F395457

General Info

Members Datasets Scaffolds Average Seq Length
300 198 600 102

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0153618|Ga0373956_0153618_448_798
Length 116
Sequence VFDFDSRATYVAGKFMATHITSDCINCGACEPECPNEAISEGDEIYVIDPELCTECVGFYDHEACQAVCPVECCLPDPNVREEEQLLLERAVKLHPDDEELKKRVASGSFPSRFRK

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
176 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 4
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0153618 3300035119 Bacteria 1083
2 rootH2_10035219 3300003320 Bacteria 8746
3 rootH1_10241972 3300003323 Bacteria 2938
4 rootH1_10303797 3300003323 Bacteria 1433
5 Ga0058859_11606197 3300004798 Bacteria 641
6 Ga0070658_10230562 3300005327 Bacteria 1568
7 Ga0070683_100018405 3300005329 Bacteria 6187
8 Ga0070683_100565188 3300005329 Bacteria 1088
9 Ga0070683_100610960 3300005329 Bacteria 1044
10 Ga0070690_100684736 3300005330 Bacteria 786
11 Ga0068869_100348924 3300005334 Bacteria 1206
12 Ga0068868_100004783 3300005338 Bacteria 9507
13 Ga0070689_100824473 3300005340 Bacteria 817
14 Ga0070689_101171783 3300005340 Bacteria 689
15 Ga0070691_10880178 3300005341 Bacteria 551
16 Ga0070678_100085233 3300005456 Bacteria 2407
17 Ga0068867_100084212 3300005459 Bacteria 2402
18 Ga0070706_100550592 3300005467 Bacteria 1073
19 Ga0070706_101019032 3300005467 Bacteria 763
20 Ga0070707_100016494 3300005468 Bacteria 6931
21 Ga0070707_102272781 3300005468 Bacteria 510
22 Ga0070679_101010079 3300005530 Bacteria 776
23 Ga0070679_101109295 3300005530 Bacteria 736
24 Ga0070684_100102360 3300005535 Bacteria 2560
25 Ga0070684_100997347 3300005535 Bacteria 786
26 Ga0068853_100877725 3300005539 Bacteria 861
27 Ga0070665_100037302 3300005548 Bacteria 4889
28 Ga0070665_101677604 3300005548 Bacteria 643
29 Ga0068855_100002913 3300005563 Bacteria 20941
30 Ga0068855_101216327 3300005563 Bacteria 783
31 Ga0068856_100144651 3300005614 Bacteria 2385
32 Ga0068856_101316134 3300005614 Bacteria 738
33 Ga0068859_100138649 3300005617 Bacteria 2506
34 Ga0068859_100312820 3300005617 Bacteria 1664
35 Ga0068864_100160696 3300005618 Bacteria 2042
36 Ga0068866_10713321 3300005718 Bacteria 689
37 Ga0068863_100283780 3300005841 Bacteria 1605
38 Ga0068863_100336935 3300005841 Bacteria 1467
39 Ga0068863_101377401 3300005841 Bacteria 713
40 Ga0068860_101863992 3300005843 Bacteria 623
41 Ga0068860_102537497 3300005843 Bacteria 532
42 Ga0081455_10023270 3300005937 Bacteria 5769
43 Ga0081455_10223112 3300005937 Bacteria 1395
44 Ga0081455_10236776 3300005937 Bacteria 1344
45 Ga0081539_10027196 3300005985 Bacteria 3629
46 Ga0081539_10048847 3300005985 Bacteria 2404
47 Ga0075362_10393591 3300006177 Bacteria 698
48 Ga0068871_100135282 3300006358 Bacteria 2093
49 Ga0075428_100765643 3300006844 Bacteria 1027
50 Ga0075433_10364371 3300006852 Bacteria 1276
51 Ga0075429_100448093 3300006880 Bacteria 1131
52 Ga0075429_101005445 3300006880 Bacteria 729
53 Ga0097620_100138642 3300006931 Bacteria 2506
54 Ga0097620_100312816 3300006931 Bacteria 1664
55 Ga0075435_101791832 3300007076 Bacteria 539
56 Ga0099794_10002970 3300007265 Bacteria 6395
57 Ga0099795_10332014 3300007788 Bacteria 676
58 Ga0105240_10782325 3300009093 Bacteria 1035
59 Ga0105240_12517272 3300009093 Bacteria 532
60 Ga0111539_10020387 3300009094 Bacteria 8164
61 Ga0111539_10865712 3300009094 Bacteria 1051
62 Ga0111539_11104165 3300009094 Bacteria 922
63 Ga0111539_13179028 3300009094 Bacteria 530
64 Ga0105245_10225625 3300009098 Bacteria 1810
65 Ga0105247_10001516 3300009101 Bacteria 16608
66 Ga0105247_11851921 3300009101 Bacteria 503
67 Ga0114129_10004412 3300009147 Bacteria 19856
68 Ga0114129_10491466 3300009147 Bacteria 1604
69 Ga0114129_10918693 3300009147 Bacteria 1108
70 Ga0105242_10110736 3300009176 Bacteria 2340
71 Ga0105242_11392838 3300009176 Bacteria 728
72 Ga0105248_12691344 3300009177 Bacteria 567
73 Ga0105237_10622926 3300009545 Bacteria 1086
74 Ga0105238_12900528 3300009551 Bacteria 515
75 Ga0105249_12466286 3300009553 Bacteria 592
76 Ga0099796_10085579 3300010159 Bacteria 1164
77 Ga0105246_11333108 3300011119 Bacteria 666
78 Ga0105246_12289370 3300011119 Bacteria 528
79 Ga0157374_10333923 3300013296 Bacteria 1504
80 Ga0157374_12419406 3300013296 Bacteria 552
81 Ga0157374_12734417 3300013296 Bacteria 521
82 Ga0157378_11320138 3300013297 Bacteria 763
83 Ga0157378_12480705 3300013297 Bacteria 570
84 Ga0163162_10288511 3300013306 Bacteria 1773
85 Ga0157380_10312267 3300014326 Bacteria 1453
86 Ga0163161_11989915 3300017792 Bacteria 517
87 Ga0206350_10903521 3300020080 Bacteria 501
88 Ga0207710_10035946 3300025900 Bacteria 2182
89 Ga0207705_10287324 3300025909 Bacteria 1260
90 Ga0207684_10477526 3300025910 Bacteria 1069
91 Ga0207646_10019451 3300025922 Bacteria 6311
92 Ga0207646_11292963 3300025922 Bacteria 637
93 Ga0207687_10293098 3300025927 Bacteria 1308
94 Ga0207686_10170627 3300025934 Bacteria 1534
95 Ga0207686_11343366 3300025934 Bacteria 587
96 Ga0207670_10001328 3300025936 Bacteria 13049
97 Ga0207704_10339031 3300025938 Bacteria 1166
98 Ga0207689_11409650 3300025942 Bacteria 584
99 Ga0207661_10407444 3300025944 Bacteria 1234
100 Ga0207661_10820966 3300025944 Bacteria 856
101 Ga0207661_11842170 3300025944 Bacteria 551
102 Ga0207667_10000194 3300025949 Bacteria 88799
103 Ga0207667_10907085 3300025949 Bacteria 873
104 Ga0207712_11534335 3300025961 Bacteria 597
105 Ga0207677_10011406 3300026023 Bacteria 5067
106 Ga0207639_10723947 3300026041 Bacteria 924
107 Ga0207678_11347908 3300026067 Bacteria 631
108 Ga0207708_10142782 3300026075 Bacteria 1879
109 Ga0207702_10100722 3300026078 Bacteria 2549
110 Ga0207641_10245847 3300026088 Bacteria 1669
111 Ga0207641_10608639 3300026088 Bacteria 1070
112 Ga0207641_11074343 3300026088 Bacteria 803
113 Ga0207648_10051867 3300026089 Bacteria 3586
114 Ga0207683_10113303 3300026121 Bacteria 2429
115 Ga0209588_1004993 3300027671 Bacteria 3775
116 Ga0207428_10102379 3300027907 Bacteria 2211
117 Ga0268266_10893756 3300028379 Bacteria 859
118 Ga0268264_11792351 3300028381 Bacteria 624
119 Ga0265319_1000390 3300028563 Bacteria 31768
120 Ga0265318_10001595 3300028577 Bacteria 13113
121 Ga0265318_10006340 3300028577 Bacteria 5459
122 Ga0265318_10070668 3300028577 Bacteria 1294
123 Ga0265338_10312487 3300028800 Bacteria 1139
124 Ga0307511_10046748 3300030521 Bacteria 3554
125 Ga0265330_10000304 3300031235 Bacteria 35488
126 Ga0265330_10019117 3300031235 Bacteria 3143
127 Ga0265332_10003490 3300031238 Bacteria 7567
128 Ga0265328_10044502 3300031239 Bacteria 1632
129 Ga0265320_10000383 3300031240 Bacteria 35880
130 Ga0265320_10107025 3300031240 Bacteria 1284
131 Ga0265320_10121252 3300031240 Bacteria 1192
132 Ga0265325_10002446 3300031241 Bacteria 12546
133 Ga0265329_10000354 3300031242 Bacteria 24221
134 Ga0265329_10034631 3300031242 Bacteria 1631
135 Ga0265340_10000489 3300031247 Bacteria 21667
136 Ga0265340_10005681 3300031247 Bacteria 6898
137 Ga0265340_10008502 3300031247 Bacteria 5540
138 Ga0265340_10160690 3300031247 Bacteria 1021
139 Ga0265339_10001610 3300031249 Bacteria 16693
140 Ga0265331_10000453 3300031250 Bacteria 39694
141 Ga0265331_10247394 3300031250 Bacteria 800
142 Ga0265316_10001786 3300031344 Bacteria 22688
143 Ga0265316_10005926 3300031344 Bacteria 11768
144 Ga0265316_10334134 3300031344 Bacteria 1099
145 Ga0307513_10880256 3300031456 Bacteria 603
146 Ga0265313_10000026 3300031595 Bacteria 134612
147 Ga0265313_10000370 3300031595 Bacteria 48777
148 Ga0307508_10001677 3300031616 Bacteria 24598
149 Ga0307514_10149796 3300031649 Bacteria 1568
150 Ga0316575_10352363 3300031665 Bacteria 627
151 Ga0265314_10000684 3300031711 Bacteria 41154
152 Ga0265314_10319178 3300031711 Bacteria 865
153 Ga0265342_10000340 3300031712 Bacteria 52275
154 Ga0265342_10087010 3300031712 Bacteria 1796
155 Ga0265342_10116349 3300031712 Bacteria 1509
156 Ga0316576_10110695 3300031727 Bacteria 2058
157 Ga0307516_10018052 3300031730 Bacteria 7339
158 Ga0307405_11739283 3300031731 Bacteria 553
159 Ga0307413_10856441 3300031824 Bacteria 768
160 Ga0307410_10129429 3300031852 Bacteria 1852
161 Ga0326468_10091519 3300031889 Bacteria 545
162 Ga0307406_10032504 3300031901 Bacteria 3186
163 Ga0307406_12155019 3300031901 Bacteria 500
164 Ga0307407_10270909 3300031903 Bacteria 1172
165 Ga0307409_100169489 3300031995 Bacteria 1920
166 Ga0307416_101054412 3300032002 Bacteria 917
167 Ga0307415_100796515 3300032126 Bacteria 862
168 Ga0307507_10065673 3300033179 Bacteria 3334
169 Ga0373934_0497180 3300035086 Bacteria 512
170 Ga0373940_0234219 3300035088 Bacteria 614
171 Ga0373936_0588357 3300035113 Bacteria 522
172 Ga0373953_0393519 3300035117 Bacteria 610
173 Ga0373955_0068327 3300035172 Bacteria 1980
174 Ga0373931_0327564 3300035691 Bacteria 953
175 Ga0373931_1209247 3300035691 Bacteria 518
176 Ga0373935_0073584 3300035692 Bacteria 2208
177 Ga0373927_0009422 3300035695 Bacteria 6548
178 Ga0373933_0439956 3300035724 Bacteria 852
179 Ga0373933_0714062 3300035724 Bacteria 659
180 Ga0373937_0032337 3300036401 Bacteria 4746
181 Ga0373937_0441242 3300036401 Bacteria 1236
182 Ga0373937_0685070 3300036401 Bacteria 971
183 Ga0316584_0171192 3300036712 Bacteria 1611
184 Ga0373925_0038324 3300037068 Bacteria 3543
185 Ga0373925_1417442 3300037068 Bacteria 569
186 Ga0395905_0291437 3300037471 Bacteria 1519
187 Ga0436364_0010552 3300037853 Bacteria 1036
188 Ga0395901_1382000 3300038443 Bacteria 663
189 Ga0436365_0875678 3300039437 Bacteria 878
190 Ga0436365_1215160 3300039437 Bacteria 623
191 Ga0436365_1552148 3300039437 Bacteria 738
192 Ga0436365_1746195 3300039437 Bacteria 580
193 Ga0436365_1774282 3300039437 Bacteria 2891
194 Ga0436361_0007203 3300039447 Bacteria 532
195 Ga0436361_0233369 3300039447 Bacteria 1530
196 Ga0436361_1024296 3300039447 Bacteria 510
197 Ga0436363_0068977 3300039450 Bacteria 523
198 Ga0436363_0131955 3300039450 Bacteria 874
199 Ga0439465_0049324 3300041413 Bacteria 1375
200 Ga0451791_1819486 3300041451 Bacteria 618
201 Ga0451793_0294845 3300041452 Bacteria 2060
202 Ga0451797_0106199 3300041453 Bacteria 1723
203 Ga0451797_0172122 3300041453 Bacteria 1218
204 Ga0451800_0069397 3300041459 Bacteria 1424
205 Ga0451802_1335399 3300041460 Bacteria 722
206 Ga0451802_1669501 3300041460 Bacteria 671
207 Ga0451807_0308043 3300041486 Bacteria 2212
208 Ga0451807_0846647 3300041486 Bacteria 643
209 Ga0451807_1768151 3300041486 Bacteria 1297
210 Ga0451807_2479006 3300041486 Bacteria 1335
211 Ga0451833_1343903 3300041491 Bacteria 839
212 Ga0451837_0605031 3300041494 Bacteria 539
213 Ga0451839_1158695 3300041496 Bacteria 606
214 Ga0451851_0270130 3300041507 Bacteria 562
215 Ga0451843_1657925 3300041509 Bacteria 711
216 Ga0451855_0306617 3300041511 Bacteria 582
217 Ga0451855_1441291 3300041511 Bacteria 600
218 Ga0439449_0153417 3300042007 Bacteria 859
219 Ga0439449_0172062 3300042007 Bacteria 809
220 Ga0439449_0178504 3300042007 Bacteria 794
221 Ga0451577_1379424 3300042876 Bacteria 625
222 Ga0453683_0181962 3300044673 Bacteria 1333
223 Ga0453684_0000526 3300044712 Bacteria 146131
224 Ga0453684_0695757 3300044712 Bacteria 1105
225 Ga0466968_0167395 3300044735 Bacteria 1017
226 Ga0466960_0142454 3300044901 Bacteria 1274
227 Ga0466960_0175137 3300044901 Bacteria 1160
228 Ga0466960_0331943 3300044901 Bacteria 863
229 Ga0451576_0168507 3300045051 Bacteria 2286
230 Ga0451576_0389403 3300045051 Bacteria 1461
231 Ga0451576_2269427 3300045051 Bacteria 556
232 Ga0495668_0648920 3300046616 Bacteria 583
233 Ga0495589_0234686 3300046794 Bacteria 859
234 Ga0495600_0145913 3300046809 Bacteria 1534
235 Ga0495660_0072226 3300046810 Bacteria 1828
236 Ga0495680_0281014 3300047322 Bacteria 1173
237 Ga0496114_0447250 3300048917 Bacteria 1144
238 Ga0496121_0571048 3300048924 Bacteria 704
239 Ga0501311_088556 3300049527 Bacteria 535
240 Ga0501312_058542 3300049528 Bacteria 663
241 Ga0501032_0348718 3300049569 Bacteria 954
242 Ga0501034_0380785 3300049571 Bacteria 1336
243 Ga0501038_0014139 3300049574 Bacteria 7271
244 Ga0501043_0007940 3300049579 Bacteria 8386
245 Ga0501047_0014470 3300049581 Bacteria 7504
246 Ga0501047_0076642 3300049581 Bacteria 3218
247 Ga0501067_0001215 3300049583 Bacteria 13992
248 Ga0501067_0087990 3300049583 Bacteria 1724
249 Ga0501068_0000473 3300049584 Bacteria 20337
250 Ga0501069_0003582 3300049585 Bacteria 8002
251 Ga0501070_0268481 3300049586 Bacteria 1394
252 Ga0501072_0000017 3300049588 Bacteria 161678
253 Ga0501072_0434886 3300049588 Bacteria 1040
254 Ga0501073_0000333 3300049589 Bacteria 31753
255 Ga0501073_0427241 3300049589 Bacteria 916
256 Ga0501074_0000143 3300049590 Bacteria 37530
257 Ga0501074_0024363 3300049590 Bacteria 4398
258 Ga0501074_0339801 3300049590 Bacteria 1066
259 Ga0501076_0136185 3300049592 Bacteria 1993
260 Ga0501077_0022195 3300049593 Bacteria 4020
261 Ga0501223_127312 3300049663 Bacteria 541
262 Ga0501233_292196 3300049668 Bacteria 501
263 Ga0501253_096453 3300049683 Bacteria 687
264 Ga0501079_0000258 3300049741 Bacteria 32342
265 Ga0501080_0002062 3300049742 Bacteria 17415
266 Ga0501080_0570812 3300049742 Bacteria 1006
267 Ga0501080_0851428 3300049742 Bacteria 797
268 Ga0501083_0002819 3300049744 Bacteria 11999
269 Ga0501083_0025654 3300049744 Bacteria 4080
270 Ga0501083_0171713 3300049744 Bacteria 1417
271 Ga0501083_0575307 3300049744 Bacteria 733
272 Ga0501265_073456 3300049762 Bacteria 582
273 Ga0501044_0096239 3300049823 Bacteria 2982
274 Ga0501044_1138153 3300049823 Bacteria 649
275 Ga0501045_0645026 3300049824 Bacteria 783
276 nmdc:mga03683_339336_c1 3300050489 Bacteria 710
277 nmdc:mga05p37_1263830_c1 3300050507 Unclassified 756
278 nmdc:mga05p37_1696740_c1 3300050507 Bacteria 616
279 nmdc:mga05p37_57196_c1 3300050507 Bacteria 4803
280 nmdc:mga09592_17800_c2 3300050508 Bacteria 1194
281 nmdc:mga09592_790708_c1 3300050508 Unclassified 803
282 nmdc:mga08y16_13768_c1 3300050511 Bacteria 8514
283 nmdc:mga08y16_849699_c1 3300050511 Bacteria 902
284 nmdc:mga08y16_873697_c1 3300050511 Bacteria 887
285 nmdc:mga0rr50_456102_c1 3300050513 Bacteria 1084
286 nmdc:mga0rr50_482771_c1 3300050513 Bacteria 1052
287 nmdc:mga0a205_13538_c1 3300050515 Bacteria 7598
288 Ga0495601_0764093 3300053077 Bacteria 614
289 Ga0495612_0613657 3300053078 Bacteria 503
290 Ga0501084_0000202 3300054114 Bacteria 45950
291 Ga0501084_0011314 3300054114 Bacteria 7389
292 Ga0501084_0026780 3300054114 Bacteria 4816
293 Ga0587077_175824 3300059493 Bacteria 577
294 Ga0587085_155995 3300059506 Bacteria 530
295 Ga0587109_177676 3300059624 Bacteria 542
296 Ga0587111_0148709 3300060346 Bacteria 627
297 Ga0501082_0052906 3300060353 Bacteria 3500
298 Ga0501082_0325305 3300060353 Bacteria 1339
299 Ga0466962_0516100 3300061719 Bacteria 605
300 Ga0530510_0019361 3300061734 Bacteria 4830
301 Ga0373956_0153618
302 rootH2_10035219
303 rootH1_10241972
304 rootH1_10303797
305 Ga0058859_11606197
306 Ga0070658_10230562
307 Ga0070683_100018405
308 Ga0070683_100565188
309 Ga0070683_100610960
310 Ga0070690_100684736
311 Ga0068869_100348924
312 Ga0068868_100004783
313 Ga0070689_100824473
314 Ga0070689_101171783
315 Ga0070691_10880178
316 Ga0070678_100085233
317 Ga0068867_100084212
318 Ga0070706_100550592
319 Ga0070706_101019032
320 Ga0070707_100016494
321 Ga0070707_102272781
322 Ga0070679_101010079
323 Ga0070679_101109295
324 Ga0070684_100102360
325 Ga0070684_100997347
326 Ga0068853_100877725
327 Ga0070665_100037302
328 Ga0070665_101677604
329 Ga0068855_100002913
330 Ga0068855_101216327
331 Ga0068856_100144651
332 Ga0068856_101316134
333 Ga0068859_100138649
334 Ga0068859_100312820
335 Ga0068864_100160696
336 Ga0068866_10713321
337 Ga0068863_100283780
338 Ga0068863_100336935
339 Ga0068863_101377401
340 Ga0068860_101863992
341 Ga0068860_102537497
342 Ga0081455_10023270
343 Ga0081455_10223112
344 Ga0081455_10236776
345 Ga0081539_10027196
346 Ga0081539_10048847
347 Ga0075362_10393591
348 Ga0068871_100135282
349 Ga0075428_100765643
350 Ga0075433_10364371
351 Ga0075429_100448093
352 Ga0075429_101005445
353 Ga0097620_100138642
354 Ga0097620_100312816
355 Ga0075435_101791832
356 Ga0099794_10002970
357 Ga0099795_10332014
358 Ga0105240_10782325
359 Ga0105240_12517272
360 Ga0111539_10020387
361 Ga0111539_10865712
362 Ga0111539_11104165
363 Ga0111539_13179028
364 Ga0105245_10225625
365 Ga0105247_10001516
366 Ga0105247_11851921
367 Ga0114129_10004412
368 Ga0114129_10491466
369 Ga0114129_10918693
370 Ga0105242_10110736
371 Ga0105242_11392838
372 Ga0105248_12691344
373 Ga0105237_10622926
374 Ga0105238_12900528
375 Ga0105249_12466286
376 Ga0099796_10085579
377 Ga0105246_11333108
378 Ga0105246_12289370
379 Ga0157374_10333923
380 Ga0157374_12419406
381 Ga0157374_12734417
382 Ga0157378_11320138
383 Ga0157378_12480705
384 Ga0163162_10288511
385 Ga0157380_10312267
386 Ga0163161_11989915
387 Ga0206350_10903521
388 Ga0207710_10035946
389 Ga0207705_10287324
390 Ga0207684_10477526
391 Ga0207646_10019451
392 Ga0207646_11292963
393 Ga0207687_10293098
394 Ga0207686_10170627
395 Ga0207686_11343366
396 Ga0207670_10001328
397 Ga0207704_10339031
398 Ga0207689_11409650
399 Ga0207661_10407444
400 Ga0207661_10820966
401 Ga0207661_11842170
402 Ga0207667_10000194
403 Ga0207667_10907085
404 Ga0207712_11534335
405 Ga0207677_10011406
406 Ga0207639_10723947
407 Ga0207678_11347908
408 Ga0207708_10142782
409 Ga0207702_10100722
410 Ga0207641_10245847
411 Ga0207641_10608639
412 Ga0207641_11074343
413 Ga0207648_10051867
414 Ga0207683_10113303
415 Ga0209588_1004993
416 Ga0207428_10102379
417 Ga0268266_10893756
418 Ga0268264_11792351
419 Ga0265319_1000390
420 Ga0265318_10001595
421 Ga0265318_10006340
422 Ga0265318_10070668
423 Ga0265338_10312487
424 Ga0307511_10046748
425 Ga0265330_10000304
426 Ga0265330_10019117
427 Ga0265332_10003490
428 Ga0265328_10044502
429 Ga0265320_10000383
430 Ga0265320_10107025
431 Ga0265320_10121252
432 Ga0265325_10002446
433 Ga0265329_10000354
434 Ga0265329_10034631
435 Ga0265340_10000489
436 Ga0265340_10005681
437 Ga0265340_10008502
438 Ga0265340_10160690
439 Ga0265339_10001610
440 Ga0265331_10000453
441 Ga0265331_10247394
442 Ga0265316_10001786
443 Ga0265316_10005926
444 Ga0265316_10334134
445 Ga0307513_10880256
446 Ga0265313_10000026
447 Ga0265313_10000370
448 Ga0307508_10001677
449 Ga0307514_10149796
450 Ga0316575_10352363
451 Ga0265314_10000684
452 Ga0265314_10319178
453 Ga0265342_10000340
454 Ga0265342_10087010
455 Ga0265342_10116349
456 Ga0316576_10110695
457 Ga0307516_10018052
458 Ga0307405_11739283
459 Ga0307413_10856441
460 Ga0307410_10129429
461 Ga0326468_10091519
462 Ga0307406_10032504
463 Ga0307406_12155019
464 Ga0307407_10270909
465 Ga0307409_100169489
466 Ga0307416_101054412
467 Ga0307415_100796515
468 Ga0307507_10065673
469 Ga0373934_0497180
470 Ga0373940_0234219
471 Ga0373936_0588357
472 Ga0373953_0393519
473 Ga0373955_0068327
474 Ga0373931_0327564
475 Ga0373931_1209247
476 Ga0373935_0073584
477 Ga0373927_0009422
478 Ga0373933_0439956
479 Ga0373933_0714062
480 Ga0373937_0032337
481 Ga0373937_0441242
482 Ga0373937_0685070
483 Ga0316584_0171192
484 Ga0373925_0038324
485 Ga0373925_1417442
486 Ga0395905_0291437
487 Ga0436364_0010552
488 Ga0395901_1382000
489 Ga0436365_0875678
490 Ga0436365_1215160
491 Ga0436365_1552148
492 Ga0436365_1746195
493 Ga0436365_1774282
494 Ga0436361_0007203
495 Ga0436361_0233369
496 Ga0436361_1024296
497 Ga0436363_0068977
498 Ga0436363_0131955
499 Ga0439465_0049324
500 Ga0451791_1819486
501 Ga0451793_0294845
502 Ga0451797_0106199
503 Ga0451797_0172122
504 Ga0451800_0069397
505 Ga0451802_1335399
506 Ga0451802_1669501
507 Ga0451807_0308043
508 Ga0451807_0846647
509 Ga0451807_1768151
510 Ga0451807_2479006
511 Ga0451833_1343903
512 Ga0451837_0605031
513 Ga0451839_1158695
514 Ga0451851_0270130
515 Ga0451843_1657925
516 Ga0451855_0306617
517 Ga0451855_1441291
518 Ga0439449_0153417
519 Ga0439449_0172062
520 Ga0439449_0178504
521 Ga0451577_1379424
522 Ga0453683_0181962
523 Ga0453684_0000526
524 Ga0453684_0695757
525 Ga0466968_0167395
526 Ga0466960_0142454
527 Ga0466960_0175137
528 Ga0466960_0331943
529 Ga0451576_0168507
530 Ga0451576_0389403
531 Ga0451576_2269427
532 Ga0495668_0648920
533 Ga0495589_0234686
534 Ga0495600_0145913
535 Ga0495660_0072226
536 Ga0495680_0281014
537 Ga0496114_0447250
538 Ga0496121_0571048
539 Ga0501311_088556
540 Ga0501312_058542
541 Ga0501032_0348718
542 Ga0501034_0380785
543 Ga0501038_0014139
544 Ga0501043_0007940
545 Ga0501047_0014470
546 Ga0501047_0076642
547 Ga0501067_0001215
548 Ga0501067_0087990
549 Ga0501068_0000473
550 Ga0501069_0003582
551 Ga0501070_0268481
552 Ga0501072_0000017
553 Ga0501072_0434886
554 Ga0501073_0000333
555 Ga0501073_0427241
556 Ga0501074_0000143
557 Ga0501074_0024363
558 Ga0501074_0339801
559 Ga0501076_0136185
560 Ga0501077_0022195
561 Ga0501223_127312
562 Ga0501233_292196
563 Ga0501253_096453
564 Ga0501079_0000258
565 Ga0501080_0002062
566 Ga0501080_0570812
567 Ga0501080_0851428
568 Ga0501083_0002819
569 Ga0501083_0025654
570 Ga0501083_0171713
571 Ga0501083_0575307
572 Ga0501265_073456
573 Ga0501044_0096239
574 Ga0501044_1138153
575 Ga0501045_0645026
576 nmdc:mga03683_339336_c1
577 nmdc:mga05p37_1263830_c1
578 nmdc:mga05p37_1696740_c1
579 nmdc:mga05p37_57196_c1
580 nmdc:mga09592_17800_c2
581 nmdc:mga09592_790708_c1
582 nmdc:mga08y16_13768_c1
583 nmdc:mga08y16_849699_c1
584 nmdc:mga08y16_873697_c1
585 nmdc:mga0rr50_456102_c1
586 nmdc:mga0rr50_482771_c1
587 nmdc:mga0a205_13538_c1
588 Ga0495601_0764093
589 Ga0495612_0613657
590 Ga0501084_0000202
591 Ga0501084_0011314
592 Ga0501084_0026780
593 Ga0587077_175824
594 Ga0587085_155995
595 Ga0587109_177676
596 Ga0587111_0148709
597 Ga0501082_0052906
598 Ga0501082_0325305
599 Ga0466962_0516100
600 Ga0530510_0019361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12838

Fer4_7

4Fe-4S dicluster domain

23

73

0.92

PF00037

Fer4

4Fe-4S binding domain

17

40

0.9

Map