F431806

General Info

Members Datasets Scaffolds Average Seq Length
390 275 780 101

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0116785|Ga0466960_0116785_406_738
Length 103
Sequence METAGSYVPAMRLTPHEQERLLIHVAAGVARERRARGLRLNHPEATAIIASFLMEGARDGRSVAELMARXDVMDGVPEMLESVQIEATFPDGTKLVTVHRPIP

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003391 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
152 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
153 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
172 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2506783011 Frankia datiscae Dg1 Isolate Nodule
245 2527291627 Frankia casuarinae Thr Isolate Nodule
246 2527291629 Frankia sp. BMG5.23 Isolate Nodule
247 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
248 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
249 2576861822 Frankia sp. CeD Isolate Nodule
250 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
251 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
252 2684623036 Frankia sp. CgIM4 Isolate Nodule
253 2710264753 Frankia sp. KB5 Isolate Nodule
254 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
255 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
256 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
257 2773857924 Frankia sp. CgIS1 Isolate Nodule
258 2773857933 Frankia sp. BMG5.30 Isolate Nodule
259 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
260 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
261 2858868258 Micromonospora sp. MH33 Isolate Unclassified
262 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
263 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
264 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
265 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
266 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
267 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
268 2922554459 Rhodococcus sp. 66b Isolate Unclassified
269 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
270 637000116 Frankia casuarinae CcI3 Isolate Nodule
271 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
272 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
273 8054920844 Frankia tisae Agncl-8 Isolate Nodule
274 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
275 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.18
Metatranscriptomes 4.36
Isolates 8.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 3.33
Rhizoplane 4.87
Rhizosphere 76.41
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0116785 3300044901 Bacteria 1393
2 rootH2_10010053 3300003320 Bacteria 4989
3 rootL2_10087880 3300003322 Bacteria 2280
4 JGI26135J50243_100963 3300003391 Bacteria 844
5 Ga0058863_11259969 3300004799 Bacteria 607
6 Ga0058861_11438009 3300004800 Bacteria 590
7 Ga0058862_10742011 3300004803 Bacteria 514
8 Ga0058862_11454372 3300004803 Bacteria 602
9 Ga0058862_12437797 3300004803 Bacteria 1417
10 Ga0070683_100164774 3300005329 Bacteria 2103
11 Ga0070683_101182909 3300005329 Bacteria 735
12 Ga0070670_101676543 3300005331 Bacteria 585
13 Ga0068869_100195248 3300005334 Unclassified 1594
14 Ga0070680_100244406 3300005336 Bacteria 1517
15 Ga0070682_100292647 3300005337 Bacteria 1192
16 Ga0070660_101075871 3300005339 Bacteria 680
17 Ga0070668_100160691 3300005347 Bacteria 1823
18 Ga0070671_100078942 3300005355 Bacteria 2751
19 Ga0070671_100205884 3300005355 Bacteria 1669
20 Ga0070671_101554473 3300005355 Bacteria 586
21 Ga0070667_100133875 3300005367 Bacteria 2166
22 Ga0070709_10251616 3300005434 Bacteria 1273
23 Ga0070714_100000620 3300005435 Bacteria 25242
24 Ga0070714_100003205 3300005435 Bacteria 12177
25 Ga0070714_100022486 3300005435 Bacteria 5170
26 Ga0070714_100067940 3300005435 Bacteria 3075
27 Ga0070714_100101488 3300005435 Bacteria 2535
28 Ga0070714_100110532 3300005435 Bacteria 2433
29 Ga0070714_100211468 3300005435 Bacteria 1778
30 Ga0070714_100357381 3300005435 Bacteria 1373
31 Ga0070714_100384610 3300005435 Bacteria 1323
32 Ga0070713_100004491 3300005436 Bacteria 9384
33 Ga0070713_100179136 3300005436 Bacteria 1903
34 Ga0070713_100229718 3300005436 Bacteria 1686
35 Ga0070713_100660637 3300005436 Bacteria 996
36 Ga0070710_10791106 3300005437 Bacteria 677
37 Ga0070711_100088812 3300005439 Bacteria 2222
38 Ga0070711_100421421 3300005439 Bacteria 1088
39 Ga0070700_101322497 3300005441 Bacteria 606
40 Ga0070708_100689940 3300005445 Bacteria 961
41 Ga0070681_10148569 3300005458 Bacteria 2271
42 Ga0070681_10964274 3300005458 Bacteria 772
43 Ga0068867_100743068 3300005459 Bacteria 870
44 Ga0070706_100559781 3300005467 Bacteria 1063
45 Ga0070707_100109140 3300005468 Bacteria 2684
46 Ga0070707_100130550 3300005468 Bacteria 2443
47 Ga0070698_100015793 3300005471 Bacteria 7975
48 Ga0070679_101069246 3300005530 Bacteria 751
49 Ga0070684_100259913 3300005535 Bacteria 1588
50 Ga0070684_101339972 3300005535 Bacteria 674
51 Ga0070697_100269460 3300005536 Bacteria 1459
52 Ga0070686_101915379 3300005544 Bacteria 506
53 Ga0070665_100342225 3300005548 Bacteria 1500
54 Ga0068855_102031934 3300005563 Bacteria 580
55 Ga0070702_100542836 3300005615 Bacteria 861
56 Ga0068852_100757803 3300005616 Bacteria 983
57 Ga0068851_11033577 3300005834 Bacteria 519
58 Ga0068863_100551167 3300005841 Bacteria 1138
59 Ga0068858_100000028 3300005842 Bacteria 144961
60 Ga0068858_100190017 3300005842 Bacteria 1940
61 Ga0068860_100016739 3300005843 Bacteria 7148
62 Ga0068862_101095891 3300005844 Bacteria 791
63 Ga0068862_102280704 3300005844 Bacteria 553
64 Ga0081455_10000609 3300005937 Bacteria 46322
65 Ga0070717_10070139 3300006028 Bacteria 2920
66 Ga0070717_10172889 3300006028 Bacteria 1879
67 Ga0075365_10279786 3300006038 Bacteria 1174
68 Ga0075364_10180693 3300006051 Bacteria 1427
69 Ga0075432_10256944 3300006058 Bacteria 711
70 Ga0070712_100148534 3300006175 Bacteria 1797
71 Ga0070712_100581582 3300006175 Bacteria 946
72 Ga0075362_10452053 3300006177 Bacteria 653
73 Ga0075362_10564197 3300006177 Bacteria 586
74 Ga0075367_10046198 3300006178 Bacteria 2558
75 Ga0075370_10031813 3300006353 Bacteria 2946
76 Ga0068871_101202200 3300006358 Bacteria 711
77 Ga0075428_102119945 3300006844 Bacteria 581
78 Ga0075430_100373452 3300006846 Bacteria 1177
79 Ga0075431_100319414 3300006847 Bacteria 1566
80 Ga0075431_101033544 3300006847 Bacteria 788
81 Ga0075433_11281614 3300006852 Bacteria 635
82 Ga0075434_101866661 3300006871 Bacteria 607
83 Ga0099794_10154488 3300007265 Bacteria 1165
84 Ga0099795_10272329 3300007788 Bacteria 736
85 Ga0111539_11488079 3300009094 Bacteria 785
86 Ga0111539_13067055 3300009094 Bacteria 539
87 Ga0105245_10107998 3300009098 Bacteria 2584
88 Ga0105245_10606604 3300009098 Bacteria 1121
89 Ga0105247_10002927 3300009101 Bacteria 11356
90 Ga0105247_11463757 3300009101 Bacteria 555
91 Ga0114129_10505299 3300009147 Bacteria 1578
92 Ga0114129_13101805 3300009147 Bacteria 543
93 Ga0105243_12059653 3300009148 Bacteria 606
94 Ga0105241_10918539 3300009174 Bacteria 814
95 Ga0105242_11034491 3300009176 Bacteria 831
96 Ga0105248_10000034 3300009177 Bacteria 192324
97 Ga0105248_10235877 3300009177 Bacteria 2059
98 Ga0105238_11061475 3300009551 Bacteria 832
99 Ga0105239_10754454 3300010375 Bacteria 1114
100 Ga0105246_11102883 3300011119 Bacteria 725
101 Ga0157371_11331270 3300013102 Bacteria 556
102 Ga0157369_10010673 3300013105 Bacteria 10454
103 Ga0157369_11696213 3300013105 Bacteria 642
104 Ga0157374_11164719 3300013296 Bacteria 792
105 Ga0157378_11893221 3300013297 Bacteria 645
106 Ga0163162_12232380 3300013306 Bacteria 628
107 Ga0157372_10231397 3300013307 Bacteria 2143
108 Ga0163163_12400001 3300014325 Bacteria 586
109 Ga0157377_11033146 3300014745 Bacteria 625
110 Ga0157379_10002010 3300014968 Bacteria 16850
111 Ga0157379_10347482 3300014968 Bacteria 1357
112 Ga0157379_10412521 3300014968 Bacteria 1243
113 Ga0206351_10190511 3300020077 Bacteria 964
114 Ga0206351_10200930 3300020077 Bacteria 532
115 Ga0206351_10897251 3300020077 Bacteria 1146
116 Ga0206350_11257110 3300020080 Bacteria 1035
117 Ga0206350_11414667 3300020080 Bacteria 986
118 Ga0206354_10196065 3300020081 Bacteria 710
119 Ga0206354_11033606 3300020081 Bacteria 783
120 Ga0206353_10304703 3300020082 Bacteria 1333
121 Ga0213876_10323040 3300021384 Bacteria 820
122 Ga0213875_10001035 3300021388 Bacteria 19625
123 Ga0213875_10037044 3300021388 Bacteria 2299
124 Ga0224712_10128759 3300022467 Bacteria 1104
125 Ga0224712_10394623 3300022467 Bacteria 659
126 Ga0224712_10493304 3300022467 Bacteria 591
127 Ga0207692_10312149 3300025898 Bacteria 960
128 Ga0207642_10845837 3300025899 Bacteria 584
129 Ga0207710_10000032 3300025900 Bacteria 274354
130 Ga0207699_10254278 3300025906 Bacteria 1212
131 Ga0207699_10635439 3300025906 Bacteria 779
132 Ga0207699_11076950 3300025906 Bacteria 595
133 Ga0207684_10024725 3300025910 Bacteria 5121
134 Ga0207707_10015393 3300025912 Bacteria 6662
135 Ga0207707_10247940 3300025912 Bacteria 1547
136 Ga0207693_10155709 3300025915 Bacteria 1797
137 Ga0207693_10322026 3300025915 Bacteria 1210
138 Ga0207693_10483183 3300025915 Bacteria 967
139 Ga0207693_10695359 3300025915 Bacteria 788
140 Ga0207663_10013516 3300025916 Bacteria 4439
141 Ga0207663_10675398 3300025916 Bacteria 816
142 Ga0207660_10564766 3300025917 Bacteria 926
143 Ga0207657_10743226 3300025919 Bacteria 760
144 Ga0207652_10021201 3300025921 Bacteria 5362
145 Ga0207652_10930114 3300025921 Bacteria 767
146 Ga0207646_10025849 3300025922 Bacteria 5367
147 Ga0207646_10323534 3300025922 Bacteria 1393
148 Ga0207694_10937001 3300025924 Bacteria 732
149 Ga0207687_10008797 3300025927 Bacteria 6598
150 Ga0207687_11247366 3300025927 Bacteria 639
151 Ga0207700_10029490 3300025928 Bacteria 3872
152 Ga0207700_10197257 3300025928 Bacteria 1694
153 Ga0207700_10288424 3300025928 Bacteria 1414
154 Ga0207700_10305705 3300025928 Bacteria 1374
155 Ga0207700_10603881 3300025928 Bacteria 977
156 Ga0207700_10909679 3300025928 Bacteria 787
157 Ga0207664_10000436 3300025929 Bacteria 29818
158 Ga0207664_10001231 3300025929 Bacteria 16947
159 Ga0207664_10047641 3300025929 Bacteria 3368
160 Ga0207664_10056659 3300025929 Bacteria 3113
161 Ga0207664_10083043 3300025929 Bacteria 2610
162 Ga0207664_10092934 3300025929 Bacteria 2477
163 Ga0207644_10350562 3300025931 Bacteria 1198
164 Ga0207644_11525744 3300025931 Bacteria 561
165 Ga0207686_10979447 3300025934 Bacteria 685
166 Ga0207711_10000067 3300025941 Bacteria 118985
167 Ga0207689_10376260 3300025942 Bacteria 1182
168 Ga0207661_10019775 3300025944 Bacteria 5026
169 Ga0207679_11421101 3300025945 Bacteria 636
170 Ga0207668_10184318 3300025972 Bacteria 1649
171 Ga0207668_11581420 3300025972 Bacteria 592
172 Ga0207658_10030759 3300025986 Bacteria 3805
173 Ga0207677_12202221 3300026023 Bacteria 513
174 Ga0207703_10000003 3300026035 Bacteria 532213
175 Ga0207703_10050592 3300026035 Bacteria 3364
176 Ga0207708_11191036 3300026075 Bacteria 666
177 Ga0207708_11306718 3300026075 Bacteria 635
178 Ga0207702_10410303 3300026078 Bacteria 1308
179 Ga0207702_11566053 3300026078 Bacteria 652
180 Ga0207648_10429957 3300026089 Bacteria 1200
181 Ga0207676_11116169 3300026095 Bacteria 780
182 Ga0207674_11063556 3300026116 Bacteria 778
183 Ga0207674_11444828 3300026116 Bacteria 657
184 Ga0207683_10576942 3300026121 Bacteria 1040
185 Ga0207698_12035888 3300026142 Bacteria 588
186 Ga0268266_10105056 3300028379 Bacteria 2495
187 Ga0268266_10515521 3300028379 Bacteria 1143
188 Ga0268266_10806839 3300028379 Bacteria 907
189 Ga0268265_10286636 3300028380 Bacteria 1476
190 Ga0265337_1000031 3300028556 Bacteria 64194
191 Ga0265326_10001068 3300028558 Bacteria 9761
192 Ga0265319_1004519 3300028563 Bacteria 6868
193 Ga0265334_10000333 3300028573 Bacteria 25219
194 Ga0265318_10003075 3300028577 Bacteria 8576
195 Ga0265322_10005717 3300028654 Bacteria 3674
196 Ga0265336_10000933 3300028666 Bacteria 14806
197 Ga0265338_10000233 3300028800 Bacteria 103593
198 Ga0265324_10005547 3300029957 Bacteria 5433
199 Ga0307512_10099018 3300030522 Bacteria 1986
200 Ga0307512_10139814 3300030522 Bacteria 1485
201 Ga0265332_10002552 3300031238 Bacteria 9248
202 Ga0265320_10002847 3300031240 Bacteria 11869
203 Ga0265325_10009078 3300031241 Bacteria 5831
204 Ga0265340_10002060 3300031247 Bacteria 11516
205 Ga0307513_10034450 3300031456 Bacteria 5683
206 Ga0307509_10007234 3300031507 Bacteria 14607
207 Ga0307509_10052549 3300031507 Bacteria 4349
208 Ga0307408_100109092 3300031548 Bacteria 2123
209 Ga0265313_10005677 3300031595 Bacteria 9106
210 Ga0265314_10009052 3300031711 Bacteria 8458
211 Ga0265342_10003708 3300031712 Bacteria 12384
212 Ga0307405_10021637 3300031731 Bacteria 3618
213 Ga0307405_10481097 3300031731 Bacteria 991
214 Ga0307405_11580592 3300031731 Bacteria 578
215 Ga0326468_10000040 3300031889 Bacteria 9896
216 Ga0307406_10115822 3300031901 Bacteria 1853
217 Ga0307406_10199711 3300031901 Bacteria 1471
218 Ga0307407_10025896 3300031903 Bacteria 3099
219 Ga0307407_10153524 3300031903 Bacteria 1499
220 Ga0307409_100000823 3300031995 Bacteria 14263
221 Ga0307409_100405693 3300031995 Bacteria 1303
222 Ga0307409_101608324 3300031995 Bacteria 678
223 Ga0307409_102741118 3300031995 Bacteria 521
224 Ga0307416_100007582 3300032002 Bacteria 6919
225 Ga0307416_100744726 3300032002 Bacteria 1072
226 Ga0307416_100880519 3300032002 Bacteria 995
227 Ga0307416_101077034 3300032002 Bacteria 908
228 Ga0307414_10025080 3300032004 Bacteria 3812
229 Ga0307414_11019349 3300032004 Bacteria 762
230 Ga0307411_10233694 3300032005 Bacteria 1435
231 Ga0307415_100000052 3300032126 Bacteria 50285
232 Ga0307415_100123421 3300032126 Bacteria 1947
233 Ga0307415_100818644 3300032126 Bacteria 852
234 Ga0307507_10354607 3300033179 Bacteria 860
235 Ga0316215_1031365 3300033544 Bacteria 552
236 Ga0316214_1021605 3300033545 Bacteria 902
237 Ga0316214_1054152 3300033545 Bacteria 583
238 Ga0316212_1000808 3300033547 Bacteria 4033
239 Ga0373939_0168151 3300035114 Bacteria 810
240 Ga0373953_0102292 3300035117 Bacteria 1207
241 Ga0373956_0005558 3300035119 Bacteria 5041
242 Ga0373956_0319635 3300035119 Bacteria 740
243 Ga0373942_0209397 3300035207 Bacteria 650
244 Ga0373931_0285491 3300035691 Bacteria 1015
245 Ga0373937_0589278 3300036401 Bacteria 1056
246 Ga0372808_055776 3300036459 Bacteria 566
247 Ga0373925_0000001 3300037068 Bacteria 402692
248 Ga0395900_1793956 3300037418 Unclassified 524
249 Ga0395898_0407033 3300037466 Bacteria 1297
250 Ga0395898_0630822 3300037466 Bacteria 1014
251 Ga0395905_0636993 3300037471 Bacteria 968
252 Ga0436364_0923522 3300037853 Bacteria 137390
253 Ga0436364_0952040 3300037853 Bacteria 5431
254 Ga0395901_0442662 3300038443 Bacteria 1330
255 Ga0400483_115492 3300039062 Bacteria 3155
256 Ga0436361_0092810 3300039447 Bacteria 581
257 Ga0436363_0333696 3300039450 Bacteria 639
258 Ga0451797_0102587 3300041453 Bacteria 620
259 Ga0451795_1098419 3300041456 Bacteria 1196
260 Ga0451800_0036085 3300041459 Bacteria 541
261 Ga0451807_0183839 3300041486 Bacteria 729
262 Ga0451835_1018637 3300041492 Bacteria 769
263 Ga0451839_1399003 3300041496 Bacteria 514
264 Ga0439463_101521 3300042016 Bacteria 742
265 Ga0451577_0023820 3300042876 Bacteria 5576
266 Ga0466972_0627159 3300044658 Bacteria 509
267 Ga0466965_0014766 3300044683 Bacteria 3699
268 Ga0466966_0089513 3300044684 Bacteria 1912
269 Ga0466966_0290830 3300044684 Bacteria 982
270 Ga0466966_0933385 3300044684 Bacteria 523
271 Ga0466961_0275447 3300044693 Bacteria 1030
272 Ga0466961_0286935 3300044693 Bacteria 1007
273 Ga0453684_0297594 3300044712 Bacteria 1835
274 Ga0453684_0461249 3300044712 Bacteria 1413
275 Ga0466971_0148045 3300044719 Bacteria 1095
276 Ga0466970_0189267 3300044765 Bacteria 1143
277 Ga0466957_0117301 3300044842 Bacteria 1694
278 Ga0466959_0164284 3300045049 Bacteria 1559
279 Ga0466958_0079346 3300045836 Bacteria 2018
280 Ga0466958_1169865 3300045836 Bacteria 502
281 Ga0495592_0081320 3300046454 Bacteria 2342
282 Ga0495651_0000740 3300046462 Bacteria 25246
283 Ga0495651_0081821 3300046462 Bacteria 2437
284 Ga0495664_0119618 3300046477 Bacteria 1593
285 Ga0495594_0006917 3300046499 Bacteria 5836
286 Ga0495628_0009448 3300046516 Bacteria 8324
287 Ga0495648_0027450 3300046524 Bacteria 3809
288 Ga0495652_0000478 3300046529 Bacteria 46945
289 Ga0495652_0420975 3300046529 Bacteria 941
290 Ga0495652_0461691 3300046529 Bacteria 887
291 Ga0495586_0055706 3300046535 Bacteria 2143
292 Ga0495587_0063446 3300046536 Bacteria 2161
293 Ga0495645_0083494 3300046543 Bacteria 2289
294 Ga0495668_0000167 3300046616 Bacteria 97427
295 Ga0495634_0097728 3300046642 Bacteria 1900
296 Ga0495634_0345095 3300046642 Bacteria 892
297 Ga0495635_0007522 3300046663 Bacteria 7602
298 Ga0495623_0110020 3300046679 Bacteria 1671
299 Ga0495646_0047569 3300046680 Bacteria 2610
300 Ga0495646_0323932 3300046680 Bacteria 811
301 Ga0495600_0010158 3300046809 Bacteria 5836
302 Ga0495602_0567995 3300048088 Bacteria 784
303 Ga0496104_0634917 3300048907 Bacteria 977
304 Ga0496106_0102708 3300048909 Bacteria 2218
305 Ga0496107_0594950 3300048910 Bacteria 818
306 Ga0496107_1143769 3300048910 Bacteria 561
307 Ga0496108_0127005 3300048911 Bacteria 2190
308 Ga0496109_1618027 3300048912 Bacteria 582
309 Ga0496110_0151325 3300048913 Bacteria 2101
310 Ga0496110_1334096 3300048913 Bacteria 627
311 Ga0496111_0195190 3300048914 Bacteria 1505
312 Ga0496114_0473560 3300048917 Bacteria 1108
313 Ga0496114_0992638 3300048917 Bacteria 723
314 Ga0496115_0014242 3300048918 Bacteria 6019
315 Ga0496115_0137611 3300048918 Bacteria 2014
316 Ga0496115_0976548 3300048918 Bacteria 649
317 Ga0496117_0035956 3300048920 Bacteria 3712
318 Ga0496117_0214719 3300048920 Bacteria 1076
319 Ga0496118_0006031 3300048921 Bacteria 13500
320 Ga0496119_0030440 3300048922 Bacteria 3638
321 Ga0496121_0047648 3300048924 Bacteria 3654
322 Ga0496125_0056340 3300048928 Bacteria 3192
323 Ga0496126_0176095 3300048929 Bacteria 1819
324 Ga0496126_0491074 3300048929 Bacteria 982
325 Ga0496126_0812346 3300048929 Bacteria 716
326 Ga0501034_0039811 3300049571 Bacteria 4760
327 Ga0501038_0002902 3300049574 Bacteria 15986
328 Ga0501047_0046155 3300049581 Bacteria 4211
329 Ga0501067_0346300 3300049583 Bacteria 828
330 nmdc:mga00v17_160932_c1 3300050491 Bacteria 1445
331 nmdc:mga0yw44_335648_c1 3300050492 Bacteria 1016
332 nmdc:mga0yw44_803276_c1 3300050492 Bacteria 639
333 nmdc:mga06z11_16957_c1 3300050494 Bacteria 3294
334 nmdc:mga05p37_725917_c1 3300050507 Bacteria 1099
335 nmdc:mga09592_85838_c1 3300050508 Bacteria 2685
336 nmdc:mga0qj67_830442_c1 3300050509 Unclassified 730
337 nmdc:mga06r32_421215_c1 3300050510 Bacteria 1316
338 nmdc:mga06r32_780751_c1 3300050510 Bacteria 917
339 nmdc:mga08y16_1941827_c1 3300050511 Bacteria 539
340 nmdc:mga0a205_294902_c1 3300050515 Bacteria 1495
341 Ga0495601_0008067 3300053077 Bacteria 6207
342 Ga0495601_0210201 3300053077 Bacteria 1271
343 Ga0495601_0741028 3300053077 Bacteria 625
344 Ga0495601_0844570 3300053077 Bacteria 580
345 Ga0495612_0003298 3300053078 Bacteria 6692
346 Ga0495612_0006994 3300053078 Bacteria 4615
347 Ga0500635_0217071 3300053080 Bacteria 746
348 Ga0495655_0242776 3300053083 Bacteria 603
349 Ga0495619_0018236 3300053085 Bacteria 4452
350 Ga0495619_0749532 3300053085 Bacteria 662
351 Ga0500646_0001200 3300053090 Bacteria 6966
352 Ga0500594_0243299 3300053118 Bacteria 598
353 Ga0500573_0058957 3300053140 Bacteria 2200
354 Ga0500588_0001488 3300053146 Bacteria 4469
355 Ga0590075_003374 3300059424 Bacteria 3803
356 Ga0466962_0524927 3300061719 Bacteria 600
357 Ga0466962_0627307 3300061719 Bacteria 549
358 2506865745 2506783011 Bacteria 5323186
359 2528202411 2527291627 Bacteria 5309833
360 2528213718 2527291629 Bacteria 5267418
361 2546949751 2546825537 Bacteria 5389291
362 2566994582 2565956761 Bacteria 6601618
363 2579747229 2576861822 Bacteria 5004595
364 2676491709 2675903060 Bacteria 10051191
365 2686535195 2684623035 Bacteria 8032739
366 2686541875 2684623036 Bacteria 5199090
367 2710602080 2710264753 Bacteria 5455564
368 2710602082 2710264753 Bacteria 5455564
369 2738891109 2738541308 Bacteria 7020677
370 2739206126 2738543005 Bacteria 5278128
371 2753269024 2751185782 Bacteria 11227053
372 2774865664 2773857924 Bacteria 5256821
373 2774904069 2773857933 Bacteria 5818019
374 2799183745 2799112218 Bacteria 4315149
375 2831936075 2831935698 Bacteria 5963223
376 2858871346 2858868258 Bacteria 7683772
377 2867352631 2867346516 Bacteria 7608576
378 2867507603 2867507094 Bacteria 6506033
379 2884696184 2884693830 Bacteria 11273186
380 2895432255 2895427314 Bacteria 13147766
381 2895449538 2895442618 Bacteria 11027144
382 2904536111 2904535858 Bacteria 6308016
383 2922555876 2922554459 Bacteria 6683962
384 3003002918 3002998708 Bacteria 11715108
385 637878167 637000116 Bacteria 5433628
386 8054734656 8054734606 Bacteria 6947278
387 8054920758 8054913762 Bacteria 7713009
388 8054926229 8054920844 Bacteria 7068637
389 8055067165 8055066027 Bacteria 9479577
390 8055174203 8055172936 Bacteria 9305943
391 Ga0466960_0116785
392 rootH2_10010053
393 rootL2_10087880
394 JGI26135J50243_100963
395 Ga0058863_11259969
396 Ga0058861_11438009
397 Ga0058862_10742011
398 Ga0058862_11454372
399 Ga0058862_12437797
400 Ga0070683_100164774
401 Ga0070683_101182909
402 Ga0070670_101676543
403 Ga0068869_100195248
404 Ga0070680_100244406
405 Ga0070682_100292647
406 Ga0070660_101075871
407 Ga0070668_100160691
408 Ga0070671_100078942
409 Ga0070671_100205884
410 Ga0070671_101554473
411 Ga0070667_100133875
412 Ga0070709_10251616
413 Ga0070714_100000620
414 Ga0070714_100003205
415 Ga0070714_100022486
416 Ga0070714_100067940
417 Ga0070714_100101488
418 Ga0070714_100110532
419 Ga0070714_100211468
420 Ga0070714_100357381
421 Ga0070714_100384610
422 Ga0070713_100004491
423 Ga0070713_100179136
424 Ga0070713_100229718
425 Ga0070713_100660637
426 Ga0070710_10791106
427 Ga0070711_100088812
428 Ga0070711_100421421
429 Ga0070700_101322497
430 Ga0070708_100689940
431 Ga0070681_10148569
432 Ga0070681_10964274
433 Ga0068867_100743068
434 Ga0070706_100559781
435 Ga0070707_100109140
436 Ga0070707_100130550
437 Ga0070698_100015793
438 Ga0070679_101069246
439 Ga0070684_100259913
440 Ga0070684_101339972
441 Ga0070697_100269460
442 Ga0070686_101915379
443 Ga0070665_100342225
444 Ga0068855_102031934
445 Ga0070702_100542836
446 Ga0068852_100757803
447 Ga0068851_11033577
448 Ga0068863_100551167
449 Ga0068858_100000028
450 Ga0068858_100190017
451 Ga0068860_100016739
452 Ga0068862_101095891
453 Ga0068862_102280704
454 Ga0081455_10000609
455 Ga0070717_10070139
456 Ga0070717_10172889
457 Ga0075365_10279786
458 Ga0075364_10180693
459 Ga0075432_10256944
460 Ga0070712_100148534
461 Ga0070712_100581582
462 Ga0075362_10452053
463 Ga0075362_10564197
464 Ga0075367_10046198
465 Ga0075370_10031813
466 Ga0068871_101202200
467 Ga0075428_102119945
468 Ga0075430_100373452
469 Ga0075431_100319414
470 Ga0075431_101033544
471 Ga0075433_11281614
472 Ga0075434_101866661
473 Ga0099794_10154488
474 Ga0099795_10272329
475 Ga0111539_11488079
476 Ga0111539_13067055
477 Ga0105245_10107998
478 Ga0105245_10606604
479 Ga0105247_10002927
480 Ga0105247_11463757
481 Ga0114129_10505299
482 Ga0114129_13101805
483 Ga0105243_12059653
484 Ga0105241_10918539
485 Ga0105242_11034491
486 Ga0105248_10000034
487 Ga0105248_10235877
488 Ga0105238_11061475
489 Ga0105239_10754454
490 Ga0105246_11102883
491 Ga0157371_11331270
492 Ga0157369_10010673
493 Ga0157369_11696213
494 Ga0157374_11164719
495 Ga0157378_11893221
496 Ga0163162_12232380
497 Ga0157372_10231397
498 Ga0163163_12400001
499 Ga0157377_11033146
500 Ga0157379_10002010
501 Ga0157379_10347482
502 Ga0157379_10412521
503 Ga0206351_10190511
504 Ga0206351_10200930
505 Ga0206351_10897251
506 Ga0206350_11257110
507 Ga0206350_11414667
508 Ga0206354_10196065
509 Ga0206354_11033606
510 Ga0206353_10304703
511 Ga0213876_10323040
512 Ga0213875_10001035
513 Ga0213875_10037044
514 Ga0224712_10128759
515 Ga0224712_10394623
516 Ga0224712_10493304
517 Ga0207692_10312149
518 Ga0207642_10845837
519 Ga0207710_10000032
520 Ga0207699_10254278
521 Ga0207699_10635439
522 Ga0207699_11076950
523 Ga0207684_10024725
524 Ga0207707_10015393
525 Ga0207707_10247940
526 Ga0207693_10155709
527 Ga0207693_10322026
528 Ga0207693_10483183
529 Ga0207693_10695359
530 Ga0207663_10013516
531 Ga0207663_10675398
532 Ga0207660_10564766
533 Ga0207657_10743226
534 Ga0207652_10021201
535 Ga0207652_10930114
536 Ga0207646_10025849
537 Ga0207646_10323534
538 Ga0207694_10937001
539 Ga0207687_10008797
540 Ga0207687_11247366
541 Ga0207700_10029490
542 Ga0207700_10197257
543 Ga0207700_10288424
544 Ga0207700_10305705
545 Ga0207700_10603881
546 Ga0207700_10909679
547 Ga0207664_10000436
548 Ga0207664_10001231
549 Ga0207664_10047641
550 Ga0207664_10056659
551 Ga0207664_10083043
552 Ga0207664_10092934
553 Ga0207644_10350562
554 Ga0207644_11525744
555 Ga0207686_10979447
556 Ga0207711_10000067
557 Ga0207689_10376260
558 Ga0207661_10019775
559 Ga0207679_11421101
560 Ga0207668_10184318
561 Ga0207668_11581420
562 Ga0207658_10030759
563 Ga0207677_12202221
564 Ga0207703_10000003
565 Ga0207703_10050592
566 Ga0207708_11191036
567 Ga0207708_11306718
568 Ga0207702_10410303
569 Ga0207702_11566053
570 Ga0207648_10429957
571 Ga0207676_11116169
572 Ga0207674_11063556
573 Ga0207674_11444828
574 Ga0207683_10576942
575 Ga0207698_12035888
576 Ga0268266_10105056
577 Ga0268266_10515521
578 Ga0268266_10806839
579 Ga0268265_10286636
580 Ga0265337_1000031
581 Ga0265326_10001068
582 Ga0265319_1004519
583 Ga0265334_10000333
584 Ga0265318_10003075
585 Ga0265322_10005717
586 Ga0265336_10000933
587 Ga0265338_10000233
588 Ga0265324_10005547
589 Ga0307512_10099018
590 Ga0307512_10139814
591 Ga0265332_10002552
592 Ga0265320_10002847
593 Ga0265325_10009078
594 Ga0265340_10002060
595 Ga0307513_10034450
596 Ga0307509_10007234
597 Ga0307509_10052549
598 Ga0307408_100109092
599 Ga0265313_10005677
600 Ga0265314_10009052
601 Ga0265342_10003708
602 Ga0307405_10021637
603 Ga0307405_10481097
604 Ga0307405_11580592
605 Ga0326468_10000040
606 Ga0307406_10115822
607 Ga0307406_10199711
608 Ga0307407_10025896
609 Ga0307407_10153524
610 Ga0307409_100000823
611 Ga0307409_100405693
612 Ga0307409_101608324
613 Ga0307409_102741118
614 Ga0307416_100007582
615 Ga0307416_100744726
616 Ga0307416_100880519
617 Ga0307416_101077034
618 Ga0307414_10025080
619 Ga0307414_11019349
620 Ga0307411_10233694
621 Ga0307415_100000052
622 Ga0307415_100123421
623 Ga0307415_100818644
624 Ga0307507_10354607
625 Ga0316215_1031365
626 Ga0316214_1021605
627 Ga0316214_1054152
628 Ga0316212_1000808
629 Ga0373939_0168151
630 Ga0373953_0102292
631 Ga0373956_0005558
632 Ga0373956_0319635
633 Ga0373942_0209397
634 Ga0373931_0285491
635 Ga0373937_0589278
636 Ga0372808_055776
637 Ga0373925_0000001
638 Ga0395900_1793956
639 Ga0395898_0407033
640 Ga0395898_0630822
641 Ga0395905_0636993
642 Ga0436364_0923522
643 Ga0436364_0952040
644 Ga0395901_0442662
645 Ga0400483_115492
646 Ga0436361_0092810
647 Ga0436363_0333696
648 Ga0451797_0102587
649 Ga0451795_1098419
650 Ga0451800_0036085
651 Ga0451807_0183839
652 Ga0451835_1018637
653 Ga0451839_1399003
654 Ga0439463_101521
655 Ga0451577_0023820
656 Ga0466972_0627159
657 Ga0466965_0014766
658 Ga0466966_0089513
659 Ga0466966_0290830
660 Ga0466966_0933385
661 Ga0466961_0275447
662 Ga0466961_0286935
663 Ga0453684_0297594
664 Ga0453684_0461249
665 Ga0466971_0148045
666 Ga0466970_0189267
667 Ga0466957_0117301
668 Ga0466959_0164284
669 Ga0466958_0079346
670 Ga0466958_1169865
671 Ga0495592_0081320
672 Ga0495651_0000740
673 Ga0495651_0081821
674 Ga0495664_0119618
675 Ga0495594_0006917
676 Ga0495628_0009448
677 Ga0495648_0027450
678 Ga0495652_0000478
679 Ga0495652_0420975
680 Ga0495652_0461691
681 Ga0495586_0055706
682 Ga0495587_0063446
683 Ga0495645_0083494
684 Ga0495668_0000167
685 Ga0495634_0097728
686 Ga0495634_0345095
687 Ga0495635_0007522
688 Ga0495623_0110020
689 Ga0495646_0047569
690 Ga0495646_0323932
691 Ga0495600_0010158
692 Ga0495602_0567995
693 Ga0496104_0634917
694 Ga0496106_0102708
695 Ga0496107_0594950
696 Ga0496107_1143769
697 Ga0496108_0127005
698 Ga0496109_1618027
699 Ga0496110_0151325
700 Ga0496110_1334096
701 Ga0496111_0195190
702 Ga0496114_0473560
703 Ga0496114_0992638
704 Ga0496115_0014242
705 Ga0496115_0137611
706 Ga0496115_0976548
707 Ga0496117_0035956
708 Ga0496117_0214719
709 Ga0496118_0006031
710 Ga0496119_0030440
711 Ga0496121_0047648
712 Ga0496125_0056340
713 Ga0496126_0176095
714 Ga0496126_0491074
715 Ga0496126_0812346
716 Ga0501034_0039811
717 Ga0501038_0002902
718 Ga0501047_0046155
719 Ga0501067_0346300
720 nmdc:mga00v17_160932_c1
721 nmdc:mga0yw44_335648_c1
722 nmdc:mga0yw44_803276_c1
723 nmdc:mga06z11_16957_c1
724 nmdc:mga05p37_725917_c1
725 nmdc:mga09592_85838_c1
726 nmdc:mga0qj67_830442_c1
727 nmdc:mga06r32_421215_c1
728 nmdc:mga06r32_780751_c1
729 nmdc:mga08y16_1941827_c1
730 nmdc:mga0a205_294902_c1
731 Ga0495601_0008067
732 Ga0495601_0210201
733 Ga0495601_0741028
734 Ga0495601_0844570
735 Ga0495612_0003298
736 Ga0495612_0006994
737 Ga0500635_0217071
738 Ga0495655_0242776
739 Ga0495619_0018236
740 Ga0495619_0749532
741 Ga0500646_0001200
742 Ga0500594_0243299
743 Ga0500573_0058957
744 Ga0500588_0001488
745 Ga0590075_003374
746 Ga0466962_0524927
747 Ga0466962_0627307
748 2506865745
749 2528202411
750 2528213718
751 2546949751
752 2566994582
753 2579747229
754 2676491709
755 2686535195
756 2686541875
757 2710602080
758 2710602082
759 2738891109
760 2739206126
761 2753269024
762 2774865664
763 2774904069
764 2799183745
765 2831936075
766 2858871346
767 2867352631
768 2867507603
769 2884696184
770 2895432255
771 2895449538
772 2904536111
773 2922555876
774 3003002918
775 637878167
776 8054734656
777 8054920758
778 8054926229
779 8055067165
780 8055174203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00547

Urease_gamma

Urease, gamma subunit

11

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fur-assembly1.cif.gz_A crystal structure of urease subunit gamma 2 from brucella melitensis biovar abortus 2308 0.9474 1 100
6zo0-assembly1.cif.gz_AAA 2.23 a resolution 3,4-dimethylcatechol (3,4-dimethylbenzene-1,2-diol) inhibited sporosarcina pasteurii urease 0.9413 2 100
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.941 2 100
2ubp-assembly1.cif.gz_A structure of native urease from bacillus pasteurii 0.9351 1 100
6zo0-assembly1.cif.gz_AAA 2.23 a resolution 3,4-dimethylcatechol (3,4-dimethylbenzene-1,2-diol) inhibited sporosarcina pasteurii urease 0.9322 2 100
ID Description Score Start End Superfamily
af_P76418_2_329_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.926 33 63 1.10.4080.10
1a5kA00 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.922 1 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.911 4 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.877 4 100 3.30.280.10
af_P32522_490_895_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6547 8 62 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A075FSK6-F1-model_v4 Urea amidohydrolase gamma subunit (UreA) (EC 3.5.1.5) 0.9866 16 70 GO:0009039
GO:0016151
GO:0043419
AF-A0A812T7F5-F1-model_v4 Uncharacterized protein 0.9801 17 77 GO:0016151
GO:0016787
GO:0043419
AF-A0A435M9M7-F1-model_v4 deleted 0.9765 1 77
AF-A0A0Q7VLX1-F1-model_v4 Urease 0.9751 10 96 GO:0009039
GO:0016151
GO:0043419
AF-G6EMB6-F1-model_v4 deleted 0.9747 3 73

Map