F422019

General Info

Members Datasets Scaffolds Average Seq Length
360 261 720 117

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_1421884|Ga0501035_1421884_10_417
Length 135
Sequence MARVKGGTMTKKRHKKILKMSKGYVGRSNNCFIPANQKIEKGLKYAYRDRKNKKRTFRNLWIARINAAARINGMVYSDLVHGLKLAGSTLDRKILAQIAFESPESFAAIAETAKSALKNNKVNSKGQKSPQEKAA

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
236 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
237 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
238 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
239 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
240 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
241 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
242 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
243 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
244 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
245 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
246 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
247 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
248 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
249 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
250 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
251 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
252 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
253 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
254 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
255 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
256 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
257 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
258 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
259 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
260 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
261 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 2.5
Isolates 7.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0.28
Rhizoplane 2.78
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 14.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_1421884 3300049822 Unclassified 531
2 JGI25406J46586_10036882 3300003203 Bacteria 1769
3 rootH1_10276498 3300003323 Bacteria 2954
4 Ga0055532_1000637 3300003758 Bacteria 13597
5 Ga0058859_11595649 3300004798 Bacteria 1465
6 Ga0058860_12211021 3300004801 Bacteria 4320
7 Ga0065707_10207175 3300005295 Bacteria 1282
8 Ga0070683_100466715 3300005329 Bacteria 1205
9 Ga0070670_101451886 3300005331 Unclassified 629
10 Ga0068869_100392898 3300005334 Bacteria 1139
11 Ga0070680_100002988 3300005336 Bacteria 12555
12 Ga0070691_10759375 3300005341 Unclassified 587
13 Ga0070687_100117021 3300005343 Bacteria 1518
14 Ga0070687_100222995 3300005343 Bacteria 1156
15 Ga0070692_10173877 3300005345 Bacteria 1243
16 Ga0070668_100160126 3300005347 Bacteria 1826
17 Ga0070669_101275568 3300005353 Unclassified 636
18 Ga0070688_100012701 3300005365 Bacteria 4725
19 Ga0070709_10086853 3300005434 Bacteria 2054
20 Ga0070713_100629390 3300005436 Bacteria 1021
21 Ga0070701_10039398 3300005438 Bacteria 2397
22 Ga0070705_100154521 3300005440 Bacteria 1526
23 Ga0070700_100019729 3300005441 Bacteria 3895
24 Ga0070708_100028644 3300005445 Bacteria 4795
25 Ga0070708_100064231 3300005445 Bacteria 3288
26 Ga0070681_10000987 3300005458 Bacteria 24071
27 Ga0070681_10101556 3300005458 Bacteria 2822
28 Ga0070685_10035040 3300005466 Bacteria 2830
29 Ga0070706_100002677 3300005467 Bacteria 17846
30 Ga0070706_100145885 3300005467 Bacteria 2210
31 Ga0070706_102165762 3300005467 Unclassified 502
32 Ga0070707_100171813 3300005468 Bacteria 2112
33 Ga0070699_100000817 3300005518 Bacteria 28818
34 Ga0070699_100174844 3300005518 Bacteria 1904
35 Ga0070679_100012403 3300005530 Bacteria 8143
36 Ga0070679_100605862 3300005530 Bacteria 1038
37 Ga0070697_100603063 3300005536 Bacteria 965
38 Ga0068853_100545638 3300005539 Bacteria 1098
39 Ga0070686_100019062 3300005544 Bacteria 4037
40 Ga0070695_101015624 3300005545 Bacteria 675
41 Ga0070693_100822687 3300005547 Bacteria 690
42 Ga0070665_100665190 3300005548 Bacteria 1054
43 Ga0068854_100371654 3300005578 Bacteria 1176
44 Ga0070702_100345629 3300005615 Bacteria 1046
45 Ga0068859_100033055 3300005617 Bacteria 5196
46 Ga0068859_102302629 3300005617 Bacteria 594
47 Ga0068864_100246432 3300005618 Bacteria 1657
48 Ga0068858_100240643 3300005842 Bacteria 1717
49 Ga0068858_100580545 3300005842 Bacteria 1086
50 Ga0068860_100132934 3300005843 Bacteria 2389
51 Ga0068860_101811122 3300005843 Bacteria 632
52 Ga0068862_100040000 3300005844 Bacteria 3984
53 Ga0081538_10003100 3300005981 Bacteria 15806
54 Ga0081538_10069662 3300005981 Bacteria 1947
55 Ga0081538_10072019 3300005981 Bacteria 1897
56 Ga0081538_10205368 3300005981 Bacteria 803
57 Ga0081539_10001434 3300005985 Bacteria 40840
58 Ga0075363_100140468 3300006048 Bacteria 1359
59 Ga0070715_10827167 3300006163 Bacteria 564
60 Ga0070716_100391351 3300006173 Bacteria 997
61 Ga0070716_100493775 3300006173 Bacteria 901
62 Ga0070712_100264310 3300006175 Bacteria 1380
63 Ga0070712_100575001 3300006175 Bacteria 951
64 Ga0075427_10011074 3300006194 Unclassified 1357
65 Ga0075428_100069019 3300006844 Bacteria 3866
66 Ga0075428_100185671 3300006844 Bacteria 2250
67 Ga0075428_100520454 3300006844 Unclassified 1272
68 Ga0075428_101123280 3300006844 Bacteria 830
69 Ga0075430_100703184 3300006846 Bacteria 833
70 Ga0075430_101164969 3300006846 Unclassified 635
71 Ga0075431_100087723 3300006847 Bacteria 3210
72 Ga0075431_100176530 3300006847 Bacteria 2194
73 Ga0075431_100478664 3300006847 Bacteria 1238
74 Ga0075433_11022608 3300006852 Unclassified 719
75 Ga0075433_11386696 3300006852 Unclassified 608
76 Ga0075434_101560265 3300006871 Unclassified 669
77 Ga0075429_100006581 3300006880 Bacteria 10062
78 Ga0075429_100517232 3300006880 Bacteria 1046
79 Ga0068865_100002543 3300006881 Bacteria 10814
80 Ga0075436_100027971 3300006914 Bacteria 3881
81 Ga0075436_100821675 3300006914 Bacteria 693
82 Ga0097620_100033055 3300006931 Bacteria 5196
83 Ga0097620_102301899 3300006931 Bacteria 594
84 Ga0099794_10002175 3300007265 Bacteria 7145
85 Ga0111539_10072363 3300009094 Bacteria 4065
86 Ga0105245_10287191 3300009098 Bacteria 1610
87 Ga0105245_12081485 3300009098 Unclassified 621
88 Ga0105247_10005791 3300009101 Bacteria 7739
89 Ga0114129_10210171 3300009147 Unclassified 2631
90 Ga0105243_10953895 3300009148 Unclassified 857
91 Ga0105241_10659779 3300009174 Bacteria 951
92 Ga0105237_11905780 3300009545 Bacteria 602
93 Ga0105238_10020431 3300009551 Bacteria 6741
94 Ga0105238_10620944 3300009551 Bacteria 1090
95 Ga0105249_10072581 3300009553 Bacteria 3182
96 Ga0105239_10538198 3300010375 Bacteria 1330
97 Ga0105246_10120988 3300011119 Bacteria 1940
98 Ga0157373_10489375 3300013100 Bacteria 888
99 Ga0157370_10003504 3300013104 Bacteria 18396
100 Ga0157369_11597140 3300013105 Bacteria 663
101 Ga0163162_10145781 3300013306 Bacteria 2484
102 Ga0157372_10443487 3300013307 Bacteria 1513
103 Ga0163163_10371424 3300014325 Bacteria 1487
104 Ga0157380_10074106 3300014326 Bacteria 2762
105 Ga0157380_11395026 3300014326 Unclassified 751
106 Ga0157379_10264734 3300014968 Bacteria 1563
107 Ga0157379_10652904 3300014968 Unclassified 985
108 Ga0157376_12487181 3300014969 Bacteria 557
109 Ga0182007_10071562 3300015262 Bacteria 1136
110 Ga0163161_10432775 3300017792 Unclassified 1060
111 Ga0224712_10133245 3300022467 Bacteria 1087
112 Ga0209147_100050 3300025229 Bacteria 274639
113 Ga0209233_1017391 3300025261 Bacteria 1960
114 Ga0209257_1000530 3300025304 Bacteria 66163
115 Ga0207697_10357246 3300025315 Unclassified 649
116 Ga0207692_11220305 3300025898 Bacteria 500
117 Ga0207710_10016004 3300025900 Bacteria 3173
118 Ga0207688_10152843 3300025901 Bacteria 1364
119 Ga0207685_10632181 3300025905 Bacteria 577
120 Ga0207699_10376547 3300025906 Bacteria 1007
121 Ga0207707_10037422 3300025912 Bacteria 4241
122 Ga0207707_10109575 3300025912 Bacteria 2414
123 Ga0207671_11170872 3300025914 Bacteria 602
124 Ga0207693_10105598 3300025915 Bacteria 2209
125 Ga0207693_10243260 3300025915 Bacteria 1412
126 Ga0207660_10223781 3300025917 Bacteria 1477
127 Ga0207662_10291402 3300025918 Bacteria 1083
128 Ga0207662_11163299 3300025918 Unclassified 548
129 Ga0207652_10937039 3300025921 Bacteria 764
130 Ga0207646_11355114 3300025922 Bacteria 620
131 Ga0207694_10418446 3300025924 Bacteria 1116
132 Ga0207704_10029859 3300025938 Bacteria 3048
133 Ga0207665_10617435 3300025939 Bacteria 848
134 Ga0207661_10504141 3300025944 Bacteria 1106
135 Ga0207667_10224663 3300025949 Bacteria 1924
136 Ga0207712_10459189 3300025961 Bacteria 1082
137 Ga0207668_10250172 3300025972 Bacteria 1439
138 Ga0207703_10207568 3300026035 Bacteria 1744
139 Ga0207703_10292453 3300026035 Bacteria 1483
140 Ga0207639_11024252 3300026041 Bacteria 773
141 Ga0207708_10025560 3300026075 Bacteria 4469
142 Ga0207675_100138636 3300026118 Bacteria 2310
143 Ga0207675_100510578 3300026118 Bacteria 1197
144 Ga0207675_100839698 3300026118 Bacteria 933
145 Ga0207428_10059318 3300027907 Bacteria 3034
146 Ga0268265_10056978 3300028380 Bacteria 2976
147 Ga0268264_10097241 3300028381 Bacteria 2552
148 Ga0268264_11367794 3300028381 Bacteria 718
149 Ga0307515_10285580 3300028794 Bacteria 1352
150 Ga0265329_10083486 3300031242 Bacteria 1012
151 Ga0265339_10104811 3300031249 Bacteria 1468
152 Ga0265331_10000805 3300031250 Bacteria 25935
153 Ga0307513_10379806 3300031456 Bacteria 1152
154 Ga0307408_101428384 3300031548 Unclassified 652
155 Ga0307408_102213997 3300031548 Unclassified 531
156 Ga0265313_10000622 3300031595 Bacteria 36655
157 Ga0316579_10009113 3300031691 Bacteria 4166
158 Ga0265314_10115422 3300031711 Bacteria 1699
159 Ga0265342_10020681 3300031712 Bacteria 4215
160 Ga0307405_10474111 3300031731 Unclassified 998
161 Ga0316577_10091903 3300031733 Unclassified 1699
162 Ga0307413_10523115 3300031824 Bacteria 957
163 Ga0307410_11050287 3300031852 Bacteria 704
164 Ga0307406_10025456 3300031901 Bacteria 3544
165 Ga0307412_10184085 3300031911 Bacteria 1574
166 Ga0307409_101688696 3300031995 Unclassified 662
167 Ga0307416_100364843 3300032002 Bacteria 1468
168 Ga0307416_100699163 3300032002 Bacteria 1103
169 Ga0307415_100613662 3300032126 Bacteria 970
170 Ga0307415_100870556 3300032126 Bacteria 828
171 Ga0316593_10196240 3300032168 Unclassified 745
172 Ga0373926_0223136 3300035083 Bacteria 728
173 Ga0373934_0398535 3300035086 Bacteria 575
174 Ga0373940_0294524 3300035088 Bacteria 557
175 Ga0373923_0061169 3300035111 Bacteria 1600
176 Ga0373954_0188006 3300035118 Bacteria 1014
177 Ga0373957_0427815 3300035120 Bacteria 572
178 Ga0373927_0349816 3300035695 Bacteria 974
179 Ga0373933_0776633 3300035724 Bacteria 630
180 Ga0373937_0011754 3300036401 Bacteria 7679
181 Ga0316582_0692472 3300036647 Bacteria 700
182 Ga0373925_0067375 3300037068 Bacteria 2700
183 Ga0395899_0000001 3300037312 Bacteria 1750322
184 Ga0395905_0251842 3300037471 Bacteria 1650
185 Ga0395905_0254879 3300037471 Bacteria 1639
186 Ga0395901_0289016 3300038443 Bacteria 1702
187 Ga0395901_1657562 3300038443 Bacteria 592
188 Ga0436361_0270017 3300039447 Bacteria 2349
189 Ga0436362_0517518 3300039453 Bacteria 643
190 Ga0439436_0035704 3300041404 Bacteria 1436
191 Ga0451787_697986 3300041441 Bacteria 739
192 Ga0451789_0825853 3300041443 Bacteria 990
193 Ga0451790_01588 3300041444 Bacteria 878
194 Ga0451793_0843989 3300041452 Bacteria 2406
195 Ga0451795_0143990 3300041456 Bacteria 955
196 Ga0451802_0364413 3300041460 Bacteria 1203
197 Ga0451807_0252822 3300041486 Bacteria 743
198 Ga0451833_1388582 3300041491 Bacteria 819
199 Ga0451837_0268031 3300041494 Bacteria 1909
200 Ga0451837_0693087 3300041494 Bacteria 1750
201 Ga0451839_1303100 3300041496 Bacteria 917
202 Ga0451851_0256496 3300041507 Bacteria 829
203 Ga0451843_1142642 3300041509 Bacteria 618
204 Ga0451855_0137844 3300041511 Bacteria 692
205 Ga0451853_3720037 3300041512 Bacteria 961
206 Ga0439431_0039483 3300041997 Bacteria 1197
207 Ga0439449_0038350 3300042007 Bacteria 1781
208 Ga0439446_0050104 3300042156 Bacteria 1246
209 Ga0439460_0185895 3300042461 Bacteria 704
210 Ga0451577_0044290 3300042876 Unclassified 3984
211 Ga0451577_0810226 3300042876 Bacteria 846
212 Ga0451577_1375106 3300042876 Bacteria 627
213 Ga0466966_0003216 3300044684 Bacteria 10767
214 Ga0466966_0012464 3300044684 Bacteria 5632
215 Ga0466961_0106055 3300044693 Bacteria 1769
216 Ga0453684_0098178 3300044712 Bacteria 3592
217 Ga0453684_0100305 3300044712 Bacteria 3544
218 Ga0453684_0176349 3300044712 Bacteria 2513
219 Ga0453684_0183849 3300044712 Unclassified 2451
220 Ga0453684_0358769 3300044712 Bacteria 1642
221 Ga0453684_2212199 3300044712 Unclassified 549
222 Ga0453684_2247853 3300044712 Bacteria 543
223 Ga0453684_2559688 3300044712 Bacteria 502
224 Ga0466971_0039396 3300044719 Bacteria 2121
225 Ga0466971_0468651 3300044719 Unclassified 619
226 Ga0466957_0176392 3300044842 Bacteria 1394
227 Ga0466957_0270318 3300044842 Unclassified 1135
228 Ga0466957_1068701 3300044842 Bacteria 581
229 Ga0466959_0003115 3300045049 Bacteria 10756
230 Ga0466959_0049393 3300045049 Bacteria 3091
231 Ga0466959_0274083 3300045049 Bacteria 1159
232 Ga0466958_0002051 3300045836 Bacteria 9953
233 Ga0466958_0318576 3300045836 Unclassified 999
234 Ga0466958_0365401 3300045836 Bacteria 930
235 Ga0466958_0369961 3300045836 Bacteria 924
236 Ga0466967_0689685 3300045976 Bacteria 1011
237 Ga0495638_0037993 3300046460 Bacteria 3062
238 Ga0495580_0413833 3300046472 Bacteria 908
239 Ga0495616_0105949 3300046513 Bacteria 1312
240 Ga0495663_0001607 3300046525 Bacteria 7069
241 Ga0495654_0131892 3300046530 Bacteria 1121
242 Ga0495658_0142701 3300046683 Bacteria 1466
243 Ga0495671_0009072 3300046692 Bacteria 5577
244 Ga0495674_0610766 3300047319 Bacteria 863
245 Ga0495684_0904717 3300047471 Bacteria 568
246 Ga0496105_1213942 3300048908 Bacteria 555
247 Ga0496106_1204652 3300048909 Unclassified 590
248 Ga0496115_1061977 3300048918 Bacteria 616
249 Ga0496116_0003651 3300048919 Bacteria 15114
250 Ga0496116_0013061 3300048919 Bacteria 6731
251 Ga0496116_0040138 3300048919 Bacteria 3226
252 Ga0496116_0064200 3300048919 Bacteria 2361
253 Ga0496117_0010005 3300048920 Bacteria 8717
254 Ga0496117_0023479 3300048920 Bacteria 4912
255 Ga0496118_0010398 3300048921 Bacteria 9223
256 Ga0496119_0000116 3300048922 Bacteria 111744
257 Ga0496119_0004234 3300048922 Bacteria 14389
258 Ga0496120_0000089 3300048923 Bacteria 151805
259 Ga0496120_0016118 3300048923 Bacteria 4895
260 Ga0496122_0005235 3300048925 Bacteria 15565
261 Ga0496122_0038166 3300048925 Bacteria 3853
262 Ga0496122_0191116 3300048925 Bacteria 1208
263 Ga0496122_0294818 3300048925 Bacteria 878
264 Ga0496122_0444170 3300048925 Bacteria 645
265 Ga0496123_0008518 3300048926 Bacteria 9404
266 Ga0496123_0072799 3300048926 Bacteria 2136
267 Ga0496123_0141106 3300048926 Bacteria 1317
268 Ga0496123_0230487 3300048926 Bacteria 927
269 Ga0496124_0000327 3300048927 Bacteria 87886
270 Ga0496124_0159191 3300048927 Bacteria 1762
271 Ga0496124_0257876 3300048927 Bacteria 1285
272 Ga0496125_0003755 3300048928 Bacteria 18079
273 Ga0496125_0096455 3300048928 Bacteria 2195
274 Ga0496125_0118405 3300048928 Bacteria 1897
275 Ga0496126_0000671 3300048929 Bacteria 63347
276 Ga0496126_0003569 3300048929 Bacteria 19512
277 Ga0496126_0004223 3300048929 Bacteria 17311
278 Ga0496126_0124886 3300048929 Bacteria 2229
279 Ga0501298_165264 3300049521 Unclassified 548
280 Ga0501039_0958086 3300049575 Unclassified 665
281 Ga0501040_0712694 3300049576 Bacteria 726
282 Ga0501040_1074663 3300049576 Unclassified 584
283 Ga0501041_0503726 3300049577 Bacteria 770
284 Ga0501041_0693326 3300049577 Bacteria 652
285 Ga0501046_0527012 3300049580 Unclassified 844
286 Ga0501048_0309775 3300049582 Bacteria 1124
287 Ga0501068_0306898 3300049584 Bacteria 1016
288 Ga0501069_0590634 3300049585 Unclassified 666
289 Ga0501069_0885752 3300049585 Bacteria 543
290 Ga0501070_0070210 3300049586 Bacteria 2900
291 Ga0501071_0269791 3300049587 Bacteria 1286
292 Ga0501072_0319790 3300049588 Bacteria 1233
293 Ga0501072_0891205 3300049588 Bacteria 695
294 Ga0501075_0049805 3300049591 Unclassified 3149
295 Ga0501076_0134876 3300049592 Unclassified 2004
296 Ga0501076_0188386 3300049592 Bacteria 1683
297 Ga0501076_0330699 3300049592 Unclassified 1250
298 Ga0501076_0862915 3300049592 Bacteria 746
299 Ga0501247_063978 3300049677 Unclassified 570
300 Ga0501257_200177 3300049686 Unclassified 574
301 Ga0501079_0644302 3300049741 Unclassified 834
302 Ga0501079_0727680 3300049741 Bacteria 781
303 Ga0501081_0376894 3300049743 Bacteria 1048
304 Ga0501081_0690690 3300049743 Unclassified 766
305 Ga0501081_1184208 3300049743 Bacteria 579
306 Ga0501283_134148 3300049779 Unclassified 505
307 nmdc:mga0k408_315897_c1 3300050493 Bacteria 932
308 nmdc:mga05p37_171870_c1 3300050507 Unclassified 2643
309 nmdc:mga05p37_195879_c1 3300050507 Bacteria 2450
310 nmdc:mga05p37_521505_c1 3300050507 Bacteria 1359
311 nmdc:mga05p37_8021_c1 3300050507 Bacteria 12467
312 nmdc:mga09592_220654_c1 3300050508 Bacteria 1643
313 nmdc:mga09592_246062_c1 3300050508 Bacteria 1550
314 nmdc:mga09592_4154_c1 3300050508 Bacteria 11700
315 nmdc:mga09592_496660_c1 3300050508 Bacteria 1051
316 nmdc:mga0qj67_711915_c1 3300050509 Bacteria 798
317 nmdc:mga06r32_161049_c1 3300050510 Bacteria 2226
318 nmdc:mga06r32_64498_c1 3300050510 Bacteria 3532
319 nmdc:mga08y16_234708_c1 3300050511 Bacteria 1897
320 nmdc:mga0n895_474366_c1 3300050512 Unclassified 1262
321 nmdc:mga08x19_565433_c1 3300050514 Bacteria 805
322 nmdc:mga0a205_1260037_c1 3300050515 Unclassified 587
323 Ga0500595_012201 3300053119 Bacteria 3330
324 Ga0500633_0082162 3300053160 Unclassified 1167
325 Ga0501084_0176677 3300054114 Bacteria 1802
326 Ga0501084_0388729 3300054114 Unclassified 1179
327 Ga0501084_0746047 3300054114 Unclassified 825
328 Ga0587073_0143573 3300059492 Bacteria 668
329 Ga0587085_072589 3300059506 Bacteria 676
330 Ga0587128_076414 3300059630 Bacteria 662
331 Ga0587067_145231 3300059640 Bacteria 591
332 Ga0501082_0437929 3300060353 Unclassified 1142
333 Ga0530510_0277770 3300061734 Bacteria 1251
334 2511176111 2510917027 Bacteria 5287437
335 2512640940 2512564013 Bacteria 6286191
336 2723602965 2721755693 Bacteria 6126117
337 2730138958 2728369359 Bacteria 5621728
338 2745165682 2744054657 Bacteria 5016802
339 2753811646 2751185905 Bacteria 6142767
340 2802436481 2802428803 Bacteria 5806948
341 2817617349 2816332336 Bacteria 5207640
342 2857462736 2857460504 Bacteria 5194327
343 2857466276 2857465823 Bacteria 6772595
344 2857593647 2857591370 Bacteria 6569758
345 2889278926 2889276214 Bacteria 5979355
346 2898909387 2898907183 Bacteria 4067722
347 2904599655 2904595352 Bacteria 6124848
348 2907204527 2907202186 Bacteria 6632024
349 2915600176 2915597211 Bacteria 6475886
350 2915609759 2915606848 Bacteria 6032732
351 2929185363 2929183550 Bacteria 6377511
352 2938653540 2938649242 Bacteria 7118381
353 2939704470 2939702853 Bacteria 5139229
354 2968561047 2968558590 Bacteria 6956864
355 2980185477 2980182181 Bacteria 9454109
356 2988228725 2988225383 Bacteria 7221625
357 2996636189 2996632988 Bacteria 6921523
358 2996708689 2996706504 Bacteria 5757485
359 3006984287 3006984091 Bacteria 4207523
360 648169290 648028048 Bacteria 5394884
361 Ga0501035_1421884
362 JGI25406J46586_10036882
363 rootH1_10276498
364 Ga0055532_1000637
365 Ga0058859_11595649
366 Ga0058860_12211021
367 Ga0065707_10207175
368 Ga0070683_100466715
369 Ga0070670_101451886
370 Ga0068869_100392898
371 Ga0070680_100002988
372 Ga0070691_10759375
373 Ga0070687_100117021
374 Ga0070687_100222995
375 Ga0070692_10173877
376 Ga0070668_100160126
377 Ga0070669_101275568
378 Ga0070688_100012701
379 Ga0070709_10086853
380 Ga0070713_100629390
381 Ga0070701_10039398
382 Ga0070705_100154521
383 Ga0070700_100019729
384 Ga0070708_100028644
385 Ga0070708_100064231
386 Ga0070681_10000987
387 Ga0070681_10101556
388 Ga0070685_10035040
389 Ga0070706_100002677
390 Ga0070706_100145885
391 Ga0070706_102165762
392 Ga0070707_100171813
393 Ga0070699_100000817
394 Ga0070699_100174844
395 Ga0070679_100012403
396 Ga0070679_100605862
397 Ga0070697_100603063
398 Ga0068853_100545638
399 Ga0070686_100019062
400 Ga0070695_101015624
401 Ga0070693_100822687
402 Ga0070665_100665190
403 Ga0068854_100371654
404 Ga0070702_100345629
405 Ga0068859_100033055
406 Ga0068859_102302629
407 Ga0068864_100246432
408 Ga0068858_100240643
409 Ga0068858_100580545
410 Ga0068860_100132934
411 Ga0068860_101811122
412 Ga0068862_100040000
413 Ga0081538_10003100
414 Ga0081538_10069662
415 Ga0081538_10072019
416 Ga0081538_10205368
417 Ga0081539_10001434
418 Ga0075363_100140468
419 Ga0070715_10827167
420 Ga0070716_100391351
421 Ga0070716_100493775
422 Ga0070712_100264310
423 Ga0070712_100575001
424 Ga0075427_10011074
425 Ga0075428_100069019
426 Ga0075428_100185671
427 Ga0075428_100520454
428 Ga0075428_101123280
429 Ga0075430_100703184
430 Ga0075430_101164969
431 Ga0075431_100087723
432 Ga0075431_100176530
433 Ga0075431_100478664
434 Ga0075433_11022608
435 Ga0075433_11386696
436 Ga0075434_101560265
437 Ga0075429_100006581
438 Ga0075429_100517232
439 Ga0068865_100002543
440 Ga0075436_100027971
441 Ga0075436_100821675
442 Ga0097620_100033055
443 Ga0097620_102301899
444 Ga0099794_10002175
445 Ga0111539_10072363
446 Ga0105245_10287191
447 Ga0105245_12081485
448 Ga0105247_10005791
449 Ga0114129_10210171
450 Ga0105243_10953895
451 Ga0105241_10659779
452 Ga0105237_11905780
453 Ga0105238_10020431
454 Ga0105238_10620944
455 Ga0105249_10072581
456 Ga0105239_10538198
457 Ga0105246_10120988
458 Ga0157373_10489375
459 Ga0157370_10003504
460 Ga0157369_11597140
461 Ga0163162_10145781
462 Ga0157372_10443487
463 Ga0163163_10371424
464 Ga0157380_10074106
465 Ga0157380_11395026
466 Ga0157379_10264734
467 Ga0157379_10652904
468 Ga0157376_12487181
469 Ga0182007_10071562
470 Ga0163161_10432775
471 Ga0224712_10133245
472 Ga0209147_100050
473 Ga0209233_1017391
474 Ga0209257_1000530
475 Ga0207697_10357246
476 Ga0207692_11220305
477 Ga0207710_10016004
478 Ga0207688_10152843
479 Ga0207685_10632181
480 Ga0207699_10376547
481 Ga0207707_10037422
482 Ga0207707_10109575
483 Ga0207671_11170872
484 Ga0207693_10105598
485 Ga0207693_10243260
486 Ga0207660_10223781
487 Ga0207662_10291402
488 Ga0207662_11163299
489 Ga0207652_10937039
490 Ga0207646_11355114
491 Ga0207694_10418446
492 Ga0207704_10029859
493 Ga0207665_10617435
494 Ga0207661_10504141
495 Ga0207667_10224663
496 Ga0207712_10459189
497 Ga0207668_10250172
498 Ga0207703_10207568
499 Ga0207703_10292453
500 Ga0207639_11024252
501 Ga0207708_10025560
502 Ga0207675_100138636
503 Ga0207675_100510578
504 Ga0207675_100839698
505 Ga0207428_10059318
506 Ga0268265_10056978
507 Ga0268264_10097241
508 Ga0268264_11367794
509 Ga0307515_10285580
510 Ga0265329_10083486
511 Ga0265339_10104811
512 Ga0265331_10000805
513 Ga0307513_10379806
514 Ga0307408_101428384
515 Ga0307408_102213997
516 Ga0265313_10000622
517 Ga0316579_10009113
518 Ga0265314_10115422
519 Ga0265342_10020681
520 Ga0307405_10474111
521 Ga0316577_10091903
522 Ga0307413_10523115
523 Ga0307410_11050287
524 Ga0307406_10025456
525 Ga0307412_10184085
526 Ga0307409_101688696
527 Ga0307416_100364843
528 Ga0307416_100699163
529 Ga0307415_100613662
530 Ga0307415_100870556
531 Ga0316593_10196240
532 Ga0373926_0223136
533 Ga0373934_0398535
534 Ga0373940_0294524
535 Ga0373923_0061169
536 Ga0373954_0188006
537 Ga0373957_0427815
538 Ga0373927_0349816
539 Ga0373933_0776633
540 Ga0373937_0011754
541 Ga0316582_0692472
542 Ga0373925_0067375
543 Ga0395899_0000001
544 Ga0395905_0251842
545 Ga0395905_0254879
546 Ga0395901_0289016
547 Ga0395901_1657562
548 Ga0436361_0270017
549 Ga0436362_0517518
550 Ga0439436_0035704
551 Ga0451787_697986
552 Ga0451789_0825853
553 Ga0451790_01588
554 Ga0451793_0843989
555 Ga0451795_0143990
556 Ga0451802_0364413
557 Ga0451807_0252822
558 Ga0451833_1388582
559 Ga0451837_0268031
560 Ga0451837_0693087
561 Ga0451839_1303100
562 Ga0451851_0256496
563 Ga0451843_1142642
564 Ga0451855_0137844
565 Ga0451853_3720037
566 Ga0439431_0039483
567 Ga0439449_0038350
568 Ga0439446_0050104
569 Ga0439460_0185895
570 Ga0451577_0044290
571 Ga0451577_0810226
572 Ga0451577_1375106
573 Ga0466966_0003216
574 Ga0466966_0012464
575 Ga0466961_0106055
576 Ga0453684_0098178
577 Ga0453684_0100305
578 Ga0453684_0176349
579 Ga0453684_0183849
580 Ga0453684_0358769
581 Ga0453684_2212199
582 Ga0453684_2247853
583 Ga0453684_2559688
584 Ga0466971_0039396
585 Ga0466971_0468651
586 Ga0466957_0176392
587 Ga0466957_0270318
588 Ga0466957_1068701
589 Ga0466959_0003115
590 Ga0466959_0049393
591 Ga0466959_0274083
592 Ga0466958_0002051
593 Ga0466958_0318576
594 Ga0466958_0365401
595 Ga0466958_0369961
596 Ga0466967_0689685
597 Ga0495638_0037993
598 Ga0495580_0413833
599 Ga0495616_0105949
600 Ga0495663_0001607
601 Ga0495654_0131892
602 Ga0495658_0142701
603 Ga0495671_0009072
604 Ga0495674_0610766
605 Ga0495684_0904717
606 Ga0496105_1213942
607 Ga0496106_1204652
608 Ga0496115_1061977
609 Ga0496116_0003651
610 Ga0496116_0013061
611 Ga0496116_0040138
612 Ga0496116_0064200
613 Ga0496117_0010005
614 Ga0496117_0023479
615 Ga0496118_0010398
616 Ga0496119_0000116
617 Ga0496119_0004234
618 Ga0496120_0000089
619 Ga0496120_0016118
620 Ga0496122_0005235
621 Ga0496122_0038166
622 Ga0496122_0191116
623 Ga0496122_0294818
624 Ga0496122_0444170
625 Ga0496123_0008518
626 Ga0496123_0072799
627 Ga0496123_0141106
628 Ga0496123_0230487
629 Ga0496124_0000327
630 Ga0496124_0159191
631 Ga0496124_0257876
632 Ga0496125_0003755
633 Ga0496125_0096455
634 Ga0496125_0118405
635 Ga0496126_0000671
636 Ga0496126_0003569
637 Ga0496126_0004223
638 Ga0496126_0124886
639 Ga0501298_165264
640 Ga0501039_0958086
641 Ga0501040_0712694
642 Ga0501040_1074663
643 Ga0501041_0503726
644 Ga0501041_0693326
645 Ga0501046_0527012
646 Ga0501048_0309775
647 Ga0501068_0306898
648 Ga0501069_0590634
649 Ga0501069_0885752
650 Ga0501070_0070210
651 Ga0501071_0269791
652 Ga0501072_0319790
653 Ga0501072_0891205
654 Ga0501075_0049805
655 Ga0501076_0134876
656 Ga0501076_0188386
657 Ga0501076_0330699
658 Ga0501076_0862915
659 Ga0501247_063978
660 Ga0501257_200177
661 Ga0501079_0644302
662 Ga0501079_0727680
663 Ga0501081_0376894
664 Ga0501081_0690690
665 Ga0501081_1184208
666 Ga0501283_134148
667 nmdc:mga0k408_315897_c1
668 nmdc:mga05p37_171870_c1
669 nmdc:mga05p37_195879_c1
670 nmdc:mga05p37_521505_c1
671 nmdc:mga05p37_8021_c1
672 nmdc:mga09592_220654_c1
673 nmdc:mga09592_246062_c1
674 nmdc:mga09592_4154_c1
675 nmdc:mga09592_496660_c1
676 nmdc:mga0qj67_711915_c1
677 nmdc:mga06r32_161049_c1
678 nmdc:mga06r32_64498_c1
679 nmdc:mga08y16_234708_c1
680 nmdc:mga0n895_474366_c1
681 nmdc:mga08x19_565433_c1
682 nmdc:mga0a205_1260037_c1
683 Ga0500595_012201
684 Ga0500633_0082162
685 Ga0501084_0176677
686 Ga0501084_0388729
687 Ga0501084_0746047
688 Ga0587073_0143573
689 Ga0587085_072589
690 Ga0587128_076414
691 Ga0587067_145231
692 Ga0501082_0437929
693 Ga0530510_0277770
694 2511176111
695 2512640940
696 2723602965
697 2730138958
698 2745165682
699 2753811646
700 2802436481
701 2817617349
702 2857462736
703 2857466276
704 2857593647
705 2889278926
706 2898909387
707 2904599655
708 2907204527
709 2915600176
710 2915609759
711 2929185363
712 2938653540
713 2939704470
714 2968561047
715 2980185477
716 2988228725
717 2996636189
718 2996708689
719 3006984287
720 648169290

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8684 51 116
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8591 61 116
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.8488 33 118
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8352 51 116
6yxy-assembly1.cif.gz_AU state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.8134 38 113
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9665 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9055 58 120 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8851 53 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8591 61 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8543 58 120 1.10.1900.20
ID Description Score Start End GO Terms
AF-W4LHU2-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.009 64 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G9GV44-F1-model_v4 deleted 1.009 64 116
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 53 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y6I0T2-F1-model_v4 deleted 1.006 54 116
AF-J9FK27-F1-model_v4 Ribosomal protein L20 1.006 60 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map