F395135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 228 | 272 | 418 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10005000|JGI24740J21852_100050002 |
| Length | 455 |
| Sequence | MTSEAPGECFVYITLPGTIEPVTAGRFALSVDRRGVPEGRFVYGRSYLERPNAVALDPVELKLSPRTYATAALNGVFGALRDASPDYWGRRVIQRHLGKAQPGEMEYLLYSPDDRAGALGFGLNQVPPAPKRSFNQTLELAKVQAIADSIVADEDQLEGDQRSATDDRGDHHHDRDQVEKLMVIGTSMGGARPKAVVEDEAGLWIAKFNRPDDAWNSARVEHAMLVLARACGLTTAESRVTDVAGRDVLLVKRFDREKAEGGYLRARMISALTLLRTEDTFRSRDRWSYVLLAEELRRVSAVPGTDAAELFRRMAFNALISNIDDHPRNHALIARDAEWRLSPAYDLTPAVPVSLERRDLAMECGDAGRFANAGNLLSQSPRFLLEPGEAAAMLDAMEAQVASTWYATARGAGVSERDCERIAPAFAYPGFRQASDHNGTTLRPRILVNQEDRWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 3 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 4 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 5 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 6 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 7 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 8 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 11 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 12 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 13 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 14 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 15 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 16 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 17 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 18 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 19 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 20 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 21 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 75 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 76 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 119 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 120 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 123 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 124 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 128 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 129 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 131 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 146 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 180 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 204 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 205 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 206 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 208 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 209 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 210 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 211 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 212 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 213 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 214 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 215 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 218 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 219 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 220 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 221 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 222 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 224 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 225 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 226 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 227 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 228 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.33 |
| Metatranscriptomes | 0.67 |
| Isolates | 9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 6.33 |
| Rhizoplane | 1.33 |
| Rhizosphere | 76.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3740212 | 2162886006 | Bacteria | 1803 |
| 2 | JGI24740J21852_10005000 | 3300001979 | Bacteria | 5630 |
| 3 | rootH2_10015861 | 3300003320 | Bacteria | 15267 |
| 4 | rootH1_10019968 | 3300003323 | Bacteria | 3078 |
| 5 | Ga0065165_1000998 | 3300005262 | Bacteria | 34892 |
| 6 | Ga0065707_10084205 | 3300005295 | Bacteria | 7526 |
| 7 | Ga0070683_100059459 | 3300005329 | Bacteria | 3551 |
| 8 | Ga0070670_100048507 | 3300005331 | Bacteria | 3654 |
| 9 | Ga0068869_100027845 | 3300005334 | Bacteria | 3943 |
| 10 | Ga0068868_100057650 | 3300005338 | Bacteria | 3069 |
| 11 | Ga0070689_100087279 | 3300005340 | Bacteria | 2454 |
| 12 | Ga0070661_100022658 | 3300005344 | Bacteria | 4498 |
| 13 | Ga0070671_100011900 | 3300005355 | Bacteria | 6997 |
| 14 | Ga0070671_100153908 | 3300005355 | Bacteria | 1942 |
| 15 | Ga0070673_100107829 | 3300005364 | Bacteria | 2305 |
| 16 | Ga0070710_10101276 | 3300005437 | Bacteria | 1716 |
| 17 | Ga0070708_100021620 | 3300005445 | Bacteria | 5443 |
| 18 | Ga0070678_100141730 | 3300005456 | Bacteria | 1924 |
| 19 | Ga0070662_100014751 | 3300005457 | Bacteria | 5223 |
| 20 | Ga0070662_100184114 | 3300005457 | Bacteria | 1648 |
| 21 | Ga0070681_10024628 | 3300005458 | Bacteria | 6055 |
| 22 | Ga0070681_10197507 | 3300005458 | Bacteria | 1930 |
| 23 | Ga0068867_100044345 | 3300005459 | Bacteria | 3258 |
| 24 | Ga0070699_100017149 | 3300005518 | Bacteria | 6219 |
| 25 | Ga0070679_100008346 | 3300005530 | Bacteria | 9745 |
| 26 | Ga0070679_100044152 | 3300005530 | Bacteria | 4441 |
| 27 | Ga0070679_100116282 | 3300005530 | Bacteria | 2659 |
| 28 | Ga0070679_100143222 | 3300005530 | Bacteria | 2369 |
| 29 | Ga0070684_100101358 | 3300005535 | Bacteria | 2573 |
| 30 | Ga0068853_100063775 | 3300005539 | Bacteria | 3192 |
| 31 | Ga0070686_100000049 | 3300005544 | Bacteria | 98216 |
| 32 | Ga0068855_100009287 | 3300005563 | Bacteria | 11877 |
| 33 | Ga0068855_100035528 | 3300005563 | Bacteria | 5935 |
| 34 | Ga0068855_100059220 | 3300005563 | Bacteria | 4482 |
| 35 | Ga0070664_100046830 | 3300005564 | Bacteria | 3653 |
| 36 | Ga0068857_100022190 | 3300005577 | Bacteria | 5584 |
| 37 | Ga0068854_100020354 | 3300005578 | Bacteria | 4488 |
| 38 | Ga0068854_100132999 | 3300005578 | Bacteria | 1901 |
| 39 | Ga0068856_100006003 | 3300005614 | Bacteria | 11952 |
| 40 | Ga0068859_100045101 | 3300005617 | Bacteria | 4430 |
| 41 | Ga0068864_100012024 | 3300005618 | Bacteria | 7148 |
| 42 | Ga0068866_10013770 | 3300005718 | Bacteria | 3556 |
| 43 | Ga0068863_100005208 | 3300005841 | Bacteria | 12836 |
| 44 | Ga0068863_100249790 | 3300005841 | Unclassified | 1713 |
| 45 | Ga0068858_100009988 | 3300005842 | Bacteria | 9015 |
| 46 | Ga0097621_100000524 | 3300006237 | Bacteria | 26915 |
| 47 | Ga0097621_100030526 | 3300006237 | Bacteria | 4267 |
| 48 | Ga0075370_10027012 | 3300006353 | Bacteria | 3183 |
| 49 | Ga0068871_100000136 | 3300006358 | Bacteria | 47129 |
| 50 | Ga0075428_100099774 | 3300006844 | Plasmid | 3166 |
| 51 | Ga0075428_100124763 | 3300006844 | Bacteria | 2802 |
| 52 | Ga0075428_100158607 | 3300006844 | Bacteria | 2456 |
| 53 | Ga0075430_100048210 | 3300006846 | Bacteria | 3596 |
| 54 | Ga0075430_100111804 | 3300006846 | Bacteria | 2277 |
| 55 | Ga0075431_100023488 | 3300006847 | Bacteria | 6309 |
| 56 | Ga0075431_100089957 | 3300006847 | Bacteria | 3168 |
| 57 | Ga0075431_100300879 | 3300006847 | Bacteria | 1620 |
| 58 | Ga0075433_10187662 | 3300006852 | Bacteria | 1839 |
| 59 | Ga0075429_100058801 | 3300006880 | Plasmid | 3348 |
| 60 | Ga0075429_100147766 | 3300006880 | Bacteria | 2057 |
| 61 | Ga0068865_100075738 | 3300006881 | Bacteria | 2400 |
| 62 | Ga0097620_100045101 | 3300006931 | Bacteria | 4430 |
| 63 | Ga0099795_10001054 | 3300007788 | Bacteria | 5687 |
| 64 | Ga0099795_10001521 | 3300007788 | Bacteria | 5075 |
| 65 | Ga0105240_10000303 | 3300009093 | Bacteria | 95509 |
| 66 | Ga0105240_10001501 | 3300009093 | Bacteria | 39739 |
| 67 | Ga0105240_10006223 | 3300009093 | Bacteria | 17556 |
| 68 | Ga0105240_10006622 | 3300009093 | Bacteria | 17007 |
| 69 | Ga0105240_10047004 | 3300009093 | Bacteria | 5463 |
| 70 | Ga0105240_10073434 | 3300009093 | Bacteria | 4224 |
| 71 | Ga0111539_10012053 | 3300009094 | Bacteria | 10843 |
| 72 | Ga0111539_10143376 | 3300009094 | Bacteria | 2796 |
| 73 | Ga0114129_10104722 | 3300009147 | Bacteria | 3910 |
| 74 | Ga0114129_10503250 | 3300009147 | Unclassified | 1582 |
| 75 | Ga0105248_10001757 | 3300009177 | Bacteria | 24112 |
| 76 | Ga0105248_10047713 | 3300009177 | Bacteria | 4803 |
| 77 | Ga0105237_10001025 | 3300009545 | Bacteria | 37594 |
| 78 | Ga0105237_10020826 | 3300009545 | Bacteria | 6753 |
| 79 | Ga0105238_10005742 | 3300009551 | Bacteria | 12273 |
| 80 | Ga0105238_10085477 | 3300009551 | Bacteria | 3142 |
| 81 | Ga0105249_10314751 | 3300009553 | Unclassified | 1575 |
| 82 | Ga0123341_1027836 | 3300009765 | Bacteria | 4403 |
| 83 | Ga0123342_1036588 | 3300009766 | Bacteria | 2018 |
| 84 | Ga0099796_10005125 | 3300010159 | Bacteria | 3243 |
| 85 | Ga0099796_10016150 | 3300010159 | Bacteria | 2199 |
| 86 | Ga0105239_10003993 | 3300010375 | Bacteria | 17866 |
| 87 | Ga0105239_10016488 | 3300010375 | Bacteria | 8172 |
| 88 | Ga0105239_10038584 | 3300010375 | Bacteria | 5235 |
| 89 | Ga0157369_10001324 | 3300013105 | Bacteria | 30678 |
| 90 | Ga0157369_10056003 | 3300013105 | Bacteria | 4255 |
| 91 | Ga0157374_10001350 | 3300013296 | Bacteria | 20892 |
| 92 | Ga0157378_10000419 | 3300013297 | Bacteria | 41780 |
| 93 | Ga0157378_10024878 | 3300013297 | Bacteria | 5273 |
| 94 | Ga0157372_10000216 | 3300013307 | Bacteria | 63844 |
| 95 | Ga0157372_10068688 | 3300013307 | Bacteria | 3984 |
| 96 | Ga0157376_10011012 | 3300014969 | Bacteria | 6646 |
| 97 | Ga0207642_10009661 | 3300025899 | Bacteria | 3366 |
| 98 | Ga0207680_10045771 | 3300025903 | Bacteria | 2582 |
| 99 | Ga0207647_10071701 | 3300025904 | Unclassified | 2090 |
| 100 | Ga0207705_10159180 | 3300025909 | Bacteria | 1696 |
| 101 | Ga0207707_10087468 | 3300025912 | Bacteria | 2723 |
| 102 | Ga0207695_10000396 | 3300025913 | Bacteria | 98138 |
| 103 | Ga0207695_10007442 | 3300025913 | Bacteria | 13935 |
| 104 | Ga0207695_10011351 | 3300025913 | Bacteria | 10797 |
| 105 | Ga0207695_10017334 | 3300025913 | Bacteria | 8384 |
| 106 | Ga0207695_10036891 | 3300025913 | Bacteria | 5278 |
| 107 | Ga0207671_10002499 | 3300025914 | Bacteria | 19623 |
| 108 | Ga0207671_10016209 | 3300025914 | Bacteria | 5801 |
| 109 | Ga0207649_10025322 | 3300025920 | Plasmid | 3458 |
| 110 | Ga0207652_10077293 | 3300025921 | Bacteria | 2904 |
| 111 | Ga0207694_10053096 | 3300025924 | Bacteria | 3142 |
| 112 | Ga0207664_10035331 | 3300025929 | Unclassified | 3856 |
| 113 | Ga0207644_10036934 | 3300025931 | Bacteria | 3432 |
| 114 | Ga0207644_10103088 | 3300025931 | Bacteria | 2147 |
| 115 | Ga0207706_10025680 | 3300025933 | Bacteria | 5277 |
| 116 | Ga0207704_10127195 | 3300025938 | Bacteria | 1757 |
| 117 | Ga0207665_10076091 | 3300025939 | Bacteria | 2301 |
| 118 | Ga0207711_10187938 | 3300025941 | Bacteria | 1882 |
| 119 | Ga0207689_10089450 | 3300025942 | Bacteria | 2529 |
| 120 | Ga0207667_10025197 | 3300025949 | Bacteria | 6516 |
| 121 | Ga0207667_10064607 | 3300025949 | Bacteria | 3819 |
| 122 | Ga0207667_10090370 | 3300025949 | Plasmid | 3165 |
| 123 | Ga0207640_10026011 | 3300025981 | Bacteria | 3549 |
| 124 | Ga0207640_10154302 | 3300025981 | Bacteria | 1691 |
| 125 | Ga0207677_10075156 | 3300026023 | Bacteria | 2400 |
| 126 | Ga0207702_10007624 | 3300026078 | Bacteria | 9210 |
| 127 | Ga0207702_10127145 | 3300026078 | Bacteria | 2289 |
| 128 | Ga0207641_10003445 | 3300026088 | Bacteria | 14010 |
| 129 | Ga0207648_10147367 | 3300026089 | Bacteria | 2076 |
| 130 | Ga0207674_10007768 | 3300026116 | Bacteria | 12478 |
| 131 | Ga0268264_10222971 | 3300028381 | Bacteria | 1736 |
| 132 | Ga0265323_10021452 | 3300028653 | Unclassified | 2474 |
| 133 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 134 | Ga0307515_10001129 | 3300028794 | Bacteria | 61098 |
| 135 | Ga0307515_10092729 | 3300028794 | Bacteria | 3755 |
| 136 | Ga0265338_10010454 | 3300028800 | Bacteria | 10878 |
| 137 | Ga0307511_10031297 | 3300030521 | Bacteria | 4757 |
| 138 | Ga0265330_10023928 | 3300031235 | Plasmid | 2771 |
| 139 | Ga0265328_10010357 | 3300031239 | Bacteria | 3757 |
| 140 | Ga0265316_10000428 | 3300031344 | Bacteria | 47855 |
| 141 | Ga0307513_10071511 | 3300031456 | Bacteria | 3620 |
| 142 | Ga0307509_10000023 | 3300031507 | Bacteria | 242310 |
| 143 | Ga0307509_10001996 | 3300031507 | Bacteria | 33693 |
| 144 | Ga0307509_10024091 | 3300031507 | Bacteria | 6821 |
| 145 | Ga0265313_10002414 | 3300031595 | Bacteria | 16162 |
| 146 | Ga0307514_10045263 | 3300031649 | Bacteria | 3444 |
| 147 | Ga0316575_10043455 | 3300031665 | Unclassified | 1781 |
| 148 | Ga0316579_10027033 | 3300031691 | Bacteria | 2602 |
| 149 | Ga0265342_10014950 | 3300031712 | Bacteria | 5128 |
| 150 | Ga0316576_10006195 | 3300031727 | Bacteria | 7424 |
| 151 | Ga0316578_10003254 | 3300031728 | Bacteria | 7378 |
| 152 | Ga0316577_10099802 | 3300031733 | Unclassified | 1627 |
| 153 | Ga0316577_10143849 | 3300031733 | Bacteria | 1343 |
| 154 | Ga0307409_100081801 | 3300031995 | Unclassified | 2612 |
| 155 | Ga0307416_100125260 | 3300032002 | Bacteria | 2300 |
| 156 | Ga0316583_10000343 | 3300032133 | Bacteria | 13277 |
| 157 | Ga0316580_10015346 | 3300032139 | Bacteria | 2343 |
| 158 | Ga0316593_10033970 | 3300032168 | Unclassified | 1672 |
| 159 | Ga0307510_10041335 | 3300033180 | Bacteria | 5043 |
| 160 | Ga0316588_1002859 | 3300033528 | Bacteria | 3067 |
| 161 | Ga0373923_0036395 | 3300035111 | Bacteria | 2009 |
| 162 | Ga0373956_0056037 | 3300035119 | Bacteria | 1779 |
| 163 | Ga0373943_0095202 | 3300035170 | Bacteria | 1548 |
| 164 | Ga0373955_0013913 | 3300035172 | Bacteria | 3904 |
| 165 | Ga0316574_0014082 | 3300035398 | Bacteria | 4613 |
| 166 | Ga0316574_0016487 | 3300035398 | Plasmid | 4307 |
| 167 | Ga0373927_0002788 | 3300035695 | Bacteria | 12758 |
| 168 | Ga0316582_0023982 | 3300036647 | Bacteria | 3643 |
| 169 | Ga0316584_0011379 | 3300036712 | Bacteria | 6250 |
| 170 | Ga0316584_0134469 | 3300036712 | Bacteria | 1846 |
| 171 | Ga0395899_0008099 | 3300037312 | Bacteria | 8093 |
| 172 | Ga0395900_0001467 | 3300037418 | Bacteria | 28145 |
| 173 | Ga0395900_0008882 | 3300037418 | Bacteria | 10318 |
| 174 | Ga0395900_0036363 | 3300037418 | Bacteria | 5076 |
| 175 | Ga0395898_0014314 | 3300037466 | Bacteria | 8152 |
| 176 | Ga0395898_0026532 | 3300037466 | Bacteria | 5826 |
| 177 | Ga0395905_0079196 | 3300037471 | Bacteria | 3079 |
| 178 | Ga0395905_0150609 | 3300037471 | Unclassified | 2189 |
| 179 | Ga0395901_0004940 | 3300038443 | Bacteria | 13459 |
| 180 | Ga0395901_0032639 | 3300038443 | Bacteria | 5370 |
| 181 | Ga0395901_0272608 | 3300038443 | Unclassified | 1759 |
| 182 | Ga0400483_200777 | 3300039062 | Bacteria | 1698 |
| 183 | Ga0436361_0181353 | 3300039447 | Bacteria | 6179 |
| 184 | Ga0466969_0023976 | 3300044656 | Bacteria | 3140 |
| 185 | Ga0466966_0000877 | 3300044684 | Bacteria | 19195 |
| 186 | Ga0466964_0015159 | 3300044706 | Bacteria | 2933 |
| 187 | Ga0453684_0000384 | 3300044712 | Bacteria | 181189 |
| 188 | Ga0466968_0049472 | 3300044735 | Bacteria | 1791 |
| 189 | Ga0466959_0071731 | 3300045049 | Bacteria | 2507 |
| 190 | Ga0495580_0119861 | 3300046472 | Bacteria | 1827 |
| 191 | Ga0495605_0003054 | 3300046474 | Bacteria | 10101 |
| 192 | Ga0495584_0086124 | 3300046491 | Bacteria | 1583 |
| 193 | Ga0495585_0008486 | 3300046492 | Bacteria | 6224 |
| 194 | Ga0495583_0008244 | 3300046506 | Bacteria | 6392 |
| 195 | Ga0495631_0008860 | 3300046518 | Bacteria | 5050 |
| 196 | Ga0495632_0017464 | 3300046519 | Bacteria | 3958 |
| 197 | Ga0495643_0008846 | 3300046522 | Bacteria | 6339 |
| 198 | Ga0495648_0006468 | 3300046524 | Bacteria | 9559 |
| 199 | Ga0495640_0055349 | 3300046533 | Bacteria | 2714 |
| 200 | Ga0495587_0023182 | 3300046536 | Bacteria | 3816 |
| 201 | Ga0495609_0009714 | 3300046538 | Bacteria | 4641 |
| 202 | Ga0495668_0012665 | 3300046616 | Bacteria | 4997 |
| 203 | Ga0495668_0042820 | 3300046616 | Bacteria | 2520 |
| 204 | Ga0495611_0044067 | 3300046648 | Bacteria | 1995 |
| 205 | Ga0495625_0002886 | 3300046660 | Bacteria | 17968 |
| 206 | Ga0495625_0067522 | 3300046660 | Bacteria | 2516 |
| 207 | Ga0495624_0068362 | 3300046690 | Bacteria | 2215 |
| 208 | Ga0495670_0012821 | 3300046691 | Bacteria | 4120 |
| 209 | Ga0495649_0068431 | 3300046694 | Bacteria | 1905 |
| 210 | Ga0495600_0027732 | 3300046809 | Bacteria | 3660 |
| 211 | Ga0495660_0114513 | 3300046810 | Bacteria | 1372 |
| 212 | Ga0495604_0006357 | 3300047317 | Bacteria | 9367 |
| 213 | Ga0495674_0073221 | 3300047319 | Plasmid | 2954 |
| 214 | Ga0495672_0020029 | 3300047320 | Bacteria | 4395 |
| 215 | Ga0495687_006577 | 3300047443 | Bacteria | 7083 |
| 216 | Ga0496100_0016467 | 3300048903 | Bacteria | 4342 |
| 217 | Ga0496112_0048343 | 3300048915 | Bacteria | 4171 |
| 218 | Ga0496112_0131072 | 3300048915 | Bacteria | 2478 |
| 219 | Ga0496115_0004329 | 3300048918 | Bacteria | 10274 |
| 220 | Ga0495678_007689 | 3300049459 | Bacteria | 5558 |
| 221 | Ga0501038_0002324 | 3300049574 | Bacteria | 17693 |
| 222 | Ga0501039_0108151 | 3300049575 | Bacteria | 2173 |
| 223 | Ga0501040_0025652 | 3300049576 | Bacteria | 3964 |
| 224 | Ga0501041_0026668 | 3300049577 | Bacteria | 3476 |
| 225 | Ga0501042_0014058 | 3300049578 | Bacteria | 5458 |
| 226 | Ga0501047_0147255 | 3300049581 | Bacteria | 2231 |
| 227 | Ga0501071_0134549 | 3300049587 | Bacteria | 1838 |
| 228 | Ga0501072_0020180 | 3300049588 | Bacteria | 5160 |
| 229 | Ga0501075_0157203 | 3300049591 | Bacteria | 1733 |
| 230 | Ga0501077_0006585 | 3300049593 | Bacteria | 7132 |
| 231 | Ga0501080_0211225 | 3300049742 | Bacteria | 1778 |
| 232 | Ga0501081_0003029 | 3300049743 | Bacteria | 10660 |
| 233 | Ga0501083_0171506 | 3300049744 | Bacteria | 1418 |
| 234 | Ga0501035_0102242 | 3300049822 | Bacteria | 2514 |
| 235 | nmdc:mga03683_66825_c1 | 3300050489 | Unclassified | 1529 |
| 236 | nmdc:mga07m45_65875_c1 | 3300050496 | Bacteria | 2057 |
| 237 | nmdc:mga09592_55660_c1 | 3300050508 | Bacteria | 3343 |
| 238 | nmdc:mga0qj67_6021_c1 | 3300050509 | Bacteria | 8883 |
| 239 | nmdc:mga0qj67_7060_c1 | 3300050509 | Bacteria | 8286 |
| 240 | nmdc:mga06r32_10658_c2 | 3300050510 | Bacteria | 7581 |
| 241 | nmdc:mga06r32_65170_c1 | 3300050510 | Bacteria | 3514 |
| 242 | nmdc:mga06r32_9961_c1 | 3300050510 | Bacteria | 8576 |
| 243 | nmdc:mga0a205_201217_c1 | 3300050515 | Bacteria | 1882 |
| 244 | Ga0495601_0065703 | 3300053077 | Bacteria | 2309 |
| 245 | Ga0495619_0070284 | 3300053085 | Bacteria | 2341 |
| 246 | Ga0500578_0000104 | 3300053086 | Bacteria | 98802 |
| 247 | Ga0500647_0050805 | 3300053091 | Bacteria | 1994 |
| 248 | Ga0500566_0000190 | 3300053094 | Bacteria | 31951 |
| 249 | Ga0500640_000028 | 3300053095 | Bacteria | 21641 |
| 250 | Ga0500557_000186 | 3300053105 | Bacteria | 11036 |
| 251 | Ga0500569_002358 | 3300053109 | Bacteria | 3708 |
| 252 | Ga0500572_000447 | 3300053111 | Bacteria | 14394 |
| 253 | Ga0500591_038335 | 3300053115 | Bacteria | 2291 |
| 254 | Ga0500614_000953 | 3300053123 | Bacteria | 7211 |
| 255 | Ga0500642_0051960 | 3300053130 | Unclassified | 1813 |
| 256 | Ga0500568_0001438 | 3300053139 | Bacteria | 15421 |
| 257 | Ga0500568_0008504 | 3300053139 | Bacteria | 4939 |
| 258 | Ga0500590_002026 | 3300053148 | Bacteria | 8741 |
| 259 | Ga0500590_006155 | 3300053148 | Bacteria | 5829 |
| 260 | Ga0500603_000065 | 3300053150 | Bacteria | 24604 |
| 261 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 262 | Ga0500616_0001878 | 3300053153 | Bacteria | 18927 |
| 263 | Ga0500633_0000072 | 3300053160 | Bacteria | 15109 |
| 264 | Ga0500638_023728 | 3300053162 | Bacteria | 2918 |
| 265 | Ga0500639_000003 | 3300053163 | Bacteria | 230428 |
| 266 | Ga0500637_0063283 | 3300053178 | Bacteria | 2121 |
| 267 | Ga0500596_000130 | 3300053735 | Bacteria | 11045 |
| 268 | Ga0500596_000801 | 3300053735 | Bacteria | 6206 |
| 269 | Ga0501084_0199194 | 3300054114 | Bacteria | 1689 |
| 270 | Ga0590071_003668 | 3300059421 | Bacteria | 3770 |
| 271 | Ga0590074_001806 | 3300059423 | Bacteria | 3495 |
| 272 | Ga0466962_0004224 | 3300061719 | Bacteria | 6880 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2935630451 | 2935637195 | 337 |
| 2 | iso_pu_bacteria | 2941507105 | 2941513833 | 337 |
| 3 | iso_pu_bacteria | 2941515067 | 2941521795 | 337 |
| 4 | iso_pu_bacteria | 2941523033 | 2941529464 | 337 |
| 5 | 3300049743 | Ga0501081_0003029 | Ga0501081_0003029_9546_10622 | 352 |
| 6 | 3300035172 | Ga0373955_0013913 | Ga0373955_0013913_2663_3835 | 382 |
| 7 | 3300046491 | Ga0495584_0086124 | Ga0495584_0086124_291_1451 | 386 |
| 8 | 3300046522 | Ga0495643_0008846 | Ga0495643_0008846_4351_5511 | 386 |
| 9 | 3300046660 | Ga0495625_0067522 | Ga0495625_0067522_787_1947 | 386 |
| 10 | 3300046694 | Ga0495649_0068431 | Ga0495649_0068431_314_1474 | 386 |
| 11 | 3300046810 | Ga0495660_0114513 | Ga0495660_0114513_180_1340 | 386 |
| 12 | 3300047443 | Ga0495687_006577 | Ga0495687_006577_1342_2502 | 386 |
| 13 | 3300046472 | Ga0495580_0119861 | Ga0495580_0119861_48_1325 | 388 |
| 14 | 3300049588 | Ga0501072_0020180 | Ga0501072_0020180_3966_5150 | 388 |
| 15 | 3300049593 | Ga0501077_0006585 | Ga0501077_0006585_5938_7122 | 388 |
| 16 | 3300009094 | Ga0111539_10143376 | Ga0111539_101433763 | 392 |
| 17 | 3300031507 | Ga0307509_10000023 | Ga0307509_10000023137 | 392 |
| 18 | 3300046492 | Ga0495585_0008486 | Ga0495585_0008486_1272_2459 | 395 |
| 19 | 3300046506 | Ga0495583_0008244 | Ga0495583_0008244_4171_5358 | 395 |
| 20 | 3300046518 | Ga0495631_0008860 | Ga0495631_0008860_406_1593 | 395 |
| 21 | 3300046519 | Ga0495632_0017464 | Ga0495632_0017464_2464_3651 | 395 |
| 22 | 3300046538 | Ga0495609_0009714 | Ga0495609_0009714_945_2132 | 395 |
| 23 | 3300046616 | Ga0495668_0012665 | Ga0495668_0012665_416_1603 | 395 |
| 24 | 3300046648 | Ga0495611_0044067 | Ga0495611_0044067_438_1625 | 395 |
| 25 | 3300046660 | Ga0495625_0002886 | Ga0495625_0002886_3918_5105 | 395 |
| 26 | 3300046691 | Ga0495670_0012821 | Ga0495670_0012821_1273_2460 | 395 |
| 27 | 3300047320 | Ga0495672_0020029 | Ga0495672_0020029_96_1283 | 395 |
| 28 | 3300049459 | Ga0495678_007689 | Ga0495678_007689_54_1241 | 395 |
| 29 | 3300053105 | Ga0500557_000186 | Ga0500557_000186_480_1667 | 395 |
| 30 | 3300053109 | Ga0500569_002358 | Ga0500569_002358_855_2042 | 395 |
| 31 | 3300053139 | Ga0500568_0001438 | Ga0500568_0001438_6192_7379 | 395 |
| 32 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_1403_2590 | 395 |
| 33 | 3300009093 | Ga0105240_10001501 | Ga0105240_1000150121 | 401 |
| 34 | 3300009545 | Ga0105237_10001025 | Ga0105237_1000102516 | 401 |
| 35 | 3300010375 | Ga0105239_10003993 | Ga0105239_100039934 | 401 |
| 36 | 3300025913 | Ga0207695_10007442 | Ga0207695_100074429 | 401 |
| 37 | 3300025914 | Ga0207671_10002499 | Ga0207671_100024996 | 401 |
| 38 | 3300044712 | Ga0453684_0000384 | Ga0453684_0000384_108504_109787 | 402 |
| 39 | 3300046616 | Ga0495668_0042820 | Ga0495668_0042820_24_1274 | 402 |
| 40 | 3300031456 | Ga0307513_10071511 | Ga0307513_100715113 | 405 |
| 41 | 3300007788 | Ga0099795_10001054 | Ga0099795_100010541 | 407 |
| 42 | 3300009093 | Ga0105240_10006622 | Ga0105240_100066225 | 407 |
| 43 | 3300010375 | Ga0105239_10038584 | Ga0105239_100385842 | 407 |
| 44 | 3300025913 | Ga0207695_10011351 | Ga0207695_100113513 | 407 |
| 45 | 3300048903 | Ga0496100_0016467 | Ga0496100_0016467_2046_3296 | 407 |
| 46 | 3300059421 | Ga0590071_003668 | Ga0590071_003668_1497_2786 | 407 |
| 47 | 3300059423 | Ga0590074_001806 | Ga0590074_001806_160_1449 | 407 |
| 48 | 3300005530 | Ga0070679_100143222 | Ga0070679_1001432222 | 408 |
| 49 | 3300013105 | Ga0157369_10056003 | Ga0157369_100560034 | 408 |
| 50 | 3300025909 | Ga0207705_10159180 | Ga0207705_101591802 | 408 |
| 51 | 3300048915 | Ga0496112_0131072 | Ga0496112_0131072_426_1652 | 408 |
| 52 | 3300035111 | Ga0373923_0036395 | Ga0373923_0036395_425_1669 | 409 |
| 53 | 3300035170 | Ga0373943_0095202 | Ga0373943_0095202_178_1422 | 409 |
| 54 | iso_pu_bacteria | 2849573788 | 2849574355 | 409 |
| 55 | 3300032133 | Ga0316583_10000343 | Ga0316583_100003433 | 411 |
| 56 | 3300053085 | Ga0495619_0070284 | Ga0495619_0070284_909_2165 | 411 |
| 57 | 3300009093 | Ga0105240_10000303 | Ga0105240_100003037 | 412 |
| 58 | 3300009551 | Ga0105238_10085477 | Ga0105238_100854772 | 412 |
| 59 | 3300025913 | Ga0207695_10000396 | Ga0207695_1000039613 | 412 |
| 60 | 3300025924 | Ga0207694_10053096 | Ga0207694_100530963 | 412 |
| 61 | 3300028794 | Ga0307515_10000037 | Ga0307515_1000003731 | 412 |
| 62 | 3300053735 | Ga0500596_000801 | Ga0500596_000801_1199_2437 | 412 |
| 63 | 3300009147 | Ga0114129_10503250 | Ga0114129_105032501 | 413 |
| 64 | 3300032168 | Ga0316593_10033970 | Ga0316593_100339701 | 413 |
| 65 | 3300053153 | Ga0500616_0001878 | Ga0500616_0001878_2606_3871 | 413 |
| 66 | 3300005329 | Ga0070683_100059459 | Ga0070683_1000594593 | 414 |
| 67 | 3300005331 | Ga0070670_100048507 | Ga0070670_1000485072 | 414 |
| 68 | 3300005334 | Ga0068869_100027845 | Ga0068869_1000278453 | 414 |
| 69 | 3300005338 | Ga0068868_100057650 | Ga0068868_1000576501 | 414 |
| 70 | 3300005355 | Ga0070671_100153908 | Ga0070671_1001539082 | 414 |
| 71 | 3300005456 | Ga0070678_100141730 | Ga0070678_1001417301 | 414 |
| 72 | 3300005458 | Ga0070681_10197507 | Ga0070681_101975072 | 414 |
| 73 | 3300005459 | Ga0068867_100044345 | Ga0068867_1000443452 | 414 |
| 74 | 3300005530 | Ga0070679_100044152 | Ga0070679_1000441522 | 414 |
| 75 | 3300005530 | Ga0070679_100116282 | Ga0070679_1001162825 | 414 |
| 76 | 3300005535 | Ga0070684_100101358 | Ga0070684_1001013583 | 414 |
| 77 | 3300005563 | Ga0068855_100009287 | Ga0068855_10000928712 | 414 |
| 78 | 3300005563 | Ga0068855_100035528 | Ga0068855_1000355285 | 414 |
| 79 | 3300005564 | Ga0070664_100046830 | Ga0070664_1000468303 | 414 |
| 80 | 3300005577 | Ga0068857_100022190 | Ga0068857_1000221903 | 414 |
| 81 | 3300005578 | Ga0068854_100020354 | Ga0068854_1000203543 | 414 |
| 82 | 3300005578 | Ga0068854_100132999 | Ga0068854_1001329991 | 414 |
| 83 | 3300005614 | Ga0068856_100006003 | Ga0068856_1000060032 | 414 |
| 84 | 3300005617 | Ga0068859_100045101 | Ga0068859_1000451014 | 414 |
| 85 | 3300005618 | Ga0068864_100012024 | Ga0068864_1000120242 | 414 |
| 86 | 3300005718 | Ga0068866_10013770 | Ga0068866_100137702 | 414 |
| 87 | 3300005841 | Ga0068863_100005208 | Ga0068863_1000052086 | 414 |
| 88 | 3300005841 | Ga0068863_100249790 | Ga0068863_1002497901 | 414 |
| 89 | 3300005842 | Ga0068858_100009988 | Ga0068858_1000099888 | 414 |
| 90 | 3300006237 | Ga0097621_100000524 | Ga0097621_1000005246 | 414 |
| 91 | 3300006237 | Ga0097621_100030526 | Ga0097621_1000305264 | 414 |
| 92 | 3300006358 | Ga0068871_100000136 | Ga0068871_10000013625 | 414 |
| 93 | 3300006881 | Ga0068865_100075738 | Ga0068865_1000757382 | 414 |
| 94 | 3300006931 | Ga0097620_100045101 | Ga0097620_1000451014 | 414 |
| 95 | 3300009177 | Ga0105248_10001757 | Ga0105248_100017574 | 414 |
| 96 | 3300009177 | Ga0105248_10047713 | Ga0105248_100477133 | 414 |
| 97 | 3300010375 | Ga0105239_10016488 | Ga0105239_100164884 | 414 |
| 98 | 3300013296 | Ga0157374_10001350 | Ga0157374_100013506 | 414 |
| 99 | 3300013297 | Ga0157378_10000419 | Ga0157378_100004192 | 414 |
| 100 | 3300013297 | Ga0157378_10024878 | Ga0157378_100248784 | 414 |
| 101 | 3300013307 | Ga0157372_10000216 | Ga0157372_1000021616 | 414 |
| 102 | 3300013307 | Ga0157372_10068688 | Ga0157372_100686882 | 414 |
| 103 | 3300014969 | Ga0157376_10011012 | Ga0157376_100110125 | 414 |
| 104 | 3300025899 | Ga0207642_10009661 | Ga0207642_100096612 | 414 |
| 105 | 3300025912 | Ga0207707_10087468 | Ga0207707_100874681 | 414 |
| 106 | 3300025921 | Ga0207652_10077293 | Ga0207652_100772932 | 414 |
| 107 | 3300025931 | Ga0207644_10103088 | Ga0207644_101030882 | 414 |
| 108 | 3300025938 | Ga0207704_10127195 | Ga0207704_101271951 | 414 |
| 109 | 3300025941 | Ga0207711_10187938 | Ga0207711_101879382 | 414 |
| 110 | 3300025942 | Ga0207689_10089450 | Ga0207689_100894502 | 414 |
| 111 | 3300025949 | Ga0207667_10025197 | Ga0207667_100251972 | 414 |
| 112 | 3300025949 | Ga0207667_10064607 | Ga0207667_100646073 | 414 |
| 113 | 3300025981 | Ga0207640_10026011 | Ga0207640_100260112 | 414 |
| 114 | 3300025981 | Ga0207640_10154302 | Ga0207640_101543022 | 414 |
| 115 | 3300026023 | Ga0207677_10075156 | Ga0207677_100751562 | 414 |
| 116 | 3300026078 | Ga0207702_10007624 | Ga0207702_100076244 | 414 |
| 117 | 3300026078 | Ga0207702_10127145 | Ga0207702_101271451 | 414 |
| 118 | 3300026088 | Ga0207641_10003445 | Ga0207641_100034452 | 414 |
| 119 | 3300026089 | Ga0207648_10147367 | Ga0207648_101473672 | 414 |
| 120 | 3300026116 | Ga0207674_10007768 | Ga0207674_100077689 | 414 |
| 121 | 3300028381 | Ga0268264_10222971 | Ga0268264_102229711 | 414 |
| 122 | 3300048915 | Ga0496112_0048343 | Ga0496112_0048343_1881_3134 | 414 |
| 123 | 3300003320 | rootH2_10015861 | rootH2_1001586113 | 415 |
| 124 | 3300005445 | Ga0070708_100021620 | Ga0070708_1000216205 | 415 |
| 125 | 3300005518 | Ga0070699_100017149 | Ga0070699_1000171494 | 415 |
| 126 | 3300006847 | Ga0075431_100023488 | Ga0075431_1000234886 | 415 |
| 127 | 3300007788 | Ga0099795_10001521 | Ga0099795_100015214 | 415 |
| 128 | 3300025939 | Ga0207665_10076091 | Ga0207665_100760912 | 415 |
| 129 | 3300031507 | Ga0307509_10024091 | Ga0307509_100240916 | 415 |
| 130 | 3300031595 | Ga0265313_10002414 | Ga0265313_1000241420 | 415 |
| 131 | 3300046524 | Ga0495648_0006468 | Ga0495648_0006468_7127_8392 | 415 |
| 132 | 3300050510 | nmdc:mga06r32_10658_c2 | nmdc:mga06r32_10658_c2_2925_4187 | 415 |
| 133 | 3300053091 | Ga0500647_0050805 | Ga0500647_0050805_204_1463 | 415 |
| 134 | 3300053094 | Ga0500566_0000190 | Ga0500566_0000190_30124_31383 | 415 |
| 135 | 3300053095 | Ga0500640_000028 | Ga0500640_000028_14157_15416 | 415 |
| 136 | 3300053111 | Ga0500572_000447 | Ga0500572_000447_12608_13867 | 415 |
| 137 | 3300053115 | Ga0500591_038335 | Ga0500591_038335_921_2180 | 415 |
| 138 | 3300053123 | Ga0500614_000953 | Ga0500614_000953_5295_6554 | 415 |
| 139 | 3300053150 | Ga0500603_000065 | Ga0500603_000065_510_1769 | 415 |
| 140 | 3300053162 | Ga0500638_023728 | Ga0500638_023728_1184_2443 | 415 |
| 141 | 3300053163 | Ga0500639_000003 | Ga0500639_000003_205683_206942 | 415 |
| 142 | 3300053178 | Ga0500637_0063283 | Ga0500637_0063283_96_1355 | 415 |
| 143 | 3300053735 | Ga0500596_000130 | Ga0500596_000130_5942_7201 | 415 |
| 144 | iso_pu_bacteria | 2513237140 | 2513886182 | 415 |
| 145 | iso_pu_bacteria | 2515154107 | 2515613492 | 415 |
| 146 | iso_pu_bacteria | 2791355091 | 2792625027 | 415 |
| 147 | iso_pu_bacteria | 2791355092 | 2792630558 | 415 |
| 148 | iso_pu_bacteria | 8016583857 | 8016593945 | 415 |
| 149 | 3300005340 | Ga0070689_100087279 | Ga0070689_1000872791 | 416 |
| 150 | 3300005457 | Ga0070662_100014751 | Ga0070662_1000147513 | 416 |
| 151 | 3300005544 | Ga0070686_100000049 | Ga0070686_10000004965 | 416 |
| 152 | 3300005563 | Ga0068855_100059220 | Ga0068855_1000592203 | 416 |
| 153 | 3300009093 | Ga0105240_10006223 | Ga0105240_100062238 | 416 |
| 154 | 3300010159 | Ga0099796_10005125 | Ga0099796_100051253 | 416 |
| 155 | 3300013105 | Ga0157369_10001324 | Ga0157369_1000132410 | 416 |
| 156 | 3300025929 | Ga0207664_10035331 | Ga0207664_100353314 | 416 |
| 157 | 3300025933 | Ga0207706_10025680 | Ga0207706_100256805 | 416 |
| 158 | 3300025949 | Ga0207667_10090370 | Ga0207667_100903702 | 416 |
| 159 | 3300028653 | Ga0265323_10021452 | Ga0265323_100214523 | 416 |
| 160 | 3300031235 | Ga0265330_10023928 | Ga0265330_100239282 | 416 |
| 161 | 3300031344 | Ga0265316_10000428 | Ga0265316_1000042819 | 416 |
| 162 | 3300031712 | Ga0265342_10014950 | Ga0265342_100149502 | 416 |
| 163 | iso_pu_bacteria | 2824609381 | 2824609561 | 416 |
| 164 | iso_pu_bacteria | 2824653114 | 2824653765 | 416 |
| 165 | iso_pu_bacteria | 2935630451 | 2935637252 | 416 |
| 166 | iso_pu_bacteria | 2941507105 | 2941513890 | 416 |
| 167 | iso_pu_bacteria | 2941515067 | 2941521851 | 416 |
| 168 | iso_pu_bacteria | 2941523033 | 2941529520 | 416 |
| 169 | iso_pu_bacteria | 8019555841 | 8019564727 | 416 |
| 170 | iso_pu_bacteria | 8019565922 | 8019574824 | 416 |
| 171 | 3300005530 | Ga0070679_100008346 | Ga0070679_1000083462 | 417 |
| 172 | 3300028794 | Ga0307515_10001129 | Ga0307515_1000112923 | 417 |
| 173 | 3300028794 | Ga0307515_10001129 | Ga0307515_100011293 | 417 |
| 174 | 3300033180 | Ga0307510_10041335 | Ga0307510_100413352 | 417 |
| 175 | iso_pu_bacteria | 2510917028 | 2511182975 | 417 |
| 176 | iso_pu_bacteria | 2513237144 | 2513913446 | 417 |
| 177 | iso_pu_bacteria | 2585427590 | 2585820118 | 417 |
| 178 | iso_pu_bacteria | 2585428057 | 2587729339 | 417 |
| 179 | iso_pu_bacteria | 2585428062 | 2587756523 | 417 |
| 180 | iso_pu_bacteria | 2643221607 | 2644047775 | 417 |
| 181 | iso_pu_bacteria | 2643221686 | 2644481937 | 417 |
| 182 | iso_pu_bacteria | 2838661181 | 2838665715 | 417 |
| 183 | 3300005437 | Ga0070710_10101276 | Ga0070710_101012762 | 418 |
| 184 | 3300005458 | Ga0070681_10024628 | Ga0070681_100246287 | 418 |
| 185 | 3300006844 | Ga0075428_100124763 | Ga0075428_1001247632 | 418 |
| 186 | 3300006852 | Ga0075433_10187662 | Ga0075433_101876621 | 418 |
| 187 | 3300009094 | Ga0111539_10012053 | Ga0111539_100120533 | 418 |
| 188 | 3300009147 | Ga0114129_10104722 | Ga0114129_101047224 | 418 |
| 189 | 3300031733 | Ga0316577_10143849 | Ga0316577_101438491 | 418 |
| 190 | 3300031995 | Ga0307409_100081801 | Ga0307409_1000818012 | 418 |
| 191 | 3300032002 | Ga0307416_100125260 | Ga0307416_1001252603 | 418 |
| 192 | 3300036712 | Ga0316584_0134469 | Ga0316584_0134469_540_1802 | 418 |
| 193 | 3300037418 | Ga0395900_0008882 | Ga0395900_0008882_3079_4356 | 418 |
| 194 | 3300038443 | Ga0395901_0004940 | Ga0395901_0004940_9084_10361 | 418 |
| 195 | 3300050515 | nmdc:mga0a205_201217_c1 | nmdc:mga0a205_201217_c1_123_1400 | 418 |
| 196 | iso_pu_bacteria | 2522572158 | 2523107446 | 418 |
| 197 | 2162886006 | SwRhRL3b_contig_3740212 | SwRhRL3b_0673.00000410 | 419 |
| 198 | 3300001979 | JGI24740J21852_10005000 | JGI24740J21852_100050002 | 419 |
| 199 | 3300003323 | rootH1_10019968 | rootH1_100199684 | 419 |
| 200 | 3300005262 | Ga0065165_1000998 | Ga0065165_100099818 | 419 |
| 201 | 3300005295 | Ga0065707_10084205 | Ga0065707_100842056 | 419 |
| 202 | 3300005344 | Ga0070661_100022658 | Ga0070661_1000226584 | 419 |
| 203 | 3300005355 | Ga0070671_100011900 | Ga0070671_1000119003 | 419 |
| 204 | 3300005364 | Ga0070673_100107829 | Ga0070673_1001078293 | 419 |
| 205 | 3300005457 | Ga0070662_100184114 | Ga0070662_1001841141 | 419 |
| 206 | 3300005539 | Ga0068853_100063775 | Ga0068853_1000637753 | 419 |
| 207 | 3300006353 | Ga0075370_10027012 | Ga0075370_100270123 | 419 |
| 208 | 3300006844 | Ga0075428_100099774 | Ga0075428_1000997742 | 419 |
| 209 | 3300006844 | Ga0075428_100158607 | Ga0075428_1001586072 | 419 |
| 210 | 3300006846 | Ga0075430_100048210 | Ga0075430_1000482103 | 419 |
| 211 | 3300006846 | Ga0075430_100111804 | Ga0075430_1001118042 | 419 |
| 212 | 3300006847 | Ga0075431_100089957 | Ga0075431_1000899572 | 419 |
| 213 | 3300006847 | Ga0075431_100300879 | Ga0075431_1003008792 | 419 |
| 214 | 3300006880 | Ga0075429_100058801 | Ga0075429_1000588012 | 419 |
| 215 | 3300006880 | Ga0075429_100147766 | Ga0075429_1001477661 | 419 |
| 216 | 3300009093 | Ga0105240_10047004 | Ga0105240_100470043 | 419 |
| 217 | 3300009093 | Ga0105240_10073434 | Ga0105240_100734343 | 419 |
| 218 | 3300009545 | Ga0105237_10020826 | Ga0105237_100208266 | 419 |
| 219 | 3300009551 | Ga0105238_10005742 | Ga0105238_100057423 | 419 |
| 220 | 3300009553 | Ga0105249_10314751 | Ga0105249_103147511 | 419 |
| 221 | 3300009765 | Ga0123341_1027836 | Ga0123341_10278365 | 419 |
| 222 | 3300009766 | Ga0123342_1036588 | Ga0123342_10365882 | 419 |
| 223 | 3300010159 | Ga0099796_10016150 | Ga0099796_100161502 | 419 |
| 224 | 3300025903 | Ga0207680_10045771 | Ga0207680_100457713 | 419 |
| 225 | 3300025904 | Ga0207647_10071701 | Ga0207647_100717011 | 419 |
| 226 | 3300025913 | Ga0207695_10017334 | Ga0207695_100173345 | 419 |
| 227 | 3300025913 | Ga0207695_10036891 | Ga0207695_100368913 | 419 |
| 228 | 3300025914 | Ga0207671_10016209 | Ga0207671_100162093 | 419 |
| 229 | 3300025920 | Ga0207649_10025322 | Ga0207649_100253224 | 419 |
| 230 | 3300025931 | Ga0207644_10036934 | Ga0207644_100369343 | 419 |
| 231 | 3300028794 | Ga0307515_10092729 | Ga0307515_100927293 | 419 |
| 232 | 3300028800 | Ga0265338_10010454 | Ga0265338_100104545 | 419 |
| 233 | 3300030521 | Ga0307511_10031297 | Ga0307511_100312973 | 419 |
| 234 | 3300031239 | Ga0265328_10010357 | Ga0265328_100103573 | 419 |
| 235 | 3300031507 | Ga0307509_10001996 | Ga0307509_100019968 | 419 |
| 236 | 3300031649 | Ga0307514_10045263 | Ga0307514_100452633 | 419 |
| 237 | 3300031665 | Ga0316575_10043455 | Ga0316575_100434552 | 419 |
| 238 | 3300031691 | Ga0316579_10027033 | Ga0316579_100270332 | 419 |
| 239 | 3300031727 | Ga0316576_10006195 | Ga0316576_100061952 | 419 |
| 240 | 3300031728 | Ga0316578_10003254 | Ga0316578_100032544 | 419 |
| 241 | 3300031733 | Ga0316577_10099802 | Ga0316577_100998022 | 419 |
| 242 | 3300032139 | Ga0316580_10015346 | Ga0316580_100153462 | 419 |
| 243 | 3300033528 | Ga0316588_1002859 | Ga0316588_10028592 | 419 |
| 244 | 3300035119 | Ga0373956_0056037 | Ga0373956_0056037_18_1301 | 419 |
| 245 | 3300035398 | Ga0316574_0014082 | Ga0316574_0014082_828_2108 | 419 |
| 246 | 3300035398 | Ga0316574_0016487 | Ga0316574_0016487_1272_2543 | 419 |
| 247 | 3300035695 | Ga0373927_0002788 | Ga0373927_0002788_10985_12268 | 419 |
| 248 | 3300036647 | Ga0316582_0023982 | Ga0316582_0023982_2260_3540 | 419 |
| 249 | 3300036712 | Ga0316584_0011379 | Ga0316584_0011379_714_1994 | 419 |
| 250 | 3300037312 | Ga0395899_0008099 | Ga0395899_0008099_2216_3508 | 419 |
| 251 | 3300037418 | Ga0395900_0001467 | Ga0395900_0001467_3791_5068 | 419 |
| 252 | 3300037418 | Ga0395900_0036363 | Ga0395900_0036363_1441_2733 | 419 |
| 253 | 3300037466 | Ga0395898_0014314 | Ga0395898_0014314_3431_4711 | 419 |
| 254 | 3300037466 | Ga0395898_0026532 | Ga0395898_0026532_571_1863 | 419 |
| 255 | 3300037471 | Ga0395905_0079196 | Ga0395905_0079196_1141_2421 | 419 |
| 256 | 3300037471 | Ga0395905_0150609 | Ga0395905_0150609_692_1969 | 419 |
| 257 | 3300038443 | Ga0395901_0032639 | Ga0395901_0032639_3499_4791 | 419 |
| 258 | 3300038443 | Ga0395901_0272608 | Ga0395901_0272608_383_1663 | 419 |
| 259 | 3300039062 | Ga0400483_200777 | Ga0400483_200777_319_1596 | 419 |
| 260 | 3300039447 | Ga0436361_0181353 | Ga0436361_0181353_4487_5776 | 419 |
| 261 | 3300044656 | Ga0466969_0023976 | Ga0466969_0023976_1583_2896 | 419 |
| 262 | 3300044684 | Ga0466966_0000877 | Ga0466966_0000877_16805_18118 | 419 |
| 263 | 3300044706 | Ga0466964_0015159 | Ga0466964_0015159_409_1722 | 419 |
| 264 | 3300044735 | Ga0466968_0049472 | Ga0466968_0049472_293_1606 | 419 |
| 265 | 3300045049 | Ga0466959_0071731 | Ga0466959_0071731_110_1423 | 419 |
| 266 | 3300046474 | Ga0495605_0003054 | Ga0495605_0003054_5024_6301 | 419 |
| 267 | 3300046533 | Ga0495640_0055349 | Ga0495640_0055349_11_1303 | 419 |
| 268 | 3300046536 | Ga0495587_0023182 | Ga0495587_0023182_798_2075 | 419 |
| 269 | 3300046690 | Ga0495624_0068362 | Ga0495624_0068362_372_1649 | 419 |
| 270 | 3300046809 | Ga0495600_0027732 | Ga0495600_0027732_253_1530 | 419 |
| 271 | 3300047317 | Ga0495604_0006357 | Ga0495604_0006357_1421_2698 | 419 |
| 272 | 3300047319 | Ga0495674_0073221 | Ga0495674_0073221_662_1954 | 419 |
| 273 | 3300048918 | Ga0496115_0004329 | Ga0496115_0004329_4541_5815 | 419 |
| 274 | 3300049574 | Ga0501038_0002324 | Ga0501038_0002324_171_1448 | 419 |
| 275 | 3300049575 | Ga0501039_0108151 | Ga0501039_0108151_520_1797 | 419 |
| 276 | 3300049576 | Ga0501040_0025652 | Ga0501040_0025652_458_1735 | 419 |
| 277 | 3300049577 | Ga0501041_0026668 | Ga0501041_0026668_252_1529 | 419 |
| 278 | 3300049578 | Ga0501042_0014058 | Ga0501042_0014058_347_1624 | 419 |
| 279 | 3300049581 | Ga0501047_0147255 | Ga0501047_0147255_706_1983 | 419 |
| 280 | 3300049587 | Ga0501071_0134549 | Ga0501071_0134549_146_1423 | 419 |
| 281 | 3300049591 | Ga0501075_0157203 | Ga0501075_0157203_76_1353 | 419 |
| 282 | 3300049742 | Ga0501080_0211225 | Ga0501080_0211225_313_1590 | 419 |
| 283 | 3300049744 | Ga0501083_0171506 | Ga0501083_0171506_76_1353 | 419 |
| 284 | 3300049822 | Ga0501035_0102242 | Ga0501035_0102242_834_2111 | 419 |
| 285 | 3300050489 | nmdc:mga03683_66825_c1 | nmdc:mga03683_66825_c1_187_1482 | 419 |
| 286 | 3300050496 | nmdc:mga07m45_65875_c1 | nmdc:mga07m45_65875_c1_716_1996 | 419 |
| 287 | 3300050508 | nmdc:mga09592_55660_c1 | nmdc:mga09592_55660_c1_911_2203 | 419 |
| 288 | 3300050509 | nmdc:mga0qj67_6021_c1 | nmdc:mga0qj67_6021_c1_7005_8285 | 419 |
| 289 | 3300050509 | nmdc:mga0qj67_7060_c1 | nmdc:mga0qj67_7060_c1_5201_6493 | 419 |
| 290 | 3300050510 | nmdc:mga06r32_65170_c1 | nmdc:mga06r32_65170_c1_893_2185 | 419 |
| 291 | 3300050510 | nmdc:mga06r32_9961_c1 | nmdc:mga06r32_9961_c1_6749_8029 | 419 |
| 292 | 3300053077 | Ga0495601_0065703 | Ga0495601_0065703_742_2019 | 419 |
| 293 | 3300053086 | Ga0500578_0000104 | Ga0500578_0000104_41798_43078 | 419 |
| 294 | 3300053130 | Ga0500642_0051960 | Ga0500642_0051960_56_1339 | 419 |
| 295 | 3300053139 | Ga0500568_0008504 | Ga0500568_0008504_859_2172 | 419 |
| 296 | 3300053148 | Ga0500590_002026 | Ga0500590_002026_6806_8083 | 419 |
| 297 | 3300053148 | Ga0500590_006155 | Ga0500590_006155_2936_4228 | 419 |
| 298 | 3300053160 | Ga0500633_0000072 | Ga0500633_0000072_11946_13223 | 419 |
| 299 | 3300054114 | Ga0501084_0199194 | Ga0501084_0199194_210_1487 | 419 |
| 300 | 3300061719 | Ga0466962_0004224 | Ga0466962_0004224_1385_2698 | 419 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vkb-assembly1.cif.gz_A | crystal structure of the a bacterial kinase complex | 0.7937 | 180 | 406 |
| 7ab5-assembly1.cif.gz_F | crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt d233q) | 0.7878 | 170 | 413 |
| 7ab4-assembly1.cif.gz_C | crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt s59a) | 0.768 | 170 | 413 |
| 7ab3-assembly1.cif.gz_F | crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt s57a) | 0.7623 | 168 | 408 |
| 4yg7-assembly1.cif.gz_K | structure of fl autorepression promoter complex | 0.7536 | 6 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3akjB01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.8826 | 177 | 241 | 3.30.200.120 |
| af_F8W2L7_1_101_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8607 | 19 | 41 | 2.60.200.20 |
| 3aklB01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.8547 | 172 | 237 | 3.30.200.120 |
| 3jr1B01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7305 | 172 | 235 | 3.30.200.20 |
| 3akjB01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; | 0.7286 | 177 | 241 | 3.30.200.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H6J9R0-F1-model_v4 | Putative DNA-binding transcriptional regulator | 0.9949 | 208 | 419 |
GO:0003677
GO:0004674 GO:0005829 |
| AF-X1M7F7-F1-model_v4 | HipA-like C-terminal domain-containing protein | 0.9929 | 187 | 417 |
GO:0004674
GO:0005829 |
| AF-A0A0R3M6Q1-F1-model_v4 | HipA-like C-terminal domain-containing protein | 0.9858 | 267 | 416 |
GO:0004674
GO:0005829 |
| AF-A0A6L8GCT7-F1-model_v4 | Type II toxin-antitoxin system HipA family toxin | 0.9858 | 4 | 107 |
|
| AF-A0A4Q4AQ82-F1-model_v4 | deleted | 0.9853 | 248 | 418 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar