F422019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 261 | 720 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_1421884|Ga0501035_1421884_10_417 |
| Length | 135 |
| Sequence | MARVKGGTMTKKRHKKILKMSKGYVGRSNNCFIPANQKIEKGLKYAYRDRKNKKRTFRNLWIARINAAARINGMVYSDLVHGLKLAGSTLDRKILAQIAFESPESFAAIAETAKSALKNNKVNSKGQKSPQEKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 134 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 149 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 150 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 153 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 158 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 159 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 160 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 161 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 162 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 165 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 166 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 167 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 195 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 196 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 197 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 198 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 199 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 213 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 217 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 227 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 235 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 236 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 237 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 238 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 239 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 240 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 241 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 242 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 243 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 244 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 245 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 246 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 247 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 248 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 249 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 250 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 251 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 252 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 253 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 254 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 255 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 256 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 257 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 258 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 259 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 260 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 261 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90 |
| Metatranscriptomes | 2.5 |
| Isolates | 7.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.22 |
| Nodule | 0.28 |
| Rhizoplane | 2.78 |
| Rhizosphere | 80 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_1421884 | 3300049822 | Unclassified | 531 |
| 2 | JGI25406J46586_10036882 | 3300003203 | Bacteria | 1769 |
| 3 | rootH1_10276498 | 3300003323 | Bacteria | 2954 |
| 4 | Ga0055532_1000637 | 3300003758 | Bacteria | 13597 |
| 5 | Ga0058859_11595649 | 3300004798 | Bacteria | 1465 |
| 6 | Ga0058860_12211021 | 3300004801 | Bacteria | 4320 |
| 7 | Ga0065707_10207175 | 3300005295 | Bacteria | 1282 |
| 8 | Ga0070683_100466715 | 3300005329 | Bacteria | 1205 |
| 9 | Ga0070670_101451886 | 3300005331 | Unclassified | 629 |
| 10 | Ga0068869_100392898 | 3300005334 | Bacteria | 1139 |
| 11 | Ga0070680_100002988 | 3300005336 | Bacteria | 12555 |
| 12 | Ga0070691_10759375 | 3300005341 | Unclassified | 587 |
| 13 | Ga0070687_100117021 | 3300005343 | Bacteria | 1518 |
| 14 | Ga0070687_100222995 | 3300005343 | Bacteria | 1156 |
| 15 | Ga0070692_10173877 | 3300005345 | Bacteria | 1243 |
| 16 | Ga0070668_100160126 | 3300005347 | Bacteria | 1826 |
| 17 | Ga0070669_101275568 | 3300005353 | Unclassified | 636 |
| 18 | Ga0070688_100012701 | 3300005365 | Bacteria | 4725 |
| 19 | Ga0070709_10086853 | 3300005434 | Bacteria | 2054 |
| 20 | Ga0070713_100629390 | 3300005436 | Bacteria | 1021 |
| 21 | Ga0070701_10039398 | 3300005438 | Bacteria | 2397 |
| 22 | Ga0070705_100154521 | 3300005440 | Bacteria | 1526 |
| 23 | Ga0070700_100019729 | 3300005441 | Bacteria | 3895 |
| 24 | Ga0070708_100028644 | 3300005445 | Bacteria | 4795 |
| 25 | Ga0070708_100064231 | 3300005445 | Bacteria | 3288 |
| 26 | Ga0070681_10000987 | 3300005458 | Bacteria | 24071 |
| 27 | Ga0070681_10101556 | 3300005458 | Bacteria | 2822 |
| 28 | Ga0070685_10035040 | 3300005466 | Bacteria | 2830 |
| 29 | Ga0070706_100002677 | 3300005467 | Bacteria | 17846 |
| 30 | Ga0070706_100145885 | 3300005467 | Bacteria | 2210 |
| 31 | Ga0070706_102165762 | 3300005467 | Unclassified | 502 |
| 32 | Ga0070707_100171813 | 3300005468 | Bacteria | 2112 |
| 33 | Ga0070699_100000817 | 3300005518 | Bacteria | 28818 |
| 34 | Ga0070699_100174844 | 3300005518 | Bacteria | 1904 |
| 35 | Ga0070679_100012403 | 3300005530 | Bacteria | 8143 |
| 36 | Ga0070679_100605862 | 3300005530 | Bacteria | 1038 |
| 37 | Ga0070697_100603063 | 3300005536 | Bacteria | 965 |
| 38 | Ga0068853_100545638 | 3300005539 | Bacteria | 1098 |
| 39 | Ga0070686_100019062 | 3300005544 | Bacteria | 4037 |
| 40 | Ga0070695_101015624 | 3300005545 | Bacteria | 675 |
| 41 | Ga0070693_100822687 | 3300005547 | Bacteria | 690 |
| 42 | Ga0070665_100665190 | 3300005548 | Bacteria | 1054 |
| 43 | Ga0068854_100371654 | 3300005578 | Bacteria | 1176 |
| 44 | Ga0070702_100345629 | 3300005615 | Bacteria | 1046 |
| 45 | Ga0068859_100033055 | 3300005617 | Bacteria | 5196 |
| 46 | Ga0068859_102302629 | 3300005617 | Bacteria | 594 |
| 47 | Ga0068864_100246432 | 3300005618 | Bacteria | 1657 |
| 48 | Ga0068858_100240643 | 3300005842 | Bacteria | 1717 |
| 49 | Ga0068858_100580545 | 3300005842 | Bacteria | 1086 |
| 50 | Ga0068860_100132934 | 3300005843 | Bacteria | 2389 |
| 51 | Ga0068860_101811122 | 3300005843 | Bacteria | 632 |
| 52 | Ga0068862_100040000 | 3300005844 | Bacteria | 3984 |
| 53 | Ga0081538_10003100 | 3300005981 | Bacteria | 15806 |
| 54 | Ga0081538_10069662 | 3300005981 | Bacteria | 1947 |
| 55 | Ga0081538_10072019 | 3300005981 | Bacteria | 1897 |
| 56 | Ga0081538_10205368 | 3300005981 | Bacteria | 803 |
| 57 | Ga0081539_10001434 | 3300005985 | Bacteria | 40840 |
| 58 | Ga0075363_100140468 | 3300006048 | Bacteria | 1359 |
| 59 | Ga0070715_10827167 | 3300006163 | Bacteria | 564 |
| 60 | Ga0070716_100391351 | 3300006173 | Bacteria | 997 |
| 61 | Ga0070716_100493775 | 3300006173 | Bacteria | 901 |
| 62 | Ga0070712_100264310 | 3300006175 | Bacteria | 1380 |
| 63 | Ga0070712_100575001 | 3300006175 | Bacteria | 951 |
| 64 | Ga0075427_10011074 | 3300006194 | Unclassified | 1357 |
| 65 | Ga0075428_100069019 | 3300006844 | Bacteria | 3866 |
| 66 | Ga0075428_100185671 | 3300006844 | Bacteria | 2250 |
| 67 | Ga0075428_100520454 | 3300006844 | Unclassified | 1272 |
| 68 | Ga0075428_101123280 | 3300006844 | Bacteria | 830 |
| 69 | Ga0075430_100703184 | 3300006846 | Bacteria | 833 |
| 70 | Ga0075430_101164969 | 3300006846 | Unclassified | 635 |
| 71 | Ga0075431_100087723 | 3300006847 | Bacteria | 3210 |
| 72 | Ga0075431_100176530 | 3300006847 | Bacteria | 2194 |
| 73 | Ga0075431_100478664 | 3300006847 | Bacteria | 1238 |
| 74 | Ga0075433_11022608 | 3300006852 | Unclassified | 719 |
| 75 | Ga0075433_11386696 | 3300006852 | Unclassified | 608 |
| 76 | Ga0075434_101560265 | 3300006871 | Unclassified | 669 |
| 77 | Ga0075429_100006581 | 3300006880 | Bacteria | 10062 |
| 78 | Ga0075429_100517232 | 3300006880 | Bacteria | 1046 |
| 79 | Ga0068865_100002543 | 3300006881 | Bacteria | 10814 |
| 80 | Ga0075436_100027971 | 3300006914 | Bacteria | 3881 |
| 81 | Ga0075436_100821675 | 3300006914 | Bacteria | 693 |
| 82 | Ga0097620_100033055 | 3300006931 | Bacteria | 5196 |
| 83 | Ga0097620_102301899 | 3300006931 | Bacteria | 594 |
| 84 | Ga0099794_10002175 | 3300007265 | Bacteria | 7145 |
| 85 | Ga0111539_10072363 | 3300009094 | Bacteria | 4065 |
| 86 | Ga0105245_10287191 | 3300009098 | Bacteria | 1610 |
| 87 | Ga0105245_12081485 | 3300009098 | Unclassified | 621 |
| 88 | Ga0105247_10005791 | 3300009101 | Bacteria | 7739 |
| 89 | Ga0114129_10210171 | 3300009147 | Unclassified | 2631 |
| 90 | Ga0105243_10953895 | 3300009148 | Unclassified | 857 |
| 91 | Ga0105241_10659779 | 3300009174 | Bacteria | 951 |
| 92 | Ga0105237_11905780 | 3300009545 | Bacteria | 602 |
| 93 | Ga0105238_10020431 | 3300009551 | Bacteria | 6741 |
| 94 | Ga0105238_10620944 | 3300009551 | Bacteria | 1090 |
| 95 | Ga0105249_10072581 | 3300009553 | Bacteria | 3182 |
| 96 | Ga0105239_10538198 | 3300010375 | Bacteria | 1330 |
| 97 | Ga0105246_10120988 | 3300011119 | Bacteria | 1940 |
| 98 | Ga0157373_10489375 | 3300013100 | Bacteria | 888 |
| 99 | Ga0157370_10003504 | 3300013104 | Bacteria | 18396 |
| 100 | Ga0157369_11597140 | 3300013105 | Bacteria | 663 |
| 101 | Ga0163162_10145781 | 3300013306 | Bacteria | 2484 |
| 102 | Ga0157372_10443487 | 3300013307 | Bacteria | 1513 |
| 103 | Ga0163163_10371424 | 3300014325 | Bacteria | 1487 |
| 104 | Ga0157380_10074106 | 3300014326 | Bacteria | 2762 |
| 105 | Ga0157380_11395026 | 3300014326 | Unclassified | 751 |
| 106 | Ga0157379_10264734 | 3300014968 | Bacteria | 1563 |
| 107 | Ga0157379_10652904 | 3300014968 | Unclassified | 985 |
| 108 | Ga0157376_12487181 | 3300014969 | Bacteria | 557 |
| 109 | Ga0182007_10071562 | 3300015262 | Bacteria | 1136 |
| 110 | Ga0163161_10432775 | 3300017792 | Unclassified | 1060 |
| 111 | Ga0224712_10133245 | 3300022467 | Bacteria | 1087 |
| 112 | Ga0209147_100050 | 3300025229 | Bacteria | 274639 |
| 113 | Ga0209233_1017391 | 3300025261 | Bacteria | 1960 |
| 114 | Ga0209257_1000530 | 3300025304 | Bacteria | 66163 |
| 115 | Ga0207697_10357246 | 3300025315 | Unclassified | 649 |
| 116 | Ga0207692_11220305 | 3300025898 | Bacteria | 500 |
| 117 | Ga0207710_10016004 | 3300025900 | Bacteria | 3173 |
| 118 | Ga0207688_10152843 | 3300025901 | Bacteria | 1364 |
| 119 | Ga0207685_10632181 | 3300025905 | Bacteria | 577 |
| 120 | Ga0207699_10376547 | 3300025906 | Bacteria | 1007 |
| 121 | Ga0207707_10037422 | 3300025912 | Bacteria | 4241 |
| 122 | Ga0207707_10109575 | 3300025912 | Bacteria | 2414 |
| 123 | Ga0207671_11170872 | 3300025914 | Bacteria | 602 |
| 124 | Ga0207693_10105598 | 3300025915 | Bacteria | 2209 |
| 125 | Ga0207693_10243260 | 3300025915 | Bacteria | 1412 |
| 126 | Ga0207660_10223781 | 3300025917 | Bacteria | 1477 |
| 127 | Ga0207662_10291402 | 3300025918 | Bacteria | 1083 |
| 128 | Ga0207662_11163299 | 3300025918 | Unclassified | 548 |
| 129 | Ga0207652_10937039 | 3300025921 | Bacteria | 764 |
| 130 | Ga0207646_11355114 | 3300025922 | Bacteria | 620 |
| 131 | Ga0207694_10418446 | 3300025924 | Bacteria | 1116 |
| 132 | Ga0207704_10029859 | 3300025938 | Bacteria | 3048 |
| 133 | Ga0207665_10617435 | 3300025939 | Bacteria | 848 |
| 134 | Ga0207661_10504141 | 3300025944 | Bacteria | 1106 |
| 135 | Ga0207667_10224663 | 3300025949 | Bacteria | 1924 |
| 136 | Ga0207712_10459189 | 3300025961 | Bacteria | 1082 |
| 137 | Ga0207668_10250172 | 3300025972 | Bacteria | 1439 |
| 138 | Ga0207703_10207568 | 3300026035 | Bacteria | 1744 |
| 139 | Ga0207703_10292453 | 3300026035 | Bacteria | 1483 |
| 140 | Ga0207639_11024252 | 3300026041 | Bacteria | 773 |
| 141 | Ga0207708_10025560 | 3300026075 | Bacteria | 4469 |
| 142 | Ga0207675_100138636 | 3300026118 | Bacteria | 2310 |
| 143 | Ga0207675_100510578 | 3300026118 | Bacteria | 1197 |
| 144 | Ga0207675_100839698 | 3300026118 | Bacteria | 933 |
| 145 | Ga0207428_10059318 | 3300027907 | Bacteria | 3034 |
| 146 | Ga0268265_10056978 | 3300028380 | Bacteria | 2976 |
| 147 | Ga0268264_10097241 | 3300028381 | Bacteria | 2552 |
| 148 | Ga0268264_11367794 | 3300028381 | Bacteria | 718 |
| 149 | Ga0307515_10285580 | 3300028794 | Bacteria | 1352 |
| 150 | Ga0265329_10083486 | 3300031242 | Bacteria | 1012 |
| 151 | Ga0265339_10104811 | 3300031249 | Bacteria | 1468 |
| 152 | Ga0265331_10000805 | 3300031250 | Bacteria | 25935 |
| 153 | Ga0307513_10379806 | 3300031456 | Bacteria | 1152 |
| 154 | Ga0307408_101428384 | 3300031548 | Unclassified | 652 |
| 155 | Ga0307408_102213997 | 3300031548 | Unclassified | 531 |
| 156 | Ga0265313_10000622 | 3300031595 | Bacteria | 36655 |
| 157 | Ga0316579_10009113 | 3300031691 | Bacteria | 4166 |
| 158 | Ga0265314_10115422 | 3300031711 | Bacteria | 1699 |
| 159 | Ga0265342_10020681 | 3300031712 | Bacteria | 4215 |
| 160 | Ga0307405_10474111 | 3300031731 | Unclassified | 998 |
| 161 | Ga0316577_10091903 | 3300031733 | Unclassified | 1699 |
| 162 | Ga0307413_10523115 | 3300031824 | Bacteria | 957 |
| 163 | Ga0307410_11050287 | 3300031852 | Bacteria | 704 |
| 164 | Ga0307406_10025456 | 3300031901 | Bacteria | 3544 |
| 165 | Ga0307412_10184085 | 3300031911 | Bacteria | 1574 |
| 166 | Ga0307409_101688696 | 3300031995 | Unclassified | 662 |
| 167 | Ga0307416_100364843 | 3300032002 | Bacteria | 1468 |
| 168 | Ga0307416_100699163 | 3300032002 | Bacteria | 1103 |
| 169 | Ga0307415_100613662 | 3300032126 | Bacteria | 970 |
| 170 | Ga0307415_100870556 | 3300032126 | Bacteria | 828 |
| 171 | Ga0316593_10196240 | 3300032168 | Unclassified | 745 |
| 172 | Ga0373926_0223136 | 3300035083 | Bacteria | 728 |
| 173 | Ga0373934_0398535 | 3300035086 | Bacteria | 575 |
| 174 | Ga0373940_0294524 | 3300035088 | Bacteria | 557 |
| 175 | Ga0373923_0061169 | 3300035111 | Bacteria | 1600 |
| 176 | Ga0373954_0188006 | 3300035118 | Bacteria | 1014 |
| 177 | Ga0373957_0427815 | 3300035120 | Bacteria | 572 |
| 178 | Ga0373927_0349816 | 3300035695 | Bacteria | 974 |
| 179 | Ga0373933_0776633 | 3300035724 | Bacteria | 630 |
| 180 | Ga0373937_0011754 | 3300036401 | Bacteria | 7679 |
| 181 | Ga0316582_0692472 | 3300036647 | Bacteria | 700 |
| 182 | Ga0373925_0067375 | 3300037068 | Bacteria | 2700 |
| 183 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 184 | Ga0395905_0251842 | 3300037471 | Bacteria | 1650 |
| 185 | Ga0395905_0254879 | 3300037471 | Bacteria | 1639 |
| 186 | Ga0395901_0289016 | 3300038443 | Bacteria | 1702 |
| 187 | Ga0395901_1657562 | 3300038443 | Bacteria | 592 |
| 188 | Ga0436361_0270017 | 3300039447 | Bacteria | 2349 |
| 189 | Ga0436362_0517518 | 3300039453 | Bacteria | 643 |
| 190 | Ga0439436_0035704 | 3300041404 | Bacteria | 1436 |
| 191 | Ga0451787_697986 | 3300041441 | Bacteria | 739 |
| 192 | Ga0451789_0825853 | 3300041443 | Bacteria | 990 |
| 193 | Ga0451790_01588 | 3300041444 | Bacteria | 878 |
| 194 | Ga0451793_0843989 | 3300041452 | Bacteria | 2406 |
| 195 | Ga0451795_0143990 | 3300041456 | Bacteria | 955 |
| 196 | Ga0451802_0364413 | 3300041460 | Bacteria | 1203 |
| 197 | Ga0451807_0252822 | 3300041486 | Bacteria | 743 |
| 198 | Ga0451833_1388582 | 3300041491 | Bacteria | 819 |
| 199 | Ga0451837_0268031 | 3300041494 | Bacteria | 1909 |
| 200 | Ga0451837_0693087 | 3300041494 | Bacteria | 1750 |
| 201 | Ga0451839_1303100 | 3300041496 | Bacteria | 917 |
| 202 | Ga0451851_0256496 | 3300041507 | Bacteria | 829 |
| 203 | Ga0451843_1142642 | 3300041509 | Bacteria | 618 |
| 204 | Ga0451855_0137844 | 3300041511 | Bacteria | 692 |
| 205 | Ga0451853_3720037 | 3300041512 | Bacteria | 961 |
| 206 | Ga0439431_0039483 | 3300041997 | Bacteria | 1197 |
| 207 | Ga0439449_0038350 | 3300042007 | Bacteria | 1781 |
| 208 | Ga0439446_0050104 | 3300042156 | Bacteria | 1246 |
| 209 | Ga0439460_0185895 | 3300042461 | Bacteria | 704 |
| 210 | Ga0451577_0044290 | 3300042876 | Unclassified | 3984 |
| 211 | Ga0451577_0810226 | 3300042876 | Bacteria | 846 |
| 212 | Ga0451577_1375106 | 3300042876 | Bacteria | 627 |
| 213 | Ga0466966_0003216 | 3300044684 | Bacteria | 10767 |
| 214 | Ga0466966_0012464 | 3300044684 | Bacteria | 5632 |
| 215 | Ga0466961_0106055 | 3300044693 | Bacteria | 1769 |
| 216 | Ga0453684_0098178 | 3300044712 | Bacteria | 3592 |
| 217 | Ga0453684_0100305 | 3300044712 | Bacteria | 3544 |
| 218 | Ga0453684_0176349 | 3300044712 | Bacteria | 2513 |
| 219 | Ga0453684_0183849 | 3300044712 | Unclassified | 2451 |
| 220 | Ga0453684_0358769 | 3300044712 | Bacteria | 1642 |
| 221 | Ga0453684_2212199 | 3300044712 | Unclassified | 549 |
| 222 | Ga0453684_2247853 | 3300044712 | Bacteria | 543 |
| 223 | Ga0453684_2559688 | 3300044712 | Bacteria | 502 |
| 224 | Ga0466971_0039396 | 3300044719 | Bacteria | 2121 |
| 225 | Ga0466971_0468651 | 3300044719 | Unclassified | 619 |
| 226 | Ga0466957_0176392 | 3300044842 | Bacteria | 1394 |
| 227 | Ga0466957_0270318 | 3300044842 | Unclassified | 1135 |
| 228 | Ga0466957_1068701 | 3300044842 | Bacteria | 581 |
| 229 | Ga0466959_0003115 | 3300045049 | Bacteria | 10756 |
| 230 | Ga0466959_0049393 | 3300045049 | Bacteria | 3091 |
| 231 | Ga0466959_0274083 | 3300045049 | Bacteria | 1159 |
| 232 | Ga0466958_0002051 | 3300045836 | Bacteria | 9953 |
| 233 | Ga0466958_0318576 | 3300045836 | Unclassified | 999 |
| 234 | Ga0466958_0365401 | 3300045836 | Bacteria | 930 |
| 235 | Ga0466958_0369961 | 3300045836 | Bacteria | 924 |
| 236 | Ga0466967_0689685 | 3300045976 | Bacteria | 1011 |
| 237 | Ga0495638_0037993 | 3300046460 | Bacteria | 3062 |
| 238 | Ga0495580_0413833 | 3300046472 | Bacteria | 908 |
| 239 | Ga0495616_0105949 | 3300046513 | Bacteria | 1312 |
| 240 | Ga0495663_0001607 | 3300046525 | Bacteria | 7069 |
| 241 | Ga0495654_0131892 | 3300046530 | Bacteria | 1121 |
| 242 | Ga0495658_0142701 | 3300046683 | Bacteria | 1466 |
| 243 | Ga0495671_0009072 | 3300046692 | Bacteria | 5577 |
| 244 | Ga0495674_0610766 | 3300047319 | Bacteria | 863 |
| 245 | Ga0495684_0904717 | 3300047471 | Bacteria | 568 |
| 246 | Ga0496105_1213942 | 3300048908 | Bacteria | 555 |
| 247 | Ga0496106_1204652 | 3300048909 | Unclassified | 590 |
| 248 | Ga0496115_1061977 | 3300048918 | Bacteria | 616 |
| 249 | Ga0496116_0003651 | 3300048919 | Bacteria | 15114 |
| 250 | Ga0496116_0013061 | 3300048919 | Bacteria | 6731 |
| 251 | Ga0496116_0040138 | 3300048919 | Bacteria | 3226 |
| 252 | Ga0496116_0064200 | 3300048919 | Bacteria | 2361 |
| 253 | Ga0496117_0010005 | 3300048920 | Bacteria | 8717 |
| 254 | Ga0496117_0023479 | 3300048920 | Bacteria | 4912 |
| 255 | Ga0496118_0010398 | 3300048921 | Bacteria | 9223 |
| 256 | Ga0496119_0000116 | 3300048922 | Bacteria | 111744 |
| 257 | Ga0496119_0004234 | 3300048922 | Bacteria | 14389 |
| 258 | Ga0496120_0000089 | 3300048923 | Bacteria | 151805 |
| 259 | Ga0496120_0016118 | 3300048923 | Bacteria | 4895 |
| 260 | Ga0496122_0005235 | 3300048925 | Bacteria | 15565 |
| 261 | Ga0496122_0038166 | 3300048925 | Bacteria | 3853 |
| 262 | Ga0496122_0191116 | 3300048925 | Bacteria | 1208 |
| 263 | Ga0496122_0294818 | 3300048925 | Bacteria | 878 |
| 264 | Ga0496122_0444170 | 3300048925 | Bacteria | 645 |
| 265 | Ga0496123_0008518 | 3300048926 | Bacteria | 9404 |
| 266 | Ga0496123_0072799 | 3300048926 | Bacteria | 2136 |
| 267 | Ga0496123_0141106 | 3300048926 | Bacteria | 1317 |
| 268 | Ga0496123_0230487 | 3300048926 | Bacteria | 927 |
| 269 | Ga0496124_0000327 | 3300048927 | Bacteria | 87886 |
| 270 | Ga0496124_0159191 | 3300048927 | Bacteria | 1762 |
| 271 | Ga0496124_0257876 | 3300048927 | Bacteria | 1285 |
| 272 | Ga0496125_0003755 | 3300048928 | Bacteria | 18079 |
| 273 | Ga0496125_0096455 | 3300048928 | Bacteria | 2195 |
| 274 | Ga0496125_0118405 | 3300048928 | Bacteria | 1897 |
| 275 | Ga0496126_0000671 | 3300048929 | Bacteria | 63347 |
| 276 | Ga0496126_0003569 | 3300048929 | Bacteria | 19512 |
| 277 | Ga0496126_0004223 | 3300048929 | Bacteria | 17311 |
| 278 | Ga0496126_0124886 | 3300048929 | Bacteria | 2229 |
| 279 | Ga0501298_165264 | 3300049521 | Unclassified | 548 |
| 280 | Ga0501039_0958086 | 3300049575 | Unclassified | 665 |
| 281 | Ga0501040_0712694 | 3300049576 | Bacteria | 726 |
| 282 | Ga0501040_1074663 | 3300049576 | Unclassified | 584 |
| 283 | Ga0501041_0503726 | 3300049577 | Bacteria | 770 |
| 284 | Ga0501041_0693326 | 3300049577 | Bacteria | 652 |
| 285 | Ga0501046_0527012 | 3300049580 | Unclassified | 844 |
| 286 | Ga0501048_0309775 | 3300049582 | Bacteria | 1124 |
| 287 | Ga0501068_0306898 | 3300049584 | Bacteria | 1016 |
| 288 | Ga0501069_0590634 | 3300049585 | Unclassified | 666 |
| 289 | Ga0501069_0885752 | 3300049585 | Bacteria | 543 |
| 290 | Ga0501070_0070210 | 3300049586 | Bacteria | 2900 |
| 291 | Ga0501071_0269791 | 3300049587 | Bacteria | 1286 |
| 292 | Ga0501072_0319790 | 3300049588 | Bacteria | 1233 |
| 293 | Ga0501072_0891205 | 3300049588 | Bacteria | 695 |
| 294 | Ga0501075_0049805 | 3300049591 | Unclassified | 3149 |
| 295 | Ga0501076_0134876 | 3300049592 | Unclassified | 2004 |
| 296 | Ga0501076_0188386 | 3300049592 | Bacteria | 1683 |
| 297 | Ga0501076_0330699 | 3300049592 | Unclassified | 1250 |
| 298 | Ga0501076_0862915 | 3300049592 | Bacteria | 746 |
| 299 | Ga0501247_063978 | 3300049677 | Unclassified | 570 |
| 300 | Ga0501257_200177 | 3300049686 | Unclassified | 574 |
| 301 | Ga0501079_0644302 | 3300049741 | Unclassified | 834 |
| 302 | Ga0501079_0727680 | 3300049741 | Bacteria | 781 |
| 303 | Ga0501081_0376894 | 3300049743 | Bacteria | 1048 |
| 304 | Ga0501081_0690690 | 3300049743 | Unclassified | 766 |
| 305 | Ga0501081_1184208 | 3300049743 | Bacteria | 579 |
| 306 | Ga0501283_134148 | 3300049779 | Unclassified | 505 |
| 307 | nmdc:mga0k408_315897_c1 | 3300050493 | Bacteria | 932 |
| 308 | nmdc:mga05p37_171870_c1 | 3300050507 | Unclassified | 2643 |
| 309 | nmdc:mga05p37_195879_c1 | 3300050507 | Bacteria | 2450 |
| 310 | nmdc:mga05p37_521505_c1 | 3300050507 | Bacteria | 1359 |
| 311 | nmdc:mga05p37_8021_c1 | 3300050507 | Bacteria | 12467 |
| 312 | nmdc:mga09592_220654_c1 | 3300050508 | Bacteria | 1643 |
| 313 | nmdc:mga09592_246062_c1 | 3300050508 | Bacteria | 1550 |
| 314 | nmdc:mga09592_4154_c1 | 3300050508 | Bacteria | 11700 |
| 315 | nmdc:mga09592_496660_c1 | 3300050508 | Bacteria | 1051 |
| 316 | nmdc:mga0qj67_711915_c1 | 3300050509 | Bacteria | 798 |
| 317 | nmdc:mga06r32_161049_c1 | 3300050510 | Bacteria | 2226 |
| 318 | nmdc:mga06r32_64498_c1 | 3300050510 | Bacteria | 3532 |
| 319 | nmdc:mga08y16_234708_c1 | 3300050511 | Bacteria | 1897 |
| 320 | nmdc:mga0n895_474366_c1 | 3300050512 | Unclassified | 1262 |
| 321 | nmdc:mga08x19_565433_c1 | 3300050514 | Bacteria | 805 |
| 322 | nmdc:mga0a205_1260037_c1 | 3300050515 | Unclassified | 587 |
| 323 | Ga0500595_012201 | 3300053119 | Bacteria | 3330 |
| 324 | Ga0500633_0082162 | 3300053160 | Unclassified | 1167 |
| 325 | Ga0501084_0176677 | 3300054114 | Bacteria | 1802 |
| 326 | Ga0501084_0388729 | 3300054114 | Unclassified | 1179 |
| 327 | Ga0501084_0746047 | 3300054114 | Unclassified | 825 |
| 328 | Ga0587073_0143573 | 3300059492 | Bacteria | 668 |
| 329 | Ga0587085_072589 | 3300059506 | Bacteria | 676 |
| 330 | Ga0587128_076414 | 3300059630 | Bacteria | 662 |
| 331 | Ga0587067_145231 | 3300059640 | Bacteria | 591 |
| 332 | Ga0501082_0437929 | 3300060353 | Unclassified | 1142 |
| 333 | Ga0530510_0277770 | 3300061734 | Bacteria | 1251 |
| 334 | 2511176111 | 2510917027 | Bacteria | 5287437 |
| 335 | 2512640940 | 2512564013 | Bacteria | 6286191 |
| 336 | 2723602965 | 2721755693 | Bacteria | 6126117 |
| 337 | 2730138958 | 2728369359 | Bacteria | 5621728 |
| 338 | 2745165682 | 2744054657 | Bacteria | 5016802 |
| 339 | 2753811646 | 2751185905 | Bacteria | 6142767 |
| 340 | 2802436481 | 2802428803 | Bacteria | 5806948 |
| 341 | 2817617349 | 2816332336 | Bacteria | 5207640 |
| 342 | 2857462736 | 2857460504 | Bacteria | 5194327 |
| 343 | 2857466276 | 2857465823 | Bacteria | 6772595 |
| 344 | 2857593647 | 2857591370 | Bacteria | 6569758 |
| 345 | 2889278926 | 2889276214 | Bacteria | 5979355 |
| 346 | 2898909387 | 2898907183 | Bacteria | 4067722 |
| 347 | 2904599655 | 2904595352 | Bacteria | 6124848 |
| 348 | 2907204527 | 2907202186 | Bacteria | 6632024 |
| 349 | 2915600176 | 2915597211 | Bacteria | 6475886 |
| 350 | 2915609759 | 2915606848 | Bacteria | 6032732 |
| 351 | 2929185363 | 2929183550 | Bacteria | 6377511 |
| 352 | 2938653540 | 2938649242 | Bacteria | 7118381 |
| 353 | 2939704470 | 2939702853 | Bacteria | 5139229 |
| 354 | 2968561047 | 2968558590 | Bacteria | 6956864 |
| 355 | 2980185477 | 2980182181 | Bacteria | 9454109 |
| 356 | 2988228725 | 2988225383 | Bacteria | 7221625 |
| 357 | 2996636189 | 2996632988 | Bacteria | 6921523 |
| 358 | 2996708689 | 2996706504 | Bacteria | 5757485 |
| 359 | 3006984287 | 3006984091 | Bacteria | 4207523 |
| 360 | 648169290 | 648028048 | Bacteria | 5394884 |
| 361 | Ga0501035_1421884 | |||
| 362 | JGI25406J46586_10036882 | |||
| 363 | rootH1_10276498 | |||
| 364 | Ga0055532_1000637 | |||
| 365 | Ga0058859_11595649 | |||
| 366 | Ga0058860_12211021 | |||
| 367 | Ga0065707_10207175 | |||
| 368 | Ga0070683_100466715 | |||
| 369 | Ga0070670_101451886 | |||
| 370 | Ga0068869_100392898 | |||
| 371 | Ga0070680_100002988 | |||
| 372 | Ga0070691_10759375 | |||
| 373 | Ga0070687_100117021 | |||
| 374 | Ga0070687_100222995 | |||
| 375 | Ga0070692_10173877 | |||
| 376 | Ga0070668_100160126 | |||
| 377 | Ga0070669_101275568 | |||
| 378 | Ga0070688_100012701 | |||
| 379 | Ga0070709_10086853 | |||
| 380 | Ga0070713_100629390 | |||
| 381 | Ga0070701_10039398 | |||
| 382 | Ga0070705_100154521 | |||
| 383 | Ga0070700_100019729 | |||
| 384 | Ga0070708_100028644 | |||
| 385 | Ga0070708_100064231 | |||
| 386 | Ga0070681_10000987 | |||
| 387 | Ga0070681_10101556 | |||
| 388 | Ga0070685_10035040 | |||
| 389 | Ga0070706_100002677 | |||
| 390 | Ga0070706_100145885 | |||
| 391 | Ga0070706_102165762 | |||
| 392 | Ga0070707_100171813 | |||
| 393 | Ga0070699_100000817 | |||
| 394 | Ga0070699_100174844 | |||
| 395 | Ga0070679_100012403 | |||
| 396 | Ga0070679_100605862 | |||
| 397 | Ga0070697_100603063 | |||
| 398 | Ga0068853_100545638 | |||
| 399 | Ga0070686_100019062 | |||
| 400 | Ga0070695_101015624 | |||
| 401 | Ga0070693_100822687 | |||
| 402 | Ga0070665_100665190 | |||
| 403 | Ga0068854_100371654 | |||
| 404 | Ga0070702_100345629 | |||
| 405 | Ga0068859_100033055 | |||
| 406 | Ga0068859_102302629 | |||
| 407 | Ga0068864_100246432 | |||
| 408 | Ga0068858_100240643 | |||
| 409 | Ga0068858_100580545 | |||
| 410 | Ga0068860_100132934 | |||
| 411 | Ga0068860_101811122 | |||
| 412 | Ga0068862_100040000 | |||
| 413 | Ga0081538_10003100 | |||
| 414 | Ga0081538_10069662 | |||
| 415 | Ga0081538_10072019 | |||
| 416 | Ga0081538_10205368 | |||
| 417 | Ga0081539_10001434 | |||
| 418 | Ga0075363_100140468 | |||
| 419 | Ga0070715_10827167 | |||
| 420 | Ga0070716_100391351 | |||
| 421 | Ga0070716_100493775 | |||
| 422 | Ga0070712_100264310 | |||
| 423 | Ga0070712_100575001 | |||
| 424 | Ga0075427_10011074 | |||
| 425 | Ga0075428_100069019 | |||
| 426 | Ga0075428_100185671 | |||
| 427 | Ga0075428_100520454 | |||
| 428 | Ga0075428_101123280 | |||
| 429 | Ga0075430_100703184 | |||
| 430 | Ga0075430_101164969 | |||
| 431 | Ga0075431_100087723 | |||
| 432 | Ga0075431_100176530 | |||
| 433 | Ga0075431_100478664 | |||
| 434 | Ga0075433_11022608 | |||
| 435 | Ga0075433_11386696 | |||
| 436 | Ga0075434_101560265 | |||
| 437 | Ga0075429_100006581 | |||
| 438 | Ga0075429_100517232 | |||
| 439 | Ga0068865_100002543 | |||
| 440 | Ga0075436_100027971 | |||
| 441 | Ga0075436_100821675 | |||
| 442 | Ga0097620_100033055 | |||
| 443 | Ga0097620_102301899 | |||
| 444 | Ga0099794_10002175 | |||
| 445 | Ga0111539_10072363 | |||
| 446 | Ga0105245_10287191 | |||
| 447 | Ga0105245_12081485 | |||
| 448 | Ga0105247_10005791 | |||
| 449 | Ga0114129_10210171 | |||
| 450 | Ga0105243_10953895 | |||
| 451 | Ga0105241_10659779 | |||
| 452 | Ga0105237_11905780 | |||
| 453 | Ga0105238_10020431 | |||
| 454 | Ga0105238_10620944 | |||
| 455 | Ga0105249_10072581 | |||
| 456 | Ga0105239_10538198 | |||
| 457 | Ga0105246_10120988 | |||
| 458 | Ga0157373_10489375 | |||
| 459 | Ga0157370_10003504 | |||
| 460 | Ga0157369_11597140 | |||
| 461 | Ga0163162_10145781 | |||
| 462 | Ga0157372_10443487 | |||
| 463 | Ga0163163_10371424 | |||
| 464 | Ga0157380_10074106 | |||
| 465 | Ga0157380_11395026 | |||
| 466 | Ga0157379_10264734 | |||
| 467 | Ga0157379_10652904 | |||
| 468 | Ga0157376_12487181 | |||
| 469 | Ga0182007_10071562 | |||
| 470 | Ga0163161_10432775 | |||
| 471 | Ga0224712_10133245 | |||
| 472 | Ga0209147_100050 | |||
| 473 | Ga0209233_1017391 | |||
| 474 | Ga0209257_1000530 | |||
| 475 | Ga0207697_10357246 | |||
| 476 | Ga0207692_11220305 | |||
| 477 | Ga0207710_10016004 | |||
| 478 | Ga0207688_10152843 | |||
| 479 | Ga0207685_10632181 | |||
| 480 | Ga0207699_10376547 | |||
| 481 | Ga0207707_10037422 | |||
| 482 | Ga0207707_10109575 | |||
| 483 | Ga0207671_11170872 | |||
| 484 | Ga0207693_10105598 | |||
| 485 | Ga0207693_10243260 | |||
| 486 | Ga0207660_10223781 | |||
| 487 | Ga0207662_10291402 | |||
| 488 | Ga0207662_11163299 | |||
| 489 | Ga0207652_10937039 | |||
| 490 | Ga0207646_11355114 | |||
| 491 | Ga0207694_10418446 | |||
| 492 | Ga0207704_10029859 | |||
| 493 | Ga0207665_10617435 | |||
| 494 | Ga0207661_10504141 | |||
| 495 | Ga0207667_10224663 | |||
| 496 | Ga0207712_10459189 | |||
| 497 | Ga0207668_10250172 | |||
| 498 | Ga0207703_10207568 | |||
| 499 | Ga0207703_10292453 | |||
| 500 | Ga0207639_11024252 | |||
| 501 | Ga0207708_10025560 | |||
| 502 | Ga0207675_100138636 | |||
| 503 | Ga0207675_100510578 | |||
| 504 | Ga0207675_100839698 | |||
| 505 | Ga0207428_10059318 | |||
| 506 | Ga0268265_10056978 | |||
| 507 | Ga0268264_10097241 | |||
| 508 | Ga0268264_11367794 | |||
| 509 | Ga0307515_10285580 | |||
| 510 | Ga0265329_10083486 | |||
| 511 | Ga0265339_10104811 | |||
| 512 | Ga0265331_10000805 | |||
| 513 | Ga0307513_10379806 | |||
| 514 | Ga0307408_101428384 | |||
| 515 | Ga0307408_102213997 | |||
| 516 | Ga0265313_10000622 | |||
| 517 | Ga0316579_10009113 | |||
| 518 | Ga0265314_10115422 | |||
| 519 | Ga0265342_10020681 | |||
| 520 | Ga0307405_10474111 | |||
| 521 | Ga0316577_10091903 | |||
| 522 | Ga0307413_10523115 | |||
| 523 | Ga0307410_11050287 | |||
| 524 | Ga0307406_10025456 | |||
| 525 | Ga0307412_10184085 | |||
| 526 | Ga0307409_101688696 | |||
| 527 | Ga0307416_100364843 | |||
| 528 | Ga0307416_100699163 | |||
| 529 | Ga0307415_100613662 | |||
| 530 | Ga0307415_100870556 | |||
| 531 | Ga0316593_10196240 | |||
| 532 | Ga0373926_0223136 | |||
| 533 | Ga0373934_0398535 | |||
| 534 | Ga0373940_0294524 | |||
| 535 | Ga0373923_0061169 | |||
| 536 | Ga0373954_0188006 | |||
| 537 | Ga0373957_0427815 | |||
| 538 | Ga0373927_0349816 | |||
| 539 | Ga0373933_0776633 | |||
| 540 | Ga0373937_0011754 | |||
| 541 | Ga0316582_0692472 | |||
| 542 | Ga0373925_0067375 | |||
| 543 | Ga0395899_0000001 | |||
| 544 | Ga0395905_0251842 | |||
| 545 | Ga0395905_0254879 | |||
| 546 | Ga0395901_0289016 | |||
| 547 | Ga0395901_1657562 | |||
| 548 | Ga0436361_0270017 | |||
| 549 | Ga0436362_0517518 | |||
| 550 | Ga0439436_0035704 | |||
| 551 | Ga0451787_697986 | |||
| 552 | Ga0451789_0825853 | |||
| 553 | Ga0451790_01588 | |||
| 554 | Ga0451793_0843989 | |||
| 555 | Ga0451795_0143990 | |||
| 556 | Ga0451802_0364413 | |||
| 557 | Ga0451807_0252822 | |||
| 558 | Ga0451833_1388582 | |||
| 559 | Ga0451837_0268031 | |||
| 560 | Ga0451837_0693087 | |||
| 561 | Ga0451839_1303100 | |||
| 562 | Ga0451851_0256496 | |||
| 563 | Ga0451843_1142642 | |||
| 564 | Ga0451855_0137844 | |||
| 565 | Ga0451853_3720037 | |||
| 566 | Ga0439431_0039483 | |||
| 567 | Ga0439449_0038350 | |||
| 568 | Ga0439446_0050104 | |||
| 569 | Ga0439460_0185895 | |||
| 570 | Ga0451577_0044290 | |||
| 571 | Ga0451577_0810226 | |||
| 572 | Ga0451577_1375106 | |||
| 573 | Ga0466966_0003216 | |||
| 574 | Ga0466966_0012464 | |||
| 575 | Ga0466961_0106055 | |||
| 576 | Ga0453684_0098178 | |||
| 577 | Ga0453684_0100305 | |||
| 578 | Ga0453684_0176349 | |||
| 579 | Ga0453684_0183849 | |||
| 580 | Ga0453684_0358769 | |||
| 581 | Ga0453684_2212199 | |||
| 582 | Ga0453684_2247853 | |||
| 583 | Ga0453684_2559688 | |||
| 584 | Ga0466971_0039396 | |||
| 585 | Ga0466971_0468651 | |||
| 586 | Ga0466957_0176392 | |||
| 587 | Ga0466957_0270318 | |||
| 588 | Ga0466957_1068701 | |||
| 589 | Ga0466959_0003115 | |||
| 590 | Ga0466959_0049393 | |||
| 591 | Ga0466959_0274083 | |||
| 592 | Ga0466958_0002051 | |||
| 593 | Ga0466958_0318576 | |||
| 594 | Ga0466958_0365401 | |||
| 595 | Ga0466958_0369961 | |||
| 596 | Ga0466967_0689685 | |||
| 597 | Ga0495638_0037993 | |||
| 598 | Ga0495580_0413833 | |||
| 599 | Ga0495616_0105949 | |||
| 600 | Ga0495663_0001607 | |||
| 601 | Ga0495654_0131892 | |||
| 602 | Ga0495658_0142701 | |||
| 603 | Ga0495671_0009072 | |||
| 604 | Ga0495674_0610766 | |||
| 605 | Ga0495684_0904717 | |||
| 606 | Ga0496105_1213942 | |||
| 607 | Ga0496106_1204652 | |||
| 608 | Ga0496115_1061977 | |||
| 609 | Ga0496116_0003651 | |||
| 610 | Ga0496116_0013061 | |||
| 611 | Ga0496116_0040138 | |||
| 612 | Ga0496116_0064200 | |||
| 613 | Ga0496117_0010005 | |||
| 614 | Ga0496117_0023479 | |||
| 615 | Ga0496118_0010398 | |||
| 616 | Ga0496119_0000116 | |||
| 617 | Ga0496119_0004234 | |||
| 618 | Ga0496120_0000089 | |||
| 619 | Ga0496120_0016118 | |||
| 620 | Ga0496122_0005235 | |||
| 621 | Ga0496122_0038166 | |||
| 622 | Ga0496122_0191116 | |||
| 623 | Ga0496122_0294818 | |||
| 624 | Ga0496122_0444170 | |||
| 625 | Ga0496123_0008518 | |||
| 626 | Ga0496123_0072799 | |||
| 627 | Ga0496123_0141106 | |||
| 628 | Ga0496123_0230487 | |||
| 629 | Ga0496124_0000327 | |||
| 630 | Ga0496124_0159191 | |||
| 631 | Ga0496124_0257876 | |||
| 632 | Ga0496125_0003755 | |||
| 633 | Ga0496125_0096455 | |||
| 634 | Ga0496125_0118405 | |||
| 635 | Ga0496126_0000671 | |||
| 636 | Ga0496126_0003569 | |||
| 637 | Ga0496126_0004223 | |||
| 638 | Ga0496126_0124886 | |||
| 639 | Ga0501298_165264 | |||
| 640 | Ga0501039_0958086 | |||
| 641 | Ga0501040_0712694 | |||
| 642 | Ga0501040_1074663 | |||
| 643 | Ga0501041_0503726 | |||
| 644 | Ga0501041_0693326 | |||
| 645 | Ga0501046_0527012 | |||
| 646 | Ga0501048_0309775 | |||
| 647 | Ga0501068_0306898 | |||
| 648 | Ga0501069_0590634 | |||
| 649 | Ga0501069_0885752 | |||
| 650 | Ga0501070_0070210 | |||
| 651 | Ga0501071_0269791 | |||
| 652 | Ga0501072_0319790 | |||
| 653 | Ga0501072_0891205 | |||
| 654 | Ga0501075_0049805 | |||
| 655 | Ga0501076_0134876 | |||
| 656 | Ga0501076_0188386 | |||
| 657 | Ga0501076_0330699 | |||
| 658 | Ga0501076_0862915 | |||
| 659 | Ga0501247_063978 | |||
| 660 | Ga0501257_200177 | |||
| 661 | Ga0501079_0644302 | |||
| 662 | Ga0501079_0727680 | |||
| 663 | Ga0501081_0376894 | |||
| 664 | Ga0501081_0690690 | |||
| 665 | Ga0501081_1184208 | |||
| 666 | Ga0501283_134148 | |||
| 667 | nmdc:mga0k408_315897_c1 | |||
| 668 | nmdc:mga05p37_171870_c1 | |||
| 669 | nmdc:mga05p37_195879_c1 | |||
| 670 | nmdc:mga05p37_521505_c1 | |||
| 671 | nmdc:mga05p37_8021_c1 | |||
| 672 | nmdc:mga09592_220654_c1 | |||
| 673 | nmdc:mga09592_246062_c1 | |||
| 674 | nmdc:mga09592_4154_c1 | |||
| 675 | nmdc:mga09592_496660_c1 | |||
| 676 | nmdc:mga0qj67_711915_c1 | |||
| 677 | nmdc:mga06r32_161049_c1 | |||
| 678 | nmdc:mga06r32_64498_c1 | |||
| 679 | nmdc:mga08y16_234708_c1 | |||
| 680 | nmdc:mga0n895_474366_c1 | |||
| 681 | nmdc:mga08x19_565433_c1 | |||
| 682 | nmdc:mga0a205_1260037_c1 | |||
| 683 | Ga0500595_012201 | |||
| 684 | Ga0500633_0082162 | |||
| 685 | Ga0501084_0176677 | |||
| 686 | Ga0501084_0388729 | |||
| 687 | Ga0501084_0746047 | |||
| 688 | Ga0587073_0143573 | |||
| 689 | Ga0587085_072589 | |||
| 690 | Ga0587128_076414 | |||
| 691 | Ga0587067_145231 | |||
| 692 | Ga0501082_0437929 | |||
| 693 | Ga0530510_0277770 | |||
| 694 | 2511176111 | |||
| 695 | 2512640940 | |||
| 696 | 2723602965 | |||
| 697 | 2730138958 | |||
| 698 | 2745165682 | |||
| 699 | 2753811646 | |||
| 700 | 2802436481 | |||
| 701 | 2817617349 | |||
| 702 | 2857462736 | |||
| 703 | 2857466276 | |||
| 704 | 2857593647 | |||
| 705 | 2889278926 | |||
| 706 | 2898909387 | |||
| 707 | 2904599655 | |||
| 708 | 2907204527 | |||
| 709 | 2915600176 | |||
| 710 | 2915609759 | |||
| 711 | 2929185363 | |||
| 712 | 2938653540 | |||
| 713 | 2939704470 | |||
| 714 | 2968561047 | |||
| 715 | 2980185477 | |||
| 716 | 2988228725 | |||
| 717 | 2996636189 | |||
| 718 | 2996708689 | |||
| 719 | 3006984287 | |||
| 720 | 648169290 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8684 | 51 | 116 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8591 | 61 | 116 |
| 6z1p-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.8488 | 33 | 118 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8352 | 51 | 116 |
| 6yxy-assembly1.cif.gz_AU | state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate | 0.8134 | 38 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9665 | 53 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9055 | 58 | 120 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8851 | 53 | 116 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8591 | 61 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8543 | 58 | 120 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W4LHU2-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.009 | 64 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G9GV44-F1-model_v4 | deleted | 1.009 | 64 | 116 |
|
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.006 | 53 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y6I0T2-F1-model_v4 | deleted | 1.006 | 54 | 116 |
|
| AF-J9FK27-F1-model_v4 | Ribosomal protein L20 | 1.006 | 60 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |