F395135

General Info

Members Datasets Scaffolds Average Seq Length
300 228 272 418

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10005000|JGI24740J21852_100050002
Length 455
Sequence MTSEAPGECFVYITLPGTIEPVTAGRFALSVDRRGVPEGRFVYGRSYLERPNAVALDPVELKLSPRTYATAALNGVFGALRDASPDYWGRRVIQRHLGKAQPGEMEYLLYSPDDRAGALGFGLNQVPPAPKRSFNQTLELAKVQAIADSIVADEDQLEGDQRSATDDRGDHHHDRDQVEKLMVIGTSMGGARPKAVVEDEAGLWIAKFNRPDDAWNSARVEHAMLVLARACGLTTAESRVTDVAGRDVLLVKRFDREKAEGGYLRARMISALTLLRTEDTFRSRDRWSYVLLAEELRRVSAVPGTDAAELFRRMAFNALISNIDDHPRNHALIARDAEWRLSPAYDLTPAVPVSLERRDLAMECGDAGRFANAGNLLSQSPRFLLEPGEAAAMLDAMEAQVASTWYATARGAGVSERDCERIAPAFAYPGFRQASDHNGTTLRPRILVNQEDRWG

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
6 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
7 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
8 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2643221607 Rhizobium sp. Root73 Isolate Unclassified
11 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
12 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
13 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
14 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
19 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
20 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
21 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
75 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
207 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
208 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
227 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
228 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.33
Metatranscriptomes 0.67
Isolates 9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 6.33
Rhizoplane 1.33
Rhizosphere 76.67
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3740212 2162886006 Bacteria 1803
2 JGI24740J21852_10005000 3300001979 Bacteria 5630
3 rootH2_10015861 3300003320 Bacteria 15267
4 rootH1_10019968 3300003323 Bacteria 3078
5 Ga0065165_1000998 3300005262 Bacteria 34892
6 Ga0065707_10084205 3300005295 Bacteria 7526
7 Ga0070683_100059459 3300005329 Bacteria 3551
8 Ga0070670_100048507 3300005331 Bacteria 3654
9 Ga0068869_100027845 3300005334 Bacteria 3943
10 Ga0068868_100057650 3300005338 Bacteria 3069
11 Ga0070689_100087279 3300005340 Bacteria 2454
12 Ga0070661_100022658 3300005344 Bacteria 4498
13 Ga0070671_100011900 3300005355 Bacteria 6997
14 Ga0070671_100153908 3300005355 Bacteria 1942
15 Ga0070673_100107829 3300005364 Bacteria 2305
16 Ga0070710_10101276 3300005437 Bacteria 1716
17 Ga0070708_100021620 3300005445 Bacteria 5443
18 Ga0070678_100141730 3300005456 Bacteria 1924
19 Ga0070662_100014751 3300005457 Bacteria 5223
20 Ga0070662_100184114 3300005457 Bacteria 1648
21 Ga0070681_10024628 3300005458 Bacteria 6055
22 Ga0070681_10197507 3300005458 Bacteria 1930
23 Ga0068867_100044345 3300005459 Bacteria 3258
24 Ga0070699_100017149 3300005518 Bacteria 6219
25 Ga0070679_100008346 3300005530 Bacteria 9745
26 Ga0070679_100044152 3300005530 Bacteria 4441
27 Ga0070679_100116282 3300005530 Bacteria 2659
28 Ga0070679_100143222 3300005530 Bacteria 2369
29 Ga0070684_100101358 3300005535 Bacteria 2573
30 Ga0068853_100063775 3300005539 Bacteria 3192
31 Ga0070686_100000049 3300005544 Bacteria 98216
32 Ga0068855_100009287 3300005563 Bacteria 11877
33 Ga0068855_100035528 3300005563 Bacteria 5935
34 Ga0068855_100059220 3300005563 Bacteria 4482
35 Ga0070664_100046830 3300005564 Bacteria 3653
36 Ga0068857_100022190 3300005577 Bacteria 5584
37 Ga0068854_100020354 3300005578 Bacteria 4488
38 Ga0068854_100132999 3300005578 Bacteria 1901
39 Ga0068856_100006003 3300005614 Bacteria 11952
40 Ga0068859_100045101 3300005617 Bacteria 4430
41 Ga0068864_100012024 3300005618 Bacteria 7148
42 Ga0068866_10013770 3300005718 Bacteria 3556
43 Ga0068863_100005208 3300005841 Bacteria 12836
44 Ga0068863_100249790 3300005841 Unclassified 1713
45 Ga0068858_100009988 3300005842 Bacteria 9015
46 Ga0097621_100000524 3300006237 Bacteria 26915
47 Ga0097621_100030526 3300006237 Bacteria 4267
48 Ga0075370_10027012 3300006353 Bacteria 3183
49 Ga0068871_100000136 3300006358 Bacteria 47129
50 Ga0075428_100099774 3300006844 Plasmid 3166
51 Ga0075428_100124763 3300006844 Bacteria 2802
52 Ga0075428_100158607 3300006844 Bacteria 2456
53 Ga0075430_100048210 3300006846 Bacteria 3596
54 Ga0075430_100111804 3300006846 Bacteria 2277
55 Ga0075431_100023488 3300006847 Bacteria 6309
56 Ga0075431_100089957 3300006847 Bacteria 3168
57 Ga0075431_100300879 3300006847 Bacteria 1620
58 Ga0075433_10187662 3300006852 Bacteria 1839
59 Ga0075429_100058801 3300006880 Plasmid 3348
60 Ga0075429_100147766 3300006880 Bacteria 2057
61 Ga0068865_100075738 3300006881 Bacteria 2400
62 Ga0097620_100045101 3300006931 Bacteria 4430
63 Ga0099795_10001054 3300007788 Bacteria 5687
64 Ga0099795_10001521 3300007788 Bacteria 5075
65 Ga0105240_10000303 3300009093 Bacteria 95509
66 Ga0105240_10001501 3300009093 Bacteria 39739
67 Ga0105240_10006223 3300009093 Bacteria 17556
68 Ga0105240_10006622 3300009093 Bacteria 17007
69 Ga0105240_10047004 3300009093 Bacteria 5463
70 Ga0105240_10073434 3300009093 Bacteria 4224
71 Ga0111539_10012053 3300009094 Bacteria 10843
72 Ga0111539_10143376 3300009094 Bacteria 2796
73 Ga0114129_10104722 3300009147 Bacteria 3910
74 Ga0114129_10503250 3300009147 Unclassified 1582
75 Ga0105248_10001757 3300009177 Bacteria 24112
76 Ga0105248_10047713 3300009177 Bacteria 4803
77 Ga0105237_10001025 3300009545 Bacteria 37594
78 Ga0105237_10020826 3300009545 Bacteria 6753
79 Ga0105238_10005742 3300009551 Bacteria 12273
80 Ga0105238_10085477 3300009551 Bacteria 3142
81 Ga0105249_10314751 3300009553 Unclassified 1575
82 Ga0123341_1027836 3300009765 Bacteria 4403
83 Ga0123342_1036588 3300009766 Bacteria 2018
84 Ga0099796_10005125 3300010159 Bacteria 3243
85 Ga0099796_10016150 3300010159 Bacteria 2199
86 Ga0105239_10003993 3300010375 Bacteria 17866
87 Ga0105239_10016488 3300010375 Bacteria 8172
88 Ga0105239_10038584 3300010375 Bacteria 5235
89 Ga0157369_10001324 3300013105 Bacteria 30678
90 Ga0157369_10056003 3300013105 Bacteria 4255
91 Ga0157374_10001350 3300013296 Bacteria 20892
92 Ga0157378_10000419 3300013297 Bacteria 41780
93 Ga0157378_10024878 3300013297 Bacteria 5273
94 Ga0157372_10000216 3300013307 Bacteria 63844
95 Ga0157372_10068688 3300013307 Bacteria 3984
96 Ga0157376_10011012 3300014969 Bacteria 6646
97 Ga0207642_10009661 3300025899 Bacteria 3366
98 Ga0207680_10045771 3300025903 Bacteria 2582
99 Ga0207647_10071701 3300025904 Unclassified 2090
100 Ga0207705_10159180 3300025909 Bacteria 1696
101 Ga0207707_10087468 3300025912 Bacteria 2723
102 Ga0207695_10000396 3300025913 Bacteria 98138
103 Ga0207695_10007442 3300025913 Bacteria 13935
104 Ga0207695_10011351 3300025913 Bacteria 10797
105 Ga0207695_10017334 3300025913 Bacteria 8384
106 Ga0207695_10036891 3300025913 Bacteria 5278
107 Ga0207671_10002499 3300025914 Bacteria 19623
108 Ga0207671_10016209 3300025914 Bacteria 5801
109 Ga0207649_10025322 3300025920 Plasmid 3458
110 Ga0207652_10077293 3300025921 Bacteria 2904
111 Ga0207694_10053096 3300025924 Bacteria 3142
112 Ga0207664_10035331 3300025929 Unclassified 3856
113 Ga0207644_10036934 3300025931 Bacteria 3432
114 Ga0207644_10103088 3300025931 Bacteria 2147
115 Ga0207706_10025680 3300025933 Bacteria 5277
116 Ga0207704_10127195 3300025938 Bacteria 1757
117 Ga0207665_10076091 3300025939 Bacteria 2301
118 Ga0207711_10187938 3300025941 Bacteria 1882
119 Ga0207689_10089450 3300025942 Bacteria 2529
120 Ga0207667_10025197 3300025949 Bacteria 6516
121 Ga0207667_10064607 3300025949 Bacteria 3819
122 Ga0207667_10090370 3300025949 Plasmid 3165
123 Ga0207640_10026011 3300025981 Bacteria 3549
124 Ga0207640_10154302 3300025981 Bacteria 1691
125 Ga0207677_10075156 3300026023 Bacteria 2400
126 Ga0207702_10007624 3300026078 Bacteria 9210
127 Ga0207702_10127145 3300026078 Bacteria 2289
128 Ga0207641_10003445 3300026088 Bacteria 14010
129 Ga0207648_10147367 3300026089 Bacteria 2076
130 Ga0207674_10007768 3300026116 Bacteria 12478
131 Ga0268264_10222971 3300028381 Bacteria 1736
132 Ga0265323_10021452 3300028653 Unclassified 2474
133 Ga0307515_10000037 3300028794 Bacteria 331970
134 Ga0307515_10001129 3300028794 Bacteria 61098
135 Ga0307515_10092729 3300028794 Bacteria 3755
136 Ga0265338_10010454 3300028800 Bacteria 10878
137 Ga0307511_10031297 3300030521 Bacteria 4757
138 Ga0265330_10023928 3300031235 Plasmid 2771
139 Ga0265328_10010357 3300031239 Bacteria 3757
140 Ga0265316_10000428 3300031344 Bacteria 47855
141 Ga0307513_10071511 3300031456 Bacteria 3620
142 Ga0307509_10000023 3300031507 Bacteria 242310
143 Ga0307509_10001996 3300031507 Bacteria 33693
144 Ga0307509_10024091 3300031507 Bacteria 6821
145 Ga0265313_10002414 3300031595 Bacteria 16162
146 Ga0307514_10045263 3300031649 Bacteria 3444
147 Ga0316575_10043455 3300031665 Unclassified 1781
148 Ga0316579_10027033 3300031691 Bacteria 2602
149 Ga0265342_10014950 3300031712 Bacteria 5128
150 Ga0316576_10006195 3300031727 Bacteria 7424
151 Ga0316578_10003254 3300031728 Bacteria 7378
152 Ga0316577_10099802 3300031733 Unclassified 1627
153 Ga0316577_10143849 3300031733 Bacteria 1343
154 Ga0307409_100081801 3300031995 Unclassified 2612
155 Ga0307416_100125260 3300032002 Bacteria 2300
156 Ga0316583_10000343 3300032133 Bacteria 13277
157 Ga0316580_10015346 3300032139 Bacteria 2343
158 Ga0316593_10033970 3300032168 Unclassified 1672
159 Ga0307510_10041335 3300033180 Bacteria 5043
160 Ga0316588_1002859 3300033528 Bacteria 3067
161 Ga0373923_0036395 3300035111 Bacteria 2009
162 Ga0373956_0056037 3300035119 Bacteria 1779
163 Ga0373943_0095202 3300035170 Bacteria 1548
164 Ga0373955_0013913 3300035172 Bacteria 3904
165 Ga0316574_0014082 3300035398 Bacteria 4613
166 Ga0316574_0016487 3300035398 Plasmid 4307
167 Ga0373927_0002788 3300035695 Bacteria 12758
168 Ga0316582_0023982 3300036647 Bacteria 3643
169 Ga0316584_0011379 3300036712 Bacteria 6250
170 Ga0316584_0134469 3300036712 Bacteria 1846
171 Ga0395899_0008099 3300037312 Bacteria 8093
172 Ga0395900_0001467 3300037418 Bacteria 28145
173 Ga0395900_0008882 3300037418 Bacteria 10318
174 Ga0395900_0036363 3300037418 Bacteria 5076
175 Ga0395898_0014314 3300037466 Bacteria 8152
176 Ga0395898_0026532 3300037466 Bacteria 5826
177 Ga0395905_0079196 3300037471 Bacteria 3079
178 Ga0395905_0150609 3300037471 Unclassified 2189
179 Ga0395901_0004940 3300038443 Bacteria 13459
180 Ga0395901_0032639 3300038443 Bacteria 5370
181 Ga0395901_0272608 3300038443 Unclassified 1759
182 Ga0400483_200777 3300039062 Bacteria 1698
183 Ga0436361_0181353 3300039447 Bacteria 6179
184 Ga0466969_0023976 3300044656 Bacteria 3140
185 Ga0466966_0000877 3300044684 Bacteria 19195
186 Ga0466964_0015159 3300044706 Bacteria 2933
187 Ga0453684_0000384 3300044712 Bacteria 181189
188 Ga0466968_0049472 3300044735 Bacteria 1791
189 Ga0466959_0071731 3300045049 Bacteria 2507
190 Ga0495580_0119861 3300046472 Bacteria 1827
191 Ga0495605_0003054 3300046474 Bacteria 10101
192 Ga0495584_0086124 3300046491 Bacteria 1583
193 Ga0495585_0008486 3300046492 Bacteria 6224
194 Ga0495583_0008244 3300046506 Bacteria 6392
195 Ga0495631_0008860 3300046518 Bacteria 5050
196 Ga0495632_0017464 3300046519 Bacteria 3958
197 Ga0495643_0008846 3300046522 Bacteria 6339
198 Ga0495648_0006468 3300046524 Bacteria 9559
199 Ga0495640_0055349 3300046533 Bacteria 2714
200 Ga0495587_0023182 3300046536 Bacteria 3816
201 Ga0495609_0009714 3300046538 Bacteria 4641
202 Ga0495668_0012665 3300046616 Bacteria 4997
203 Ga0495668_0042820 3300046616 Bacteria 2520
204 Ga0495611_0044067 3300046648 Bacteria 1995
205 Ga0495625_0002886 3300046660 Bacteria 17968
206 Ga0495625_0067522 3300046660 Bacteria 2516
207 Ga0495624_0068362 3300046690 Bacteria 2215
208 Ga0495670_0012821 3300046691 Bacteria 4120
209 Ga0495649_0068431 3300046694 Bacteria 1905
210 Ga0495600_0027732 3300046809 Bacteria 3660
211 Ga0495660_0114513 3300046810 Bacteria 1372
212 Ga0495604_0006357 3300047317 Bacteria 9367
213 Ga0495674_0073221 3300047319 Plasmid 2954
214 Ga0495672_0020029 3300047320 Bacteria 4395
215 Ga0495687_006577 3300047443 Bacteria 7083
216 Ga0496100_0016467 3300048903 Bacteria 4342
217 Ga0496112_0048343 3300048915 Bacteria 4171
218 Ga0496112_0131072 3300048915 Bacteria 2478
219 Ga0496115_0004329 3300048918 Bacteria 10274
220 Ga0495678_007689 3300049459 Bacteria 5558
221 Ga0501038_0002324 3300049574 Bacteria 17693
222 Ga0501039_0108151 3300049575 Bacteria 2173
223 Ga0501040_0025652 3300049576 Bacteria 3964
224 Ga0501041_0026668 3300049577 Bacteria 3476
225 Ga0501042_0014058 3300049578 Bacteria 5458
226 Ga0501047_0147255 3300049581 Bacteria 2231
227 Ga0501071_0134549 3300049587 Bacteria 1838
228 Ga0501072_0020180 3300049588 Bacteria 5160
229 Ga0501075_0157203 3300049591 Bacteria 1733
230 Ga0501077_0006585 3300049593 Bacteria 7132
231 Ga0501080_0211225 3300049742 Bacteria 1778
232 Ga0501081_0003029 3300049743 Bacteria 10660
233 Ga0501083_0171506 3300049744 Bacteria 1418
234 Ga0501035_0102242 3300049822 Bacteria 2514
235 nmdc:mga03683_66825_c1 3300050489 Unclassified 1529
236 nmdc:mga07m45_65875_c1 3300050496 Bacteria 2057
237 nmdc:mga09592_55660_c1 3300050508 Bacteria 3343
238 nmdc:mga0qj67_6021_c1 3300050509 Bacteria 8883
239 nmdc:mga0qj67_7060_c1 3300050509 Bacteria 8286
240 nmdc:mga06r32_10658_c2 3300050510 Bacteria 7581
241 nmdc:mga06r32_65170_c1 3300050510 Bacteria 3514
242 nmdc:mga06r32_9961_c1 3300050510 Bacteria 8576
243 nmdc:mga0a205_201217_c1 3300050515 Bacteria 1882
244 Ga0495601_0065703 3300053077 Bacteria 2309
245 Ga0495619_0070284 3300053085 Bacteria 2341
246 Ga0500578_0000104 3300053086 Bacteria 98802
247 Ga0500647_0050805 3300053091 Bacteria 1994
248 Ga0500566_0000190 3300053094 Bacteria 31951
249 Ga0500640_000028 3300053095 Bacteria 21641
250 Ga0500557_000186 3300053105 Bacteria 11036
251 Ga0500569_002358 3300053109 Bacteria 3708
252 Ga0500572_000447 3300053111 Bacteria 14394
253 Ga0500591_038335 3300053115 Bacteria 2291
254 Ga0500614_000953 3300053123 Bacteria 7211
255 Ga0500642_0051960 3300053130 Unclassified 1813
256 Ga0500568_0001438 3300053139 Bacteria 15421
257 Ga0500568_0008504 3300053139 Bacteria 4939
258 Ga0500590_002026 3300053148 Bacteria 8741
259 Ga0500590_006155 3300053148 Bacteria 5829
260 Ga0500603_000065 3300053150 Bacteria 24604
261 Ga0500616_0000472 3300053153 Bacteria 52191
262 Ga0500616_0001878 3300053153 Bacteria 18927
263 Ga0500633_0000072 3300053160 Bacteria 15109
264 Ga0500638_023728 3300053162 Bacteria 2918
265 Ga0500639_000003 3300053163 Bacteria 230428
266 Ga0500637_0063283 3300053178 Bacteria 2121
267 Ga0500596_000130 3300053735 Bacteria 11045
268 Ga0500596_000801 3300053735 Bacteria 6206
269 Ga0501084_0199194 3300054114 Bacteria 1689
270 Ga0590071_003668 3300059421 Bacteria 3770
271 Ga0590074_001806 3300059423 Bacteria 3495
272 Ga0466962_0004224 3300061719 Bacteria 6880

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2935630451 2935637195 337
2 iso_pu_bacteria 2941507105 2941513833 337
3 iso_pu_bacteria 2941515067 2941521795 337
4 iso_pu_bacteria 2941523033 2941529464 337
5 3300049743 Ga0501081_0003029 Ga0501081_0003029_9546_10622 352
6 3300035172 Ga0373955_0013913 Ga0373955_0013913_2663_3835 382
7 3300046491 Ga0495584_0086124 Ga0495584_0086124_291_1451 386
8 3300046522 Ga0495643_0008846 Ga0495643_0008846_4351_5511 386
9 3300046660 Ga0495625_0067522 Ga0495625_0067522_787_1947 386
10 3300046694 Ga0495649_0068431 Ga0495649_0068431_314_1474 386
11 3300046810 Ga0495660_0114513 Ga0495660_0114513_180_1340 386
12 3300047443 Ga0495687_006577 Ga0495687_006577_1342_2502 386
13 3300046472 Ga0495580_0119861 Ga0495580_0119861_48_1325 388
14 3300049588 Ga0501072_0020180 Ga0501072_0020180_3966_5150 388
15 3300049593 Ga0501077_0006585 Ga0501077_0006585_5938_7122 388
16 3300009094 Ga0111539_10143376 Ga0111539_101433763 392
17 3300031507 Ga0307509_10000023 Ga0307509_10000023137 392
18 3300046492 Ga0495585_0008486 Ga0495585_0008486_1272_2459 395
19 3300046506 Ga0495583_0008244 Ga0495583_0008244_4171_5358 395
20 3300046518 Ga0495631_0008860 Ga0495631_0008860_406_1593 395
21 3300046519 Ga0495632_0017464 Ga0495632_0017464_2464_3651 395
22 3300046538 Ga0495609_0009714 Ga0495609_0009714_945_2132 395
23 3300046616 Ga0495668_0012665 Ga0495668_0012665_416_1603 395
24 3300046648 Ga0495611_0044067 Ga0495611_0044067_438_1625 395
25 3300046660 Ga0495625_0002886 Ga0495625_0002886_3918_5105 395
26 3300046691 Ga0495670_0012821 Ga0495670_0012821_1273_2460 395
27 3300047320 Ga0495672_0020029 Ga0495672_0020029_96_1283 395
28 3300049459 Ga0495678_007689 Ga0495678_007689_54_1241 395
29 3300053105 Ga0500557_000186 Ga0500557_000186_480_1667 395
30 3300053109 Ga0500569_002358 Ga0500569_002358_855_2042 395
31 3300053139 Ga0500568_0001438 Ga0500568_0001438_6192_7379 395
32 3300053153 Ga0500616_0000472 Ga0500616_0000472_1403_2590 395
33 3300009093 Ga0105240_10001501 Ga0105240_1000150121 401
34 3300009545 Ga0105237_10001025 Ga0105237_1000102516 401
35 3300010375 Ga0105239_10003993 Ga0105239_100039934 401
36 3300025913 Ga0207695_10007442 Ga0207695_100074429 401
37 3300025914 Ga0207671_10002499 Ga0207671_100024996 401
38 3300044712 Ga0453684_0000384 Ga0453684_0000384_108504_109787 402
39 3300046616 Ga0495668_0042820 Ga0495668_0042820_24_1274 402
40 3300031456 Ga0307513_10071511 Ga0307513_100715113 405
41 3300007788 Ga0099795_10001054 Ga0099795_100010541 407
42 3300009093 Ga0105240_10006622 Ga0105240_100066225 407
43 3300010375 Ga0105239_10038584 Ga0105239_100385842 407
44 3300025913 Ga0207695_10011351 Ga0207695_100113513 407
45 3300048903 Ga0496100_0016467 Ga0496100_0016467_2046_3296 407
46 3300059421 Ga0590071_003668 Ga0590071_003668_1497_2786 407
47 3300059423 Ga0590074_001806 Ga0590074_001806_160_1449 407
48 3300005530 Ga0070679_100143222 Ga0070679_1001432222 408
49 3300013105 Ga0157369_10056003 Ga0157369_100560034 408
50 3300025909 Ga0207705_10159180 Ga0207705_101591802 408
51 3300048915 Ga0496112_0131072 Ga0496112_0131072_426_1652 408
52 3300035111 Ga0373923_0036395 Ga0373923_0036395_425_1669 409
53 3300035170 Ga0373943_0095202 Ga0373943_0095202_178_1422 409
54 iso_pu_bacteria 2849573788 2849574355 409
55 3300032133 Ga0316583_10000343 Ga0316583_100003433 411
56 3300053085 Ga0495619_0070284 Ga0495619_0070284_909_2165 411
57 3300009093 Ga0105240_10000303 Ga0105240_100003037 412
58 3300009551 Ga0105238_10085477 Ga0105238_100854772 412
59 3300025913 Ga0207695_10000396 Ga0207695_1000039613 412
60 3300025924 Ga0207694_10053096 Ga0207694_100530963 412
61 3300028794 Ga0307515_10000037 Ga0307515_1000003731 412
62 3300053735 Ga0500596_000801 Ga0500596_000801_1199_2437 412
63 3300009147 Ga0114129_10503250 Ga0114129_105032501 413
64 3300032168 Ga0316593_10033970 Ga0316593_100339701 413
65 3300053153 Ga0500616_0001878 Ga0500616_0001878_2606_3871 413
66 3300005329 Ga0070683_100059459 Ga0070683_1000594593 414
67 3300005331 Ga0070670_100048507 Ga0070670_1000485072 414
68 3300005334 Ga0068869_100027845 Ga0068869_1000278453 414
69 3300005338 Ga0068868_100057650 Ga0068868_1000576501 414
70 3300005355 Ga0070671_100153908 Ga0070671_1001539082 414
71 3300005456 Ga0070678_100141730 Ga0070678_1001417301 414
72 3300005458 Ga0070681_10197507 Ga0070681_101975072 414
73 3300005459 Ga0068867_100044345 Ga0068867_1000443452 414
74 3300005530 Ga0070679_100044152 Ga0070679_1000441522 414
75 3300005530 Ga0070679_100116282 Ga0070679_1001162825 414
76 3300005535 Ga0070684_100101358 Ga0070684_1001013583 414
77 3300005563 Ga0068855_100009287 Ga0068855_10000928712 414
78 3300005563 Ga0068855_100035528 Ga0068855_1000355285 414
79 3300005564 Ga0070664_100046830 Ga0070664_1000468303 414
80 3300005577 Ga0068857_100022190 Ga0068857_1000221903 414
81 3300005578 Ga0068854_100020354 Ga0068854_1000203543 414
82 3300005578 Ga0068854_100132999 Ga0068854_1001329991 414
83 3300005614 Ga0068856_100006003 Ga0068856_1000060032 414
84 3300005617 Ga0068859_100045101 Ga0068859_1000451014 414
85 3300005618 Ga0068864_100012024 Ga0068864_1000120242 414
86 3300005718 Ga0068866_10013770 Ga0068866_100137702 414
87 3300005841 Ga0068863_100005208 Ga0068863_1000052086 414
88 3300005841 Ga0068863_100249790 Ga0068863_1002497901 414
89 3300005842 Ga0068858_100009988 Ga0068858_1000099888 414
90 3300006237 Ga0097621_100000524 Ga0097621_1000005246 414
91 3300006237 Ga0097621_100030526 Ga0097621_1000305264 414
92 3300006358 Ga0068871_100000136 Ga0068871_10000013625 414
93 3300006881 Ga0068865_100075738 Ga0068865_1000757382 414
94 3300006931 Ga0097620_100045101 Ga0097620_1000451014 414
95 3300009177 Ga0105248_10001757 Ga0105248_100017574 414
96 3300009177 Ga0105248_10047713 Ga0105248_100477133 414
97 3300010375 Ga0105239_10016488 Ga0105239_100164884 414
98 3300013296 Ga0157374_10001350 Ga0157374_100013506 414
99 3300013297 Ga0157378_10000419 Ga0157378_100004192 414
100 3300013297 Ga0157378_10024878 Ga0157378_100248784 414
101 3300013307 Ga0157372_10000216 Ga0157372_1000021616 414
102 3300013307 Ga0157372_10068688 Ga0157372_100686882 414
103 3300014969 Ga0157376_10011012 Ga0157376_100110125 414
104 3300025899 Ga0207642_10009661 Ga0207642_100096612 414
105 3300025912 Ga0207707_10087468 Ga0207707_100874681 414
106 3300025921 Ga0207652_10077293 Ga0207652_100772932 414
107 3300025931 Ga0207644_10103088 Ga0207644_101030882 414
108 3300025938 Ga0207704_10127195 Ga0207704_101271951 414
109 3300025941 Ga0207711_10187938 Ga0207711_101879382 414
110 3300025942 Ga0207689_10089450 Ga0207689_100894502 414
111 3300025949 Ga0207667_10025197 Ga0207667_100251972 414
112 3300025949 Ga0207667_10064607 Ga0207667_100646073 414
113 3300025981 Ga0207640_10026011 Ga0207640_100260112 414
114 3300025981 Ga0207640_10154302 Ga0207640_101543022 414
115 3300026023 Ga0207677_10075156 Ga0207677_100751562 414
116 3300026078 Ga0207702_10007624 Ga0207702_100076244 414
117 3300026078 Ga0207702_10127145 Ga0207702_101271451 414
118 3300026088 Ga0207641_10003445 Ga0207641_100034452 414
119 3300026089 Ga0207648_10147367 Ga0207648_101473672 414
120 3300026116 Ga0207674_10007768 Ga0207674_100077689 414
121 3300028381 Ga0268264_10222971 Ga0268264_102229711 414
122 3300048915 Ga0496112_0048343 Ga0496112_0048343_1881_3134 414
123 3300003320 rootH2_10015861 rootH2_1001586113 415
124 3300005445 Ga0070708_100021620 Ga0070708_1000216205 415
125 3300005518 Ga0070699_100017149 Ga0070699_1000171494 415
126 3300006847 Ga0075431_100023488 Ga0075431_1000234886 415
127 3300007788 Ga0099795_10001521 Ga0099795_100015214 415
128 3300025939 Ga0207665_10076091 Ga0207665_100760912 415
129 3300031507 Ga0307509_10024091 Ga0307509_100240916 415
130 3300031595 Ga0265313_10002414 Ga0265313_1000241420 415
131 3300046524 Ga0495648_0006468 Ga0495648_0006468_7127_8392 415
132 3300050510 nmdc:mga06r32_10658_c2 nmdc:mga06r32_10658_c2_2925_4187 415
133 3300053091 Ga0500647_0050805 Ga0500647_0050805_204_1463 415
134 3300053094 Ga0500566_0000190 Ga0500566_0000190_30124_31383 415
135 3300053095 Ga0500640_000028 Ga0500640_000028_14157_15416 415
136 3300053111 Ga0500572_000447 Ga0500572_000447_12608_13867 415
137 3300053115 Ga0500591_038335 Ga0500591_038335_921_2180 415
138 3300053123 Ga0500614_000953 Ga0500614_000953_5295_6554 415
139 3300053150 Ga0500603_000065 Ga0500603_000065_510_1769 415
140 3300053162 Ga0500638_023728 Ga0500638_023728_1184_2443 415
141 3300053163 Ga0500639_000003 Ga0500639_000003_205683_206942 415
142 3300053178 Ga0500637_0063283 Ga0500637_0063283_96_1355 415
143 3300053735 Ga0500596_000130 Ga0500596_000130_5942_7201 415
144 iso_pu_bacteria 2513237140 2513886182 415
145 iso_pu_bacteria 2515154107 2515613492 415
146 iso_pu_bacteria 2791355091 2792625027 415
147 iso_pu_bacteria 2791355092 2792630558 415
148 iso_pu_bacteria 8016583857 8016593945 415
149 3300005340 Ga0070689_100087279 Ga0070689_1000872791 416
150 3300005457 Ga0070662_100014751 Ga0070662_1000147513 416
151 3300005544 Ga0070686_100000049 Ga0070686_10000004965 416
152 3300005563 Ga0068855_100059220 Ga0068855_1000592203 416
153 3300009093 Ga0105240_10006223 Ga0105240_100062238 416
154 3300010159 Ga0099796_10005125 Ga0099796_100051253 416
155 3300013105 Ga0157369_10001324 Ga0157369_1000132410 416
156 3300025929 Ga0207664_10035331 Ga0207664_100353314 416
157 3300025933 Ga0207706_10025680 Ga0207706_100256805 416
158 3300025949 Ga0207667_10090370 Ga0207667_100903702 416
159 3300028653 Ga0265323_10021452 Ga0265323_100214523 416
160 3300031235 Ga0265330_10023928 Ga0265330_100239282 416
161 3300031344 Ga0265316_10000428 Ga0265316_1000042819 416
162 3300031712 Ga0265342_10014950 Ga0265342_100149502 416
163 iso_pu_bacteria 2824609381 2824609561 416
164 iso_pu_bacteria 2824653114 2824653765 416
165 iso_pu_bacteria 2935630451 2935637252 416
166 iso_pu_bacteria 2941507105 2941513890 416
167 iso_pu_bacteria 2941515067 2941521851 416
168 iso_pu_bacteria 2941523033 2941529520 416
169 iso_pu_bacteria 8019555841 8019564727 416
170 iso_pu_bacteria 8019565922 8019574824 416
171 3300005530 Ga0070679_100008346 Ga0070679_1000083462 417
172 3300028794 Ga0307515_10001129 Ga0307515_1000112923 417
173 3300028794 Ga0307515_10001129 Ga0307515_100011293 417
174 3300033180 Ga0307510_10041335 Ga0307510_100413352 417
175 iso_pu_bacteria 2510917028 2511182975 417
176 iso_pu_bacteria 2513237144 2513913446 417
177 iso_pu_bacteria 2585427590 2585820118 417
178 iso_pu_bacteria 2585428057 2587729339 417
179 iso_pu_bacteria 2585428062 2587756523 417
180 iso_pu_bacteria 2643221607 2644047775 417
181 iso_pu_bacteria 2643221686 2644481937 417
182 iso_pu_bacteria 2838661181 2838665715 417
183 3300005437 Ga0070710_10101276 Ga0070710_101012762 418
184 3300005458 Ga0070681_10024628 Ga0070681_100246287 418
185 3300006844 Ga0075428_100124763 Ga0075428_1001247632 418
186 3300006852 Ga0075433_10187662 Ga0075433_101876621 418
187 3300009094 Ga0111539_10012053 Ga0111539_100120533 418
188 3300009147 Ga0114129_10104722 Ga0114129_101047224 418
189 3300031733 Ga0316577_10143849 Ga0316577_101438491 418
190 3300031995 Ga0307409_100081801 Ga0307409_1000818012 418
191 3300032002 Ga0307416_100125260 Ga0307416_1001252603 418
192 3300036712 Ga0316584_0134469 Ga0316584_0134469_540_1802 418
193 3300037418 Ga0395900_0008882 Ga0395900_0008882_3079_4356 418
194 3300038443 Ga0395901_0004940 Ga0395901_0004940_9084_10361 418
195 3300050515 nmdc:mga0a205_201217_c1 nmdc:mga0a205_201217_c1_123_1400 418
196 iso_pu_bacteria 2522572158 2523107446 418
197 2162886006 SwRhRL3b_contig_3740212 SwRhRL3b_0673.00000410 419
198 3300001979 JGI24740J21852_10005000 JGI24740J21852_100050002 419
199 3300003323 rootH1_10019968 rootH1_100199684 419
200 3300005262 Ga0065165_1000998 Ga0065165_100099818 419
201 3300005295 Ga0065707_10084205 Ga0065707_100842056 419
202 3300005344 Ga0070661_100022658 Ga0070661_1000226584 419
203 3300005355 Ga0070671_100011900 Ga0070671_1000119003 419
204 3300005364 Ga0070673_100107829 Ga0070673_1001078293 419
205 3300005457 Ga0070662_100184114 Ga0070662_1001841141 419
206 3300005539 Ga0068853_100063775 Ga0068853_1000637753 419
207 3300006353 Ga0075370_10027012 Ga0075370_100270123 419
208 3300006844 Ga0075428_100099774 Ga0075428_1000997742 419
209 3300006844 Ga0075428_100158607 Ga0075428_1001586072 419
210 3300006846 Ga0075430_100048210 Ga0075430_1000482103 419
211 3300006846 Ga0075430_100111804 Ga0075430_1001118042 419
212 3300006847 Ga0075431_100089957 Ga0075431_1000899572 419
213 3300006847 Ga0075431_100300879 Ga0075431_1003008792 419
214 3300006880 Ga0075429_100058801 Ga0075429_1000588012 419
215 3300006880 Ga0075429_100147766 Ga0075429_1001477661 419
216 3300009093 Ga0105240_10047004 Ga0105240_100470043 419
217 3300009093 Ga0105240_10073434 Ga0105240_100734343 419
218 3300009545 Ga0105237_10020826 Ga0105237_100208266 419
219 3300009551 Ga0105238_10005742 Ga0105238_100057423 419
220 3300009553 Ga0105249_10314751 Ga0105249_103147511 419
221 3300009765 Ga0123341_1027836 Ga0123341_10278365 419
222 3300009766 Ga0123342_1036588 Ga0123342_10365882 419
223 3300010159 Ga0099796_10016150 Ga0099796_100161502 419
224 3300025903 Ga0207680_10045771 Ga0207680_100457713 419
225 3300025904 Ga0207647_10071701 Ga0207647_100717011 419
226 3300025913 Ga0207695_10017334 Ga0207695_100173345 419
227 3300025913 Ga0207695_10036891 Ga0207695_100368913 419
228 3300025914 Ga0207671_10016209 Ga0207671_100162093 419
229 3300025920 Ga0207649_10025322 Ga0207649_100253224 419
230 3300025931 Ga0207644_10036934 Ga0207644_100369343 419
231 3300028794 Ga0307515_10092729 Ga0307515_100927293 419
232 3300028800 Ga0265338_10010454 Ga0265338_100104545 419
233 3300030521 Ga0307511_10031297 Ga0307511_100312973 419
234 3300031239 Ga0265328_10010357 Ga0265328_100103573 419
235 3300031507 Ga0307509_10001996 Ga0307509_100019968 419
236 3300031649 Ga0307514_10045263 Ga0307514_100452633 419
237 3300031665 Ga0316575_10043455 Ga0316575_100434552 419
238 3300031691 Ga0316579_10027033 Ga0316579_100270332 419
239 3300031727 Ga0316576_10006195 Ga0316576_100061952 419
240 3300031728 Ga0316578_10003254 Ga0316578_100032544 419
241 3300031733 Ga0316577_10099802 Ga0316577_100998022 419
242 3300032139 Ga0316580_10015346 Ga0316580_100153462 419
243 3300033528 Ga0316588_1002859 Ga0316588_10028592 419
244 3300035119 Ga0373956_0056037 Ga0373956_0056037_18_1301 419
245 3300035398 Ga0316574_0014082 Ga0316574_0014082_828_2108 419
246 3300035398 Ga0316574_0016487 Ga0316574_0016487_1272_2543 419
247 3300035695 Ga0373927_0002788 Ga0373927_0002788_10985_12268 419
248 3300036647 Ga0316582_0023982 Ga0316582_0023982_2260_3540 419
249 3300036712 Ga0316584_0011379 Ga0316584_0011379_714_1994 419
250 3300037312 Ga0395899_0008099 Ga0395899_0008099_2216_3508 419
251 3300037418 Ga0395900_0001467 Ga0395900_0001467_3791_5068 419
252 3300037418 Ga0395900_0036363 Ga0395900_0036363_1441_2733 419
253 3300037466 Ga0395898_0014314 Ga0395898_0014314_3431_4711 419
254 3300037466 Ga0395898_0026532 Ga0395898_0026532_571_1863 419
255 3300037471 Ga0395905_0079196 Ga0395905_0079196_1141_2421 419
256 3300037471 Ga0395905_0150609 Ga0395905_0150609_692_1969 419
257 3300038443 Ga0395901_0032639 Ga0395901_0032639_3499_4791 419
258 3300038443 Ga0395901_0272608 Ga0395901_0272608_383_1663 419
259 3300039062 Ga0400483_200777 Ga0400483_200777_319_1596 419
260 3300039447 Ga0436361_0181353 Ga0436361_0181353_4487_5776 419
261 3300044656 Ga0466969_0023976 Ga0466969_0023976_1583_2896 419
262 3300044684 Ga0466966_0000877 Ga0466966_0000877_16805_18118 419
263 3300044706 Ga0466964_0015159 Ga0466964_0015159_409_1722 419
264 3300044735 Ga0466968_0049472 Ga0466968_0049472_293_1606 419
265 3300045049 Ga0466959_0071731 Ga0466959_0071731_110_1423 419
266 3300046474 Ga0495605_0003054 Ga0495605_0003054_5024_6301 419
267 3300046533 Ga0495640_0055349 Ga0495640_0055349_11_1303 419
268 3300046536 Ga0495587_0023182 Ga0495587_0023182_798_2075 419
269 3300046690 Ga0495624_0068362 Ga0495624_0068362_372_1649 419
270 3300046809 Ga0495600_0027732 Ga0495600_0027732_253_1530 419
271 3300047317 Ga0495604_0006357 Ga0495604_0006357_1421_2698 419
272 3300047319 Ga0495674_0073221 Ga0495674_0073221_662_1954 419
273 3300048918 Ga0496115_0004329 Ga0496115_0004329_4541_5815 419
274 3300049574 Ga0501038_0002324 Ga0501038_0002324_171_1448 419
275 3300049575 Ga0501039_0108151 Ga0501039_0108151_520_1797 419
276 3300049576 Ga0501040_0025652 Ga0501040_0025652_458_1735 419
277 3300049577 Ga0501041_0026668 Ga0501041_0026668_252_1529 419
278 3300049578 Ga0501042_0014058 Ga0501042_0014058_347_1624 419
279 3300049581 Ga0501047_0147255 Ga0501047_0147255_706_1983 419
280 3300049587 Ga0501071_0134549 Ga0501071_0134549_146_1423 419
281 3300049591 Ga0501075_0157203 Ga0501075_0157203_76_1353 419
282 3300049742 Ga0501080_0211225 Ga0501080_0211225_313_1590 419
283 3300049744 Ga0501083_0171506 Ga0501083_0171506_76_1353 419
284 3300049822 Ga0501035_0102242 Ga0501035_0102242_834_2111 419
285 3300050489 nmdc:mga03683_66825_c1 nmdc:mga03683_66825_c1_187_1482 419
286 3300050496 nmdc:mga07m45_65875_c1 nmdc:mga07m45_65875_c1_716_1996 419
287 3300050508 nmdc:mga09592_55660_c1 nmdc:mga09592_55660_c1_911_2203 419
288 3300050509 nmdc:mga0qj67_6021_c1 nmdc:mga0qj67_6021_c1_7005_8285 419
289 3300050509 nmdc:mga0qj67_7060_c1 nmdc:mga0qj67_7060_c1_5201_6493 419
290 3300050510 nmdc:mga06r32_65170_c1 nmdc:mga06r32_65170_c1_893_2185 419
291 3300050510 nmdc:mga06r32_9961_c1 nmdc:mga06r32_9961_c1_6749_8029 419
292 3300053077 Ga0495601_0065703 Ga0495601_0065703_742_2019 419
293 3300053086 Ga0500578_0000104 Ga0500578_0000104_41798_43078 419
294 3300053130 Ga0500642_0051960 Ga0500642_0051960_56_1339 419
295 3300053139 Ga0500568_0008504 Ga0500568_0008504_859_2172 419
296 3300053148 Ga0500590_002026 Ga0500590_002026_6806_8083 419
297 3300053148 Ga0500590_006155 Ga0500590_006155_2936_4228 419
298 3300053160 Ga0500633_0000072 Ga0500633_0000072_11946_13223 419
299 3300054114 Ga0501084_0199194 Ga0501084_0199194_210_1487 419
300 3300061719 Ga0466962_0004224 Ga0466962_0004224_1385_2698 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13657

Couple_hipA

HipA N-terminal domain

22

122

0.88

PF07804

HipA_C

HipA-like C-terminal domain

186

405

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vkb-assembly1.cif.gz_A crystal structure of the a bacterial kinase complex 0.7937 180 406
7ab5-assembly1.cif.gz_F crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt d233q) 0.7878 170 413
7ab4-assembly1.cif.gz_C crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt s59a) 0.768 170 413
7ab3-assembly1.cif.gz_F crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt s57a) 0.7623 168 408
4yg7-assembly1.cif.gz_K structure of fl autorepression promoter complex 0.7536 6 408
ID Description Score Start End Superfamily
3akjB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.8826 177 241 3.30.200.120
af_F8W2L7_1_101_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8607 19 41 2.60.200.20
3aklB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.8547 172 237 3.30.200.120
3jr1B01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7305 172 235 3.30.200.20
3akjB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.7286 177 241 3.30.200.120
ID Description Score Start End GO Terms
AF-A0A2H6J9R0-F1-model_v4 Putative DNA-binding transcriptional regulator 0.9949 208 419 GO:0003677
GO:0004674
GO:0005829
AF-X1M7F7-F1-model_v4 HipA-like C-terminal domain-containing protein 0.9929 187 417 GO:0004674
GO:0005829
AF-A0A0R3M6Q1-F1-model_v4 HipA-like C-terminal domain-containing protein 0.9858 267 416 GO:0004674
GO:0005829
AF-A0A6L8GCT7-F1-model_v4 Type II toxin-antitoxin system HipA family toxin 0.9858 4 107
AF-A0A4Q4AQ82-F1-model_v4 deleted 0.9853 248 418

Feature Viewer

pLDDT pTM Quality
90.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map