F435432

General Info

Members Datasets Scaffolds Average Seq Length
403 274 806 89

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0475413|Ga0373934_0475413_197_490
Length 97
Sequence MAHKKGVGSSRNGRDSKPKMLGVKRFDGQLVHSGSVLVRQMGTRFNPGRNVGLGRDFTLFAKVDGTVKFEWESRTKKRVSVYPVAAEQPVAETAATA

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
175 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
176 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
221 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
239 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
249 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 8.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 2.98
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 25.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0475413 3300035086 Bacteria 525
2 Ga0006759J45824_1073712 3300003163 Bacteria 699
3 rootH1_10090753 3300003323 Bacteria 1682
4 Ga0058863_11942208 3300004799 Bacteria 651
5 Ga0058861_11839426 3300004800 Unclassified 1184
6 Ga0058860_11751730 3300004801 Unclassified 552
7 Ga0070658_10146961 3300005327 Bacteria 1972
8 Ga0070676_10458010 3300005328 Bacteria 898
9 Ga0070683_100448366 3300005329 Bacteria 1231
10 Ga0070683_100917796 3300005329 Unclassified 840
11 Ga0070670_100082848 3300005331 Bacteria 2756
12 Ga0070670_100309411 3300005331 Unclassified 1383
13 Ga0068869_101715967 3300005334 Bacteria 561
14 Ga0070666_10831525 3300005335 Bacteria 681
15 Ga0070689_100894511 3300005340 Bacteria 785
16 Ga0070687_100532809 3300005343 Bacteria 796
17 Ga0070692_10423615 3300005345 Bacteria 846
18 Ga0070692_11090303 3300005345 Bacteria 563
19 Ga0070668_101363058 3300005347 Bacteria 646
20 Ga0070669_100484253 3300005353 Bacteria 1024
21 Ga0070675_100290741 3300005354 Unclassified 1438
22 Ga0070671_100090878 3300005355 Unclassified 2556
23 Ga0070671_100612514 3300005355 Unclassified 941
24 Ga0070674_101288735 3300005356 Bacteria 651
25 Ga0070674_101401977 3300005356 Bacteria 626
26 Ga0070673_100112750 3300005364 Unclassified 2257
27 Ga0070673_100541250 3300005364 Unclassified 1057
28 Ga0070673_100584623 3300005364 Bacteria 1017
29 Ga0070667_100378687 3300005367 Bacteria 1285
30 Ga0070667_101847918 3300005367 Bacteria 569
31 Ga0070709_10396807 3300005434 Bacteria 1029
32 Ga0070709_10421937 3300005434 Unclassified 1000
33 Ga0070701_10681896 3300005438 Unclassified 689
34 Ga0070711_100561903 3300005439 Bacteria 948
35 Ga0070705_100147733 3300005440 Bacteria 1555
36 Ga0070708_101653769 3300005445 Bacteria 595
37 Ga0070708_102105080 3300005445 Unclassified 522
38 Ga0070663_100077568 3300005455 Bacteria 2433
39 Ga0070678_100020638 3300005456 Bacteria 4326
40 Ga0070678_100795888 3300005456 Unclassified 858
41 Ga0070678_100802129 3300005456 Unclassified 855
42 Ga0070662_100338033 3300005457 Bacteria 1231
43 Ga0068867_100104506 3300005459 Bacteria 2168
44 Ga0070685_10039214 3300005466 Bacteria 2690
45 Ga0070706_100085258 3300005467 Bacteria 2927
46 Ga0070706_100347379 3300005467 Bacteria 1383
47 Ga0070706_100964480 3300005467 Bacteria 787
48 Ga0070706_101417321 3300005467 Bacteria 636
49 Ga0070707_101513779 3300005468 Bacteria 638
50 Ga0070699_100717637 3300005518 Bacteria 914
51 Ga0070684_100153648 3300005535 Bacteria 2086
52 Ga0070697_100341144 3300005536 Bacteria 1293
53 Ga0070672_101202682 3300005543 Unclassified 675
54 Ga0070686_100786111 3300005544 Bacteria 766
55 Ga0070696_100130351 3300005546 Bacteria 1829
56 Ga0070696_102018619 3300005546 Bacteria 501
57 Ga0070665_100536994 3300005548 Bacteria 1181
58 Ga0070704_100779100 3300005549 Bacteria 853
59 Ga0070704_101623806 3300005549 Bacteria 596
60 Ga0068855_101711803 3300005563 Bacteria 641
61 Ga0068857_100764434 3300005577 Bacteria 921
62 Ga0068856_100056349 3300005614 Bacteria 3878
63 Ga0070702_100261184 3300005615 Unclassified 1179
64 Ga0070702_101405610 3300005615 Unclassified 571
65 Ga0068859_101901957 3300005617 Bacteria 657
66 Ga0068859_102416352 3300005617 Unclassified 579
67 Ga0068864_100212108 3300005618 Unclassified 1783
68 Ga0068864_100324885 3300005618 Bacteria 1446
69 Ga0068864_100909203 3300005618 Bacteria 869
70 Ga0068864_101290268 3300005618 Bacteria 730
71 Ga0068861_100627082 3300005719 Bacteria 990
72 Ga0068861_101936256 3300005719 Unclassified 587
73 Ga0068863_100024529 3300005841 Bacteria 5752
74 Ga0068863_100418725 3300005841 Bacteria 1312
75 Ga0068863_100904126 3300005841 Unclassified 883
76 Ga0068858_100181837 3300005842 Bacteria 1986
77 Ga0068858_100926566 3300005842 Bacteria 852
78 Ga0068858_101548812 3300005842 Bacteria 654
79 Ga0068860_101824298 3300005843 Unclassified 630
80 Ga0068862_100052746 3300005844 Bacteria 3481
81 Ga0070717_10863750 3300006028 Unclassified 823
82 Ga0070717_11557044 3300006028 Unclassified 599
83 Ga0070712_100543883 3300006175 Bacteria 978
84 Ga0075366_10195086 3300006195 Bacteria 1231
85 Ga0097621_100210954 3300006237 Bacteria 1690
86 Ga0097621_101318192 3300006237 Bacteria 682
87 Ga0068871_101506704 3300006358 Bacteria 636
88 Ga0068871_101541955 3300006358 Unclassified 628
89 Ga0068871_101679889 3300006358 Bacteria 602
90 Ga0075430_100068671 3300006846 Bacteria 2973
91 Ga0075431_100012702 3300006847 Bacteria 8504
92 Ga0075431_100031522 3300006847 Bacteria 5460
93 Ga0075433_10585251 3300006852 Bacteria 980
94 Ga0075434_100077421 3300006871 Bacteria 3321
95 Ga0075434_101428074 3300006871 Unclassified 702
96 Ga0075429_100076476 3300006880 Bacteria 2916
97 Ga0075429_100227924 3300006880 Bacteria 1632
98 Ga0075429_100527213 3300006880 Bacteria 1035
99 Ga0068865_100532395 3300006881 Unclassified 984
100 Ga0075436_100140145 3300006914 Bacteria 1699
101 Ga0075436_101080479 3300006914 Bacteria 604
102 Ga0097620_101901174 3300006931 Bacteria 657
103 Ga0097620_102415076 3300006931 Unclassified 579
104 Ga0075435_100170492 3300007076 Unclassified 1836
105 Ga0099794_10160266 3300007265 Unclassified 1144
106 Ga0099795_10052910 3300007788 Bacteria 1485
107 Ga0099795_10436978 3300007788 Unclassified 600
108 Ga0105240_10250022 3300009093 Unclassified 2051
109 Ga0105240_10617478 3300009093 Bacteria 1192
110 Ga0105240_11772545 3300009093 Bacteria 644
111 Ga0111539_10020146 3300009094 Bacteria 8218
112 Ga0105245_11662909 3300009098 Bacteria 690
113 Ga0114129_11130738 3300009147 Bacteria 979
114 Ga0114129_11817639 3300009147 Bacteria 741
115 Ga0114129_12190982 3300009147 Unclassified 665
116 Ga0114129_12624229 3300009147 Unclassified 601
117 Ga0114129_13106478 3300009147 Bacteria 543
118 Ga0105243_10722829 3300009148 Unclassified 973
119 Ga0105241_10723931 3300009174 Bacteria 910
120 Ga0105242_10158665 3300009176 Bacteria 1978
121 Ga0105242_11128695 3300009176 Unclassified 799
122 Ga0105237_11882273 3300009545 Bacteria 606
123 Ga0105249_11353698 3300009553 Bacteria 784
124 Ga0105249_13189440 3300009553 Bacteria 527
125 Ga0105239_12895093 3300010375 Bacteria 560
126 Ga0157370_10298752 3300013104 Bacteria 1487
127 Ga0157374_10040637 3300013296 Bacteria 4284
128 Ga0157378_10004803 3300013297 Bacteria 11845
129 Ga0163163_11113761 3300014325 Unclassified 852
130 Ga0163163_11804548 3300014325 Bacteria 672
131 Ga0157380_10191990 3300014326 Unclassified 1804
132 Ga0157379_11097158 3300014968 Unclassified 762
133 Ga0157376_12854009 3300014969 Unclassified 523
134 Ga0206356_10382313 3300020070 Unclassified 1332
135 Ga0206349_1908274 3300020075 Unclassified 1453
136 Ga0206355_1379097 3300020076 Unclassified 1359
137 Ga0206354_10163564 3300020081 Unclassified 1344
138 Ga0206353_10095485 3300020082 Unclassified 1343
139 Ga0213875_10296285 3300021388 Unclassified 765
140 Ga0213871_10272047 3300021441 Unclassified 542
141 Ga0224712_10071260 3300022467 Bacteria 1412
142 Ga0224712_10081199 3300022467 Unclassified 1338
143 Ga0228598_1096868 3300024227 Bacteria 595
144 Ga0207656_10426643 3300025321 Unclassified 668
145 Ga0207680_11258223 3300025903 Bacteria 527
146 Ga0207680_11338721 3300025903 Bacteria 509
147 Ga0207699_10235800 3300025906 Bacteria 1255
148 Ga0207699_11260641 3300025906 Bacteria 547
149 Ga0207705_10153923 3300025909 Bacteria 1724
150 Ga0207684_10346981 3300025910 Bacteria 1278
151 Ga0207684_10576250 3300025910 Bacteria 962
152 Ga0207684_10729422 3300025910 Bacteria 841
153 Ga0207695_10240411 3300025913 Bacteria 1712
154 Ga0207693_10507227 3300025915 Bacteria 942
155 Ga0207693_10852738 3300025915 Bacteria 700
156 Ga0207662_10288289 3300025918 Bacteria 1088
157 Ga0207646_10743960 3300025922 Unclassified 875
158 Ga0207650_10334721 3300025925 Unclassified 1242
159 Ga0207644_10045023 3300025931 Unclassified 3138
160 Ga0207686_10532395 3300025934 Unclassified 916
161 Ga0207686_10757564 3300025934 Unclassified 775
162 Ga0207709_11792991 3300025935 Unclassified 510
163 Ga0207669_11114717 3300025937 Bacteria 666
164 Ga0207704_10325926 3300025938 Bacteria 1187
165 Ga0207665_10759149 3300025939 Bacteria 765
166 Ga0207661_10044347 3300025944 Bacteria 3514
167 Ga0207667_11162684 3300025949 Bacteria 753
168 Ga0207651_10136207 3300025960 Unclassified 1889
169 Ga0207651_11440772 3300025960 Bacteria 620
170 Ga0207668_11237508 3300025972 Bacteria 671
171 Ga0207658_10877804 3300025986 Unclassified 816
172 Ga0207658_11984358 3300025986 Bacteria 530
173 Ga0207677_10033227 3300026023 Bacteria 3325
174 Ga0207703_10709414 3300026035 Bacteria 957
175 Ga0207703_11174455 3300026035 Bacteria 738
176 Ga0207639_11163130 3300026041 Bacteria 724
177 Ga0207678_10023142 3300026067 Bacteria 5435
178 Ga0207702_10104770 3300026078 Bacteria 2504
179 Ga0207641_10087745 3300026088 Bacteria 2714
180 Ga0207641_11436905 3300026088 Bacteria 691
181 Ga0207648_10146872 3300026089 Bacteria 2080
182 Ga0207676_10173814 3300026095 Unclassified 1879
183 Ga0207676_10892922 3300026095 Bacteria 871
184 Ga0207676_11094877 3300026095 Unclassified 787
185 Ga0207674_10929225 3300026116 Bacteria 838
186 Ga0207675_100405716 3300026118 Bacteria 1344
187 Ga0207675_101498865 3300026118 Bacteria 695
188 Ga0207683_10010975 3300026121 Bacteria 7725
189 Ga0209973_1053063 3300027252 Bacteria 614
190 Ga0209969_1080469 3300027360 Bacteria 521
191 Ga0209982_1069266 3300027552 Bacteria 577
192 Ga0209971_1002099 3300027682 Bacteria 4849
193 Ga0209974_10016964 3300027876 Bacteria 2417
194 Ga0207428_10139658 3300027907 Bacteria 1850
195 Ga0268266_10474925 3300028379 Bacteria 1191
196 Ga0268264_10063905 3300028381 Bacteria 3096
197 Ga0268264_10456722 3300028381 Bacteria 1239
198 Ga0265337_1141500 3300028556 Bacteria 651
199 Ga0265319_1000237 3300028563 Bacteria 41411
200 Ga0265318_10000048 3300028577 Bacteria 120525
201 Ga0265318_10001575 3300028577 Bacteria 13213
202 Ga0265770_1035745 3300030878 Unclassified 851
203 Ga0265765_1001045 3300030879 Bacteria 2455
204 Ga0265760_10280756 3300031090 Unclassified 585
205 Ga0265330_10000731 3300031235 Bacteria 20692
206 Ga0265330_10090729 3300031235 Bacteria 1312
207 Ga0265330_10105865 3300031235 Bacteria 1203
208 Ga0265332_10001106 3300031238 Bacteria 15717
209 Ga0265332_10004629 3300031238 Bacteria 6433
210 Ga0265332_10208154 3300031238 Bacteria 812
211 Ga0265328_10009446 3300031239 Bacteria 3970
212 Ga0265320_10003286 3300031240 Bacteria 10916
213 Ga0265320_10036354 3300031240 Bacteria 2489
214 Ga0265325_10000797 3300031241 Bacteria 22771
215 Ga0265329_10000187 3300031242 Bacteria 31681
216 Ga0265340_10000852 3300031247 Bacteria 17345
217 Ga0265340_10019426 3300031247 Bacteria 3499
218 Ga0265339_10000140 3300031249 Bacteria 60076
219 Ga0265339_10008062 3300031249 Bacteria 6732
220 Ga0265339_10121351 3300031249 Bacteria 1343
221 Ga0265331_10000538 3300031250 Bacteria 34763
222 Ga0265316_10001647 3300031344 Bacteria 23783
223 Ga0265316_10001751 3300031344 Bacteria 22986
224 Ga0307509_10979564 3300031507 Unclassified 512
225 Ga0307408_100028371 3300031548 Bacteria 3867
226 Ga0307408_101582332 3300031548 Bacteria 622
227 Ga0265313_10000389 3300031595 Bacteria 47320
228 Ga0265313_10000627 3300031595 Bacteria 36561
229 Ga0307508_10003028 3300031616 Bacteria 17310
230 Ga0307514_10045824 3300031649 Bacteria 3419
231 Ga0316575_10007190 3300031665 Bacteria 4029
232 Ga0316575_10017351 3300031665 Bacteria 2733
233 Ga0316579_10091800 3300031691 Unclassified 1450
234 Ga0265314_10002216 3300031711 Bacteria 20252
235 Ga0265314_10003910 3300031711 Bacteria 14155
236 Ga0265314_10127022 3300031711 Bacteria 1596
237 Ga0265342_10000575 3300031712 Bacteria 38824
238 Ga0265342_10012996 3300031712 Bacteria 5612
239 Ga0316576_10000933 3300031727 Bacteria 14920
240 Ga0316576_10010457 3300031727 Bacteria 6029
241 Ga0316576_10442630 3300031727 Unclassified 960
242 Ga0316576_11300534 3300031727 Unclassified 512
243 Ga0316578_10018945 3300031728 Bacteria 3781
244 Ga0316578_10039090 3300031728 Unclassified 2739
245 Ga0316578_10683681 3300031728 Unclassified 598
246 Ga0307516_10022830 3300031730 Bacteria 6421
247 Ga0316577_10183935 3300031733 Unclassified 1180
248 Ga0307413_10236051 3300031824 Bacteria 1346
249 Ga0307413_10919150 3300031824 Bacteria 744
250 Ga0307410_10006314 3300031852 Bacteria 6386
251 Ga0307410_10182962 3300031852 Bacteria 1588
252 Ga0307406_10257604 3300031901 Unclassified 1318
253 Ga0307406_11161328 3300031901 Bacteria 669
254 Ga0307407_10028472 3300031903 Bacteria 2987
255 Ga0307409_100004670 3300031995 Bacteria 7746
256 Ga0307416_100003916 3300032002 Bacteria 8864
257 Ga0307416_100330249 3300032002 Bacteria 1532
258 Ga0307414_10002615 3300032004 Bacteria 9470
259 Ga0307414_10155602 3300032004 Bacteria 1809
260 Ga0307411_10002752 3300032005 Bacteria 7902
261 Ga0307411_10106342 3300032005 Bacteria 1997
262 Ga0307411_11957169 3300032005 Bacteria 546
263 Ga0307415_100125362 3300032126 Bacteria 1934
264 Ga0316585_10149747 3300032137 Bacteria 770
265 Ga0316580_10026974 3300032139 Unclassified 1776
266 Ga0316593_10008058 3300032168 Bacteria 2922
267 Ga0316593_10061724 3300032168 Unclassified 1282
268 Ga0316593_10111148 3300032168 Bacteria 979
269 Ga0316593_10251248 3300032168 Unclassified 662
270 Ga0316592_1061659 3300033524 Unclassified 842
271 Ga0316588_1060440 3300033528 Unclassified 924
272 Ga0316596_1058419 3300033541 Unclassified 1027
273 Ga0373926_0042267 3300035083 Unclassified 1630
274 Ga0373926_0091021 3300035083 Bacteria 1134
275 Ga0373943_0683840 3300035170 Unclassified 607
276 Ga0373955_0396719 3300035172 Bacteria 838
277 Ga0316574_0011697 3300035398 Bacteria 4997
278 Ga0373927_0034492 3300035695 Bacteria 3292
279 Ga0373947_1191342 3300035725 Bacteria 519
280 Ga0373937_0359546 3300036401 Unclassified 1380
281 Ga0373937_0776053 3300036401 Bacteria 906
282 Ga0316582_0350886 3300036647 Bacteria 1015
283 Ga0316582_1157629 3300036647 Unclassified 527
284 Ga0316584_0569417 3300036712 Bacteria 789
285 Ga0373925_0421712 3300037068 Unclassified 1090
286 Ga0373925_0975206 3300037068 Bacteria 698
287 Ga0395905_0034913 3300037471 Bacteria 4721
288 Ga0436364_0121662 3300037853 Unclassified 784
289 Ga0436365_1085577 3300039437 Bacteria 554
290 Ga0436360_1311080 3300039438 Unclassified 1129
291 Ga0436362_0452241 3300039453 Bacteria 4110
292 Ga0436362_0643637 3300039453 Unclassified 931
293 Ga0436362_1024746 3300039453 Unclassified 608
294 Ga0439436_0213232 3300041404 Bacteria 555
295 Ga0439438_100482 3300041405 Bacteria 702
296 Ga0451791_1768846 3300041451 Bacteria 1071
297 Ga0451793_0178515 3300041452 Bacteria 1556
298 Ga0451797_0646532 3300041453 Bacteria 4415
299 Ga0451797_1498763 3300041453 Bacteria 544
300 Ga0451805_099684 3300041461 Bacteria 820
301 Ga0451807_0309762 3300041486 Bacteria 1498
302 Ga0451807_0800172 3300041486 Unclassified 520
303 Ga0451807_1154829 3300041486 Bacteria 585
304 Ga0451807_2737277 3300041486 Bacteria 1059
305 Ga0451839_0152538 3300041496 Bacteria 738
306 Ga0451839_0772902 3300041496 Bacteria 511
307 Ga0451851_0954374 3300041507 Unclassified 572
308 Ga0439449_0369420 3300042007 Bacteria 544
309 Ga0453683_0001082 3300044673 Bacteria 25130
310 Ga0453683_0839212 3300044673 Bacteria 606
311 Ga0453683_1047964 3300044673 Unclassified 542
312 Ga0466965_0304473 3300044683 Bacteria 865
313 Ga0453684_0366025 3300044712 Bacteria 1622
314 Ga0453684_2215642 3300044712 Bacteria 548
315 Ga0466957_0195943 3300044842 Bacteria 1325
316 Ga0466960_0007015 3300044901 Bacteria 4551
317 Ga0451576_1698099 3300045051 Bacteria 654
318 Ga0451576_2455649 3300045051 Bacteria 533
319 Ga0495608_0460745 3300046511 Bacteria 773
320 Ga0495640_0251228 3300046533 Bacteria 1107
321 Ga0495669_0334779 3300046684 Bacteria 731
322 Ga0495581_0202558 3300047315 Bacteria 1161
323 Ga0495604_0099256 3300047317 Bacteria 2143
324 Ga0495602_0024183 3300048088 Bacteria 5898
325 Ga0496104_0142568 3300048907 Bacteria 2302
326 Ga0496104_1752573 3300048907 Bacteria 523
327 Ga0496106_0652459 3300048909 Bacteria 841
328 Ga0501292_066991 3300049515 Unclassified 661
329 Ga0501298_021410 3300049521 Unclassified 1211
330 Ga0501313_064438 3300049529 Bacteria 523
331 Ga0501317_032295 3300049533 Bacteria 766
332 Ga0501031_0624883 3300049568 Bacteria 693
333 Ga0501036_0107581 3300049572 Bacteria 2358
334 Ga0501037_0512191 3300049573 Bacteria 813
335 Ga0501040_0122165 3300049576 Bacteria 1828
336 Ga0501040_0709091 3300049576 Bacteria 728
337 Ga0501040_0735374 3300049576 Bacteria 714
338 Ga0501041_0056686 3300049577 Bacteria 2395
339 Ga0501041_0079442 3300049577 Bacteria 2019
340 Ga0501042_0990145 3300049578 Bacteria 613
341 Ga0501046_0154026 3300049580 Unclassified 1733
342 Ga0501047_0019310 3300049581 Bacteria 6539
343 Ga0501067_0332300 3300049583 Bacteria 847
344 Ga0501068_0810423 3300049584 Bacteria 614
345 Ga0501069_0308102 3300049585 Bacteria 929
346 Ga0501069_0730659 3300049585 Unclassified 598
347 Ga0501070_1548442 3300049586 Bacteria 501
348 Ga0501074_0518245 3300049590 Unclassified 845
349 Ga0501075_0025549 3300049591 Bacteria 4339
350 Ga0501075_0784111 3300049591 Bacteria 725
351 Ga0501076_0024218 3300049592 Bacteria 4689
352 Ga0501076_0217222 3300049592 Bacteria 1563
353 Ga0501076_1108075 3300049592 Bacteria 652
354 Ga0501209_155499 3300049656 Unclassified 690
355 Ga0501214_012712 3300049659 Bacteria 965
356 Ga0501223_101490 3300049663 Unclassified 593
357 Ga0501230_044833 3300049667 Unclassified 865
358 Ga0501233_115341 3300049668 Unclassified 722
359 Ga0501257_097291 3300049686 Unclassified 770
360 Ga0501079_0016357 3300049741 Bacteria 5668
361 Ga0501080_0582044 3300049742 Bacteria 995
362 Ga0501081_0026479 3300049743 Bacteria 3911
363 Ga0501083_0765727 3300049744 Bacteria 628
364 Ga0501083_0776449 3300049744 Bacteria 623
365 Ga0501083_1060721 3300049744 Bacteria 527
366 Ga0501264_046130 3300049761 Unclassified 549
367 Ga0501279_009412 3300049775 Bacteria 1308
368 Ga0501045_0132545 3300049824 Bacteria 1853
369 Ga0501045_0931487 3300049824 Bacteria 638
370 nmdc:mga0k408_181579_c1 3300050493 Bacteria 1255
371 nmdc:mga05p37_784364_c1 3300050507 Bacteria 1045
372 nmdc:mga09592_135056_c1 3300050508 Bacteria 2124
373 nmdc:mga09592_1726576_c1 3300050508 Bacteria 504
374 nmdc:mga09592_593912_c1 3300050508 Bacteria 949
375 nmdc:mga09592_708105_c1 3300050508 Bacteria 857
376 nmdc:mga09592_825863_c1 3300050508 Bacteria 783
377 nmdc:mga0qj67_590796_c1 3300050509 Archaea 888
378 nmdc:mga06r32_122873_c1 3300050510 Bacteria 2562
379 nmdc:mga06r32_625786_c1 3300050510 Bacteria 1046
380 nmdc:mga08y16_13432_c1 3300050511 Bacteria 8617
381 nmdc:mga0n895_1462124_c1 3300050512 Bacteria 650
382 nmdc:mga0n895_75889_c1 3300050512 Bacteria 3342
383 nmdc:mga08x19_1105213_c1 3300050514 Bacteria 562
384 nmdc:mga08x19_182752_c1 3300050514 Bacteria 1432
385 nmdc:mga0a205_1106184_c1 3300050515 Bacteria 640
386 nmdc:mga0a205_199480_c1 3300050515 Bacteria 1891
387 Ga0495612_0524967 3300053078 Unclassified 544
388 Ga0495655_0296364 3300053083 Bacteria 555
389 Ga0495595_0412103 3300053084 Bacteria 685
390 Ga0500555_100347 3300053103 Bacteria 735
391 Ga0501084_0153918 3300054114 Unclassified 1939
392 Ga0587066_225099 3300059490 Bacteria 505
393 Ga0587077_052797 3300059493 Bacteria 856
394 Ga0587080_166046 3300059503 Unclassified 521
395 Ga0587109_114369 3300059624 Bacteria 634
396 Ga0587109_127460 3300059624 Bacteria 610
397 Ga0587128_069159 3300059630 Unclassified 684
398 Ga0587062_049751 3300059639 Bacteria 706
399 Ga0587075_060919 3300059644 Unclassified 680
400 Ga0587071_101543 3300060344 Unclassified 666
401 Ga0587111_0200531 3300060346 Bacteria 565
402 Ga0501082_0014175 3300060353 Bacteria 6861
403 Ga0501082_1892693 3300060353 Bacteria 520
404 Ga0373934_0475413
405 Ga0006759J45824_1073712
406 rootH1_10090753
407 Ga0058863_11942208
408 Ga0058861_11839426
409 Ga0058860_11751730
410 Ga0070658_10146961
411 Ga0070676_10458010
412 Ga0070683_100448366
413 Ga0070683_100917796
414 Ga0070670_100082848
415 Ga0070670_100309411
416 Ga0068869_101715967
417 Ga0070666_10831525
418 Ga0070689_100894511
419 Ga0070687_100532809
420 Ga0070692_10423615
421 Ga0070692_11090303
422 Ga0070668_101363058
423 Ga0070669_100484253
424 Ga0070675_100290741
425 Ga0070671_100090878
426 Ga0070671_100612514
427 Ga0070674_101288735
428 Ga0070674_101401977
429 Ga0070673_100112750
430 Ga0070673_100541250
431 Ga0070673_100584623
432 Ga0070667_100378687
433 Ga0070667_101847918
434 Ga0070709_10396807
435 Ga0070709_10421937
436 Ga0070701_10681896
437 Ga0070711_100561903
438 Ga0070705_100147733
439 Ga0070708_101653769
440 Ga0070708_102105080
441 Ga0070663_100077568
442 Ga0070678_100020638
443 Ga0070678_100795888
444 Ga0070678_100802129
445 Ga0070662_100338033
446 Ga0068867_100104506
447 Ga0070685_10039214
448 Ga0070706_100085258
449 Ga0070706_100347379
450 Ga0070706_100964480
451 Ga0070706_101417321
452 Ga0070707_101513779
453 Ga0070699_100717637
454 Ga0070684_100153648
455 Ga0070697_100341144
456 Ga0070672_101202682
457 Ga0070686_100786111
458 Ga0070696_100130351
459 Ga0070696_102018619
460 Ga0070665_100536994
461 Ga0070704_100779100
462 Ga0070704_101623806
463 Ga0068855_101711803
464 Ga0068857_100764434
465 Ga0068856_100056349
466 Ga0070702_100261184
467 Ga0070702_101405610
468 Ga0068859_101901957
469 Ga0068859_102416352
470 Ga0068864_100212108
471 Ga0068864_100324885
472 Ga0068864_100909203
473 Ga0068864_101290268
474 Ga0068861_100627082
475 Ga0068861_101936256
476 Ga0068863_100024529
477 Ga0068863_100418725
478 Ga0068863_100904126
479 Ga0068858_100181837
480 Ga0068858_100926566
481 Ga0068858_101548812
482 Ga0068860_101824298
483 Ga0068862_100052746
484 Ga0070717_10863750
485 Ga0070717_11557044
486 Ga0070712_100543883
487 Ga0075366_10195086
488 Ga0097621_100210954
489 Ga0097621_101318192
490 Ga0068871_101506704
491 Ga0068871_101541955
492 Ga0068871_101679889
493 Ga0075430_100068671
494 Ga0075431_100012702
495 Ga0075431_100031522
496 Ga0075433_10585251
497 Ga0075434_100077421
498 Ga0075434_101428074
499 Ga0075429_100076476
500 Ga0075429_100227924
501 Ga0075429_100527213
502 Ga0068865_100532395
503 Ga0075436_100140145
504 Ga0075436_101080479
505 Ga0097620_101901174
506 Ga0097620_102415076
507 Ga0075435_100170492
508 Ga0099794_10160266
509 Ga0099795_10052910
510 Ga0099795_10436978
511 Ga0105240_10250022
512 Ga0105240_10617478
513 Ga0105240_11772545
514 Ga0111539_10020146
515 Ga0105245_11662909
516 Ga0114129_11130738
517 Ga0114129_11817639
518 Ga0114129_12190982
519 Ga0114129_12624229
520 Ga0114129_13106478
521 Ga0105243_10722829
522 Ga0105241_10723931
523 Ga0105242_10158665
524 Ga0105242_11128695
525 Ga0105237_11882273
526 Ga0105249_11353698
527 Ga0105249_13189440
528 Ga0105239_12895093
529 Ga0157370_10298752
530 Ga0157374_10040637
531 Ga0157378_10004803
532 Ga0163163_11113761
533 Ga0163163_11804548
534 Ga0157380_10191990
535 Ga0157379_11097158
536 Ga0157376_12854009
537 Ga0206356_10382313
538 Ga0206349_1908274
539 Ga0206355_1379097
540 Ga0206354_10163564
541 Ga0206353_10095485
542 Ga0213875_10296285
543 Ga0213871_10272047
544 Ga0224712_10071260
545 Ga0224712_10081199
546 Ga0228598_1096868
547 Ga0207656_10426643
548 Ga0207680_11258223
549 Ga0207680_11338721
550 Ga0207699_10235800
551 Ga0207699_11260641
552 Ga0207705_10153923
553 Ga0207684_10346981
554 Ga0207684_10576250
555 Ga0207684_10729422
556 Ga0207695_10240411
557 Ga0207693_10507227
558 Ga0207693_10852738
559 Ga0207662_10288289
560 Ga0207646_10743960
561 Ga0207650_10334721
562 Ga0207644_10045023
563 Ga0207686_10532395
564 Ga0207686_10757564
565 Ga0207709_11792991
566 Ga0207669_11114717
567 Ga0207704_10325926
568 Ga0207665_10759149
569 Ga0207661_10044347
570 Ga0207667_11162684
571 Ga0207651_10136207
572 Ga0207651_11440772
573 Ga0207668_11237508
574 Ga0207658_10877804
575 Ga0207658_11984358
576 Ga0207677_10033227
577 Ga0207703_10709414
578 Ga0207703_11174455
579 Ga0207639_11163130
580 Ga0207678_10023142
581 Ga0207702_10104770
582 Ga0207641_10087745
583 Ga0207641_11436905
584 Ga0207648_10146872
585 Ga0207676_10173814
586 Ga0207676_10892922
587 Ga0207676_11094877
588 Ga0207674_10929225
589 Ga0207675_100405716
590 Ga0207675_101498865
591 Ga0207683_10010975
592 Ga0209973_1053063
593 Ga0209969_1080469
594 Ga0209982_1069266
595 Ga0209971_1002099
596 Ga0209974_10016964
597 Ga0207428_10139658
598 Ga0268266_10474925
599 Ga0268264_10063905
600 Ga0268264_10456722
601 Ga0265337_1141500
602 Ga0265319_1000237
603 Ga0265318_10000048
604 Ga0265318_10001575
605 Ga0265770_1035745
606 Ga0265765_1001045
607 Ga0265760_10280756
608 Ga0265330_10000731
609 Ga0265330_10090729
610 Ga0265330_10105865
611 Ga0265332_10001106
612 Ga0265332_10004629
613 Ga0265332_10208154
614 Ga0265328_10009446
615 Ga0265320_10003286
616 Ga0265320_10036354
617 Ga0265325_10000797
618 Ga0265329_10000187
619 Ga0265340_10000852
620 Ga0265340_10019426
621 Ga0265339_10000140
622 Ga0265339_10008062
623 Ga0265339_10121351
624 Ga0265331_10000538
625 Ga0265316_10001647
626 Ga0265316_10001751
627 Ga0307509_10979564
628 Ga0307408_100028371
629 Ga0307408_101582332
630 Ga0265313_10000389
631 Ga0265313_10000627
632 Ga0307508_10003028
633 Ga0307514_10045824
634 Ga0316575_10007190
635 Ga0316575_10017351
636 Ga0316579_10091800
637 Ga0265314_10002216
638 Ga0265314_10003910
639 Ga0265314_10127022
640 Ga0265342_10000575
641 Ga0265342_10012996
642 Ga0316576_10000933
643 Ga0316576_10010457
644 Ga0316576_10442630
645 Ga0316576_11300534
646 Ga0316578_10018945
647 Ga0316578_10039090
648 Ga0316578_10683681
649 Ga0307516_10022830
650 Ga0316577_10183935
651 Ga0307413_10236051
652 Ga0307413_10919150
653 Ga0307410_10006314
654 Ga0307410_10182962
655 Ga0307406_10257604
656 Ga0307406_11161328
657 Ga0307407_10028472
658 Ga0307409_100004670
659 Ga0307416_100003916
660 Ga0307416_100330249
661 Ga0307414_10002615
662 Ga0307414_10155602
663 Ga0307411_10002752
664 Ga0307411_10106342
665 Ga0307411_11957169
666 Ga0307415_100125362
667 Ga0316585_10149747
668 Ga0316580_10026974
669 Ga0316593_10008058
670 Ga0316593_10061724
671 Ga0316593_10111148
672 Ga0316593_10251248
673 Ga0316592_1061659
674 Ga0316588_1060440
675 Ga0316596_1058419
676 Ga0373926_0042267
677 Ga0373926_0091021
678 Ga0373943_0683840
679 Ga0373955_0396719
680 Ga0316574_0011697
681 Ga0373927_0034492
682 Ga0373947_1191342
683 Ga0373937_0359546
684 Ga0373937_0776053
685 Ga0316582_0350886
686 Ga0316582_1157629
687 Ga0316584_0569417
688 Ga0373925_0421712
689 Ga0373925_0975206
690 Ga0395905_0034913
691 Ga0436364_0121662
692 Ga0436365_1085577
693 Ga0436360_1311080
694 Ga0436362_0452241
695 Ga0436362_0643637
696 Ga0436362_1024746
697 Ga0439436_0213232
698 Ga0439438_100482
699 Ga0451791_1768846
700 Ga0451793_0178515
701 Ga0451797_0646532
702 Ga0451797_1498763
703 Ga0451805_099684
704 Ga0451807_0309762
705 Ga0451807_0800172
706 Ga0451807_1154829
707 Ga0451807_2737277
708 Ga0451839_0152538
709 Ga0451839_0772902
710 Ga0451851_0954374
711 Ga0439449_0369420
712 Ga0453683_0001082
713 Ga0453683_0839212
714 Ga0453683_1047964
715 Ga0466965_0304473
716 Ga0453684_0366025
717 Ga0453684_2215642
718 Ga0466957_0195943
719 Ga0466960_0007015
720 Ga0451576_1698099
721 Ga0451576_2455649
722 Ga0495608_0460745
723 Ga0495640_0251228
724 Ga0495669_0334779
725 Ga0495581_0202558
726 Ga0495604_0099256
727 Ga0495602_0024183
728 Ga0496104_0142568
729 Ga0496104_1752573
730 Ga0496106_0652459
731 Ga0501292_066991
732 Ga0501298_021410
733 Ga0501313_064438
734 Ga0501317_032295
735 Ga0501031_0624883
736 Ga0501036_0107581
737 Ga0501037_0512191
738 Ga0501040_0122165
739 Ga0501040_0709091
740 Ga0501040_0735374
741 Ga0501041_0056686
742 Ga0501041_0079442
743 Ga0501042_0990145
744 Ga0501046_0154026
745 Ga0501047_0019310
746 Ga0501067_0332300
747 Ga0501068_0810423
748 Ga0501069_0308102
749 Ga0501069_0730659
750 Ga0501070_1548442
751 Ga0501074_0518245
752 Ga0501075_0025549
753 Ga0501075_0784111
754 Ga0501076_0024218
755 Ga0501076_0217222
756 Ga0501076_1108075
757 Ga0501209_155499
758 Ga0501214_012712
759 Ga0501223_101490
760 Ga0501230_044833
761 Ga0501233_115341
762 Ga0501257_097291
763 Ga0501079_0016357
764 Ga0501080_0582044
765 Ga0501081_0026479
766 Ga0501083_0765727
767 Ga0501083_0776449
768 Ga0501083_1060721
769 Ga0501264_046130
770 Ga0501279_009412
771 Ga0501045_0132545
772 Ga0501045_0931487
773 nmdc:mga0k408_181579_c1
774 nmdc:mga05p37_784364_c1
775 nmdc:mga09592_135056_c1
776 nmdc:mga09592_1726576_c1
777 nmdc:mga09592_593912_c1
778 nmdc:mga09592_708105_c1
779 nmdc:mga09592_825863_c1
780 nmdc:mga0qj67_590796_c1
781 nmdc:mga06r32_122873_c1
782 nmdc:mga06r32_625786_c1
783 nmdc:mga08y16_13432_c1
784 nmdc:mga0n895_1462124_c1
785 nmdc:mga0n895_75889_c1
786 nmdc:mga08x19_1105213_c1
787 nmdc:mga08x19_182752_c1
788 nmdc:mga0a205_1106184_c1
789 nmdc:mga0a205_199480_c1
790 Ga0495612_0524967
791 Ga0495655_0296364
792 Ga0495595_0412103
793 Ga0500555_100347
794 Ga0501084_0153918
795 Ga0587066_225099
796 Ga0587077_052797
797 Ga0587080_166046
798 Ga0587109_114369
799 Ga0587109_127460
800 Ga0587128_069159
801 Ga0587062_049751
802 Ga0587075_060919
803 Ga0587071_101543
804 Ga0587111_0200531
805 Ga0501082_0014175
806 Ga0501082_1892693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9193 24 83
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9184 22 83
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9174 22 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9141 22 83
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8983 22 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9174 22 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8814 29 82 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8781 22 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8512 29 82 2.40.50.100
af_Q9U0I4_44_103_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7808 28 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7X7P7E9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9959 27 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A432T7Q1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9908 26 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V3W3R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9847 25 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X7P7E9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9794 27 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D1WKP5-F1-model_v4 deleted 0.9739 24 82

Map