F422700

General Info

Members Datasets Scaffolds Average Seq Length
362 204 724 88

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0015839|Ga0453684_0015839_6196_6489
Length 97
Sequence MSNFQWSLDMAHKKGGGSTRNGRDSNAQRLGVKKFSGEFVQAGTIIIRQRGTHVRPGLNVGLGKDDTLYALITGHVKFEPYSKEQKQVSVYPQGDAA

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.31
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0015839 3300044712 Bacteria 11852
2 SwRhRL3b_contig_2593129 2162886006 Bacteria 827
3 JGI25406J46586_10004683 3300003203 Bacteria 6366
4 JGI25406J46586_10038702 3300003203 Bacteria 1707
5 JGI26145J50221_1003880 3300003371 Bacteria 1201
6 Ga0058860_11834593 3300004801 Bacteria 610
7 Ga0065704_10243976 3300005289 Bacteria 985
8 Ga0065707_10033736 3300005295 Unclassified 1342
9 Ga0065707_10267079 3300005295 Bacteria 1081
10 Ga0070658_10083953 3300005327 Bacteria 2619
11 Ga0070683_100200540 3300005329 Bacteria 1895
12 Ga0070680_100059565 3300005336 Bacteria 3125
13 Ga0070680_100759294 3300005336 Unclassified 835
14 Ga0070660_100020345 3300005339 Bacteria 4876
15 Ga0070660_100219823 3300005339 Bacteria 1544
16 Ga0070691_10640307 3300005341 Bacteria 632
17 Ga0070661_100820954 3300005344 Bacteria 764
18 Ga0070692_10270243 3300005345 Unclassified 1026
19 Ga0070692_11262653 3300005345 Bacteria 528
20 Ga0070669_101247058 3300005353 Bacteria 643
21 Ga0070705_100604257 3300005440 Bacteria 849
22 Ga0070700_101559178 3300005441 Bacteria 563
23 Ga0070694_100159927 3300005444 Unclassified 1652
24 Ga0070694_100240627 3300005444 Bacteria 1365
25 Ga0070694_100407838 3300005444 Bacteria 1065
26 Ga0070708_100284650 3300005445 Bacteria 1556
27 Ga0070708_100600928 3300005445 Bacteria 1037
28 Ga0070663_100605398 3300005455 Bacteria 922
29 Ga0070681_10106031 3300005458 Bacteria 2752
30 Ga0070681_10865595 3300005458 Bacteria 822
31 Ga0068867_100490444 3300005459 Unclassified 1054
32 Ga0068867_101215958 3300005459 Bacteria 693
33 Ga0070706_100009852 3300005467 Bacteria 8879
34 Ga0070707_100139170 3300005468 Unclassified 2362
35 Ga0070707_102021373 3300005468 Unclassified 544
36 Ga0070698_100359742 3300005471 Bacteria 1387
37 Ga0070698_100384281 3300005471 Unclassified 1336
38 Ga0070698_100426678 3300005471 Bacteria 1260
39 Ga0070699_100169002 3300005518 Bacteria 1937
40 Ga0070699_100238945 3300005518 Bacteria 1621
41 Ga0070699_100720618 3300005518 Bacteria 912
42 Ga0070679_100012133 3300005530 Bacteria 8233
43 Ga0070679_100880802 3300005530 Bacteria 839
44 Ga0070679_101522457 3300005530 Bacteria 616
45 Ga0070684_100837367 3300005535 Bacteria 861
46 Ga0070697_100466693 3300005536 Bacteria 1101
47 Ga0070696_100058653 3300005546 Unclassified 2688
48 Ga0070696_100294012 3300005546 Bacteria 1242
49 Ga0070696_100683797 3300005546 Bacteria 835
50 Ga0070665_100124971 3300005548 Bacteria 2575
51 Ga0070704_100047864 3300005549 Bacteria 2991
52 Ga0070704_100170965 3300005549 Bacteria 1728
53 Ga0070704_100557893 3300005549 Bacteria 1002
54 Ga0068855_100188886 3300005563 Bacteria 2325
55 Ga0070664_101250445 3300005564 Bacteria 701
56 Ga0068857_100467673 3300005577 Unclassified 1181
57 Ga0068861_100428574 3300005719 Bacteria 1180
58 Ga0068861_101823334 3300005719 Bacteria 604
59 Ga0068861_102249677 3300005719 Bacteria 547
60 Ga0068870_10903931 3300005840 Bacteria 624
61 Ga0068863_100313807 3300005841 Unclassified 1522
62 Ga0068860_100975570 3300005843 Bacteria 865
63 Ga0068862_100054738 3300005844 Bacteria 3416
64 Ga0068862_100057581 3300005844 Bacteria 3334
65 Ga0081539_10006236 3300005985 Bacteria 11551
66 Ga0070712_101698146 3300006175 Bacteria 553
67 Ga0097621_100866295 3300006237 Bacteria 840
68 Ga0075428_100076360 3300006844 Bacteria 3658
69 Ga0075428_100092358 3300006844 Bacteria 3300
70 Ga0075428_100717526 3300006844 Bacteria 1065
71 Ga0075430_100139595 3300006846 Unclassified 2018
72 Ga0075430_100408215 3300006846 Unclassified 1121
73 Ga0075431_100002061 3300006847 Bacteria 19205
74 Ga0075431_100261262 3300006847 Bacteria 1757
75 Ga0075433_10044543 3300006852 Bacteria 3856
76 Ga0075434_101100116 3300006871 Bacteria 808
77 Ga0075434_101214007 3300006871 Bacteria 766
78 Ga0075429_100006618 3300006880 Bacteria 10037
79 Ga0075429_100180166 3300006880 Bacteria 1852
80 Ga0075435_101031645 3300007076 Unclassified 718
81 Ga0105240_10808117 3300009093 Bacteria 1015
82 Ga0111539_10022170 3300009094 Bacteria 7807
83 Ga0111539_10558646 3300009094 Bacteria 1333
84 Ga0111539_11365202 3300009094 Bacteria 822
85 Ga0105245_10703418 3300009098 Bacteria 1044
86 Ga0105245_11237013 3300009098 Bacteria 795
87 Ga0105245_11486979 3300009098 Bacteria 728
88 Ga0105247_11332249 3300009101 Bacteria 578
89 Ga0114129_10019647 3300009147 Bacteria 9617
90 Ga0114129_10117544 3300009147 Bacteria 3664
91 Ga0114129_10467459 3300009147 Bacteria 1652
92 Ga0105243_10046163 3300009148 Bacteria 3425
93 Ga0105243_10234842 3300009148 Bacteria 1629
94 Ga0105241_11193863 3300009174 Bacteria 720
95 Ga0105242_11890257 3300009176 Bacteria 637
96 Ga0105238_11115135 3300009551 Bacteria 812
97 Ga0105249_10540948 3300009553 Unclassified 1214
98 Ga0105249_11027784 3300009553 Bacteria 893
99 Ga0105249_11899693 3300009553 Bacteria 668
100 Ga0105246_10432320 3300011119 Bacteria 1102
101 Ga0157343_1021469 3300012488 Bacteria 588
102 Ga0157369_10036561 3300013105 Bacteria 5379
103 Ga0163162_12133732 3300013306 Bacteria 643
104 Ga0157380_12414262 3300014326 Bacteria 591
105 Ga0157376_11623993 3300014969 Bacteria 681
106 Ga0206356_11677614 3300020070 Bacteria 2883
107 Ga0213873_10022659 3300021358 Bacteria 1490
108 Ga0213875_10037411 3300021388 Bacteria 2287
109 Ga0213871_10019858 3300021441 Bacteria 1659
110 Ga0207692_10744076 3300025898 Bacteria 639
111 Ga0207705_10288598 3300025909 Bacteria 1257
112 Ga0207654_10837934 3300025911 Bacteria 665
113 Ga0207707_10232669 3300025912 Bacteria 1603
114 Ga0207663_11393823 3300025916 Bacteria 565
115 Ga0207660_10523525 3300025917 Bacteria 963
116 Ga0207657_10056512 3300025919 Bacteria 3386
117 Ga0207652_10036031 3300025921 Bacteria 4181
118 Ga0207652_11179884 3300025921 Bacteria 667
119 Ga0207652_11352224 3300025921 Bacteria 615
120 Ga0207652_11368590 3300025921 Bacteria 611
121 Ga0207681_10925214 3300025923 Bacteria 731
122 Ga0207687_11053195 3300025927 Bacteria 698
123 Ga0207700_10058059 3300025928 Bacteria 2921
124 Ga0207664_10933021 3300025929 Bacteria 779
125 Ga0207686_10952812 3300025934 Bacteria 695
126 Ga0207686_11026524 3300025934 Unclassified 670
127 Ga0207709_10393915 3300025935 Bacteria 1057
128 Ga0207709_10415432 3300025935 Bacteria 1032
129 Ga0207709_10870258 3300025935 Bacteria 731
130 Ga0207712_10106345 3300025961 Bacteria 2096
131 Ga0207712_11257492 3300025961 Bacteria 661
132 Ga0207668_10567621 3300025972 Bacteria 985
133 Ga0207678_10521225 3300026067 Bacteria 1037
134 Ga0207678_11923766 3300026067 Bacteria 516
135 Ga0207708_11077261 3300026075 Bacteria 700
136 Ga0207648_10555139 3300026089 Bacteria 1055
137 Ga0207648_10667702 3300026089 Unclassified 961
138 Ga0207674_10301208 3300026116 Unclassified 1552
139 Ga0207675_100044418 3300026118 Bacteria 4152
140 Ga0207675_100415034 3300026118 Bacteria 1328
141 Ga0207675_102511922 3300026118 Bacteria 526
142 Ga0209996_1012326 3300027395 Bacteria 1148
143 Ga0210000_1008342 3300027462 Bacteria 1519
144 Ga0209995_1029211 3300027471 Bacteria 921
145 Ga0209968_1007491 3300027526 Bacteria 1652
146 Ga0209999_1012272 3300027543 Bacteria 1552
147 Ga0209970_1000243 3300027614 Bacteria 8852
148 Ga0210002_1012769 3300027617 Bacteria 1307
149 Ga0209983_1001291 3300027665 Bacteria 5576
150 Ga0209971_1004988 3300027682 Bacteria 3154
151 Ga0209998_10001586 3300027717 Bacteria 5463
152 Ga0209974_10000932 3300027876 Bacteria 10201
153 Ga0207428_10132511 3300027907 Bacteria 1906
154 Ga0268265_10116076 3300028380 Bacteria 2196
155 Ga0265326_10125698 3300028558 Bacteria 730
156 Ga0265334_10145470 3300028573 Bacteria 838
157 Ga0265336_10172930 3300028666 Bacteria 642
158 Ga0265336_10203201 3300028666 Bacteria 589
159 Ga0265338_10159197 3300028800 Bacteria 1746
160 Ga0265338_10208347 3300028800 Bacteria 1469
161 Ga0265338_10261550 3300028800 Bacteria 1272
162 Ga0265338_10722529 3300028800 Bacteria 686
163 Ga0265328_10196830 3300031239 Bacteria 765
164 Ga0265320_10402317 3300031240 Bacteria 605
165 Ga0265325_10210527 3300031241 Bacteria 893
166 Ga0265325_10368058 3300031241 Bacteria 633
167 Ga0265325_10422189 3300031241 Bacteria 583
168 Ga0265340_10221641 3300031247 Bacteria 847
169 Ga0265339_10104491 3300031249 Bacteria 1471
170 Ga0265331_10486232 3300031250 Bacteria 555
171 Ga0265331_10581777 3300031250 Bacteria 505
172 Ga0265327_10282318 3300031251 Bacteria 733
173 Ga0265327_10515405 3300031251 Bacteria 515
174 Ga0307408_100147151 3300031548 Unclassified 1856
175 Ga0316575_10253048 3300031665 Bacteria 739
176 Ga0316579_10121484 3300031691 Bacteria 1255
177 Ga0316579_10177341 3300031691 Bacteria 1030
178 Ga0265314_10182924 3300031711 Bacteria 1254
179 Ga0265314_10541114 3300031711 Bacteria 607
180 Ga0316578_10827715 3300031728 Unclassified 536
181 Ga0307405_10114485 3300031731 Unclassified 1833
182 Ga0316577_10015357 3300031733 Bacteria 4212
183 Ga0316577_10219281 3300031733 Bacteria 1075
184 Ga0307413_10074971 3300031824 Unclassified 2145
185 Ga0307413_11791422 3300031824 Bacteria 549
186 Ga0307410_10096178 3300031852 Unclassified 2113
187 Ga0307407_10012711 3300031903 Unclassified 4058
188 Ga0307409_100277945 3300031995 Bacteria 1546
189 Ga0307416_100335738 3300032002 Unclassified 1521
190 Ga0307414_10038774 3300032004 Unclassified 3203
191 Ga0307411_10983946 3300032005 Bacteria 754
192 Ga0307411_10990024 3300032005 Bacteria 752
193 Ga0307415_100052839 3300032126 Unclassified 2765
194 Ga0316593_10032538 3300032168 Unclassified 1704
195 Ga0316596_1044429 3300033541 Bacteria 1170
196 Ga0316596_1119956 3300033541 Unclassified 716
197 Ga0316574_0028617 3300035398 Unclassified 3362
198 Ga0316574_0612454 3300035398 Bacteria 672
199 Ga0373937_0371339 3300036401 Bacteria 1356
200 Ga0373937_2050417 3300036401 Bacteria 518
201 Ga0316582_0007047 3300036647 Bacteria 5965
202 Ga0316584_0046151 3300036712 Unclassified 3253
203 Ga0395899_0074144 3300037312 Bacteria 2487
204 Ga0436364_0831778 3300037853 Bacteria 9609
205 Ga0436364_1482070 3300037853 Bacteria 1363
206 Ga0395901_2004056 3300038443 Bacteria 525
207 Ga0436365_0732742 3300039437 Bacteria 1079
208 Ga0436365_1147457 3300039437 Bacteria 3235
209 Ga0436360_0395990 3300039438 Bacteria 1131
210 Ga0436360_0473768 3300039438 Bacteria 502
211 Ga0436360_0577353 3300039438 Bacteria 1599
212 Ga0436360_0579439 3300039438 Bacteria 2244
213 Ga0436360_0795565 3300039438 Bacteria 1044
214 Ga0436360_1324817 3300039438 Bacteria 1050
215 Ga0436360_1362380 3300039438 Bacteria 1187
216 Ga0436360_1377799 3300039438 Bacteria 1269
217 Ga0436361_0169852 3300039447 Bacteria 684
218 Ga0436361_0434638 3300039447 Bacteria 42089
219 Ga0436361_0563664 3300039447 Bacteria 609
220 Ga0436361_0565039 3300039447 Bacteria 2841
221 Ga0436361_0984651 3300039447 Bacteria 1938
222 Ga0436363_0030924 3300039450 Bacteria 1057
223 Ga0436363_0065917 3300039450 Bacteria 873
224 Ga0436363_0195099 3300039450 Bacteria 580
225 Ga0436363_0255849 3300039450 Bacteria 833
226 Ga0436362_0096140 3300039453 Bacteria 643
227 Ga0436362_0227011 3300039453 Bacteria 4591
228 Ga0436362_0265375 3300039453 Bacteria 528
229 Ga0436362_0288846 3300039453 Bacteria 578
230 Ga0436362_0435333 3300039453 Bacteria 1061
231 Ga0436362_0704241 3300039453 Bacteria 509
232 Ga0436362_0884708 3300039453 Bacteria 1326
233 Ga0436362_0969416 3300039453 Bacteria 1032
234 Ga0436362_1055623 3300039453 Bacteria 1605
235 Ga0450916_042556 3300042530 Bacteria 695
236 Ga0451577_0001152 3300042876 Bacteria 37382
237 Ga0451577_0023510 3300042876 Bacteria 5620
238 Ga0451577_0261207 3300042876 Bacteria 1568
239 Ga0451577_0579250 3300042876 Bacteria 1019
240 Ga0451577_1040034 3300042876 Bacteria 734
241 Ga0451577_1165541 3300042876 Bacteria 688
242 Ga0451577_1289275 3300042876 Bacteria 650
243 Ga0453683_0008046 3300044673 Bacteria 7099
244 Ga0453683_0008470 3300044673 Bacteria 6898
245 Ga0453683_0066512 3300044673 Unclassified 2253
246 Ga0453683_0133944 3300044673 Bacteria 1562
247 Ga0453683_0319316 3300044673 Bacteria 995
248 Ga0453684_0000021 3300044712 Bacteria 873490
249 Ga0453684_0000055 3300044712 Bacteria 532014
250 Ga0453684_0000263 3300044712 Bacteria 226494
251 Ga0453684_0004426 3300044712 Bacteria 29661
252 Ga0453684_0015459 3300044712 Bacteria 12065
253 Ga0453684_0020379 3300044712 Bacteria 10007
254 Ga0453684_0106224 3300044712 Bacteria 3422
255 Ga0453684_0108484 3300044712 Unclassified 3378
256 Ga0453684_0108607 3300044712 Bacteria 3376
257 Ga0453684_0139536 3300044712 Unclassified 2897
258 Ga0453684_0141126 3300044712 Bacteria 2877
259 Ga0453684_0154384 3300044712 Bacteria 2724
260 Ga0453684_0184709 3300044712 Bacteria 2445
261 Ga0453684_0199927 3300044712 Bacteria 2330
262 Ga0453684_0261700 3300044712 Bacteria 1981
263 Ga0453684_0318448 3300044712 Unclassified 1762
264 Ga0453684_0342886 3300044712 Bacteria 1686
265 Ga0453684_0371471 3300044712 Bacteria 1607
266 Ga0453684_0450586 3300044712 Bacteria 1432
267 Ga0453684_0480215 3300044712 Unclassified 1379
268 Ga0453684_0531597 3300044712 Bacteria 1298
269 Ga0453684_0644473 3300044712 Bacteria 1157
270 Ga0453684_0689101 3300044712 Bacteria 1111
271 Ga0453684_0719688 3300044712 Bacteria 1083
272 Ga0453684_0856433 3300044712 Bacteria 976
273 Ga0453684_1279685 3300044712 Bacteria 766
274 Ga0453684_1349815 3300044712 Bacteria 742
275 Ga0453684_1413232 3300044712 Bacteria 721
276 Ga0453684_1764218 3300044712 Bacteria 630
277 Ga0453684_2096942 3300044712 Bacteria 567
278 Ga0466957_0779632 3300044842 Bacteria 678
279 Ga0466959_0574409 3300045049 Bacteria 759
280 Ga0466959_0666646 3300045049 Bacteria 698
281 Ga0451576_0023887 3300045051 Bacteria 6611
282 Ga0451576_0084168 3300045051 Bacteria 3308
283 Ga0451576_0321253 3300045051 Bacteria 1620
284 Ga0451576_0362465 3300045051 Bacteria 1518
285 Ga0451576_0801568 3300045051 Bacteria 989
286 Ga0466958_0153829 3300045836 Bacteria 1451
287 Ga0466967_0501040 3300045976 Bacteria 1192
288 Ga0495603_0565345 3300046455 Bacteria 651
289 Ga0495580_1031339 3300046472 Bacteria 523
290 Ga0495605_0048057 3300046474 Bacteria 2091
291 Ga0495664_0839307 3300046477 Bacteria 539
292 Ga0495630_0935343 3300046517 Unclassified 660
293 Ga0495652_0618770 3300046529 Bacteria 737
294 Ga0495667_0642246 3300046559 Bacteria 660
295 Ga0495635_1095463 3300046663 Bacteria 504
296 Ga0495581_0247347 3300047315 Bacteria 1043
297 Ga0495672_0533875 3300047320 Bacteria 517
298 Ga0495680_1091154 3300047322 Bacteria 505
299 Ga0496100_1192118 3300048903 Bacteria 601
300 Ga0496102_0086205 3300048905 Bacteria 2900
301 Ga0496104_0379486 3300048907 Bacteria 1326
302 Ga0496105_0227402 3300048908 Bacteria 1517
303 Ga0496105_0789372 3300048908 Bacteria 723
304 Ga0496109_0616095 3300048912 Bacteria 1022
305 Ga0496109_1210608 3300048912 Bacteria 692
306 Ga0496109_1771699 3300048912 Bacteria 551
307 Ga0496112_0153682 3300048915 Bacteria 2268
308 Ga0496112_0718496 3300048915 Bacteria 926
309 Ga0496113_0701699 3300048916 Bacteria 807
310 Ga0496113_1396352 3300048916 Bacteria 542
311 Ga0501335_033024 3300049551 Unclassified 590
312 Ga0501036_0760650 3300049572 Bacteria 799
313 Ga0501038_0682952 3300049574 Bacteria 771
314 Ga0501039_1153780 3300049575 Bacteria 600
315 Ga0501040_0131624 3300049576 Bacteria 1759
316 Ga0501041_0322916 3300049577 Bacteria 974
317 Ga0501041_1021319 3300049577 Bacteria 532
318 Ga0501042_0756659 3300049578 Bacteria 707
319 Ga0501068_0437031 3300049584 Bacteria 846
320 Ga0501069_0255340 3300049585 Bacteria 1023
321 Ga0501069_0886437 3300049585 Bacteria 543
322 Ga0501070_0712244 3300049586 Bacteria 793
323 Ga0501070_1272292 3300049586 Bacteria 562
324 Ga0501072_0664039 3300049588 Bacteria 820
325 Ga0501073_0050134 3300049589 Bacteria 2926
326 Ga0501073_1110931 3300049589 Bacteria 543
327 Ga0501074_0306669 3300049590 Bacteria 1128
328 Ga0501075_0077701 3300049591 Bacteria 2512
329 Ga0501075_0138026 3300049591 Bacteria 1858
330 Ga0501076_0064516 3300049592 Bacteria 2919
331 Ga0501077_0624820 3300049593 Bacteria 692
332 Ga0501079_0146101 3300049741 Bacteria 1843
333 Ga0501079_0538944 3300049741 Bacteria 918
334 Ga0501080_0286016 3300049742 Bacteria 1498
335 Ga0501081_0084452 3300049743 Bacteria 2227
336 Ga0501081_1282156 3300049743 Bacteria 555
337 Ga0501083_0893013 3300049744 Bacteria 578
338 Ga0501035_0900704 3300049822 Bacteria 701
339 Ga0501035_1570957 3300049822 Bacteria 500
340 Ga0501045_0092654 3300049824 Bacteria 2235
341 nmdc:mga05p37_189668_c1 3300050507 Bacteria 2497
342 nmdc:mga05p37_38641_c1 3300050507 Bacteria 5856
343 nmdc:mga05p37_410597_c1 3300050507 Bacteria 1578
344 nmdc:mga05p37_476733_c1 3300050507 Bacteria 1438
345 nmdc:mga09592_18807_c1 3300050508 Bacteria 5668
346 nmdc:mga09592_202048_c1 3300050508 Bacteria 1721
347 nmdc:mga09592_93216_c1 3300050508 Bacteria 2575
348 nmdc:mga0qj67_1005367_c1 3300050509 Bacteria 654
349 nmdc:mga0qj67_427839_c1 3300050509 Unclassified 1067
350 nmdc:mga06r32_4500_c2 3300050510 Bacteria 10942
351 nmdc:mga08y16_218406_c1 3300050511 Bacteria 1974
352 nmdc:mga0rr50_944892_c1 3300050513 Unclassified 735
353 nmdc:mga0a205_11654_c1 3300050515 Bacteria 8105
354 nmdc:mga0a205_7763_c1 3300050515 Bacteria 9740
355 Ga0495655_0005555 3300053083 Bacteria 2236
356 Ga0495619_0583638 3300053085 Bacteria 765
357 Ga0501084_0000651 3300054114 Bacteria 26459
358 Ga0501084_0022647 3300054114 Bacteria 5243
359 Ga0501084_0207132 3300054114 Bacteria 1655
360 Ga0501082_0141688 3300060353 Bacteria 2087
361 Ga0501082_0739177 3300060353 Bacteria 861
362 Ga0530510_0537387 3300061734 Bacteria 887
363 Ga0453684_0015839
364 SwRhRL3b_contig_2593129
365 JGI25406J46586_10004683
366 JGI25406J46586_10038702
367 JGI26145J50221_1003880
368 Ga0058860_11834593
369 Ga0065704_10243976
370 Ga0065707_10033736
371 Ga0065707_10267079
372 Ga0070658_10083953
373 Ga0070683_100200540
374 Ga0070680_100059565
375 Ga0070680_100759294
376 Ga0070660_100020345
377 Ga0070660_100219823
378 Ga0070691_10640307
379 Ga0070661_100820954
380 Ga0070692_10270243
381 Ga0070692_11262653
382 Ga0070669_101247058
383 Ga0070705_100604257
384 Ga0070700_101559178
385 Ga0070694_100159927
386 Ga0070694_100240627
387 Ga0070694_100407838
388 Ga0070708_100284650
389 Ga0070708_100600928
390 Ga0070663_100605398
391 Ga0070681_10106031
392 Ga0070681_10865595
393 Ga0068867_100490444
394 Ga0068867_101215958
395 Ga0070706_100009852
396 Ga0070707_100139170
397 Ga0070707_102021373
398 Ga0070698_100359742
399 Ga0070698_100384281
400 Ga0070698_100426678
401 Ga0070699_100169002
402 Ga0070699_100238945
403 Ga0070699_100720618
404 Ga0070679_100012133
405 Ga0070679_100880802
406 Ga0070679_101522457
407 Ga0070684_100837367
408 Ga0070697_100466693
409 Ga0070696_100058653
410 Ga0070696_100294012
411 Ga0070696_100683797
412 Ga0070665_100124971
413 Ga0070704_100047864
414 Ga0070704_100170965
415 Ga0070704_100557893
416 Ga0068855_100188886
417 Ga0070664_101250445
418 Ga0068857_100467673
419 Ga0068861_100428574
420 Ga0068861_101823334
421 Ga0068861_102249677
422 Ga0068870_10903931
423 Ga0068863_100313807
424 Ga0068860_100975570
425 Ga0068862_100054738
426 Ga0068862_100057581
427 Ga0081539_10006236
428 Ga0070712_101698146
429 Ga0097621_100866295
430 Ga0075428_100076360
431 Ga0075428_100092358
432 Ga0075428_100717526
433 Ga0075430_100139595
434 Ga0075430_100408215
435 Ga0075431_100002061
436 Ga0075431_100261262
437 Ga0075433_10044543
438 Ga0075434_101100116
439 Ga0075434_101214007
440 Ga0075429_100006618
441 Ga0075429_100180166
442 Ga0075435_101031645
443 Ga0105240_10808117
444 Ga0111539_10022170
445 Ga0111539_10558646
446 Ga0111539_11365202
447 Ga0105245_10703418
448 Ga0105245_11237013
449 Ga0105245_11486979
450 Ga0105247_11332249
451 Ga0114129_10019647
452 Ga0114129_10117544
453 Ga0114129_10467459
454 Ga0105243_10046163
455 Ga0105243_10234842
456 Ga0105241_11193863
457 Ga0105242_11890257
458 Ga0105238_11115135
459 Ga0105249_10540948
460 Ga0105249_11027784
461 Ga0105249_11899693
462 Ga0105246_10432320
463 Ga0157343_1021469
464 Ga0157369_10036561
465 Ga0163162_12133732
466 Ga0157380_12414262
467 Ga0157376_11623993
468 Ga0206356_11677614
469 Ga0213873_10022659
470 Ga0213875_10037411
471 Ga0213871_10019858
472 Ga0207692_10744076
473 Ga0207705_10288598
474 Ga0207654_10837934
475 Ga0207707_10232669
476 Ga0207663_11393823
477 Ga0207660_10523525
478 Ga0207657_10056512
479 Ga0207652_10036031
480 Ga0207652_11179884
481 Ga0207652_11352224
482 Ga0207652_11368590
483 Ga0207681_10925214
484 Ga0207687_11053195
485 Ga0207700_10058059
486 Ga0207664_10933021
487 Ga0207686_10952812
488 Ga0207686_11026524
489 Ga0207709_10393915
490 Ga0207709_10415432
491 Ga0207709_10870258
492 Ga0207712_10106345
493 Ga0207712_11257492
494 Ga0207668_10567621
495 Ga0207678_10521225
496 Ga0207678_11923766
497 Ga0207708_11077261
498 Ga0207648_10555139
499 Ga0207648_10667702
500 Ga0207674_10301208
501 Ga0207675_100044418
502 Ga0207675_100415034
503 Ga0207675_102511922
504 Ga0209996_1012326
505 Ga0210000_1008342
506 Ga0209995_1029211
507 Ga0209968_1007491
508 Ga0209999_1012272
509 Ga0209970_1000243
510 Ga0210002_1012769
511 Ga0209983_1001291
512 Ga0209971_1004988
513 Ga0209998_10001586
514 Ga0209974_10000932
515 Ga0207428_10132511
516 Ga0268265_10116076
517 Ga0265326_10125698
518 Ga0265334_10145470
519 Ga0265336_10172930
520 Ga0265336_10203201
521 Ga0265338_10159197
522 Ga0265338_10208347
523 Ga0265338_10261550
524 Ga0265338_10722529
525 Ga0265328_10196830
526 Ga0265320_10402317
527 Ga0265325_10210527
528 Ga0265325_10368058
529 Ga0265325_10422189
530 Ga0265340_10221641
531 Ga0265339_10104491
532 Ga0265331_10486232
533 Ga0265331_10581777
534 Ga0265327_10282318
535 Ga0265327_10515405
536 Ga0307408_100147151
537 Ga0316575_10253048
538 Ga0316579_10121484
539 Ga0316579_10177341
540 Ga0265314_10182924
541 Ga0265314_10541114
542 Ga0316578_10827715
543 Ga0307405_10114485
544 Ga0316577_10015357
545 Ga0316577_10219281
546 Ga0307413_10074971
547 Ga0307413_11791422
548 Ga0307410_10096178
549 Ga0307407_10012711
550 Ga0307409_100277945
551 Ga0307416_100335738
552 Ga0307414_10038774
553 Ga0307411_10983946
554 Ga0307411_10990024
555 Ga0307415_100052839
556 Ga0316593_10032538
557 Ga0316596_1044429
558 Ga0316596_1119956
559 Ga0316574_0028617
560 Ga0316574_0612454
561 Ga0373937_0371339
562 Ga0373937_2050417
563 Ga0316582_0007047
564 Ga0316584_0046151
565 Ga0395899_0074144
566 Ga0436364_0831778
567 Ga0436364_1482070
568 Ga0395901_2004056
569 Ga0436365_0732742
570 Ga0436365_1147457
571 Ga0436360_0395990
572 Ga0436360_0473768
573 Ga0436360_0577353
574 Ga0436360_0579439
575 Ga0436360_0795565
576 Ga0436360_1324817
577 Ga0436360_1362380
578 Ga0436360_1377799
579 Ga0436361_0169852
580 Ga0436361_0434638
581 Ga0436361_0563664
582 Ga0436361_0565039
583 Ga0436361_0984651
584 Ga0436363_0030924
585 Ga0436363_0065917
586 Ga0436363_0195099
587 Ga0436363_0255849
588 Ga0436362_0096140
589 Ga0436362_0227011
590 Ga0436362_0265375
591 Ga0436362_0288846
592 Ga0436362_0435333
593 Ga0436362_0704241
594 Ga0436362_0884708
595 Ga0436362_0969416
596 Ga0436362_1055623
597 Ga0450916_042556
598 Ga0451577_0001152
599 Ga0451577_0023510
600 Ga0451577_0261207
601 Ga0451577_0579250
602 Ga0451577_1040034
603 Ga0451577_1165541
604 Ga0451577_1289275
605 Ga0453683_0008046
606 Ga0453683_0008470
607 Ga0453683_0066512
608 Ga0453683_0133944
609 Ga0453683_0319316
610 Ga0453684_0000021
611 Ga0453684_0000055
612 Ga0453684_0000263
613 Ga0453684_0004426
614 Ga0453684_0015459
615 Ga0453684_0020379
616 Ga0453684_0106224
617 Ga0453684_0108484
618 Ga0453684_0108607
619 Ga0453684_0139536
620 Ga0453684_0141126
621 Ga0453684_0154384
622 Ga0453684_0184709
623 Ga0453684_0199927
624 Ga0453684_0261700
625 Ga0453684_0318448
626 Ga0453684_0342886
627 Ga0453684_0371471
628 Ga0453684_0450586
629 Ga0453684_0480215
630 Ga0453684_0531597
631 Ga0453684_0644473
632 Ga0453684_0689101
633 Ga0453684_0719688
634 Ga0453684_0856433
635 Ga0453684_1279685
636 Ga0453684_1349815
637 Ga0453684_1413232
638 Ga0453684_1764218
639 Ga0453684_2096942
640 Ga0466957_0779632
641 Ga0466959_0574409
642 Ga0466959_0666646
643 Ga0451576_0023887
644 Ga0451576_0084168
645 Ga0451576_0321253
646 Ga0451576_0362465
647 Ga0451576_0801568
648 Ga0466958_0153829
649 Ga0466967_0501040
650 Ga0495603_0565345
651 Ga0495580_1031339
652 Ga0495605_0048057
653 Ga0495664_0839307
654 Ga0495630_0935343
655 Ga0495652_0618770
656 Ga0495667_0642246
657 Ga0495635_1095463
658 Ga0495581_0247347
659 Ga0495672_0533875
660 Ga0495680_1091154
661 Ga0496100_1192118
662 Ga0496102_0086205
663 Ga0496104_0379486
664 Ga0496105_0227402
665 Ga0496105_0789372
666 Ga0496109_0616095
667 Ga0496109_1210608
668 Ga0496109_1771699
669 Ga0496112_0153682
670 Ga0496112_0718496
671 Ga0496113_0701699
672 Ga0496113_1396352
673 Ga0501335_033024
674 Ga0501036_0760650
675 Ga0501038_0682952
676 Ga0501039_1153780
677 Ga0501040_0131624
678 Ga0501041_0322916
679 Ga0501041_1021319
680 Ga0501042_0756659
681 Ga0501068_0437031
682 Ga0501069_0255340
683 Ga0501069_0886437
684 Ga0501070_0712244
685 Ga0501070_1272292
686 Ga0501072_0664039
687 Ga0501073_0050134
688 Ga0501073_1110931
689 Ga0501074_0306669
690 Ga0501075_0077701
691 Ga0501075_0138026
692 Ga0501076_0064516
693 Ga0501077_0624820
694 Ga0501079_0146101
695 Ga0501079_0538944
696 Ga0501080_0286016
697 Ga0501081_0084452
698 Ga0501081_1282156
699 Ga0501083_0893013
700 Ga0501035_0900704
701 Ga0501035_1570957
702 Ga0501045_0092654
703 nmdc:mga05p37_189668_c1
704 nmdc:mga05p37_38641_c1
705 nmdc:mga05p37_410597_c1
706 nmdc:mga05p37_476733_c1
707 nmdc:mga09592_18807_c1
708 nmdc:mga09592_202048_c1
709 nmdc:mga09592_93216_c1
710 nmdc:mga0qj67_1005367_c1
711 nmdc:mga0qj67_427839_c1
712 nmdc:mga06r32_4500_c2
713 nmdc:mga08y16_218406_c1
714 nmdc:mga0rr50_944892_c1
715 nmdc:mga0a205_11654_c1
716 nmdc:mga0a205_7763_c1
717 Ga0495655_0005555
718 Ga0495619_0583638
719 Ga0501084_0000651
720 Ga0501084_0022647
721 Ga0501084_0207132
722 Ga0501082_0141688
723 Ga0501082_0739177
724 Ga0530510_0537387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

11

90

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9708 20 83
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.968 20 83
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9556 21 85
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9414 19 81
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.9401 19 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9343 20 84 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9076 20 84 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8843 21 85 2.40.50.100
af_Q4DVL3_299_475_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.881 66 80 3.40.50.300
af_O59821_2_44_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8572 29 66 2.40.50.100
ID Description Score Start End GO Terms
AF-I4M014-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9878 28 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A7Y5TEY2-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9873 21 82 GO:0003735
GO:0006412
GO:0022625
AF-I0R0V1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9851 23 83 GO:0003735
GO:0006412
GO:0022625
AF-A0A3D3VUF3-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9842 23 82 GO:0003735
GO:0006412
GO:0022625
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9796 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map