria 1039
279 Ga0268264_11822889 3300028381 Bacteria 618
280 Ga0265334_10133283 3300028573 Bacteria 883
281 Ga0265318_10065345 3300028577 Bacteria 1353
282 Ga0265318_10151381 3300028577 Bacteria 851
283 Ga0265318_10381261 3300028577 Bacteria 515
284 Ga0265338_10485750 3300028800 Bacteria 871
285 Ga0265328_10107473 3300031239 Bacteria 1036
286 Ga0265320_10043019 3300031240 Bacteria 2236
287 Ga0265325_10066932 3300031241 Bacteria 1810
288 Ga0265329_10151040 3300031242 Bacteria 752
289 Ga0265331_10021951 3300031250 Bacteria 3261
290 Ga0265331_10040706 3300031250 Bacteria 2260
291 Ga0265316_10294765 3300031344 Bacteria 1183
292 Ga0265316_10361553 3300031344 Bacteria 1049
293 Ga0265316_10910958 3300031344 Bacteria 614
294 Ga0307513_10086579 3300031456 Bacteria 3211
295 Ga0307408_100120148 3300031548 Bacteria 2034
296 Ga0307408_100161875 3300031548 Bacteria 1778
297 Ga0265313_10003436 3300031595 Bacteria 12819
298 Ga0265313_10006899 3300031595 Bacteria 7897
299 Ga0265314_10063922 3300031711 Bacteria 2494
300 Ga0265342_10161208 3300031712 Bacteria 1239
301 Ga0307405_10026097 3300031731 Unclassified 3365
302 Ga0307405_10173523 3300031731 Unclassified 1540
303 Ga0307413_10016978 3300031824 Unclassified 3779
304 Ga0307413_10091375 3300031824 Bacteria 1983
305 Ga0307413_10101037 3300031824 Bacteria 1906
306 Ga0307413_11651987 3300031824 Bacteria 570
307 Ga0307410_10028417 3300031852 Unclassified 3547
308 Ga0307410_10176143 3300031852 Unclassified 1616
309 Ga0307410_10919975 3300031852 Bacteria 750
310 Ga0307406_10034886 3300031901 Bacteria 3089
311 Ga0307407_10038472 3300031903 Unclassified 2651
312 Ga0307412_10073299 3300031911 Bacteria 2342
313 Ga0307412_10362075 3300031911 Unclassified 1168
314 Ga0307409_100021867 3300031995 Bacteria 4396
315 Ga0307409_100466185 3300031995 Unclassified 1222
316 Ga0307409_101028150 3300031995 Bacteria 843
317 Ga0307409_101117530 3300031995 Bacteria 810
318 Ga0307416_100357249 3300032002 Bacteria 1481
319 Ga0307416_101799208 3300032002 Unclassified 716
320 Ga0307416_101985824 3300032002 Unclassified 684
321 Ga0307414_10031756 3300032004 Bacteria 3468
322 Ga0307414_10227642 3300032004 Bacteria 1535
323 Ga0307411_10289206 3300032005 Bacteria 1308
324 Ga0307411_10316107 3300032005 Unclassified 1259
325 Ga0307415_100015078 3300032126 Bacteria 4565
326 Ga0307415_100852281 3300032126 Bacteria 836
327 Ga0307510_10186164 3300033180 Bacteria 1631
328 Ga0307510_10186987 3300033180 Bacteria 1625
329 Ga0373954_0089894 3300035118 Bacteria 1474
330 Ga0373933_0149840 3300035724 Bacteria 1477
331 Ga0373937_0493453 3300036401 Bacteria 1163
332 Ga0395899_0891197 3300037312 Bacteria 543
333 Ga0395900_1311167 3300037418 Bacteria 638
334 Ga0395905_0193255 3300037471 Bacteria 1909
335 Ga0436365_1061670 3300039437 Bacteria 3184
336 Ga0436360_0732168 3300039438 Bacteria 1588
337 Ga0436361_0600343 3300039447 Bacteria 5201
338 Ga0436362_0235024 3300039453 Bacteria 1397
339 Ga0451853_0008623 3300041512 Bacteria 605
340 Ga0451577_0715024 3300042876 Unclassified 907
341 Ga0466969_0000059 3300044656 Bacteria 58201
342 Ga0466969_0026022 3300044656 Bacteria 3003
343 Ga0466972_0015982 3300044658 Bacteria 3752
344 Ga0466966_0006626 3300044684 Bacteria 7667
345 Ga0466966_0054789 3300044684 Bacteria 2525
346 Ga0466961_0075396 3300044693 Unclassified 2138
347 Ga0466963_0329797 3300044694 Bacteria 1074
348 Ga0466964_0000044 3300044706 Bacteria 26361
349 Ga0453684_0029558 3300044712 Bacteria 7776
350 Ga0466971_0504249 3300044719 Unclassified 597
351 Ga0466968_0000333 3300044735 Bacteria 15202
352 Ga0466970_0000365 3300044765 Bacteria 21988
353 Ga0466957_0110921 3300044842 Bacteria 1739
354 Ga0466959_0012728 3300045049 Bacteria 6085
355 Ga0466959_0069044 3300045049 Unclassified 2561
356 Ga0451576_0088798 3300045051 Bacteria 3215
357 Ga0451576_0267597 3300045051 Bacteria 1787
358 Ga0451576_0964441 3300045051 Bacteria 894
359 Ga0466958_0365836 3300045836 Bacteria 929
360 Ga0466958_0718834 3300045836 Bacteria 651
361 Ga0495629_0563204 3300046459 Bacteria 764
362 Ga0495629_0725007 3300046459 Bacteria 659
363 Ga0495580_0016074 3300046472 Bacteria 5625
364 Ga0495580_0620581 3300046472 Bacteria 713
365 Ga0495639_0356903 3300046475 Unclassified 734
366 Ga0495630_0531165 3300046517 Bacteria 902
367 Ga0495665_0377200 3300046531 Bacteria 721
368 Ga0495635_0208754 3300046663 Bacteria 1323
369 Ga0495635_1085026 3300046663 Unclassified 507
370 Ga0495659_0003126 3300046664 Bacteria 5317
371 Ga0495658_0390732 3300046683 Bacteria 886
372 Ga0495669_0098695 3300046684 Unclassified 1355
373 Ga0495670_0402168 3300046691 Bacteria 740
374 Ga0495672_0168958 3300047320 Bacteria 1117
375 Ga0495672_0372579 3300047320 Bacteria 658
376 Ga0495675_0687265 3300047444 Bacteria 574
377 Ga0495684_0306173 3300047471 Bacteria 1140
378 Ga0495686_0020675 3300047472 Bacteria 4387
379 Ga0495602_0263840 3300048088 Bacteria 1276
380 Ga0495614_0428379 3300048089 Bacteria 624
381 Ga0496102_0555502 3300048905 Bacteria 1071
382 Ga0496104_1567859 3300048907 Bacteria 561
383 Ga0496105_0265502 3300048908 Bacteria 1387
384 Ga0496107_0623746 3300048910 Unclassified 796
385 Ga0496110_1309289 3300048913 Bacteria 634
386 Ga0496119_0437180 3300048922 Bacteria 618
387 Ga0496121_0007045 3300048924 Bacteria 13654
388 Ga0496126_0003887 3300048929 Bacteria 18388
389 Ga0496126_0079527 3300048929 Bacteria 2902
390 Ga0496126_0172161 3300048929 Bacteria 1844
391 Ga0496126_0182269 3300048929 Bacteria 1783
392 Ga0496126_0186327 3300048929 Bacteria 1760
393 Ga0496126_0608175 3300048929 Unclassified 860
394 Ga0501032_0262118 3300049569 Bacteria 1120
395 Ga0501033_0078355 3300049570 Bacteria 2425
396 Ga0501034_0320216 3300049571 Bacteria 1484
397 Ga0501034_1103375 3300049571 Bacteria 674
398 Ga0501036_0010270 3300049572 Bacteria 7723
399 Ga0501038_0011370 3300049574 Bacteria 8123
400 Ga0501039_0001967 3300049575 Bacteria 15240
401 Ga0501040_0001924 3300049576 Bacteria 13350
402 Ga0501041_0001995 3300049577 Bacteria 11477
403 Ga0501042_0001719 3300049578 Bacteria 13087
404 Ga0501046_0003205 3300049580 Bacteria 15056
405 Ga0501047_0021172 3300049581 Bacteria 6245
406 Ga0501047_0572868 3300049581 Bacteria 952
407 Ga0501068_0017710 3300049584 Bacteria 4122
408 Ga0501068_0838176 3300049584 Bacteria 604
409 Ga0501071_0043246 3300049587 Bacteria 3229
410 Ga0501072_0000628 3300049588 Bacteria 25301
411 Ga0501072_0297499 3300049588 Bacteria 1283
412 Ga0501074_0064179 3300049590 Bacteria 2645
413 Ga0501075_0000533 3300049591 Bacteria 23044
414 Ga0501076_0000372 3300049592 Bacteria 27922
415 Ga0501076_0670016 3300049592 Bacteria 856
416 Ga0501077_0008671 3300049593 Bacteria 6303
417 Ga0501209_069371 3300049656 Bacteria 1000
418 Ga0501227_063083 3300049665 Bacteria 953
419 Ga0501235_038016 3300049669 Bacteria 1096
420 Ga0501242_007057 3300049674 Bacteria 1291
421 Ga0501249_003187 3300049679 Bacteria 3302
422 Ga0501079_0001963 3300049741 Bacteria 14747
423 Ga0501079_1380993 3300049741 Bacteria 554
424 Ga0501080_0005923 3300049742 Bacteria 10952
425 Ga0501080_0070325 3300049742 Bacteria 3255
426 Ga0501081_0002188 3300049743 Bacteria 12289
427 Ga0501083_0020884 3300049744 Bacteria 4552
428 Ga0501083_0384964 3300049744 Bacteria 912
429 Ga0501268_000224 3300049765 Bacteria 5614
430 Ga0501270_000874 3300049767 Bacteria 2735
431 Ga0501273_047734 3300049770 Bacteria 648
432 Ga0501044_0005272 3300049823 Bacteria 14380
433 Ga0501045_0000319 3300049824 Bacteria 28139
434 nmdc:mga06z11_64202_c2 3300050494 Unclassified 980
435 nmdc:mga05p37_27032_c1 3300050507 Bacteria 6983
436 nmdc:mga05p37_807171_c1 3300050507 Bacteria 1026
437 nmdc:mga09592_135675_c1 3300050508 Bacteria 2120
438 nmdc:mga06r32_1135486_c1 3300050510 Bacteria 729
439 nmdc:mga06r32_527688_c1 3300050510 Unclassified 1156
440 nmdc:mga06r32_59536_c1 3300050510 Bacteria 3674
441 nmdc:mga06r32_7907_c1 3300050510 Bacteria 9559
442 nmdc:mga08y16_496241_c1 3300050511 Bacteria 1241
443 nmdc:mga08y16_52066_c1 3300050511 Bacteria 4284
444 nmdc:mga0n895_1463_c1 3300050512 Bacteria 17695
445 nmdc:mga0n895_225496_c1 3300050512 Bacteria 1902
446 nmdc:mga0rr50_218773_c1 3300050513 Unclassified 1572
447 nmdc:mga0rr50_439244_c1 3300050513 Bacteria 1105
448 nmdc:mga08x19_944835_c1 3300050514 Bacteria 612
449 nmdc:mga0a205_1209670_c1 3300050515 Bacteria 603
450 nmdc:mga0a205_33329_c1 3300050515 Bacteria 4939
451 nmdc:mga0a205_564_c1 3300050515 Bacteria 29455
452 nmdc:mga0a205_758955_c1 3300050515 Bacteria 818
453 Ga0495601_0857021 3300053077 Unclassified 575
454 Ga0495619_0992570 3300053085 Bacteria 562
455 Ga0500595_052666 3300053119 Bacteria 1255
456 Ga0500595_091187 3300053119 Bacteria 881
457 Ga0500658_0140451 3300053134 Bacteria 1083
458 Ga0500637_0423513 3300053178 Bacteria 684
459 Ga0501084_0001132 3300054114 Bacteria 20798
460 Ga0500661_003446 3300055283 Bacteria 2968
461 Ga0590071_155734 3300059421 Bacteria 593
462 Ga0590077_057635 3300059426 Bacteria 878
463 Ga0501082_0001448 3300060353 Bacteria 20834
464 Ga0501082_0359608 3300060353 Bacteria 1270
465 Ga0466962_0010283 3300061719 Bacteria 4494
466 Ga0466962_0476835 3300061719 Bacteria 630
467 Ga0530510_0002794 3300061734 Bacteria 12006
468 Ga0265762_1157185
469 LJNas_1000217
470 rootH2_10015581
471 rootH2_10143326
472 rootH1_10191755
473 Ga0065704_10190284
474 Ga0065715_10247286
475 Ga0065707_10263396
476 Ga0065707_10548181
477 Ga0070683_101037907
478 Ga0070690_100225571
479 Ga0070670_100345735
480 Ga0068869_100572329
481 Ga0070666_10495752
482 Ga0070680_101681726
483 Ga0070660_101113605
484 Ga0070689_100013813
485 Ga0070669_100630855
486 Ga0070675_100022554
487 Ga0070675_100695747
488 Ga0070675_100711759
489 Ga0070673_100090349
490 Ga0070688_100292120
491 Ga0070659_101858154
492 Ga0070667_100130456
493 Ga0070705_100402689
494 Ga0070700_100276833
495 Ga0070694_100470582
496 Ga0070708_100081255
497 Ga0070708_100536612
498 Ga0070708_101735175
499 Ga0070663_100534775
500 Ga0070678_101985217
501 Ga0070681_10132708
502 Ga0070681_10554941
503 Ga0070681_11576355
504 Ga0068867_100483836
505 Ga0068867_101911231
506 Ga0070685_10024142
507 Ga0070706_100355277
508 Ga0070706_100789624
509 Ga0070706_101424428
510 Ga0070707_100034989
511 Ga0070707_100076912
512 Ga0070707_100432278
513 Ga0070698_100521067
514 Ga0070698_101065012
515 Ga0070699_100037861
516 Ga0070699_100489211
517 Ga0070699_101128716
518 Ga0070679_100030155
519 Ga0070679_100149027
520 Ga0070679_101727245
521 Ga0070684_100051986
522 Ga0070697_100034927
523 Ga0070697_100083936
524 Ga0070697_100435927
525 Ga0070697_100625595
526 Ga0068853_100011484
527 Ga0068853_100062397
528 Ga0068853_100901272
529 Ga0070672_100142112
530 Ga0070672_101396698
531 Ga0070695_100754341
532 Ga0070693_101232159
533 Ga0070665_100017992
534 Ga0070665_100034763
535 Ga0070665_100667207
536 Ga0070665_101152811
537 Ga0070704_100232456
538 Ga0068855_100138127
539 Ga0068855_100411373
540 Ga0070664_100308807
541 Ga0068857_100073062
542 Ga0068854_101144319
543 Ga0068854_101365076
544 Ga0070702_100397211
545 Ga0068852_102513766
546 Ga0068859_100078287
547 Ga0068859_100860780
548 Ga0068864_100111861
549 Ga0068864_100156162
550 Ga0068866_10271459
551 Ga0068863_100040004
552 Ga0068863_100610751
553 Ga0068858_100014953
554 Ga0068858_100402733
555 Ga0068860_100015064
556 Ga0068860_100079591
557 Ga0068860_100080715
558 Ga0068860_101240445
559 Ga0068860_102475810
560 Ga0068862_100970611
561 Ga0068862_100978620
562 Ga0081455_10811370
563 Ga0081539_10018572
564 Ga0070717_10076390
565 Ga0070712_100616136
566 Ga0075367_10291726
567 Ga0075427_10111049
568 Ga0097621_100002203
569 Ga0097621_100085187
570 Ga0097621_101208301
571 Ga0097621_101469548
572 Ga0068871_100022942
573 Ga0068871_100134113
574 Ga0068871_101096524
575 Ga0075428_100040202
576 Ga0075428_100200686
577 Ga0075428_100768670
578 Ga0075428_100981554
579 Ga0075428_101132496
580 Ga0075430_100028696
581 Ga0075430_100753173
582 Ga0075431_100002494
583 Ga0075431_100244424
584 Ga0075431_100287663
585 Ga0075431_100329902
586 Ga0075433_10001345
587 Ga0075434_100009876
588 Ga0075434_100368292
589 Ga0075434_100710857
590 Ga0075434_101208026
591 Ga0075429_100437439
592 Ga0068865_100132935
593 Ga0068865_100359892
594 Ga0068865_100811132
595 Ga0068865_101952123
596 Ga0075436_100636402
597 Ga0075436_101014817
598 Ga0097620_100078284
599 Ga0097620_100860696
600 Ga0075435_100177085
601 Ga0075435_100275489
602 Ga0075435_100542419
603 Ga0105240_10028885
604 Ga0105240_10949050
605 Ga0105240_12436459
606 Ga0111539_10153343
607 Ga0111539_11319008
608 Ga0111539_11916175
609 Ga0111539_12541143
610 Ga0111539_12821422
611 Ga0105245_10002865
612 Ga0105247_10506040
613 Ga0114129_10013123
614 Ga0114129_10145952
615 Ga0114129_11187833
616 Ga0114129_11750180
617 Ga0105243_10307969
618 Ga0105241_10005714
619 Ga0105242_10003235
620 Ga0105242_10052033
621 Ga0105248_10005082
622 Ga0105248_10060585
623 Ga0105248_10135444
624 Ga0105248_10229291
625 Ga0105237_10005518
626 Ga0105237_10008009
627 Ga0105237_11034260
628 Ga0105237_11139974
629 Ga0105238_10000854
630 Ga0105249_10074029
631 Ga0105249_10242669
632 Ga0105249_10863551
633 Ga0105249_11665015
634 Ga0105249_12810804
635 Ga0105239_10005088
636 Ga0105239_10526530
637 Ga0105239_11056319
638 Ga0105246_10009998
639 Ga0157370_10029065
640 Ga0157369_12269426
641 Ga0157374_10002659
642 Ga0157374_10317132
643 Ga0157374_11358742
644 Ga0157378_10149561
645 Ga0157378_10326030
646 Ga0163162_10020326
647 Ga0163162_10416211
648 Ga0163162_10421368
649 Ga0163162_11976029
650 Ga0157372_10484694
651 Ga0157375_10057668
652 Ga0157375_10607602
653 Ga0163163_10040450
654 Ga0163163_11010187
655 Ga0163163_11211791
656 Ga0163163_11893564
657 Ga0157380_10228809
658 Ga0157379_10091208
659 Ga0157379_10110142
660 Ga0157379_10675951
661 Ga0157376_10024344
662 Ga0157376_10317967
663 Ga0157376_11233635
664 Ga0157376_11779343
665 Ga0206349_1869766
666 Ga0206351_10950113
667 Ga0206350_11065087
668 Ga0206354_11083946
669 Ga0213876_10152876
670 Ga0224712_10614444
671 Ga0228598_1036342
672 Ga0207653_10014916
673 Ga0207642_10157707
674 Ga0207680_10192950
675 Ga0207680_10761680
676 Ga0207684_10311534
677 Ga0207684_10408188
678 Ga0207654_10010847
679 Ga0207707_10040412
680 Ga0207707_10487375
681 Ga0207707_11149106
682 Ga0207671_10004882
683 Ga0207671_10098838
684 Ga0207671_10116517
685 Ga0207693_10388304
686 Ga0207663_11682088
687 Ga0207657_11122447
688 Ga0207652_10062218
689 Ga0207652_10459139
690 Ga0207646_10001462
691 Ga0207646_10017662
692 Ga0207694_10001849
693 Ga0207650_10811707
694 Ga0207659_10000315
695 Ga0207687_10003540
696 Ga0207686_10096185
697 Ga0207686_10119998
698 Ga0207670_10004682
699 Ga0207704_10011917
700 Ga0207704_10422138
701 Ga0207704_10893146
702 Ga0207691_10090466
703 Ga0207691_10715119
704 Ga0207711_10061287
705 Ga0207711_10354362
706 Ga0207711_10516510
707 Ga0207661_11218800
708 Ga0207679_10312621
709 Ga0207667_10403990
710 Ga0207667_10948443
711 Ga0207667_11730518
712 Ga0207651_10046769
713 Ga0207712_11970796
714 Ga0207640_10258399
715 Ga0207658_10613848
716 Ga0207677_10056293
717 Ga0207703_10017820
718 Ga0207703_10330244
719 Ga0207639_10134739
720 Ga0207639_10381215
721 Ga0207678_10343352
722 Ga0207678_10711948
723 Ga0207708_10311783
724 Ga0207641_10246375
725 Ga0207641_10277873
726 Ga0207641_10307625
727 Ga0207641_11133141
728 Ga0207641_11193800
729 Ga0207648_10007005
730 Ga0207648_12002622
731 Ga0207676_10050284
732 Ga0207674_10002640
733 Ga0207674_10903161
734 Ga0265354_1017579
735 Ga0265357_1019646
736 Ga0268266_10000126
737 Ga0268266_10022824
738 Ga0268266_10077185
739 Ga0268266_10160179
740 Ga0268266_10315234
741 Ga0268265_10748774
742 Ga0268264_10004340
743 Ga0268264_10050170
744 Ga0268264_10108292
745 Ga0268264_10655124
746 Ga0268264_11822889
747 Ga0265334_10133283
748 Ga0265318_10065345
749 Ga0265318_10151381
750 Ga0265318_10381261
751 Ga0265338_10485750
752 Ga0265328_10107473
753 Ga0265320_10043019
754 Ga0265325_10066932
755 Ga0265329_10151040
756 Ga0265331_10021951
757 Ga0265331_10040706
758 Ga0265316_10294765
759 Ga0265316_10361553
760 Ga0265316_10910958
761 Ga0307513_10086579
762 Ga0307408_100120148
763 Ga0307408_100161875
764 Ga0265313_10003436
765 Ga0265313_10006899
766 Ga0265314_10063922
767 Ga0265342_10161208
768 Ga0307405_10026097
769 Ga0307405_10173523
770 Ga0307413_10016978
771 Ga0307413_10091375
772 Ga0307413_10101037
773 Ga0307413_11651987
774 Ga0307410_10028417
775 Ga0307410_10176143
776 Ga0307410_10919975
777 Ga0307406_10034886
778 Ga0307407_10038472
779 Ga0307412_10073299
780 Ga0307412_10362075
781 Ga0307409_100021867
782 Ga0307409_100466185
783 Ga0307409_101028150
784 Ga0307409_101117530
785 Ga0307416_100357249
786 Ga0307416_101799208
787 Ga0307416_101985824
788 Ga0307414_10031756
789 Ga0307414_10227642
790 Ga0307411_10289206
791 Ga0307411_10316107
792 Ga0307415_100015078
793 Ga0307415_100852281
794 Ga0307510_10186164
795 Ga0307510_10186987
796 Ga0373954_0089894
797 Ga0373933_0149840
798 Ga0373937_0493453
799 Ga0395899_0891197
800 Ga0395900_1311167
801 Ga0395905_0193255
802 Ga0436365_1061670
803 Ga0436360_0732168
804 Ga0436361_0600343
805 Ga0436362_0235024
806 Ga0451853_0008623
807 Ga0451577_0715024
808 Ga0466969_0000059
809 Ga0466969_0026022
810 Ga0466972_0015982
811 Ga0466966_0006626
812 Ga0466966_0054789
813 Ga0466961_0075396
814 Ga0466963_0329797
815 Ga0466964_0000044
816 Ga0453684_0029558
817 Ga0466971_0504249
818 Ga0466968_0000333
819 Ga0466970_0000365
820 Ga0466957_0110921
821 Ga0466959_0012728
822 Ga0466959_0069044
823 Ga0451576_0088798
824 Ga0451576_0267597
825 Ga0451576_0964441
826 Ga0466958_0365836
827 Ga0466958_0718834
828 Ga0495629_0563204
829 Ga0495629_0725007
830 Ga0495580_0016074
831 Ga0495580_0620581
832 Ga0495639_0356903
833 Ga0495630_0531165
834 Ga0495665_0377200
835 Ga0495635_0208754
836 Ga0495635_1085026
837 Ga0495659_0003126
838 Ga0495658_0390732
839 Ga0495669_0098695
840 Ga0495670_0402168
841 Ga0495672_0168958
842 Ga0495672_0372579
843 Ga0495675_0687265
844 Ga0495684_0306173
845 Ga0495686_0020675
846 Ga0495602_0263840
847 Ga0495614_0428379
848 Ga0496102_0555502
849 Ga0496104_1567859
850 Ga0496105_0265502
851 Ga0496107_0623746
852 Ga0496110_1309289
853 Ga0496119_0437180
854 Ga0496121_0007045
855 Ga0496126_0003887
856 Ga0496126_0079527
857 Ga0496126_0172161
858 Ga0496126_0182269
859 Ga0496126_0186327
860 Ga0496126_0608175
861 Ga0501032_0262118
862 Ga0501033_0078355
863 Ga0501034_0320216
864 Ga0501034_1103375
865 Ga0501036_0010270
866 Ga0501038_0011370
867 Ga0501039_0001967
868 Ga0501040_0001924
869 Ga0501041_0001995
870 Ga0501042_0001719
871 Ga0501046_0003205
872 Ga0501047_0021172
873 Ga0501047_0572868
874 Ga0501068_0017710
875 Ga0501068_0838176
876 Ga0501071_0043246
877 Ga0501072_0000628
878 Ga0501072_0297499
879 Ga0501074_0064179
880 Ga0501075_0000533
881 Ga0501076_0000372
882 Ga0501076_0670016
883 Ga0501077_0008671
884 Ga0501209_069371
885 Ga0501227_063083
886 Ga0501235_038016
887 Ga0501242_007057
888 Ga0501249_003187
889 Ga0501079_0001963
890 Ga0501079_1380993
891 Ga0501080_0005923
892 Ga0501080_0070325
893 Ga0501081_0002188
894 Ga0501083_0020884
895 Ga0501083_0384964
896 Ga0501268_000224
897 Ga0501270_000874
898 Ga0501273_047734
899 Ga0501044_0005272
900 Ga0501045_0000319
901 nmdc:mga06z11_64202_c2
902 nmdc:mga05p37_27032_c1
903 nmdc:mga05p37_807171_c1
904 nmdc:mga09592_135675_c1
905 nmdc:mga06r32_1135486_c1
906 nmdc:mga06r32_527688_c1
907 nmdc:mga06r32_59536_c1
908 nmdc:mga06r32_7907_c1
909 nmdc:mga08y16_496241_c1
910 nmdc:mga08y16_52066_c1
911 nmdc:mga0n895_1463_c1
912 nmdc:mga0n895_225496_c1
913 nmdc:mga0rr50_218773_c1
914 nmdc:mga0rr50_439244_c1
915 nmdc:mga08x19_944835_c1
916 nmdc:mga0a205_1209670_c1
917 nmdc:mga0a205_33329_c1
918 nmdc:mga0a205_564_c1
919 nmdc:mga0a205_758955_c1
920 Ga0495601_0857021
921 Ga0495619_0992570
922 Ga0500595_052666
923 Ga0500595_091187
924 Ga0500658_0140451
925 Ga0500637_0423513
926 Ga0501084_0001132
927 Ga0500661_003446
928 Ga0590071_155734
929 Ga0590077_057635
930 Ga0501082_0001448
931 Ga0501082_0359608
932 Ga0466962_0010283
933 Ga0466962_0476835
934 Ga0530510_0002794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

2

126

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a2l-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae protein orfy, pfam duf336 0.9443 6 136
6bws-assembly1.cif.gz_B-2 crystal structure of efga from methylobacterium extorquens 0.9416 5 133
4nkp-assembly1.cif.gz_B crystal structure of a putative extracellular heme-binding protein (despig_02683) from desulfovibrio piger atcc 29098 at 1.24 a resolution 0.9349 5 132
3fpv-assembly1.cif.gz_C crystal structure of hbps 0.927 6 132
5cx7-assembly1.cif.gz_B crystal structure of pduoc:heme complex 0.9243 5 133
ID Description Score Start End Superfamily
2a2lA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9443 6 136 3.30.450.150
6c0zB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.937 5 136 3.30.450.150
3fpvA01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9281 6 132 3.30.450.150
4nkpD01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9255 6 132 3.30.450.150
5cx7B00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9243 5 133 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A3S4CAV0-F1-model_v4 Heme-binding protein 0.965 6 134
AF-A0A7Y9GNA0-F1-model_v4 Uncharacterized protein GlcG (DUF336 family) 0.9647 6 136
AF-A0A1Z4TUW8-F1-model_v4 deleted 0.964 5 134
AF-A0A369VSZ3-F1-model_v4 Heme-binding protein 0.964 6 134
AF-A0A837D5N6-F1-model_v4 ATP:cob(I)alamin adenosyltransferase 0.9635 5 134 GO:0016740

Map