F497054

General Info

Members Datasets Scaffolds Average Seq Length
2784 825 2529 199

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10329738|Ga0307410_103297382
Length 226
Sequence MEKFTQHTGVGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDALFAAWRGDPDFVLNRPAYASGSVLVAGPDFGTGSSREHAVWALKDYGFRVVLAPKFADIFRGNAGKQGLVAGVISQEDAEMLWKVLENEPGTEVTVDLVGKTVVAGDVHATFEIDDYTRWRLLEGLDDIGLTLQNEADITAFEATREPWRPRTLPAKHLPPVHVMAARPVGGDGGLPAHADAPLA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
5 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
6 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
7 2558860280 Kutzneria sp. 744 Isolate Unclassified
8 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
9 2582580736 Prauserella sp. Am3 Isolate Unclassified
10 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
11 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
12 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
13 2643221546 Microbacterium sp. Root53 Isolate Unclassified
14 2643221553 Microbacterium sp. Root553 Isolate Unclassified
15 2643221561 Nocardioides sp. Root151 Isolate Unclassified
16 2643221566 Microbacterium sp. Root166 Isolate Unclassified
17 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
18 2643221572 Leifsonia sp. Root60 Isolate Unclassified
19 2643221575 Microbacterium sp. Root61 Isolate Unclassified
20 2643221597 Microbacterium sp. Root180 Isolate Unclassified
21 2643221613 Oerskovia sp. Root22 Isolate Unclassified
22 2643221615 Nocardioides sp. Root224 Isolate Unclassified
23 2643221616 Leifsonia sp. Root227 Isolate Unclassified
24 2643221617 Nocardioides sp. Root79 Isolate Unclassified
25 2643221620 Nocardioides sp. Root240 Isolate Unclassified
26 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
27 2643221630 Microbacterium sp. Root322 Isolate Unclassified
28 2643221641 Nocardioides sp. Root122 Isolate Unclassified
29 2643221649 Leifsonia sp. Root4 Isolate Unclassified
30 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
31 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
32 2643221679 Angustibacter sp. Root456 Isolate Unclassified
33 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
34 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
35 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
36 2643221692 Nocardia sp. Root136 Isolate Unclassified
37 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
38 2643221696 Nocardioides sp. Root140 Isolate Unclassified
39 2643221711 Terrabacter sp. Root85 Isolate Unclassified
40 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
41 2643221721 Oerskovia sp. Root918 Isolate Unclassified
42 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
43 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
44 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
45 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
46 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
47 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
48 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
49 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
50 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
51 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
52 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
53 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
54 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
55 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
56 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
57 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
58 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
59 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
60 2739367653 Kocuria sp. OV113 Isolate Unclassified
61 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
62 2739367898 Nocardioides sp. CF479 Isolate Unclassified
63 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
64 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
65 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
66 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
67 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
68 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
69 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
70 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
71 2773857759 Microbacterium sp. 1294 Isolate Unclassified
72 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
73 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
74 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
75 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
76 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
77 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
78 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
79 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
80 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
81 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
82 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
83 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
84 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
85 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
86 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
87 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
88 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
89 2808606394 Promicromonospora sp. C35 Isolate Unclassified
90 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
91 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
92 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
93 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
94 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
95 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
96 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
97 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
98 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
99 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
100 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
101 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
102 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
103 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
104 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
105 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
106 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
107 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
108 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
109 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
110 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
111 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
112 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
113 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
114 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
115 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
116 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
117 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
118 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
119 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
120 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
121 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
122 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
123 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
124 2857727296 Kocuria sp. R-72562 Isolate Unclassified
125 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
126 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
127 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
128 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
129 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
130 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
131 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
132 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
133 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
134 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
135 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
136 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
137 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
138 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
139 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
140 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
141 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
142 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
143 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
144 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
145 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
146 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
147 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
148 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
149 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
150 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
151 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
152 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
153 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
154 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
155 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
156 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
157 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
158 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
159 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
160 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
161 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
162 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
163 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
164 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
165 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
166 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
167 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
168 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
169 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
170 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
171 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
172 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
173 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
174 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
175 2919069694 Microbacterium sp. 1154 Isolate Unclassified
176 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
177 2919395869 Microbacterium resistens 2980 Isolate Unclassified
178 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
179 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
180 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
181 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
182 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
183 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
184 2922554459 Rhodococcus sp. 66b Isolate Unclassified
185 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
186 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
187 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
188 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
189 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
190 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
191 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
192 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
193 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
194 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
195 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
196 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
197 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
198 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
199 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
200 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
201 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
202 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
203 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
204 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
205 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
206 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
207 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
208 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
209 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
210 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
211 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
212 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
213 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
214 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
215 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
216 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
217 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
218 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
219 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
220 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
221 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
222 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
223 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
224 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
225 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
226 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
227 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
228 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
229 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
230 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
231 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
232 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
233 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
234 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
235 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
236 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
237 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
238 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
239 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
240 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
241 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
242 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
243 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
244 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
245 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
246 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
247 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
248 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
249 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
250 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
251 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
252 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
253 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
254 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
255 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
256 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
257 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
258 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
259 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
260 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
261 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
262 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
263 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
264 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
265 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
266 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
267 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
268 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
269 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
270 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
271 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
272 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
273 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
274 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
275 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
276 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
277 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
278 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
279 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
280 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
281 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
282 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
283 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
284 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
285 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
286 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
287 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
288 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
289 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
290 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
291 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
292 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
293 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
294 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
295 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
296 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
297 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
298 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
299 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
300 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
301 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
302 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
303 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
304 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
305 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
306 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
307 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
308 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
309 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
310 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
311 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
312 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
313 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
314 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
315 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
316 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
317 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
318 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
319 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
320 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
321 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
322 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
323 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
324 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
325 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
326 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
327 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
328 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
329 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
330 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
331 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
332 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
333 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
334 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
335 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
336 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
337 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
338 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
339 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
340 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
341 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
342 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
343 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
344 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
345 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
346 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
347 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
348 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
349 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
350 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
351 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
352 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
353 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
354 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
355 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
356 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
357 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
358 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
359 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
360 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
361 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
362 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
363 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
364 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
365 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
366 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
367 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
368 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
369 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
370 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
371 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
372 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
373 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
374 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
375 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
376 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
377 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
378 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
379 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
380 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
381 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
382 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
383 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
384 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
385 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
386 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
387 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
388 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
389 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
390 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
391 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
392 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
393 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
394 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
395 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
396 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
397 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
398 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
399 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
400 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
401 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
402 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
403 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
404 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
405 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
406 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
407 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
411 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
412 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
413 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
414 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
415 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
418 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
419 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
420 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
421 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
422 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
423 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
490 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
492 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
493 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
497 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
498 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
499 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
500 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
501 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
502 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
503 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
504 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
505 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
506 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
507 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
508 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
509 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
510 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
511 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
512 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
513 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
514 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
515 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
516 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
517 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
518 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
519 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
520 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
521 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
522 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
523 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
524 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
525 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
526 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
527 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
528 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
529 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
530 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
531 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
532 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
534 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
535 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
537 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
538 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
539 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
540 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
541 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
542 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
543 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
544 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
545 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
546 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
547 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
548 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
549 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
550 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
551 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
552 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
553 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
554 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
555 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
556 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
557 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
558 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
559 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
560 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
561 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
562 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
563 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
564 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
565 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
566 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
567 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
568 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
569 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
570 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
571 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
572 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
573 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
574 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
575 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
576 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
577 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
578 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
579 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
580 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
581 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
582 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
583 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
584 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
585 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
586 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
587 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
588 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
589 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
590 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
591 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
592 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
593 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
594 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
595 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
596 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
597 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
598 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
599 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
600 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
601 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
602 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
603 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
604 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
605 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
606 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
607 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
608 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
609 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
610 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
611 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
612 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
613 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
614 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
615 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
616 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
617 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
618 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
619 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
620 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
621 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
622 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
623 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
624 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
625 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
626 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
627 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
628 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
629 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
630 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
631 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
632 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
633 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
634 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
635 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
636 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
637 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
638 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
639 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
640 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
641 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
642 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
643 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
644 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
645 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
646 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
647 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
648 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
649 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
650 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
651 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
652 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
653 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
654 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
655 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
656 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
657 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
658 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
659 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
660 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
661 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
662 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
663 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
664 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
665 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
666 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
667 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
668 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
669 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
670 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
671 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
672 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
673 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
674 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
675 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
676 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
677 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
678 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
679 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
680 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
681 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
682 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
683 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
684 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
685 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
686 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
687 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
688 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
689 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
690 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
691 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
692 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
693 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
694 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
695 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
696 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
697 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
698 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
699 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
700 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
701 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
702 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
703 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
704 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
705 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
706 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
707 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
708 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
713 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
714 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
715 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
716 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
717 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
718 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
720 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
721 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
722 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
723 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
724 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
727 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
728 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
729 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
730 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
731 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
732 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
733 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
734 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
735 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
736 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
737 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
738 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
739 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
740 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
741 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
742 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
743 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
744 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
745 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
746 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
747 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
748 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
749 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
750 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
751 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
752 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
753 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
754 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
755 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
756 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
757 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
758 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
759 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
760 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
761 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
762 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
763 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
764 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
765 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
766 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
767 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
768 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
769 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
770 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
771 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
772 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
773 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
774 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
775 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
776 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
777 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
778 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
779 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
780 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
781 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
782 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
783 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
784 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
785 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
786 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
787 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
788 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
789 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
790 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
791 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
792 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
804 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
805 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
806 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
807 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
808 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
809 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
810 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
811 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
812 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
813 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
814 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
815 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
816 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
817 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
818 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
819 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
820 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
821 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
822 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
823 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
824 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
825 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.37
Metatranscriptomes 1.47
Isolates 9.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 9.2
Nodule 0.07
Rhizoplane 10.45
Rhizosphere 68.03
Stem 0
Stem Tuber 0.07
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001015 3300000545 Bacteria 1846
2 LJQas_1000855 3300000549 Bacteria 4764
3 LJQas_1002763 3300000549 Bacteria 2410
4 LJQas_1007556 3300000549 Bacteria 1335
5 JGI24740J21852_10059155 3300001979 Bacteria 1063
6 JGI24739J22299_10030952 3300001989 Bacteria 1852
7 JGI24737J22298_10018187 3300001990 Bacteria 2257
8 JGI24737J22298_10021654 3300001990 Bacteria 2048
9 JGI24737J22298_10037221 3300001990 Bacteria 1500
10 JGI24737J22298_10142156 3300001990 Bacteria 709
11 JGI24743J22301_10009702 3300001991 Bacteria 1710
12 JGI24735J21928_10034642 3300002067 Bacteria 1488
13 JGI24735J21928_10043912 3300002067 Bacteria 1299
14 JGI24750J21931_1025667 3300002070 Bacteria 846
15 JGI24744J21845_10000011 3300002077 Bacteria 21329
16 JGI24744J21845_10000356 3300002077 Bacteria 7772
17 JGI24744J21845_10000383 3300002077 Bacteria 7570
18 JGI24034J26672_10016186 3300002239 Bacteria 1147
19 JGI24742J22300_10000643 3300002244 Bacteria 5256
20 JGI24742J22300_10011245 3300002244 Bacteria 1484
21 JGI25154J39366_1000846 3300002738 Bacteria 13272
22 JGI25164J39214_1003843 3300002772 Bacteria 1820
23 JGI25152J39213_1000824 3300002773 Bacteria 15472
24 Ga0006778J45830_1046883 3300003162 Bacteria 1059
25 JGI25151J46595_10032830 3300003187 Bacteria 2007
26 JGI25406J46586_10004772 3300003203 Bacteria 6305
27 JGI25406J46586_10006188 3300003203 Bacteria 5526
28 JGI25165J46597_1000002 3300003214 Bacteria 765387
29 Ga0007423J48922_100245 3300003285 Bacteria 6110
30 Ga0006781J51513_1017245 3300003568 Bacteria 2071
31 Ga0006562J51391_1032679 3300003578 Bacteria 11760
32 Ga0006562J51391_1032682 3300003578 Bacteria 10200
33 Ga0007429J51699_1045605 3300003579 Bacteria 817
34 Ga0007429J51699_1064618 3300003579 Bacteria 1781
35 Ga0006780_1011353 3300003735 Bacteria 3476
36 Ga0055539_1006455 3300003752 Bacteria 1499
37 Ga0055542_1000017 3300003762 Bacteria 348744
38 Ga0055529_1000023 3300003763 Bacteria 314383
39 Ga0055540_1000057 3300003792 Bacteria 136356
40 Ga0055540_1004388 3300003792 Bacteria 6387
41 Ga0055540_1009880 3300003792 Bacteria 3235
42 Ga0055540_1016644 3300003792 Bacteria 2083
43 JGI25405J52794_10023184 3300003911 Bacteria 1262
44 Ga0065714_10068195 3300005288 Bacteria 4900
45 Ga0065714_10127339 3300005288 Bacteria 1283
46 Ga0065714_10128825 3300005288 Bacteria 1269
47 Ga0065714_10180099 3300005288 Bacteria 966
48 Ga0065714_10225455 3300005288 Bacteria 830
49 Ga0065714_10226292 3300005288 Bacteria 828
50 Ga0065712_10099900 3300005290 Bacteria 2077
51 Ga0070658_10007350 3300005327 Bacteria 8899
52 Ga0070658_10036596 3300005327 Bacteria 3956
53 Ga0070658_10052407 3300005327 Bacteria 3309
54 Ga0070658_10065597 3300005327 Bacteria 2963
55 Ga0070658_10170067 3300005327 Bacteria 1830
56 Ga0070658_10207444 3300005327 Bacteria 1655
57 Ga0070658_10245614 3300005327 Bacteria 1518
58 Ga0070676_10013868 3300005328 Bacteria 4421
59 Ga0070676_10108855 3300005328 Bacteria 1723
60 Ga0070676_10649297 3300005328 Bacteria 766
61 Ga0070683_100002925 3300005329 Bacteria 13686
62 Ga0070683_100005291 3300005329 Bacteria 10749
63 Ga0070683_100376374 3300005329 Bacteria 1353
64 Ga0070690_100001859 3300005330 Bacteria 11199
65 Ga0070690_100232940 3300005330 Bacteria 1296
66 Ga0070670_100058829 3300005331 Bacteria 3299
67 Ga0068869_100084842 3300005334 Bacteria 2371
68 Ga0070666_10004074 3300005335 Bacteria 8875
69 Ga0070666_10202121 3300005335 Bacteria 1398
70 Ga0070682_100016306 3300005337 Bacteria 4318
71 Ga0070682_100029896 3300005337 Bacteria 3284
72 Ga0070682_100057509 3300005337 Bacteria 2450
73 Ga0070682_100069578 3300005337 Bacteria 2248
74 Ga0070682_100227290 3300005337 Bacteria 1332
75 Ga0070682_100272480 3300005337 Bacteria 1230
76 Ga0070682_100285939 3300005337 Bacteria 1204
77 Ga0068868_100001302 3300005338 Bacteria 17195
78 Ga0068868_100058460 3300005338 Bacteria 3047
79 Ga0068868_100153555 3300005338 Bacteria 1897
80 Ga0068868_100270642 3300005338 Bacteria 1435
81 Ga0068868_100619552 3300005338 Bacteria 961
82 Ga0068868_100632007 3300005338 Bacteria 951
83 Ga0070660_100097022 3300005339 Bacteria 2332
84 Ga0070660_100126694 3300005339 Bacteria 2041
85 Ga0070660_100378725 3300005339 Bacteria 1168
86 Ga0070660_100435252 3300005339 Bacteria 1087
87 Ga0070689_100038951 3300005340 Bacteria 3638
88 Ga0070689_100185179 3300005340 Bacteria 1693
89 Ga0070691_10000684 3300005341 Bacteria 13222
90 Ga0070691_10055518 3300005341 Bacteria 1897
91 Ga0070687_100330061 3300005343 Bacteria 978
92 Ga0070687_100332120 3300005343 Bacteria 975
93 Ga0070692_10092708 3300005345 Bacteria 1644
94 Ga0070692_10393311 3300005345 Bacteria 873
95 Ga0070692_10440528 3300005345 Bacteria 832
96 Ga0070692_10596993 3300005345 Bacteria 730
97 Ga0070668_100001456 3300005347 Bacteria 17104
98 Ga0070668_100020142 3300005347 Bacteria 5030
99 Ga0070668_100084941 3300005347 Bacteria 2487
100 Ga0070668_100102518 3300005347 Bacteria 2269
101 Ga0070668_100279222 3300005347 Bacteria 1394
102 Ga0070668_100554718 3300005347 Bacteria 1000
103 Ga0070668_101169999 3300005347 Bacteria 696
104 Ga0070669_100004418 3300005353 Bacteria 10144
105 Ga0070669_100044484 3300005353 Bacteria 3235
106 Ga0070669_100133619 3300005353 Bacteria 1906
107 Ga0070675_101140593 3300005354 Bacteria 717
108 Ga0070671_100002781 3300005355 Bacteria 13594
109 Ga0070671_100075602 3300005355 Bacteria 2814
110 Ga0070671_100428683 3300005355 Bacteria 1133
111 Ga0070671_100467829 3300005355 Bacteria 1082
112 Ga0070674_100001031 3300005356 Bacteria 14566
113 Ga0070674_100004224 3300005356 Bacteria 8162
114 Ga0070674_100163583 3300005356 Bacteria 1690
115 Ga0070674_100313073 3300005356 Bacteria 1256
116 Ga0070673_100057901 3300005364 Bacteria 3063
117 Ga0070673_100202797 3300005364 Bacteria 1709
118 Ga0070688_100040398 3300005365 Bacteria 2859
119 Ga0070688_100108325 3300005365 Bacteria 1843
120 Ga0070659_100116239 3300005366 Bacteria 2162
121 Ga0070667_100000063 3300005367 Bacteria 138777
122 Ga0070667_100003592 3300005367 Bacteria 13194
123 Ga0070667_100020470 3300005367 Bacteria 5492
124 Ga0070667_100077308 3300005367 Bacteria 2842
125 Ga0070667_100222013 3300005367 Bacteria 1682
126 Ga0070667_100586459 3300005367 Bacteria 1026
127 Ga0070667_100955093 3300005367 Bacteria 799
128 Ga0070709_10012771 3300005434 Bacteria 4706
129 Ga0070709_10035781 3300005434 Bacteria 3020
130 Ga0070709_10106104 3300005434 Bacteria 1880
131 Ga0070714_100097682 3300005435 Bacteria 2582
132 Ga0070714_100131541 3300005435 Bacteria 2237
133 Ga0070714_100220314 3300005435 Bacteria 1743
134 Ga0070714_100426128 3300005435 Bacteria 1257
135 Ga0070714_100836029 3300005435 Bacteria 892
136 Ga0070714_100929831 3300005435 Bacteria 845
137 Ga0070713_100010550 3300005436 Bacteria 6678
138 Ga0070713_100063045 3300005436 Bacteria 3106
139 Ga0070710_10000170 3300005437 Bacteria 30007
140 Ga0070710_10086143 3300005437 Bacteria 1844
141 Ga0070710_10091914 3300005437 Bacteria 1791
142 Ga0070701_10017749 3300005438 Bacteria 3332
143 Ga0070701_10058316 3300005438 Bacteria 2026
144 Ga0070701_10113895 3300005438 Bacteria 1515
145 Ga0070711_100000327 3300005439 Bacteria 24630
146 Ga0070711_100057285 3300005439 Bacteria 2698
147 Ga0070705_100009547 3300005440 Bacteria 4828
148 Ga0070705_100016831 3300005440 Bacteria 3806
149 Ga0070705_100066626 3300005440 Bacteria 2160
150 Ga0070700_100015828 3300005441 Bacteria 4286
151 Ga0070700_100023501 3300005441 Bacteria 3605
152 Ga0070700_100074882 3300005441 Bacteria 2170
153 Ga0070694_100092053 3300005444 Bacteria 2130
154 Ga0070694_100461561 3300005444 Bacteria 1004
155 Ga0070708_100398506 3300005445 Bacteria 1298
156 Ga0070663_100000066 3300005455 Bacteria 45121
157 Ga0070663_100095231 3300005455 Bacteria 2212
158 Ga0070663_100244187 3300005455 Bacteria 1419
159 Ga0070663_100698980 3300005455 Bacteria 862
160 Ga0070663_100951066 3300005455 Bacteria 745
161 Ga0070678_100000105 3300005456 Bacteria 32409
162 Ga0070678_100181660 3300005456 Bacteria 1722
163 Ga0070678_100186562 3300005456 Bacteria 1702
164 Ga0070678_100267679 3300005456 Bacteria 1440
165 Ga0070678_100328699 3300005456 Bacteria 1308
166 Ga0070678_100433832 3300005456 Bacteria 1148
167 Ga0070678_100669366 3300005456 Bacteria 932
168 Ga0070678_100696239 3300005456 Bacteria 915
169 Ga0070678_100711350 3300005456 Bacteria 906
170 Ga0070662_100013920 3300005457 Bacteria 5359
171 Ga0070681_10187707 3300005458 Bacteria 1987
172 Ga0070681_10462752 3300005458 Bacteria 1181
173 Ga0070681_11026109 3300005458 Bacteria 745
174 Ga0068867_100000723 3300005459 Bacteria 22069
175 Ga0068867_100084233 3300005459 Bacteria 2401
176 Ga0068867_100775014 3300005459 Bacteria 853
177 Ga0068867_100898079 3300005459 Bacteria 797
178 Ga0070685_10038005 3300005466 Bacteria 2728
179 Ga0070685_10068320 3300005466 Bacteria 2099
180 Ga0070707_100070332 3300005468 Bacteria 3371
181 Ga0070698_100036887 3300005471 Bacteria 5044
182 Ga0070679_100168141 3300005530 Bacteria 2165
183 Ga0070679_100179119 3300005530 Bacteria 2092
184 Ga0070679_100192160 3300005530 Bacteria 2010
185 Ga0070679_100218819 3300005530 Bacteria 1866
186 Ga0070679_100679874 3300005530 Bacteria 972
187 Ga0070684_100002996 3300005535 Bacteria 12573
188 Ga0070684_100128019 3300005535 Bacteria 2289
189 Ga0070684_100664926 3300005535 Bacteria 970
190 Ga0070684_100801116 3300005535 Bacteria 881
191 Ga0068853_100004749 3300005539 Bacteria 10561
192 Ga0068853_100105330 3300005539 Bacteria 2498
193 Ga0068853_100113957 3300005539 Bacteria 2404
194 Ga0068853_100271861 3300005539 Bacteria 1561
195 Ga0068853_100319131 3300005539 Bacteria 1440
196 Ga0068853_100341205 3300005539 Bacteria 1392
197 Ga0068853_100865855 3300005539 Bacteria 867
198 Ga0070672_100233895 3300005543 Bacteria 1544
199 Ga0070672_100545062 3300005543 Bacteria 1007
200 Ga0070686_100183266 3300005544 Bacteria 1489
201 Ga0070686_100255224 3300005544 Bacteria 1282
202 Ga0070686_100295262 3300005544 Bacteria 1200
203 Ga0070695_100138181 3300005545 Bacteria 1686
204 Ga0070696_100001184 3300005546 Bacteria 16907
205 Ga0070696_100029704 3300005546 Bacteria 3739
206 Ga0070696_100207002 3300005546 Bacteria 1467
207 Ga0070696_100252580 3300005546 Bacteria 1334
208 Ga0070693_100001801 3300005547 Bacteria 9762
209 Ga0070693_100091220 3300005547 Bacteria 1837
210 Ga0070665_100003486 3300005548 Bacteria 16751
211 Ga0070665_100004232 3300005548 Bacteria 15101
212 Ga0070665_100016876 3300005548 Bacteria 7320
213 Ga0070665_100021912 3300005548 Bacteria 6427
214 Ga0070665_100077582 3300005548 Bacteria 3328
215 Ga0070665_100149255 3300005548 Bacteria 2341
216 Ga0070665_100303804 3300005548 Bacteria 1599
217 Ga0070665_100630898 3300005548 Bacteria 1085
218 Ga0070665_100651929 3300005548 Bacteria 1066
219 Ga0070665_100774285 3300005548 Bacteria 972
220 Ga0070704_100000016 3300005549 Bacteria 57860
221 Ga0070704_100206369 3300005549 Bacteria 1589
222 Ga0068855_100101899 3300005563 Bacteria 3305
223 Ga0068855_100373522 3300005563 Bacteria 1567
224 Ga0070664_100053809 3300005564 Bacteria 3413
225 Ga0070664_100060127 3300005564 Bacteria 3234
226 Ga0070664_100304863 3300005564 Bacteria 1440
227 Ga0070664_100448781 3300005564 Bacteria 1184
228 Ga0068857_100165705 3300005577 Bacteria 2007
229 Ga0068857_100198908 3300005577 Bacteria 1826
230 Ga0068857_100239231 3300005577 Bacteria 1662
231 Ga0068854_100061462 3300005578 Bacteria 2721
232 Ga0068854_100077266 3300005578 Bacteria 2449
233 Ga0068854_100137026 3300005578 Bacteria 1875
234 Ga0068854_100221202 3300005578 Bacteria 1498
235 Ga0068856_100356286 3300005614 Bacteria 1482
236 Ga0068856_100670502 3300005614 Bacteria 1058
237 Ga0070702_100005010 3300005615 Bacteria 6118
238 Ga0070702_100078712 3300005615 Bacteria 1968
239 Ga0070702_100121090 3300005615 Bacteria 1638
240 Ga0068852_100061563 3300005616 Bacteria 3262
241 Ga0068852_100382475 3300005616 Bacteria 1381
242 Ga0068859_100000777 3300005617 Bacteria 32236
243 Ga0068859_100000989 3300005617 Bacteria 29085
244 Ga0068859_100136415 3300005617 Bacteria 2527
245 Ga0068859_100414924 3300005617 Bacteria 1442
246 Ga0068859_100450299 3300005617 Bacteria 1383
247 Ga0068864_100051792 3300005618 Bacteria 3537
248 Ga0068864_100246904 3300005618 Bacteria 1656
249 Ga0068864_100377908 3300005618 Bacteria 1342
250 Ga0068864_100396433 3300005618 Bacteria 1311
251 Ga0068866_10000152 3300005718 Bacteria 31563
252 Ga0068866_10106627 3300005718 Bacteria 1555
253 Ga0068866_10108479 3300005718 Bacteria 1544
254 Ga0068861_100000157 3300005719 Bacteria 35512
255 Ga0068861_100491494 3300005719 Bacteria 1107
256 Ga0068851_10275388 3300005834 Bacteria 961
257 Ga0068863_100000159 3300005841 Bacteria 71831
258 Ga0068863_100000740 3300005841 Bacteria 32623
259 Ga0068863_100003604 3300005841 Bacteria 15290
260 Ga0068863_100037599 3300005841 Bacteria 4609
261 Ga0068858_100001068 3300005842 Bacteria 28330
262 Ga0068858_100019278 3300005842 Bacteria 6379
263 Ga0068858_100081614 3300005842 Bacteria 3005
264 Ga0068858_100285182 3300005842 Bacteria 1573
265 Ga0068858_100854422 3300005842 Bacteria 889
266 Ga0068860_100000065 3300005843 Bacteria 186634
267 Ga0068860_100000214 3300005843 Bacteria 90752
268 Ga0068860_100000520 3300005843 Bacteria 47181
269 Ga0068860_100000663 3300005843 Bacteria 39893
270 Ga0068860_100050567 3300005843 Bacteria 3956
271 Ga0068860_100140960 3300005843 Bacteria 2317
272 Ga0068860_100621157 3300005843 Bacteria 1087
273 Ga0068860_100651399 3300005843 Bacteria 1061
274 Ga0068862_100000028 3300005844 Bacteria 184197
275 Ga0068862_100052035 3300005844 Bacteria 3503
276 Ga0068862_100233169 3300005844 Bacteria 1671
277 Ga0068862_100554728 3300005844 Bacteria 1097
278 Ga0068862_100977863 3300005844 Bacteria 836
279 Ga0081455_10000873 3300005937 Bacteria 38958
280 Ga0081455_10009524 3300005937 Bacteria 9978
281 Ga0081455_10021629 3300005937 Bacteria 6028
282 Ga0081455_10077029 3300005937 Bacteria 2745
283 Ga0081455_10116150 3300005937 Bacteria 2117
284 Ga0081538_10138881 3300005981 Bacteria 1125
285 Ga0081540_1048325 3300005983 Bacteria 2132
286 Ga0081539_10001153 3300005985 Bacteria 47882
287 Ga0081539_10001159 3300005985 Bacteria 47725
288 Ga0081539_10011421 3300005985 Bacteria 7019
289 Ga0081539_10039734 3300005985 Bacteria 2772
290 Ga0081539_10088852 3300005985 Bacteria 1602
291 Ga0081539_10102540 3300005985 Bacteria 1456
292 Ga0070717_10377339 3300006028 Bacteria 1271
293 Ga0075365_10018905 3300006038 Bacteria 4243
294 Ga0075365_10033559 3300006038 Bacteria 3309
295 Ga0075365_10038012 3300006038 Bacteria 3126
296 Ga0075365_10047812 3300006038 Bacteria 2813
297 Ga0075365_10050161 3300006038 Bacteria 2753
298 Ga0075365_10080556 3300006038 Bacteria 2205
299 Ga0075365_10100827 3300006038 Bacteria 1977
300 Ga0075365_10133449 3300006038 Bacteria 1719
301 Ga0075365_10142973 3300006038 Bacteria 1661
302 Ga0075365_10174172 3300006038 Bacteria 1502
303 Ga0075365_10252513 3300006038 Bacteria 1239
304 Ga0075365_10326759 3300006038 Bacteria 1080
305 Ga0075365_10348690 3300006038 Bacteria 1043
306 Ga0075368_10001314 3300006042 Bacteria 7870
307 Ga0075368_10010344 3300006042 Bacteria 3371
308 Ga0075363_100000364 3300006048 Bacteria 13662
309 Ga0075363_100002709 3300006048 Bacteria 7329
310 Ga0075363_100009318 3300006048 Bacteria 4613
311 Ga0075363_100020572 3300006048 Bacteria 3311
312 Ga0075363_100035986 3300006048 Bacteria 2594
313 Ga0075363_100040621 3300006048 Bacteria 2452
314 Ga0075363_100055140 3300006048 Bacteria 2128
315 Ga0075363_100068975 3300006048 Bacteria 1918
316 Ga0075363_100077541 3300006048 Bacteria 1813
317 Ga0075363_100141102 3300006048 Bacteria 1357
318 Ga0075363_100507485 3300006048 Bacteria 717
319 Ga0075364_10003349 3300006051 Bacteria 9092
320 Ga0075364_10004420 3300006051 Bacteria 8085
321 Ga0075364_10008281 3300006051 Bacteria 6210
322 Ga0075364_10017035 3300006051 Bacteria 4531
323 Ga0075364_10017435 3300006051 Bacteria 4486
324 Ga0075364_10036950 3300006051 Bacteria 3160
325 Ga0075364_10041030 3300006051 Bacteria 3003
326 Ga0075364_10050012 3300006051 Bacteria 2727
327 Ga0075364_10054415 3300006051 Bacteria 2617
328 Ga0075364_10075060 3300006051 Bacteria 2230
329 Ga0075364_10108791 3300006051 Bacteria 1849
330 Ga0075364_10135076 3300006051 Bacteria 1657
331 Ga0075364_10256766 3300006051 Bacteria 1188
332 Ga0075364_10283624 3300006051 Bacteria 1127
333 Ga0075364_10314977 3300006051 Bacteria 1065
334 Ga0075364_10352998 3300006051 Bacteria 1002
335 Ga0075432_10005548 3300006058 Bacteria 4296
336 Ga0075432_10089176 3300006058 Bacteria 1127
337 Ga0075432_10163937 3300006058 Bacteria 861
338 Ga0070715_10218788 3300006163 Bacteria 978
339 Ga0070716_100032534 3300006173 Bacteria 2845
340 Ga0070716_100085602 3300006173 Bacteria 1894
341 Ga0070716_100248660 3300006173 Bacteria 1210
342 Ga0070712_100000926 3300006175 Bacteria 17635
343 Ga0070712_100019484 3300006175 Bacteria 4426
344 Ga0070712_100375532 3300006175 Bacteria 1169
345 Ga0075362_10028655 3300006177 Bacteria 2393
346 Ga0075362_10045940 3300006177 Bacteria 1941
347 Ga0075362_10090970 3300006177 Bacteria 1416
348 Ga0075362_10265740 3300006177 Bacteria 846
349 Ga0075367_10000349 3300006178 Bacteria 16510
350 Ga0075367_10006336 3300006178 Bacteria 5967
351 Ga0075367_10008508 3300006178 Bacteria 5320
352 Ga0075367_10106767 3300006178 Bacteria 1716
353 Ga0075367_10204965 3300006178 Bacteria 1232
354 Ga0075367_10219744 3300006178 Bacteria 1189
355 Ga0075367_10226819 3300006178 Bacteria 1170
356 Ga0075367_10441324 3300006178 Bacteria 825
357 Ga0075367_10444307 3300006178 Bacteria 822
358 Ga0075367_10525892 3300006178 Bacteria 751
359 Ga0075369_10006451 3300006186 Bacteria 4436
360 Ga0075369_10008548 3300006186 Bacteria 3943
361 Ga0075369_10011511 3300006186 Bacteria 3482
362 Ga0075369_10012427 3300006186 Bacteria 3364
363 Ga0075369_10027424 3300006186 Bacteria 2381
364 Ga0075369_10029755 3300006186 Bacteria 2296
365 Ga0075369_10040367 3300006186 Bacteria 1994
366 Ga0075369_10055060 3300006186 Bacteria 1728
367 Ga0075369_10059194 3300006186 Bacteria 1669
368 Ga0075369_10168347 3300006186 Bacteria 1005
369 Ga0075369_10181246 3300006186 Bacteria 969
370 Ga0075366_10338460 3300006195 Bacteria 923
371 Ga0097621_100079038 3300006237 Bacteria 2733
372 Ga0097621_100245407 3300006237 Bacteria 1567
373 Ga0075370_10001708 3300006353 Bacteria 9755
374 Ga0075370_10001851 3300006353 Bacteria 9478
375 Ga0075370_10024027 3300006353 Bacteria 3362
376 Ga0075370_10028681 3300006353 Bacteria 3095
377 Ga0075370_10053682 3300006353 Bacteria 2287
378 Ga0075370_10073119 3300006353 Bacteria 1963
379 Ga0075370_10122697 3300006353 Bacteria 1513
380 Ga0075370_10149920 3300006353 Bacteria 1367
381 Ga0075370_10302414 3300006353 Bacteria 951
382 Ga0068871_100055089 3300006358 Bacteria 3227
383 Ga0068871_100204039 3300006358 Bacteria 1708
384 Ga0068871_100385217 3300006358 Bacteria 1246
385 Ga0068871_100560249 3300006358 Bacteria 1036
386 Ga0075428_100710879 3300006844 Bacteria 1070
387 Ga0075428_100913642 3300006844 Bacteria 931
388 Ga0075431_100471737 3300006847 Bacteria 1249
389 Ga0075434_100945825 3300006871 Bacteria 876
390 Ga0068865_100001042 3300006881 Bacteria 15923
391 Ga0068865_100069240 3300006881 Bacteria 2497
392 Ga0068865_100240174 3300006881 Bacteria 1425
393 Ga0068865_100273685 3300006881 Bacteria 1342
394 Ga0068865_100473349 3300006881 Bacteria 1040
395 Ga0075436_100661462 3300006914 Bacteria 772
396 Ga0097620_100000777 3300006931 Bacteria 32236
397 Ga0097620_100000989 3300006931 Bacteria 29085
398 Ga0097620_100136415 3300006931 Bacteria 2527
399 Ga0097620_100414926 3300006931 Bacteria 1442
400 Ga0097620_100450311 3300006931 Bacteria 1383
401 Ga0099795_10027588 3300007788 Bacteria 1922
402 Ga0099795_10112493 3300007788 Bacteria 1080
403 Ga0105251_10013879 3300009011 Bacteria 4481
404 Ga0105251_10230767 3300009011 Bacteria 834
405 Ga0105244_10013549 3300009036 Bacteria 4758
406 Ga0105244_10105049 3300009036 Bacteria 1378
407 Ga0105244_10114558 3300009036 Bacteria 1309
408 Ga0105244_10125464 3300009036 Bacteria 1241
409 Ga0105244_10292098 3300009036 Bacteria 755
410 Ga0105250_10056956 3300009092 Bacteria 1568
411 Ga0105250_10092952 3300009092 Bacteria 1228
412 Ga0105250_10190799 3300009092 Bacteria 862
413 Ga0105240_10858087 3300009093 Bacteria 979
414 Ga0105240_11158795 3300009093 Bacteria 820
415 Ga0105240_11531599 3300009093 Bacteria 699
416 Ga0111539_10127148 3300009094 Bacteria 2985
417 Ga0111539_10161618 3300009094 Bacteria 2619
418 Ga0111539_10470214 3300009094 Bacteria 1464
419 Ga0111539_12002692 3300009094 Bacteria 672
420 Ga0105245_10000172 3300009098 Bacteria 61572
421 Ga0105245_10009129 3300009098 Bacteria 8646
422 Ga0105245_10056993 3300009098 Bacteria 3513
423 Ga0105245_10114201 3300009098 Bacteria 2515
424 Ga0105245_10158054 3300009098 Bacteria 2149
425 Ga0105245_10165675 3300009098 Bacteria 2101
426 Ga0105245_10214561 3300009098 Bacteria 1854
427 Ga0105245_10271765 3300009098 Bacteria 1653
428 Ga0105245_10297267 3300009098 Bacteria 1583
429 Ga0105245_10389919 3300009098 Bacteria 1389
430 Ga0105245_10394668 3300009098 Bacteria 1381
431 Ga0105245_10416694 3300009098 Bacteria 1345
432 Ga0105245_10764125 3300009098 Bacteria 1003
433 Ga0105245_10879446 3300009098 Bacteria 937
434 Ga0105245_10888474 3300009098 Bacteria 932
435 Ga0105247_10000009 3300009101 Bacteria 385991
436 Ga0105247_10000451 3300009101 Bacteria 34877
437 Ga0105247_10070046 3300009101 Bacteria 2190
438 Ga0105247_10129360 3300009101 Bacteria 1644
439 Ga0105247_10166960 3300009101 Bacteria 1461
440 Ga0114129_10251226 3300009147 Bacteria 2374
441 Ga0114129_10365314 3300009147 Bacteria 1909
442 Ga0105243_10001407 3300009148 Bacteria 21285
443 Ga0105243_10010174 3300009148 Bacteria 7153
444 Ga0105243_10036529 3300009148 Bacteria 3814
445 Ga0105243_10043093 3300009148 Bacteria 3536
446 Ga0105243_10048710 3300009148 Bacteria 3341
447 Ga0105243_10076149 3300009148 Bacteria 2725
448 Ga0105243_10190325 3300009148 Bacteria 1792
449 Ga0105243_10602177 3300009148 Bacteria 1058
450 Ga0105243_11306310 3300009148 Bacteria 743
451 Ga0105241_10017718 3300009174 Bacteria 5237
452 Ga0105241_10052975 3300009174 Bacteria 3101
453 Ga0105242_10000281 3300009176 Bacteria 40643
454 Ga0105242_10008466 3300009176 Bacteria 7903
455 Ga0105242_10048975 3300009176 Bacteria 3437
456 Ga0105242_10189303 3300009176 Bacteria 1821
457 Ga0105242_10307760 3300009176 Bacteria 1449
458 Ga0105242_10335033 3300009176 Bacteria 1393
459 Ga0105242_10488746 3300009176 Bacteria 1168
460 Ga0105242_11012757 3300009176 Bacteria 839
461 Ga0105242_11295074 3300009176 Bacteria 752
462 Ga0105248_10000186 3300009177 Bacteria 72427
463 Ga0105248_10001346 3300009177 Bacteria 27382
464 Ga0105248_10026572 3300009177 Bacteria 6438
465 Ga0105248_10058233 3300009177 Bacteria 4338
466 Ga0105248_10206396 3300009177 Bacteria 2214
467 Ga0105248_10319926 3300009177 Bacteria 1747
468 Ga0105248_10682811 3300009177 Bacteria 1158
469 Ga0105248_10880487 3300009177 Bacteria 1011
470 Ga0105237_10037656 3300009545 Bacteria 4887
471 Ga0105237_10058531 3300009545 Bacteria 3856
472 Ga0105237_10067816 3300009545 Bacteria 3561
473 Ga0105237_10195641 3300009545 Bacteria 2022
474 Ga0105237_10245778 3300009545 Bacteria 1791
475 Ga0105238_10027437 3300009551 Bacteria 5802
476 Ga0105238_10038061 3300009551 Bacteria 4887
477 Ga0105238_10191309 3300009551 Bacteria 2022
478 Ga0105238_10256238 3300009551 Bacteria 1729
479 Ga0105238_10691082 3300009551 Bacteria 1032
480 Ga0105238_11367643 3300009551 Bacteria 735
481 Ga0105249_10000011 3300009553 Bacteria 292812
482 Ga0105249_10089379 3300009553 Bacteria 2879
483 Ga0105249_10175830 3300009553 Bacteria 2079
484 Ga0105249_10228292 3300009553 Bacteria 1835
485 Ga0105249_10245276 3300009553 Bacteria 1773
486 Ga0105249_10318134 3300009553 Bacteria 1567
487 Ga0105249_10575465 3300009553 Bacteria 1179
488 Ga0105249_10708684 3300009553 Bacteria 1067
489 Ga0105148_111343 3300009978 Bacteria 683
490 Ga0105033_104336 3300009986 Bacteria 1206
491 Ga0105033_109591 3300009986 Bacteria 848
492 Ga0105035_102655 3300009988 Bacteria 1331
493 Ga0105028_106112 3300009993 Bacteria 1256
494 Ga0099796_10290635 3300010159 Bacteria 690
495 Ga0105239_10012474 3300010375 Bacteria 9464
496 Ga0105239_10046896 3300010375 Bacteria 4734
497 Ga0105239_10118564 3300010375 Bacteria 2937
498 Ga0105239_10189334 3300010375 Bacteria 2303
499 Ga0105239_10202287 3300010375 Bacteria 2225
500 Ga0105239_10248624 3300010375 Bacteria 1997
501 Ga0105239_10615116 3300010375 Bacteria 1240
502 Ga0105239_11017100 3300010375 Bacteria 953
503 Ga0105239_11033230 3300010375 Bacteria 945
504 Ga0105239_11179299 3300010375 Bacteria 882
505 Ga0105246_10000453 3300011119 Bacteria 22003
506 Ga0105246_10001313 3300011119 Bacteria 14635
507 Ga0105246_10002230 3300011119 Bacteria 11691
508 Ga0105246_10085286 3300011119 Bacteria 2261
509 Ga0105246_10106504 3300011119 Bacteria 2051
510 Ga0105246_10172365 3300011119 Bacteria 1658
511 Ga0105246_10212260 3300011119 Bacteria 1512
512 Ga0105246_10237858 3300011119 Bacteria 1438
513 Ga0105246_10240468 3300011119 Bacteria 1431
514 Ga0105246_10267002 3300011119 Bacteria 1366
515 Ga0105246_10384235 3300011119 Bacteria 1161
516 Ga0157318_1004668 3300012482 Bacteria 842
517 Ga0157326_1031416 3300012513 Bacteria 705
518 Ga0157373_10128811 3300013100 Bacteria 1780
519 Ga0157371_10113804 3300013102 Bacteria 1921
520 Ga0157370_10006087 3300013104 Bacteria 13393
521 Ga0157370_10316337 3300013104 Bacteria 1440
522 Ga0157370_10366195 3300013104 Bacteria 1328
523 Ga0157370_10391765 3300013104 Bacteria 1279
524 Ga0157370_10443519 3300013104 Bacteria 1194
525 Ga0157370_10590337 3300013104 Bacteria 1017
526 Ga0157369_10003564 3300013105 Bacteria 18497
527 Ga0157369_10014492 3300013105 Bacteria 8897
528 Ga0157369_10041050 3300013105 Bacteria 5051
529 Ga0157369_10139662 3300013105 Bacteria 2564
530 Ga0157369_10141293 3300013105 Bacteria 2548
531 Ga0157369_10200194 3300013105 Bacteria 2097
532 Ga0157369_10258875 3300013105 Bacteria 1815
533 Ga0157369_10292514 3300013105 Bacteria 1695
534 Ga0157369_10362610 3300013105 Bacteria 1504
535 Ga0157369_10406694 3300013105 Bacteria 1412
536 Ga0157369_10413156 3300013105 Bacteria 1399
537 Ga0157369_10491545 3300013105 Bacteria 1270
538 Ga0157369_10502648 3300013105 Bacteria 1254
539 Ga0157369_10572874 3300013105 Bacteria 1166
540 Ga0157369_10601143 3300013105 Bacteria 1135
541 Ga0157369_11457221 3300013105 Bacteria 697
542 Ga0171462_1003 3300013250 Bacteria 853796
543 Ga0157374_10058502 3300013296 Bacteria 3602
544 Ga0157374_10233253 3300013296 Bacteria 1808
545 Ga0157374_10523092 3300013296 Bacteria 1192
546 Ga0157374_10536436 3300013296 Bacteria 1177
547 Ga0157378_10000282 3300013297 Bacteria 49400
548 Ga0157378_10033250 3300013297 Bacteria 4557
549 Ga0157378_10200269 3300013297 Bacteria 1888
550 Ga0157378_10868244 3300013297 Bacteria 931
551 Ga0163162_10001346 3300013306 Bacteria 22877
552 Ga0163162_10008478 3300013306 Bacteria 10030
553 Ga0163162_10074340 3300013306 Bacteria 3457
554 Ga0163162_10168713 3300013306 Bacteria 2313
555 Ga0163162_10206622 3300013306 Bacteria 2093
556 Ga0163162_10242409 3300013306 Bacteria 1934
557 Ga0163162_10281134 3300013306 Bacteria 1796
558 Ga0163162_10391488 3300013306 Bacteria 1522
559 Ga0163162_10411219 3300013306 Bacteria 1485
560 Ga0163162_10549838 3300013306 Bacteria 1283
561 Ga0163162_11023250 3300013306 Bacteria 934
562 Ga0163162_11162481 3300013306 Bacteria 875
563 Ga0163162_11244451 3300013306 Bacteria 845
564 Ga0163162_11309445 3300013306 Bacteria 823
565 Ga0157372_10007256 3300013307 Bacteria 11802
566 Ga0157372_10008436 3300013307 Bacteria 10939
567 Ga0157372_10189646 3300013307 Bacteria 2381
568 Ga0157372_10198498 3300013307 Bacteria 2324
569 Ga0157372_10203453 3300013307 Bacteria 2294
570 Ga0157372_10316858 3300013307 Bacteria 1816
571 Ga0157372_10377278 3300013307 Bacteria 1652
572 Ga0157372_10577699 3300013307 Bacteria 1310
573 Ga0157372_10682421 3300013307 Bacteria 1196
574 Ga0157372_10711593 3300013307 Bacteria 1168
575 Ga0157372_10887642 3300013307 Bacteria 1035
576 Ga0157372_11203304 3300013307 Bacteria 875
577 Ga0157372_11317968 3300013307 Bacteria 833
578 Ga0157372_11416180 3300013307 Bacteria 801
579 Ga0157375_10000443 3300013308 Bacteria 37561
580 Ga0157375_10031503 3300013308 Bacteria 5014
581 Ga0157375_10063616 3300013308 Bacteria 3671
582 Ga0157375_10069146 3300013308 Bacteria 3536
583 Ga0157375_10175751 3300013308 Bacteria 2291
584 Ga0157375_10181792 3300013308 Bacteria 2254
585 Ga0157375_10214662 3300013308 Bacteria 2082
586 Ga0157375_10321371 3300013308 Bacteria 1712
587 Ga0157375_10494367 3300013308 Bacteria 1388
588 Ga0157375_10640399 3300013308 Bacteria 1220
589 Ga0157375_11087099 3300013308 Bacteria 936
590 Ga0157375_11293691 3300013308 Bacteria 857
591 Ga0157375_11317860 3300013308 Bacteria 849
592 Ga0157375_11352433 3300013308 Bacteria 838
593 Ga0157375_11970479 3300013308 Bacteria 694
594 Ga0163163_10014700 3300014325 Bacteria 7199
595 Ga0163163_10032885 3300014325 Bacteria 5012
596 Ga0163163_10072127 3300014325 Bacteria 3442
597 Ga0163163_10106281 3300014325 Bacteria 2833
598 Ga0163163_10432712 3300014325 Bacteria 1375
599 Ga0163163_10564973 3300014325 Bacteria 1200
600 Ga0163163_10886233 3300014325 Bacteria 956
601 Ga0163163_11229117 3300014325 Bacteria 812
602 Ga0157380_10035286 3300014326 Bacteria 3862
603 Ga0157380_10049176 3300014326 Bacteria 3324
604 Ga0157380_10070769 3300014326 Bacteria 2820
605 Ga0157380_10310642 3300014326 Bacteria 1457
606 Ga0157380_10316718 3300014326 Bacteria 1444
607 Ga0157380_10352449 3300014326 Bacteria 1378
608 Ga0157380_10362272 3300014326 Bacteria 1361
609 Ga0157380_10571509 3300014326 Bacteria 1113
610 Ga0157380_10580437 3300014326 Bacteria 1105
611 Ga0157380_10977769 3300014326 Bacteria 878
612 Ga0157380_11001072 3300014326 Bacteria 869
613 Ga0157380_11190060 3300014326 Bacteria 805
614 Ga0157380_11319791 3300014326 Bacteria 769
615 Ga0182008_10003852 3300014497 Bacteria 8913
616 Ga0182008_10059022 3300014497 Bacteria 1893
617 Ga0182008_10270969 3300014497 Bacteria 881
618 Ga0157377_10046561 3300014745 Bacteria 2426
619 Ga0157377_10125556 3300014745 Bacteria 1561
620 Ga0157377_10263320 3300014745 Bacteria 1123
621 Ga0157377_10655686 3300014745 Bacteria 756
622 Ga0157379_10010438 3300014968 Bacteria 8095
623 Ga0157379_10078759 3300014968 Bacteria 2952
624 Ga0157379_10098804 3300014968 Bacteria 2620
625 Ga0157379_10123989 3300014968 Bacteria 2324
626 Ga0157379_10189879 3300014968 Bacteria 1857
627 Ga0157379_10385140 3300014968 Bacteria 1287
628 Ga0157379_10441834 3300014968 Bacteria 1200
629 Ga0157379_10743543 3300014968 Bacteria 923
630 Ga0157379_11010874 3300014968 Bacteria 793
631 Ga0157376_10192353 3300014969 Bacteria 1872
632 Ga0157376_11384130 3300014969 Bacteria 735
633 Ga0182006_1042935 3300015261 Bacteria 1769
634 Ga0163161_10001593 3300017792 Bacteria 16741
635 Ga0163161_10178525 3300017792 Bacteria 1627
636 Ga0163161_10283852 3300017792 Bacteria 1299
637 Ga0163161_10336265 3300017792 Bacteria 1197
638 Ga0163161_10379019 3300017792 Bacteria 1130
639 Ga0163161_10576226 3300017792 Bacteria 925
640 Ga0163161_10679646 3300017792 Bacteria 855
641 Ga0163161_10810301 3300017792 Bacteria 787
642 Ga0163161_11063373 3300017792 Bacteria 694
643 Ga0197907_10053258 3300020069 Bacteria 7119
644 Ga0206356_10128213 3300020070 Bacteria 2622
645 Ga0206349_1184288 3300020075 Bacteria 1013
646 Ga0206349_1248741 3300020075 Bacteria 3259
647 Ga0206349_1380049 3300020075 Bacteria 2105
648 Ga0206352_11295339 3300020078 Bacteria 1091
649 Ga0206350_10317472 3300020080 Bacteria 3699
650 Ga0206350_11611524 3300020080 Bacteria 1360
651 Ga0206354_10526698 3300020081 Bacteria 760
652 Ga0206354_10663781 3300020081 Bacteria 10305
653 Ga0206353_10607526 3300020082 Bacteria 923
654 Ga0206353_11560231 3300020082 Bacteria 22870
655 Ga0206353_11704142 3300020082 Bacteria 1360
656 Ga0206353_11794715 3300020082 Bacteria 1211
657 Ga0213874_10231079 3300021377 Bacteria 675
658 Ga0213876_10021702 3300021384 Bacteria 3396
659 Ga0213876_10036533 3300021384 Bacteria 2591
660 Ga0213876_10045009 3300021384 Bacteria 2334
661 Ga0213876_10459845 3300021384 Bacteria 677
662 Ga0213875_10003439 3300021388 Bacteria 9012
663 Ga0213875_10014919 3300021388 Bacteria 3785
664 Ga0213875_10056891 3300021388 Bacteria 1832
665 Ga0209672_100003 3300025228 Bacteria 1560476
666 Ga0209147_100633 3300025229 Bacteria 18857
667 Ga0209563_100388 3300025230 Bacteria 15838
668 Ga0207427_100034 3300025231 Bacteria 320342
669 Ga0209437_100486 3300025233 Bacteria 29316
670 Ga0209258_101954 3300025242 Bacteria 6013
671 Ga0207425_1019073 3300025245 Bacteria 1482
672 Ga0209646_1000168 3300025246 Bacteria 86352
673 Ga0209677_100321 3300025253 Bacteria 30989
674 Ga0209148_1000004 3300025254 Bacteria 1844481
675 Ga0209148_1003685 3300025254 Bacteria 4069
676 Ga0209148_1003974 3300025254 Bacteria 3795
677 Ga0209129_1000028 3300025258 Bacteria 405451
678 Ga0209233_1000001 3300025261 Bacteria 2992747
679 Ga0209455_1000022 3300025272 Bacteria 688910
680 Ga0209455_1001078 3300025272 Bacteria 13442
681 Ga0209673_1018161 3300025273 Bacteria 2568
682 Ga0209025_1002052 3300025294 Bacteria 22929
683 Ga0207426_1018189 3300025302 Bacteria 2480
684 Ga0209051_1000075 3300025303 Bacteria 205011
685 Ga0209051_1000448 3300025303 Bacteria 54644
686 Ga0209051_1002630 3300025303 Bacteria 12609
687 Ga0209051_1009355 3300025303 Bacteria 5062
688 Ga0207697_10002620 3300025315 Bacteria 9253
689 Ga0207697_10033332 3300025315 Bacteria 2108
690 Ga0207696_1040603 3300025711 Bacteria 1362
691 Ga0207696_1048985 3300025711 Bacteria 1213
692 Ga0207696_1049774 3300025711 Bacteria 1201
693 Ga0207655_1002079 3300025728 Bacteria 16808
694 Ga0207655_1012416 3300025728 Bacteria 4980
695 Ga0207655_1026275 3300025728 Bacteria 2799
696 Ga0207655_1050757 3300025728 Bacteria 1683
697 Ga0207713_1075046 3300025735 Bacteria 1235
698 Ga0207653_10053415 3300025885 Bacteria 1350
699 Ga0207682_10030373 3300025893 Bacteria 2164
700 Ga0207692_10000599 3300025898 Bacteria 12787
701 Ga0207692_10002256 3300025898 Bacteria 7387
702 Ga0207692_10011571 3300025898 Bacteria 3760
703 Ga0207642_10000264 3300025899 Bacteria 15769
704 Ga0207642_10114528 3300025899 Bacteria 1379
705 Ga0207642_10193023 3300025899 Bacteria 1119
706 Ga0207710_10000014 3300025900 Bacteria 408072
707 Ga0207710_10000721 3300025900 Bacteria 18358
708 Ga0207688_10000335 3300025901 Bacteria 21839
709 Ga0207688_10002023 3300025901 Bacteria 10880
710 Ga0207688_10036380 3300025901 Bacteria 2728
711 Ga0207688_10062433 3300025901 Bacteria 2100
712 Ga0207688_10110505 3300025901 Bacteria 1595
713 Ga0207688_10386280 3300025901 Bacteria 867
714 Ga0207688_10517183 3300025901 Bacteria 748
715 Ga0207680_10046958 3300025903 Bacteria 2556
716 Ga0207680_10104139 3300025903 Bacteria 1828
717 Ga0207680_10168644 3300025903 Bacteria 1473
718 Ga0207680_10201881 3300025903 Bacteria 1355
719 Ga0207647_10014486 3300025904 Bacteria 5435
720 Ga0207647_10056436 3300025904 Bacteria 2410
721 Ga0207647_10156503 3300025904 Bacteria 1330
722 Ga0207647_10192515 3300025904 Bacteria 1181
723 Ga0207647_10273485 3300025904 Bacteria 965
724 Ga0207647_10543617 3300025904 Bacteria 645
725 Ga0207685_10363474 3300025905 Bacteria 733
726 Ga0207699_10006639 3300025906 Bacteria 5611
727 Ga0207699_10013278 3300025906 Bacteria 4212
728 Ga0207645_10015972 3300025907 Bacteria 4974
729 Ga0207645_10059697 3300025907 Bacteria 2436
730 Ga0207645_10247597 3300025907 Bacteria 1179
731 Ga0207643_10174754 3300025908 Bacteria 1298
732 Ga0207705_10016193 3300025909 Bacteria 5348
733 Ga0207654_10042464 3300025911 Bacteria 2573
734 Ga0207654_10135341 3300025911 Bacteria 1565
735 Ga0207707_10373802 3300025912 Bacteria 1226
736 Ga0207707_10784043 3300025912 Bacteria 795
737 Ga0207707_10835629 3300025912 Bacteria 765
738 Ga0207695_10341245 3300025913 Bacteria 1385
739 Ga0207695_10779348 3300025913 Bacteria 836
740 Ga0207671_10098190 3300025914 Bacteria 2215
741 Ga0207671_10433658 3300025914 Bacteria 1046
742 Ga0207671_11002164 3300025914 Bacteria 658
743 Ga0207693_10000049 3300025915 Bacteria 100347
744 Ga0207693_10000258 3300025915 Bacteria 48916
745 Ga0207693_10400335 3300025915 Bacteria 1073
746 Ga0207663_10000314 3300025916 Bacteria 21124
747 Ga0207663_10034113 3300025916 Bacteria 3040
748 Ga0207663_10434861 3300025916 Bacteria 1009
749 Ga0207663_10760927 3300025916 Bacteria 770
750 Ga0207662_10013512 3300025918 Bacteria 4566
751 Ga0207662_10781823 3300025918 Bacteria 672
752 Ga0207657_10033008 3300025919 Bacteria 4670
753 Ga0207657_10035850 3300025919 Bacteria 4443
754 Ga0207657_10113217 3300025919 Bacteria 2239
755 Ga0207657_10175963 3300025919 Bacteria 1732
756 Ga0207657_10213205 3300025919 Bacteria 1549
757 Ga0207657_10284810 3300025919 Bacteria 1311
758 Ga0207657_10492642 3300025919 Bacteria 960
759 Ga0207657_10507447 3300025919 Bacteria 944
760 Ga0207652_10088979 3300025921 Bacteria 2710
761 Ga0207652_10161826 3300025921 Bacteria 2007
762 Ga0207652_10425977 3300025921 Bacteria 1197
763 Ga0207652_11088857 3300025921 Bacteria 699
764 Ga0207646_10520655 3300025922 Bacteria 1071
765 Ga0207681_10003263 3300025923 Bacteria 10159
766 Ga0207681_10021594 3300025923 Bacteria 4095
767 Ga0207681_10026475 3300025923 Bacteria 3741
768 Ga0207694_10022807 3300025924 Bacteria 4748
769 Ga0207694_10160437 3300025924 Bacteria 1816
770 Ga0207694_10180071 3300025924 Bacteria 1714
771 Ga0207694_10585157 3300025924 Bacteria 938
772 Ga0207694_10723162 3300025924 Bacteria 840
773 Ga0207694_10824575 3300025924 Bacteria 784
774 Ga0207650_10054492 3300025925 Bacteria 2966
775 Ga0207650_10320443 3300025925 Bacteria 1269
776 Ga0207687_10000153 3300025927 Bacteria 46342
777 Ga0207687_10006190 3300025927 Bacteria 7921
778 Ga0207687_10015346 3300025927 Bacteria 5021
779 Ga0207687_10130971 3300025927 Bacteria 1890
780 Ga0207687_10186796 3300025927 Bacteria 1610
781 Ga0207687_11123759 3300025927 Bacteria 675
782 Ga0207700_10208146 3300025928 Bacteria 1652
783 Ga0207664_10002749 3300025929 Bacteria 11679
784 Ga0207664_10019234 3300025929 Bacteria 5044
785 Ga0207664_10029135 3300025929 Bacteria 4203
786 Ga0207664_10246438 3300025929 Bacteria 1558
787 Ga0207644_10005846 3300025931 Bacteria 8016
788 Ga0207644_10112848 3300025931 Bacteria 2058
789 Ga0207644_10133398 3300025931 Bacteria 1904
790 Ga0207644_10487923 3300025931 Bacteria 1015
791 Ga0207690_10383259 3300025932 Bacteria 1118
792 Ga0207706_10010210 3300025933 Bacteria 8588
793 Ga0207706_10074314 3300025933 Bacteria 2989
794 Ga0207686_10047600 3300025934 Bacteria 2652
795 Ga0207686_10165113 3300025934 Bacteria 1556
796 Ga0207686_10601788 3300025934 Bacteria 865
797 Ga0207686_10775344 3300025934 Bacteria 767
798 Ga0207709_10004736 3300025935 Bacteria 7811
799 Ga0207709_10016230 3300025935 Bacteria 4138
800 Ga0207709_10035744 3300025935 Bacteria 2939
801 Ga0207709_10214170 3300025935 Bacteria 1385
802 Ga0207709_10254401 3300025935 Bacteria 1285
803 Ga0207709_10375087 3300025935 Bacteria 1081
804 Ga0207709_10400688 3300025935 Bacteria 1049
805 Ga0207709_10448446 3300025935 Bacteria 997
806 Ga0207709_10568692 3300025935 Bacteria 894
807 Ga0207709_10962427 3300025935 Bacteria 696
808 Ga0207670_10030292 3300025936 Bacteria 3456
809 Ga0207670_10185364 3300025936 Bacteria 1570
810 Ga0207670_10418883 3300025936 Bacteria 1074
811 Ga0207669_10000277 3300025937 Bacteria 23524
812 Ga0207669_10016487 3300025937 Bacteria 3755
813 Ga0207669_10225519 3300025937 Bacteria 1378
814 Ga0207669_10269687 3300025937 Bacteria 1278
815 Ga0207669_10307933 3300025937 Bacteria 1207
816 Ga0207669_10362644 3300025937 Bacteria 1123
817 Ga0207669_10518063 3300025937 Bacteria 957
818 Ga0207704_10000115 3300025938 Bacteria 44598
819 Ga0207704_10096581 3300025938 Bacteria 1957
820 Ga0207704_10301161 3300025938 Bacteria 1228
821 Ga0207704_10756838 3300025938 Bacteria 808
822 Ga0207665_10003528 3300025939 Bacteria 10446
823 Ga0207665_10011384 3300025939 Bacteria 5842
824 Ga0207665_10053737 3300025939 Bacteria 2715
825 Ga0207665_10232995 3300025939 Bacteria 1354
826 Ga0207665_10350928 3300025939 Bacteria 1114
827 Ga0207665_10461719 3300025939 Bacteria 976
828 Ga0207691_10000233 3300025940 Bacteria 54222
829 Ga0207691_10054880 3300025940 Bacteria 3634
830 Ga0207691_10071886 3300025940 Bacteria 3121
831 Ga0207691_10450599 3300025940 Bacteria 1095
832 Ga0207691_10820040 3300025940 Bacteria 781
833 Ga0207711_10000373 3300025941 Bacteria 47596
834 Ga0207711_10103833 3300025941 Bacteria 2517
835 Ga0207711_10109378 3300025941 Bacteria 2456
836 Ga0207711_10217068 3300025941 Bacteria 1748
837 Ga0207711_10356647 3300025941 Bacteria 1354
838 Ga0207711_10390839 3300025941 Bacteria 1291
839 Ga0207689_10014356 3300025942 Bacteria 6738
840 Ga0207689_10049054 3300025942 Bacteria 3484
841 Ga0207661_10007359 3300025944 Bacteria 7832
842 Ga0207661_10117609 3300025944 Bacteria 2258
843 Ga0207661_10284259 3300025944 Bacteria 1479
844 Ga0207661_10516679 3300025944 Bacteria 1092
845 Ga0207661_10542640 3300025944 Bacteria 1065
846 Ga0207661_10588874 3300025944 Bacteria 1020
847 Ga0207679_10408148 3300025945 Bacteria 1196
848 Ga0207679_10602442 3300025945 Bacteria 990
849 Ga0207679_11104161 3300025945 Bacteria 728
850 Ga0207667_10034806 3300025949 Bacteria 5406
851 Ga0207667_10320831 3300025949 Bacteria 1582
852 Ga0207667_10452949 3300025949 Bacteria 1304
853 Ga0207651_10038678 3300025960 Bacteria 3138
854 Ga0207712_10000020 3300025961 Bacteria 292796
855 Ga0207712_10005489 3300025961 Bacteria 7999
856 Ga0207712_10017769 3300025961 Bacteria 4624
857 Ga0207712_10106493 3300025961 Bacteria 2095
858 Ga0207712_10125455 3300025961 Bacteria 1948
859 Ga0207712_10135798 3300025961 Bacteria 1881
860 Ga0207712_10208731 3300025961 Bacteria 1554
861 Ga0207668_10003692 3300025972 Bacteria 9007
862 Ga0207668_10062888 3300025972 Bacteria 2616
863 Ga0207668_10091025 3300025972 Bacteria 2240
864 Ga0207668_10114285 3300025972 Bacteria 2032
865 Ga0207668_10394774 3300025972 Bacteria 1168
866 Ga0207668_10523393 3300025972 Bacteria 1023
867 Ga0207668_10531294 3300025972 Bacteria 1016
868 Ga0207668_10610342 3300025972 Bacteria 951
869 Ga0207668_10672414 3300025972 Bacteria 908
870 Ga0207640_10037694 3300025981 Bacteria 3044
871 Ga0207640_10063136 3300025981 Bacteria 2460
872 Ga0207640_10190096 3300025981 Bacteria 1547
873 Ga0207658_10000573 3300025986 Bacteria 33277
874 Ga0207658_10008307 3300025986 Bacteria 7069
875 Ga0207658_10028388 3300025986 Bacteria 3941
876 Ga0207658_10058175 3300025986 Bacteria 2875
877 Ga0207658_10112722 3300025986 Bacteria 2153
878 Ga0207658_10121217 3300025986 Bacteria 2085
879 Ga0207658_10299785 3300025986 Bacteria 1384
880 Ga0207658_10349572 3300025986 Bacteria 1287
881 Ga0207677_10003884 3300026023 Bacteria 7954
882 Ga0207677_10082631 3300026023 Bacteria 2309
883 Ga0207677_10362580 3300026023 Bacteria 1218
884 Ga0207677_10381424 3300026023 Bacteria 1190
885 Ga0207677_10520298 3300026023 Bacteria 1032
886 Ga0207677_10912741 3300026023 Bacteria 792
887 Ga0207703_10011762 3300026035 Bacteria 6810
888 Ga0207703_10023372 3300026035 Bacteria 4854
889 Ga0207703_10030413 3300026035 Bacteria 4268
890 Ga0207703_10219706 3300026035 Bacteria 1698
891 Ga0207639_10008892 3300026041 Bacteria 6908
892 Ga0207639_10059075 3300026041 Bacteria 2952
893 Ga0207639_10108887 3300026041 Bacteria 2253
894 Ga0207639_10257115 3300026041 Bacteria 1526
895 Ga0207639_10279370 3300026041 Bacteria 1468
896 Ga0207678_10000511 3300026067 Bacteria 35188
897 Ga0207678_10091668 3300026067 Bacteria 2597
898 Ga0207678_10093126 3300026067 Bacteria 2575
899 Ga0207678_10186551 3300026067 Bacteria 1771
900 Ga0207678_10218859 3300026067 Bacteria 1630
901 Ga0207678_10249935 3300026067 Bacteria 1518
902 Ga0207678_10366785 3300026067 Bacteria 1243
903 Ga0207678_10408417 3300026067 Bacteria 1176
904 Ga0207678_10628589 3300026067 Bacteria 942
905 Ga0207678_11164763 3300026067 Bacteria 683
906 Ga0207708_10003058 3300026075 Bacteria 12327
907 Ga0207708_10021548 3300026075 Bacteria 4861
908 Ga0207708_10043572 3300026075 Bacteria 3420
909 Ga0207708_10064113 3300026075 Bacteria 2807
910 Ga0207702_10417068 3300026078 Bacteria 1297
911 Ga0207641_10000156 3300026088 Bacteria 97171
912 Ga0207641_10005483 3300026088 Bacteria 10821
913 Ga0207641_10024733 3300026088 Bacteria 4950
914 Ga0207641_10027827 3300026088 Bacteria 4670
915 Ga0207641_10376380 3300026088 Bacteria 1359
916 Ga0207641_10549820 3300026088 Bacteria 1126
917 Ga0207648_10001288 3300026089 Bacteria 27969
918 Ga0207648_10004514 3300026089 Bacteria 14272
919 Ga0207648_10013968 3300026089 Bacteria 7445
920 Ga0207648_10348666 3300026089 Bacteria 1334
921 Ga0207676_10019892 3300026095 Bacteria 4904
922 Ga0207676_10122972 3300026095 Bacteria 2192
923 Ga0207676_10474797 3300026095 Bacteria 1183
924 Ga0207674_10003834 3300026116 Bacteria 18322
925 Ga0207674_10073677 3300026116 Bacteria 3427
926 Ga0207674_10164705 3300026116 Bacteria 2171
927 Ga0207674_10212961 3300026116 Bacteria 1881
928 Ga0207675_100000220 3300026118 Bacteria 53425
929 Ga0207675_100032244 3300026118 Bacteria 4881
930 Ga0207675_100048224 3300026118 Bacteria 3976
931 Ga0207675_100349542 3300026118 Bacteria 1449
932 Ga0207675_100365543 3300026118 Bacteria 1416
933 Ga0207675_100856631 3300026118 Bacteria 924
934 Ga0207675_101219904 3300026118 Bacteria 772
935 Ga0207683_10000184 3300026121 Bacteria 53332
936 Ga0207683_10005628 3300026121 Bacteria 10746
937 Ga0207683_10033631 3300026121 Bacteria 4454
938 Ga0207683_10176286 3300026121 Bacteria 1937
939 Ga0207683_10178711 3300026121 Bacteria 1924
940 Ga0207683_10204404 3300026121 Bacteria 1796
941 Ga0207683_10309385 3300026121 Bacteria 1446
942 Ga0207683_10354123 3300026121 Bacteria 1348
943 Ga0207683_10377572 3300026121 Bacteria 1303
944 Ga0207683_10490238 3300026121 Bacteria 1134
945 Ga0207683_10538283 3300026121 Bacteria 1079
946 Ga0207683_10926190 3300026121 Bacteria 809
947 Ga0207698_10048023 3300026142 Bacteria 3238
948 Ga0207698_10148211 3300026142 Bacteria 2033
949 Ga0207698_10844850 3300026142 Bacteria 920
950 Ga0209179_1025078 3300027512 Bacteria 1187
951 Ga0209813_10003608 3300027866 Bacteria 3636
952 Ga0209813_10134778 3300027866 Bacteria 872
953 Ga0207428_10000930 3300027907 Bacteria 32598
954 Ga0207428_10034774 3300027907 Bacteria 4126
955 Ga0207428_10056631 3300027907 Bacteria 3114
956 Ga0268266_10001619 3300028379 Bacteria 26252
957 Ga0268266_10002233 3300028379 Bacteria 21159
958 Ga0268266_10004459 3300028379 Bacteria 13385
959 Ga0268266_10005268 3300028379 Bacteria 12145
960 Ga0268266_10035723 3300028379 Bacteria 4227
961 Ga0268266_10112275 3300028379 Bacteria 2416
962 Ga0268266_10238730 3300028379 Bacteria 1676
963 Ga0268266_10352788 3300028379 Bacteria 1383
964 Ga0268266_10387528 3300028379 Bacteria 1319
965 Ga0268266_10847355 3300028379 Bacteria 883
966 Ga0268265_10000004 3300028380 Bacteria 648376
967 Ga0268265_10022153 3300028380 Bacteria 4459
968 Ga0268264_10000024 3300028381 Bacteria 470081
969 Ga0268264_10000027 3300028381 Bacteria 440852
970 Ga0268264_10000242 3300028381 Bacteria 103492
971 Ga0268264_10000925 3300028381 Bacteria 30466
972 Ga0268264_10040710 3300028381 Bacteria 3840
973 Ga0268264_10318710 3300028381 Bacteria 1469
974 Ga0268264_10755160 3300028381 Bacteria 969
975 Ga0268264_11122354 3300028381 Bacteria 795
976 Ga0268264_11150541 3300028381 Bacteria 785
977 Ga0265334_10001010 3300028573 Bacteria 13877
978 Ga0307515_10036541 3300028794 Bacteria 7942
979 Ga0307515_10110667 3300028794 Bacteria 3212
980 Ga0307511_10000622 3300030521 Bacteria 37906
981 Ga0307512_10031225 3300030522 Bacteria 4617
982 Ga0307512_10176339 3300030522 Bacteria 1212
983 Ga0316177_1052389 3300030731 Bacteria 1714
984 Ga0316179_1056474 3300030734 Bacteria 1133
985 Ga0316180_1152100 3300030736 Bacteria 755
986 Ga0316181_1237503 3300030744 Bacteria 1173
987 Ga0265340_10000824 3300031247 Bacteria 17640
988 Ga0265327_10000018 3300031251 Bacteria 439197
989 Ga0265327_10000408 3300031251 Bacteria 79100
990 Ga0265327_10018468 3300031251 Bacteria 4320
991 Ga0265327_10102653 3300031251 Bacteria 1377
992 Ga0307513_10015857 3300031456 Bacteria 9113
993 Ga0307513_10118686 3300031456 Bacteria 2619
994 Ga0307513_10262858 3300031456 Bacteria 1514
995 Ga0307509_10144912 3300031507 Bacteria 2303
996 Ga0307408_100021303 3300031548 Bacteria 4386
997 Ga0307408_100030981 3300031548 Bacteria 3719
998 Ga0307408_100047580 3300031548 Bacteria 3072
999 Ga0307408_100108271 3300031548 Bacteria 2130
1000 Ga0307408_100128282 3300031548 Bacteria 1975
1001 Ga0307408_100173665 3300031548 Bacteria 1722
1002 Ga0307408_100363769 3300031548 Bacteria 1231
1003 Ga0307408_100407167 3300031548 Bacteria 1169
1004 Ga0307408_100484095 3300031548 Bacteria 1080
1005 Ga0307508_10072357 3300031616 Bacteria 3022
1006 Ga0307514_10064722 3300031649 Bacteria 2772
1007 Ga0307514_10112618 3300031649 Bacteria 1923
1008 Ga0316575_10000020 3300031665 Bacteria 41761
1009 Ga0316575_10010297 3300031665 Bacteria 3432
1010 Ga0316575_10011282 3300031665 Bacteria 3303
1011 Ga0316579_10000554 3300031691 Bacteria 12418
1012 Ga0316579_10004265 3300031691 Bacteria 5664
1013 Ga0316579_10009211 3300031691 Bacteria 4145
1014 Ga0316576_10001035 3300031727 Bacteria 14388
1015 Ga0316576_10004053 3300031727 Bacteria 8718
1016 Ga0316576_10015891 3300031727 Bacteria 5066
1017 Ga0316576_10033863 3300031727 Bacteria 3638
1018 Ga0316576_10108724 3300031727 Bacteria 2077
1019 Ga0316576_10196786 3300031727 Bacteria 1519
1020 Ga0316576_10253739 3300031727 Bacteria 1320
1021 Ga0316576_10277953 3300031727 Bacteria 1254
1022 Ga0316576_10373535 3300031727 Bacteria 1059
1023 Ga0316578_10002936 3300031728 Bacteria 7655
1024 Ga0316578_10009754 3300031728 Bacteria 4951
1025 Ga0316578_10014478 3300031728 Bacteria 4215
1026 Ga0316578_10034715 3300031728 Bacteria 2896
1027 Ga0316578_10069495 3300031728 Bacteria 2084
1028 Ga0316578_10079589 3300031728 Bacteria 1949
1029 Ga0307516_10095936 3300031730 Bacteria 2787
1030 Ga0307405_10002212 3300031731 Bacteria 8494
1031 Ga0307405_10005056 3300031731 Bacteria 6311
1032 Ga0307405_10165646 3300031731 Bacteria 1571
1033 Ga0307405_10338772 3300031731 Bacteria 1155
1034 Ga0307405_10352944 3300031731 Bacteria 1135
1035 Ga0307405_10363089 3300031731 Bacteria 1121
1036 Ga0307405_10404939 3300031731 Bacteria 1069
1037 Ga0307405_10417302 3300031731 Bacteria 1055
1038 Ga0307405_10430617 3300031731 Bacteria 1041
1039 Ga0316577_10073843 3300031733 Bacteria 1904
1040 Ga0316577_10285474 3300031733 Bacteria 934
1041 Ga0307413_10000562 3300031824 Bacteria 12452
1042 Ga0307413_10039323 3300031824 Bacteria 2750
1043 Ga0307413_10076674 3300031824 Bacteria 2126
1044 Ga0307413_10105931 3300031824 Bacteria 1870
1045 Ga0307413_10137772 3300031824 Bacteria 1681
1046 Ga0307413_10151949 3300031824 Bacteria 1615
1047 Ga0307413_10161284 3300031824 Bacteria 1575
1048 Ga0307413_10267830 3300031824 Bacteria 1277
1049 Ga0307413_10277600 3300031824 Bacteria 1258
1050 Ga0307413_10287469 3300031824 Bacteria 1240
1051 Ga0307413_10696277 3300031824 Bacteria 843
1052 Ga0307518_10002521 3300031838 Bacteria 13370
1053 Ga0307410_10010201 3300031852 Bacteria 5310
1054 Ga0307410_10018809 3300031852 Bacteria 4185
1055 Ga0307410_10020465 3300031852 Bacteria 4047
1056 Ga0307410_10038280 3300031852 Bacteria 3140
1057 Ga0307410_10056924 3300031852 Bacteria 2660
1058 Ga0307410_10060351 3300031852 Bacteria 2591
1059 Ga0307410_10066312 3300031852 Bacteria 2486
1060 Ga0307410_10096056 3300031852 Bacteria 2114
1061 Ga0307410_10141309 3300031852 Bacteria 1781
1062 Ga0307410_10151859 3300031852 Bacteria 1725
1063 Ga0307410_10168478 3300031852 Bacteria 1648
1064 Ga0307410_10175687 3300031852 Bacteria 1618
1065 Ga0307410_10308212 3300031852 Bacteria 1252
1066 Ga0307410_10309692 3300031852 Bacteria 1249
1067 Ga0307410_10329738 3300031852 Bacteria 1213
1068 Ga0307410_10360613 3300031852 Bacteria 1164
1069 Ga0307410_10376423 3300031852 Bacteria 1141
1070 Ga0307410_10542527 3300031852 Bacteria 963
1071 Ga0307406_10000217 3300031901 Bacteria 34729
1072 Ga0307406_10000795 3300031901 Bacteria 17683
1073 Ga0307406_10013566 3300031901 Bacteria 4671
1074 Ga0307406_10022194 3300031901 Bacteria 3763
1075 Ga0307406_10184758 3300031901 Bacteria 1521
1076 Ga0307406_10197990 3300031901 Bacteria 1476
1077 Ga0307406_10206894 3300031901 Bacteria 1449
1078 Ga0307406_10222593 3300031901 Bacteria 1403
1079 Ga0307406_10308237 3300031901 Bacteria 1219
1080 Ga0307406_10420920 3300031901 Bacteria 1064
1081 Ga0307406_10440472 3300031901 Bacteria 1043
1082 Ga0307406_10536323 3300031901 Bacteria 955
1083 Ga0307406_10609877 3300031901 Bacteria 901
1084 Ga0307407_10009118 3300031903 Bacteria 4603
1085 Ga0307407_10040578 3300031903 Bacteria 2597
1086 Ga0307407_10062466 3300031903 Bacteria 2181
1087 Ga0307407_10066373 3300031903 Bacteria 2128
1088 Ga0307407_10081259 3300031903 Bacteria 1961
1089 Ga0307407_10125801 3300031903 Bacteria 1632
1090 Ga0307407_10188591 3300031903 Bacteria 1372
1091 Ga0307407_10277476 3300031903 Bacteria 1159
1092 Ga0307407_10586450 3300031903 Bacteria 828
1093 Ga0307412_10007306 3300031911 Bacteria 6264
1094 Ga0307412_10011923 3300031911 Bacteria 5048
1095 Ga0307412_10022049 3300031911 Bacteria 3898
1096 Ga0307412_10038443 3300031911 Bacteria 3082
1097 Ga0307412_10047139 3300031911 Bacteria 2829
1098 Ga0307412_10058349 3300031911 Bacteria 2581
1099 Ga0307412_10107762 3300031911 Bacteria 1984
1100 Ga0307412_10133628 3300031911 Bacteria 1806
1101 Ga0307412_10234388 3300031911 Bacteria 1415
1102 Ga0307412_10254355 3300031911 Bacteria 1366
1103 Ga0307412_10798893 3300031911 Bacteria 819
1104 Ga0307409_100019274 3300031995 Bacteria 4614
1105 Ga0307409_100044212 3300031995 Bacteria 3353
1106 Ga0307409_100045235 3300031995 Bacteria 3322
1107 Ga0307409_100050805 3300031995 Bacteria 3169
1108 Ga0307409_100064126 3300031995 Bacteria 2885
1109 Ga0307409_100072330 3300031995 Bacteria 2745
1110 Ga0307409_100096119 3300031995 Bacteria 2443
1111 Ga0307409_100105789 3300031995 Bacteria 2347
1112 Ga0307409_100111106 3300031995 Bacteria 2298
1113 Ga0307409_100139552 3300031995 Bacteria 2086
1114 Ga0307409_100142337 3300031995 Bacteria 2068
1115 Ga0307409_100191519 3300031995 Bacteria 1821
1116 Ga0307409_100333127 3300031995 Bacteria 1425
1117 Ga0307409_100349377 3300031995 Bacteria 1395
1118 Ga0307409_100395866 3300031995 Bacteria 1318
1119 Ga0307409_100396955 3300031995 Bacteria 1316
1120 Ga0307409_100398183 3300031995 Bacteria 1314
1121 Ga0307409_100407915 3300031995 Bacteria 1300
1122 Ga0307409_100424015 3300031995 Bacteria 1277
1123 Ga0307409_100437051 3300031995 Bacteria 1259
1124 Ga0307409_100511406 3300031995 Bacteria 1171
1125 Ga0307409_100542191 3300031995 Bacteria 1140
1126 Ga0307409_100546541 3300031995 Bacteria 1136
1127 Ga0307409_100638038 3300031995 Bacteria 1057
1128 Ga0307409_100701578 3300031995 Bacteria 1011
1129 Ga0307409_100962030 3300031995 Bacteria 870
1130 Ga0307409_101218841 3300031995 Bacteria 776
1131 Ga0307409_101605684 3300031995 Bacteria 678
1132 Ga0307416_100010101 3300032002 Bacteria 6219
1133 Ga0307416_100036552 3300032002 Bacteria 3768
1134 Ga0307416_100046082 3300032002 Bacteria 3438
1135 Ga0307416_100047414 3300032002 Bacteria 3400
1136 Ga0307416_100081979 3300032002 Bacteria 2730
1137 Ga0307416_100122476 3300032002 Bacteria 2321
1138 Ga0307416_100202584 3300032002 Bacteria 1884
1139 Ga0307416_100228765 3300032002 Bacteria 1791
1140 Ga0307416_100297599 3300032002 Bacteria 1602
1141 Ga0307416_100304061 3300032002 Bacteria 1587
1142 Ga0307416_100313235 3300032002 Bacteria 1567
1143 Ga0307416_100390335 3300032002 Bacteria 1426
1144 Ga0307416_100412241 3300032002 Bacteria 1392
1145 Ga0307416_100423974 3300032002 Bacteria 1375
1146 Ga0307416_100753655 3300032002 Bacteria 1066
1147 Ga0307416_100943428 3300032002 Bacteria 964
1148 Ga0307416_100999227 3300032002 Bacteria 940
1149 Ga0307416_101223402 3300032002 Bacteria 857
1150 Ga0307416_101257888 3300032002 Bacteria 846
1151 Ga0307416_101278103 3300032002 Bacteria 840
1152 Ga0307416_101359537 3300032002 Bacteria 816
1153 Ga0307416_101665320 3300032002 Bacteria 743
1154 Ga0307414_10024948 3300032004 Bacteria 3821
1155 Ga0307414_10031241 3300032004 Bacteria 3491
1156 Ga0307414_10164807 3300032004 Bacteria 1765
1157 Ga0307414_10195431 3300032004 Bacteria 1641
1158 Ga0307414_10242762 3300032004 Bacteria 1492
1159 Ga0307414_10323246 3300032004 Bacteria 1314
1160 Ga0307414_10332053 3300032004 Bacteria 1298
1161 Ga0307414_10420489 3300032004 Bacteria 1165
1162 Ga0307414_10444021 3300032004 Bacteria 1136
1163 Ga0307414_10473750 3300032004 Bacteria 1103
1164 Ga0307414_10597811 3300032004 Bacteria 989
1165 Ga0307414_10666250 3300032004 Bacteria 939
1166 Ga0307414_10758727 3300032004 Bacteria 882
1167 Ga0307414_10895441 3300032004 Bacteria 813
1168 Ga0307414_10950352 3300032004 Bacteria 790
1169 Ga0307414_11099943 3300032004 Bacteria 734
1170 Ga0307411_10048638 3300032005 Bacteria 2750
1171 Ga0307411_10057509 3300032005 Bacteria 2570
1172 Ga0307411_10101613 3300032005 Bacteria 2035
1173 Ga0307411_10495896 3300032005 Bacteria 1031
1174 Ga0307411_10811817 3300032005 Bacteria 824
1175 Ga0307415_100000490 3300032126 Bacteria 17127
1176 Ga0307415_100066166 3300032126 Bacteria 2521
1177 Ga0307415_100079511 3300032126 Bacteria 2336
1178 Ga0307415_100082014 3300032126 Bacteria 2306
1179 Ga0307415_100103756 3300032126 Bacteria 2093
1180 Ga0307415_100112283 3300032126 Bacteria 2025
1181 Ga0307415_100145848 3300032126 Bacteria 1814
1182 Ga0307415_100163119 3300032126 Bacteria 1730
1183 Ga0307415_100177951 3300032126 Bacteria 1666
1184 Ga0307415_100315264 3300032126 Bacteria 1302
1185 Ga0307415_100318113 3300032126 Bacteria 1296
1186 Ga0307415_100345042 3300032126 Bacteria 1251
1187 Ga0307415_100348736 3300032126 Bacteria 1245
1188 Ga0307415_100616430 3300032126 Bacteria 968
1189 Ga0307415_100721345 3300032126 Bacteria 902
1190 Ga0307415_101016556 3300032126 Bacteria 771
1191 Ga0316583_10004706 3300032133 Bacteria 4872
1192 Ga0316583_10017611 3300032133 Bacteria 2569
1193 Ga0316585_10001298 3300032137 Bacteria 6548
1194 Ga0316585_10007275 3300032137 Bacteria 3187
1195 Ga0316585_10079369 3300032137 Bacteria 1068
1196 Ga0316580_10000717 3300032139 Bacteria 7980
1197 Ga0316580_10024904 3300032139 Bacteria 1849
1198 Ga0316580_10034015 3300032139 Bacteria 1577
1199 Ga0316580_10035069 3300032139 Bacteria 1552
1200 Ga0316593_10046437 3300032168 Bacteria 1458
1201 Ga0316593_10144336 3300032168 Bacteria 863
1202 Ga0307507_10020058 3300033179 Bacteria 7499
1203 Ga0307507_10022107 3300033179 Bacteria 7047
1204 Ga0307507_10134964 3300033179 Bacteria 1915
1205 Ga0307507_10153152 3300033179 Bacteria 1728
1206 Ga0307510_10022713 3300033180 Bacteria 7278
1207 Ga0316596_1011025 3300033541 Bacteria 2200
1208 Ga0316596_1029852 3300033541 Bacteria 1412
1209 Ga0373948_0018181 3300034817 Bacteria 1318
1210 Ga0373952_0058465 3300035092 Bacteria 937
1211 Ga0373960_0082015 3300035121 Bacteria 1017
1212 Ga0373960_0140268 3300035121 Bacteria 818
1213 Ga0373962_0015361 3300035242 Bacteria 1962
1214 Ga0316574_0001374 3300035398 Bacteria 11469
1215 Ga0316574_0011993 3300035398 Bacteria 4945
1216 Ga0316574_0040766 3300035398 Bacteria 2859
1217 Ga0316574_0082047 3300035398 Bacteria 2048
1218 Ga0316574_0189779 3300035398 Bacteria 1321
1219 Ga0316574_0216544 3300035398 Bacteria 1228
1220 Ga0373924_0290841 3300035410 Bacteria 725
1221 Ga0373931_0018347 3300035691 Bacteria 3479
1222 Ga0373931_0018520 3300035691 Bacteria 3464
1223 Ga0373931_0158929 3300035691 Bacteria 1323
1224 Ga0316582_0001126 3300036647 Bacteria 11356
1225 Ga0316582_0036139 3300036647 Bacteria 3055
1226 Ga0316582_0091332 3300036647 Bacteria 2005
1227 Ga0316582_0193607 3300036647 Bacteria 1385
1228 Ga0316584_0005823 3300036712 Bacteria 8317
1229 Ga0316584_0022330 3300036712 Bacteria 4613
1230 Ga0316584_0130464 3300036712 Bacteria 1877
1231 Ga0316584_0132859 3300036712 Bacteria 1858
1232 Ga0316584_0166448 3300036712 Bacteria 1637
1233 Ga0316584_0197293 3300036712 Bacteria 1486
1234 Ga0373925_0051265 3300037068 Bacteria 3080
1235 Ga0373925_0131715 3300037068 Bacteria 1950
1236 Ga0395899_0016256 3300037312 Bacteria 5672
1237 Ga0395899_0022477 3300037312 Bacteria 4782
1238 Ga0395899_0045398 3300037312 Bacteria 3274
1239 Ga0395899_0055711 3300037312 Bacteria 2924
1240 Ga0395899_0086896 3300037312 Bacteria 2270
1241 Ga0395899_0108241 3300037312 Bacteria 2000
1242 Ga0395899_0344910 3300037312 Bacteria 998
1243 Ga0395899_0442672 3300037312 Bacteria 852
1244 Ga0395899_0629563 3300037312 Bacteria 680
1245 Ga0395900_0014788 3300037418 Bacteria 7953
1246 Ga0395900_0016528 3300037418 Bacteria 7527
1247 Ga0395900_0022895 3300037418 Bacteria 6393
1248 Ga0395900_0041026 3300037418 Bacteria 4772
1249 Ga0395900_0070795 3300037418 Bacteria 3585
1250 Ga0395900_0074807 3300037418 Bacteria 3482
1251 Ga0395900_0083636 3300037418 Bacteria 3279
1252 Ga0395900_0100965 3300037418 Bacteria 2963
1253 Ga0395900_0112045 3300037418 Bacteria 2802
1254 Ga0395900_0116189 3300037418 Bacteria 2745
1255 Ga0395900_0120956 3300037418 Bacteria 2686
1256 Ga0395900_0145531 3300037418 Bacteria 2423
1257 Ga0395900_0150001 3300037418 Bacteria 2382
1258 Ga0395900_0211502 3300037418 Bacteria 1958
1259 Ga0395900_0334909 3300037418 Bacteria 1490
1260 Ga0395900_0356986 3300037418 Bacteria 1434
1261 Ga0395900_0403307 3300037418 Bacteria 1331
1262 Ga0395898_0009247 3300037466 Bacteria 10366
1263 Ga0395898_0014659 3300037466 Bacteria 8049
1264 Ga0395898_0015605 3300037466 Bacteria 7786
1265 Ga0395898_0017262 3300037466 Bacteria 7371
1266 Ga0395898_0066293 3300037466 Bacteria 3498
1267 Ga0395898_0078068 3300037466 Bacteria 3195
1268 Ga0395898_0085089 3300037466 Bacteria 3048
1269 Ga0395898_0138944 3300037466 Bacteria 2326
1270 Ga0395898_0152568 3300037466 Bacteria 2210
1271 Ga0395898_0160733 3300037466 Bacteria 2148
1272 Ga0395898_0168267 3300037466 Bacteria 2095
1273 Ga0395898_0213897 3300037466 Bacteria 1839
1274 Ga0395898_0314761 3300037466 Bacteria 1493
1275 Ga0395898_0373648 3300037466 Bacteria 1359
1276 Ga0395898_0488560 3300037466 Bacteria 1171
1277 Ga0395898_0493551 3300037466 Bacteria 1165
1278 Ga0395905_0018534 3300037471 Bacteria 6606
1279 Ga0395905_0482404 3300037471 Bacteria 1139
1280 Ga0395905_0668759 3300037471 Bacteria 941
1281 Ga0395905_0737646 3300037471 Bacteria 887
1282 Ga0316581_0008048 3300037588 Bacteria 2852
1283 Ga0316581_0026717 3300037588 Bacteria 1724
1284 Ga0436364_0117105 3300037853 Bacteria 1945
1285 Ga0436364_0159364 3300037853 Bacteria 1361
1286 Ga0436364_0159458 3300037853 Bacteria 1225
1287 Ga0436364_0250930 3300037853 Bacteria 2803
1288 Ga0436364_0290389 3300037853 Bacteria 159315
1289 Ga0436364_0473109 3300037853 Bacteria 35842
1290 Ga0436364_0796641 3300037853 Bacteria 22493
1291 Ga0436364_1102635 3300037853 Bacteria 5470
1292 Ga0395901_0017149 3300038443 Bacteria 7386
1293 Ga0395901_0048319 3300038443 Bacteria 4418
1294 Ga0395901_0052609 3300038443 Bacteria 4232
1295 Ga0395901_0058668 3300038443 Bacteria 4003
1296 Ga0395901_0062427 3300038443 Bacteria 3877
1297 Ga0395901_0067255 3300038443 Bacteria 3731
1298 Ga0395901_0089901 3300038443 Bacteria 3213
1299 Ga0395901_0107455 3300038443 Bacteria 2929
1300 Ga0395901_0118878 3300038443 Bacteria 2777
1301 Ga0395901_0135886 3300038443 Bacteria 2584
1302 Ga0395901_0159694 3300038443 Bacteria 2367
1303 Ga0395901_0271228 3300038443 Bacteria 1765
1304 Ga0395901_0329282 3300038443 Bacteria 1579
1305 Ga0395901_0409189 3300038443 Bacteria 1393
1306 Ga0395901_0415915 3300038443 Bacteria 1379
1307 Ga0395901_0418456 3300038443 Bacteria 1374
1308 Ga0395901_0452187 3300038443 Bacteria 1313
1309 Ga0395901_0535491 3300038443 Bacteria 1188
1310 Ga0400485_18908 3300038735 Bacteria 69934
1311 Ga0400486_23235 3300038742 Bacteria 1407
1312 Ga0400486_28504 3300038742 Bacteria 12016
1313 Ga0436365_0024174 3300039437 Bacteria 4342
1314 Ga0436365_0070434 3300039437 Bacteria 2996
1315 Ga0436365_0201441 3300039437 Bacteria 25491
1316 Ga0436365_0585474 3300039437 Bacteria 22245
1317 Ga0436365_0606366 3300039437 Bacteria 3879
1318 Ga0436365_1183714 3300039437 Bacteria 4869
1319 Ga0436365_1739919 3300039437 Bacteria 767
1320 Ga0436365_1821963 3300039437 Bacteria 739
1321 Ga0436365_1920746 3300039437 Bacteria 19751
1322 Ga0436360_0766235 3300039438 Bacteria 1096
1323 Ga0436363_1398133 3300039450 Bacteria 3686
1324 Ga0436363_1528557 3300039450 Bacteria 1689
1325 Ga0436363_1657942 3300039450 Bacteria 2906
1326 Ga0436362_0345588 3300039453 Bacteria 54446
1327 Ga0439436_0003699 3300041404 Bacteria 4662
1328 Ga0439436_0011136 3300041404 Bacteria 2733
1329 Ga0439436_0015206 3300041404 Bacteria 2315
1330 Ga0439438_016946 3300041405 Bacteria 2109
1331 Ga0439438_018633 3300041405 Bacteria 1974
1332 Ga0439438_024607 3300041405 Bacteria 1647
1333 Ga0439439_0018664 3300041406 Bacteria 1715
1334 Ga0439447_011196 3300041407 Bacteria 2629
1335 Ga0439461_0000735 3300041410 Bacteria 4764
1336 Ga0439461_0003823 3300041410 Bacteria 2491
1337 Ga0439461_0016624 3300041410 Bacteria 1422
1338 Ga0439461_0027979 3300041410 Bacteria 1159
1339 Ga0439461_0035095 3300041410 Bacteria 1062
1340 Ga0439466_0001603 3300041411 Bacteria 8829
1341 Ga0439466_0009389 3300041411 Bacteria 3652
1342 Ga0439466_0029654 3300041411 Bacteria 1881
1343 Ga0439466_0033829 3300041411 Bacteria 1735
1344 Ga0439466_0096519 3300041411 Bacteria 924
1345 Ga0439465_0001837 3300041413 Bacteria 6947
1346 Ga0439465_0003484 3300041413 Bacteria 5133
1347 Ga0439465_0021728 3300041413 Bacteria 2014
1348 Ga0439465_0036951 3300041413 Bacteria 1570
1349 Ga0439465_0130441 3300041413 Bacteria 887
1350 Ga0451787_456576 3300041441 Bacteria 905
1351 Ga0451789_0258112 3300041443 Bacteria 1426
1352 Ga0451789_0528476 3300041443 Bacteria 820
1353 Ga0451789_0555308 3300041443 Bacteria 690
1354 Ga0451791_0875325 3300041451 Bacteria 745
1355 Ga0451791_1921000 3300041451 Bacteria 1166
1356 Ga0451793_0181067 3300041452 Bacteria 1399
1357 Ga0451793_0257821 3300041452 Bacteria 8966
1358 Ga0451793_1068462 3300041452 Bacteria 963
1359 Ga0451797_0728331 3300041453 Bacteria 1163
1360 Ga0451797_1236370 3300041453 Bacteria 2093
1361 Ga0451797_1475442 3300041453 Bacteria 918
1362 Ga0451795_0004404 3300041456 Bacteria 1135
1363 Ga0451795_0247050 3300041456 Bacteria 1381
1364 Ga0451795_0522910 3300041456 Bacteria 1582
1365 Ga0451800_0023653 3300041459 Bacteria 783
1366 Ga0451800_1675357 3300041459 Bacteria 1060
1367 Ga0451804_0302612 3300041463 Bacteria 1027
1368 Ga0451807_2379788 3300041486 Bacteria 738
1369 Ga0451833_0136467 3300041491 Bacteria 766
1370 Ga0451833_0567609 3300041491 Bacteria 11564
1371 Ga0451833_0576784 3300041491 Bacteria 11799
1372 Ga0451837_0512487 3300041494 Bacteria 1646
1373 Ga0451839_0032650 3300041496 Bacteria 2975
1374 Ga0451839_1031148 3300041496 Bacteria 768
1375 Ga0451841_0312875 3300041498 Bacteria 2101
1376 Ga0451841_0983754 3300041498 Bacteria 1021
1377 Ga0451841_1307443 3300041498 Bacteria 795
1378 Ga0451841_1366994 3300041498 Bacteria 895
1379 Ga0451847_0352736 3300041503 Bacteria 771
1380 Ga0451843_0154978 3300041509 Bacteria 1832
1381 Ga0451843_0385079 3300041509 Bacteria 1878
1382 Ga0451843_1082564 3300041509 Bacteria 841
1383 Ga0451843_1233444 3300041509 Bacteria 924
1384 Ga0451853_0724352 3300041512 Bacteria 1542
1385 Ga0451853_1387346 3300041512 Bacteria 812
1386 Ga0451853_3031538 3300041512 Bacteria 1237
1387 Ga0451853_3355307 3300041512 Bacteria 1778
1388 Ga0451853_3487584 3300041512 Bacteria 1001
1389 Ga0451853_3654876 3300041512 Bacteria 960
1390 Ga0439431_0003207 3300041997 Bacteria 3593
1391 Ga0439431_0032418 3300041997 Bacteria 1302
1392 Ga0439431_0118006 3300041997 Bacteria 739
1393 Ga0439431_0132476 3300041997 Bacteria 700
1394 Ga0439433_0000454 3300041999 Bacteria 7545
1395 Ga0439433_0000518 3300041999 Bacteria 7240
1396 Ga0439442_000017 3300042002 Bacteria 45973
1397 Ga0439442_000210 3300042002 Bacteria 14549
1398 Ga0439442_000606 3300042002 Bacteria 7709
1399 Ga0439442_002097 3300042002 Bacteria 3916
1400 Ga0439442_004672 3300042002 Bacteria 2722
1401 Ga0439442_013293 3300042002 Bacteria 1688
1402 Ga0439445_0001633 3300042004 Bacteria 4903
1403 Ga0439445_0005519 3300042004 Bacteria 2883
1404 Ga0439445_0072852 3300042004 Bacteria 952
1405 Ga0439448_0017962 3300042005 Bacteria 2163
1406 Ga0439432_032498 3300042006 Bacteria 1682
1407 Ga0439449_0002498 3300042007 Bacteria 7190
1408 Ga0439449_0002526 3300042007 Bacteria 7149
1409 Ga0439449_0016340 3300042007 Bacteria 2788
1410 Ga0439449_0017891 3300042007 Bacteria 2660
1411 Ga0439449_0151279 3300042007 Bacteria 865
1412 Ga0439452_015513 3300042010 Bacteria 2088
1413 Ga0439452_026761 3300042010 Bacteria 1453
1414 Ga0439457_001341 3300042014 Bacteria 7395
1415 Ga0439457_004829 3300042014 Bacteria 3466
1416 Ga0439457_082769 3300042014 Bacteria 738
1417 Ga0439462_0015923 3300042015 Bacteria 1941
1418 Ga0439462_0019359 3300042015 Bacteria 1771
1419 Ga0450911_004128 3300042115 Bacteria 2425
1420 Ga0450919_000638 3300042121 Bacteria 4441
1421 Ga0450920_001582 3300042122 Bacteria 3793
1422 Ga0450920_004454 3300042122 Bacteria 2462
1423 Ga0450920_028106 3300042122 Bacteria 1101
1424 Ga0450907_000065 3300042146 Bacteria 40682
1425 Ga0450907_008464 3300042146 Bacteria 1709
1426 Ga0450907_023914 3300042146 Bacteria 1032
1427 Ga0439446_0002186 3300042156 Bacteria 4658
1428 Ga0439458_0128700 3300042157 Bacteria 670
1429 Ga0439434_0000100 3300042435 Bacteria 22043
1430 Ga0439434_0003973 3300042435 Bacteria 4316
1431 Ga0439434_0004091 3300042435 Bacteria 4259
1432 Ga0439434_0004608 3300042435 Bacteria 4036
1433 Ga0439434_0014143 3300042435 Bacteria 2373
1434 Ga0450918_001384 3300042531 Bacteria 4854
1435 Ga0450918_003902 3300042531 Bacteria 2743
1436 Ga0451577_0063035 3300042876 Bacteria 3306
1437 Ga0466969_0054397 3300044656 Bacteria 1961
1438 Ga0466972_0004495 3300044658 Bacteria 6979
1439 Ga0466972_0010542 3300044658 Bacteria 4637
1440 Ga0466972_0019259 3300044658 Bacteria 3413
1441 Ga0466972_0028483 3300044658 Bacteria 2755
1442 Ga0466972_0038637 3300044658 Bacteria 2331
1443 Ga0466972_0072821 3300044658 Bacteria 1638
1444 Ga0466972_0078519 3300044658 Bacteria 1572
1445 Ga0466972_0194569 3300044658 Bacteria 950
1446 Ga0466972_0262719 3300044658 Bacteria 807
1447 Ga0466965_0001067 3300044683 Bacteria 10644
1448 Ga0466965_0001750 3300044683 Bacteria 8967
1449 Ga0466965_0001891 3300044683 Bacteria 8722
1450 Ga0466965_0005761 3300044683 Bacteria 5592
1451 Ga0466965_0007511 3300044683 Bacteria 5009
1452 Ga0466965_0007733 3300044683 Bacteria 4946
1453 Ga0466965_0007881 3300044683 Bacteria 4912
1454 Ga0466965_0013083 3300044683 Bacteria 3910
1455 Ga0466965_0019242 3300044683 Bacteria 3278
1456 Ga0466965_0024262 3300044683 Bacteria 2932
1457 Ga0466965_0030137 3300044683 Bacteria 2642
1458 Ga0466965_0032452 3300044683 Bacteria 2550
1459 Ga0466965_0034643 3300044683 Bacteria 2470
1460 Ga0466965_0044424 3300044683 Bacteria 2195
1461 Ga0466965_0097637 3300044683 Bacteria 1499
1462 Ga0466965_0102448 3300044683 Bacteria 1465
1463 Ga0466965_0112635 3300044683 Bacteria 1399
1464 Ga0466965_0134744 3300044683 Bacteria 1283
1465 Ga0466965_0134832 3300044683 Bacteria 1282
1466 Ga0466965_0148542 3300044683 Bacteria 1224
1467 Ga0466965_0203180 3300044683 Bacteria 1052
1468 Ga0466966_0005894 3300044684 Bacteria 8083
1469 Ga0466966_0010547 3300044684 Bacteria 6141
1470 Ga0466966_0022584 3300044684 Bacteria 4127
1471 Ga0466966_0056933 3300044684 Bacteria 2472
1472 Ga0466966_0057153 3300044684 Bacteria 2467
1473 Ga0466966_0117078 3300044684 Bacteria 1639
1474 Ga0466966_0117471 3300044684 Bacteria 1636
1475 Ga0466966_0142434 3300044684 Bacteria 1464
1476 Ga0466961_0002946 3300044693 Bacteria 10572
1477 Ga0466961_0010095 3300044693 Bacteria 6016
1478 Ga0466961_0013068 3300044693 Bacteria 5312
1479 Ga0466961_0055510 3300044693 Bacteria 2525
1480 Ga0466961_0249709 3300044693 Bacteria 1089
1481 Ga0466963_0027470 3300044694 Bacteria 3645
1482 Ga0466963_0040021 3300044694 Bacteria 3072
1483 Ga0466963_0066677 3300044694 Bacteria 2415
1484 Ga0466963_0070225 3300044694 Bacteria 2355
1485 Ga0466963_0084493 3300044694 Bacteria 2154
1486 Ga0466963_0096429 3300044694 Bacteria 2020
1487 Ga0466963_0149754 3300044694 Bacteria 1620
1488 Ga0466963_0209804 3300044694 Bacteria 1363
1489 Ga0466963_0330843 3300044694 Bacteria 1072
1490 Ga0466963_0801816 3300044694 Bacteria 664
1491 Ga0466964_0014897 3300044706 Bacteria 2961
1492 Ga0466964_0044120 3300044706 Bacteria 1811
1493 Ga0466964_0075615 3300044706 Bacteria 1434
1494 Ga0466964_0221621 3300044706 Bacteria 919
1495 Ga0466964_0290458 3300044706 Bacteria 820
1496 Ga0466971_0003674 3300044719 Bacteria 6562
1497 Ga0466971_0056955 3300044719 Bacteria 1763
1498 Ga0466971_0060356 3300044719 Bacteria 1714
1499 Ga0466971_0166936 3300044719 Bacteria 1032
1500 Ga0466968_0001388 3300044735 Bacteria 8653
1501 Ga0466968_0012577 3300044735 Bacteria 3316
1502 Ga0466968_0025444 3300044735 Bacteria 2424
1503 Ga0466968_0037356 3300044735 Bacteria 2037
1504 Ga0466968_0059966 3300044735 Bacteria 1639
1505 Ga0466968_0064888 3300044735 Bacteria 1580
1506 Ga0466968_0126384 3300044735 Bacteria 1161
1507 Ga0466968_0185629 3300044735 Bacteria 969
1508 Ga0466968_0278841 3300044735 Bacteria 799
1509 Ga0466970_0000176 3300044765 Bacteria 30506
1510 Ga0466970_0004725 3300044765 Bacteria 6728
1511 Ga0466970_0007605 3300044765 Bacteria 5432
1512 Ga0466970_0008421 3300044765 Bacteria 5189
1513 Ga0466970_0013259 3300044765 Bacteria 4225
1514 Ga0466970_0017830 3300044765 Bacteria 3671
1515 Ga0466970_0020199 3300044765 Bacteria 3458
1516 Ga0466970_0023859 3300044765 Bacteria 3197
1517 Ga0466970_0024826 3300044765 Bacteria 3135
1518 Ga0466970_0025056 3300044765 Bacteria 3122
1519 Ga0466970_0027328 3300044765 Bacteria 2994
1520 Ga0466970_0027997 3300044765 Bacteria 2960
1521 Ga0466970_0028904 3300044765 Bacteria 2916
1522 Ga0466970_0039820 3300044765 Bacteria 2495
1523 Ga0466970_0049723 3300044765 Bacteria 2235
1524 Ga0466970_0053951 3300044765 Bacteria 2146
1525 Ga0466970_0067141 3300044765 Bacteria 1925
1526 Ga0466970_0071824 3300044765 Bacteria 1862
1527 Ga0466970_0075091 3300044765 Bacteria 1820
1528 Ga0466970_0075935 3300044765 Bacteria 1810
1529 Ga0466970_0083590 3300044765 Bacteria 1727
1530 Ga0466970_0110731 3300044765 Bacteria 1499
1531 Ga0466970_0505993 3300044765 Bacteria 696
1532 Ga0466957_0002569 3300044842 Bacteria 9770
1533 Ga0466957_0009173 3300044842 Bacteria 5643
1534 Ga0466957_0015040 3300044842 Bacteria 4514
1535 Ga0466957_0017272 3300044842 Bacteria 4224
1536 Ga0466957_0017419 3300044842 Bacteria 4207
1537 Ga0466957_0026962 3300044842 Bacteria 3411
1538 Ga0466957_0056361 3300044842 Bacteria 2403
1539 Ga0466957_0117939 3300044842 Bacteria 1690
1540 Ga0466957_0175232 3300044842 Bacteria 1398
1541 Ga0466957_0197065 3300044842 Bacteria 1321
1542 Ga0466957_0370175 3300044842 Bacteria 975
1543 Ga0466957_0427001 3300044842 Bacteria 910
1544 Ga0466960_0000108 3300044901 Bacteria 27686
1545 Ga0466960_0005615 3300044901 Bacteria 4976
1546 Ga0466960_0009070 3300044901 Bacteria 4092
1547 Ga0466960_0010089 3300044901 Bacteria 3914
1548 Ga0466960_0010838 3300044901 Bacteria 3795
1549 Ga0466960_0011366 3300044901 Bacteria 3723
1550 Ga0466960_0011393 3300044901 Bacteria 3720
1551 Ga0466960_0011813 3300044901 Bacteria 3668
1552 Ga0466960_0015183 3300044901 Bacteria 3315
1553 Ga0466960_0015534 3300044901 Bacteria 3283
1554 Ga0466960_0015560 3300044901 Bacteria 3281
1555 Ga0466960_0016732 3300044901 Bacteria 3186
1556 Ga0466960_0029533 3300044901 Bacteria 2516
1557 Ga0466960_0071076 3300044901 Bacteria 1732
1558 Ga0466960_0194572 3300044901 Bacteria 1105
1559 Ga0466960_0247326 3300044901 Bacteria 989
1560 Ga0466959_0001743 3300045049 Bacteria 13537
1561 Ga0466959_0002933 3300045049 Bacteria 11002
1562 Ga0466959_0005367 3300045049 Bacteria 8774
1563 Ga0466959_0007058 3300045049 Bacteria 7852
1564 Ga0466959_0022541 3300045049 Bacteria 4656
1565 Ga0466959_0102150 3300045049 Bacteria 2052
1566 Ga0466959_0310808 3300045049 Bacteria 1078
1567 Ga0466959_0339296 3300045049 Bacteria 1025
1568 Ga0451576_0277383 3300045051 Bacteria 1753
1569 Ga0466958_0000249 3300045836 Bacteria 20765
1570 Ga0466958_0012316 3300045836 Bacteria 4843
1571 Ga0466958_0014386 3300045836 Bacteria 4519
1572 Ga0466958_0024769 3300045836 Bacteria 3532
1573 Ga0466958_0038815 3300045836 Bacteria 2858
1574 Ga0466958_0049943 3300045836 Bacteria 2532
1575 Ga0466958_0100440 3300045836 Bacteria 1798
1576 Ga0466958_0130840 3300045836 Bacteria 1576
1577 Ga0466958_0165840 3300045836 Bacteria 1397
1578 Ga0466958_0242593 3300045836 Bacteria 1151
1579 Ga0466958_0311975 3300045836 Bacteria 1010
1580 Ga0466958_0316095 3300045836 Bacteria 1003
1581 Ga0466958_0410796 3300045836 Bacteria 874
1582 Ga0466967_0004216 3300045976 Bacteria 9641
1583 Ga0466967_0005152 3300045976 Bacteria 8992
1584 Ga0466967_0017156 3300045976 Bacteria 5737
1585 Ga0466967_0019813 3300045976 Bacteria 5420
1586 Ga0466967_0020955 3300045976 Bacteria 5295
1587 Ga0466967_0025921 3300045976 Bacteria 4844
1588 Ga0466967_0026568 3300045976 Bacteria 4797
1589 Ga0466967_0031674 3300045976 Bacteria 4455
1590 Ga0466967_0033247 3300045976 Bacteria 4363
1591 Ga0466967_0164985 3300045976 Bacteria 2081
1592 Ga0466967_0213475 3300045976 Bacteria 1831
1593 Ga0466967_0222432 3300045976 Bacteria 1794
1594 Ga0466967_0316601 3300045976 Bacteria 1504
1595 Ga0466967_0746291 3300045976 Bacteria 971
1596 Ga0495627_000401 3300046453 Bacteria 38376
1597 Ga0495592_0014364 3300046454 Bacteria 6012
1598 Ga0495603_0014689 3300046455 Bacteria 4734
1599 Ga0495603_0372243 3300046455 Bacteria 819
1600 Ga0495629_0036577 3300046459 Bacteria 3464
1601 Ga0495629_0197022 3300046459 Bacteria 1393
1602 Ga0495629_0482862 3300046459 Bacteria 837
1603 Ga0495638_0001617 3300046460 Bacteria 20096
1604 Ga0495638_0017392 3300046460 Bacteria 4795
1605 Ga0495638_0265773 3300046460 Bacteria 939
1606 Ga0495638_0274217 3300046460 Bacteria 919
1607 Ga0495641_0078306 3300046461 Bacteria 1482
1608 Ga0495641_0095047 3300046461 Bacteria 1331
1609 Ga0495641_0101382 3300046461 Bacteria 1285
1610 Ga0495641_0102962 3300046461 Bacteria 1274
1611 Ga0495641_0319281 3300046461 Bacteria 701
1612 Ga0495651_0004873 3300046462 Bacteria 10265
1613 Ga0495651_0584879 3300046462 Bacteria 706
1614 Ga0495653_0098109 3300046463 Bacteria 2128
1615 Ga0495653_0461373 3300046463 Bacteria 797
1616 Ga0495650_0080504 3300046471 Bacteria 1257
1617 Ga0495580_0002953 3300046472 Bacteria 14598
1618 Ga0495580_0186130 3300046472 Bacteria 1433
1619 Ga0495582_0021508 3300046473 Bacteria 3531
1620 Ga0495582_0232945 3300046473 Bacteria 1054
1621 Ga0495582_0307198 3300046473 Bacteria 912
1622 Ga0495582_0385366 3300046473 Bacteria 808
1623 Ga0495639_0005090 3300046475 Bacteria 5648
1624 Ga0495662_0001536 3300046476 Bacteria 11467
1625 Ga0495662_0041219 3300046476 Bacteria 2229
1626 Ga0495662_0108611 3300046476 Bacteria 1359
1627 Ga0495664_0003114 3300046477 Bacteria 9005
1628 Ga0495664_0417087 3300046477 Bacteria 805
1629 Ga0495594_0025885 3300046499 Bacteria 3155
1630 Ga0495594_0166227 3300046499 Bacteria 1255
1631 Ga0495594_0455961 3300046499 Bacteria 727
1632 Ga0495606_0044325 3300046507 Bacteria 2959
1633 Ga0495608_0105115 3300046511 Bacteria 1818
1634 Ga0495608_0120974 3300046511 Bacteria 1679
1635 Ga0495620_0074180 3300046515 Bacteria 1386
1636 Ga0495628_0471375 3300046516 Bacteria 910
1637 Ga0495628_0620817 3300046516 Bacteria 770
1638 Ga0495630_0316816 3300046517 Bacteria 1192
1639 Ga0495631_0112966 3300046518 Bacteria 1168
1640 Ga0495631_0164415 3300046518 Bacteria 952
1641 Ga0495643_0224251 3300046522 Bacteria 890
1642 Ga0495648_0000060 3300046524 Bacteria 152166
1643 Ga0495666_0244541 3300046526 Bacteria 818
1644 Ga0495642_0059247 3300046528 Bacteria 1587
1645 Ga0495652_0020548 3300046529 Bacteria 5869
1646 Ga0495640_0065503 3300046533 Bacteria 2453
1647 Ga0495587_0015054 3300046536 Bacteria 4834
1648 Ga0495587_0175689 3300046536 Bacteria 1215
1649 Ga0495609_0018232 3300046538 Bacteria 3253
1650 Ga0495609_0030682 3300046538 Bacteria 2446
1651 Ga0495645_0119000 3300046543 Bacteria 1861
1652 Ga0495645_0145984 3300046543 Bacteria 1648
1653 Ga0495622_0000711 3300046557 Bacteria 18855
1654 Ga0495656_0012675 3300046615 Bacteria 3118
1655 Ga0495656_0073969 3300046615 Bacteria 1521
1656 Ga0495656_0226731 3300046615 Bacteria 936
1657 Ga0495656_0327176 3300046615 Bacteria 790
1658 Ga0495668_0007903 3300046616 Bacteria 6717
1659 Ga0495668_0143873 3300046616 Bacteria 1305
1660 Ga0495634_0002254 3300046642 Bacteria 16167
1661 Ga0495634_0181551 3300046642 Bacteria 1317
1662 Ga0495625_0038469 3300046660 Bacteria 3502
1663 Ga0495625_0100904 3300046660 Bacteria 1983
1664 Ga0495635_0007350 3300046663 Bacteria 7687
1665 Ga0495635_0031993 3300046663 Bacteria 3651
1666 Ga0495635_0083317 3300046663 Bacteria 2188
1667 Ga0495635_0241094 3300046663 Bacteria 1220
1668 Ga0495659_0198060 3300046664 Bacteria 823
1669 Ga0495588_0039616 3300046674 Bacteria 2401
1670 Ga0495588_0104338 3300046674 Bacteria 1491
1671 Ga0495588_0127746 3300046674 Bacteria 1341
1672 Ga0495588_0249312 3300046674 Bacteria 936
1673 Ga0495657_0008139 3300046675 Bacteria 8036
1674 Ga0495646_0000819 3300046680 Bacteria 17471
1675 Ga0495646_0118028 3300046680 Bacteria 1504
1676 Ga0495658_0007185 3300046683 Bacteria 5500
1677 Ga0495658_0019238 3300046683 Bacteria 3562
1678 Ga0495658_0361519 3300046683 Bacteria 923
1679 Ga0495613_0066413 3300046689 Bacteria 2634
1680 Ga0495624_0026430 3300046690 Bacteria 3804
1681 Ga0495624_0241576 3300046690 Bacteria 1093
1682 Ga0495624_0419312 3300046690 Bacteria 803
1683 Ga0495670_0037917 3300046691 Bacteria 2402
1684 Ga0495670_0292938 3300046691 Bacteria 871
1685 Ga0495671_0177018 3300046692 Bacteria 1036
1686 Ga0495671_0375187 3300046692 Bacteria 682
1687 Ga0495649_0080004 3300046694 Bacteria 1748
1688 Ga0495649_0286404 3300046694 Bacteria 841
1689 Ga0495600_0017321 3300046809 Bacteria 4581
1690 Ga0495600_0021040 3300046809 Bacteria 4174
1691 Ga0495600_0064568 3300046809 Bacteria 2393
1692 Ga0495600_0257032 3300046809 Bacteria 1110
1693 Ga0495581_0006577 3300047315 Bacteria 6733
1694 Ga0495581_0007818 3300047315 Bacteria 6192
1695 Ga0495581_0024721 3300047315 Bacteria 3481
1696 Ga0495581_0029889 3300047315 Bacteria 3158
1697 Ga0495581_0119456 3300047315 Bacteria 1534
1698 Ga0495581_0125390 3300047315 Bacteria 1495
1699 Ga0495581_0155323 3300047315 Bacteria 1337
1700 Ga0495604_0000582 3300047317 Bacteria 31932
1701 Ga0495636_0080315 3300047318 Bacteria 1403
1702 Ga0495674_0031514 3300047319 Bacteria 4817
1703 Ga0495674_0476453 3300047319 Bacteria 1001
1704 Ga0495672_0000112 3300047320 Bacteria 130094
1705 Ga0495672_0026633 3300047320 Bacteria 3686
1706 Ga0495672_0115532 3300047320 Bacteria 1434
1707 Ga0495676_0047587 3300047321 Bacteria 3466
1708 Ga0495676_0280730 3300047321 Bacteria 1128
1709 Ga0495680_0147266 3300047322 Bacteria 1719
1710 Ga0495680_0189407 3300047322 Bacteria 1481
1711 Ga0495680_0240797 3300047322 Bacteria 1285
1712 Ga0495683_0012837 3300047323 Bacteria 4394
1713 Ga0495675_0011607 3300047444 Bacteria 5531
1714 Ga0495675_0063350 3300047444 Bacteria 2340
1715 Ga0495675_0401456 3300047444 Bacteria 799
1716 Ga0495681_0084543 3300047470 Bacteria 1411
1717 Ga0495684_0549858 3300047471 Bacteria 786
1718 Ga0495686_0021284 3300047472 Bacteria 4309
1719 Ga0495686_0094890 3300047472 Bacteria 1807
1720 Ga0495686_0326737 3300047472 Bacteria 839
1721 Ga0495593_0011893 3300047673 Bacteria 4990
1722 Ga0495593_0201603 3300047673 Bacteria 1000
1723 Ga0495602_0492253 3300048088 Bacteria 858
1724 Ga0495614_0004070 3300048089 Bacteria 6573
1725 Ga0495614_0121854 3300048089 Unclassified 1150
1726 Ga0495614_0361640 3300048089 Bacteria 678
1727 Ga0495615_0058873 3300048090 Bacteria 1009
1728 Ga0495626_0178033 3300048091 Bacteria 883
1729 Ga0496100_0000009 3300048903 Bacteria 225785
1730 Ga0496100_0000555 3300048903 Bacteria 17739
1731 Ga0496100_0008062 3300048903 Bacteria 5855
1732 Ga0496100_0009017 3300048903 Bacteria 5587
1733 Ga0496100_0026768 3300048903 Bacteria 3539
1734 Ga0496100_0027772 3300048903 Bacteria 3483
1735 Ga0496100_0029481 3300048903 Bacteria 3395
1736 Ga0496100_0030954 3300048903 Bacteria 3323
1737 Ga0496100_0060751 3300048903 Bacteria 2488
1738 Ga0496100_0077378 3300048903 Bacteria 2236
1739 Ga0496100_0166658 3300048903 Bacteria 1583
1740 Ga0496100_0379734 3300048903 Bacteria 1073
1741 Ga0496100_0549379 3300048903 Bacteria 893
1742 Ga0496101_0000018 3300048904 Bacteria 236102
1743 Ga0496101_0002057 3300048904 Bacteria 12242
1744 Ga0496101_0003076 3300048904 Bacteria 10312
1745 Ga0496101_0004515 3300048904 Bacteria 8781
1746 Ga0496101_0016494 3300048904 Bacteria 4992
1747 Ga0496101_0035458 3300048904 Bacteria 3528
1748 Ga0496101_0037409 3300048904 Bacteria 3442
1749 Ga0496101_0048441 3300048904 Bacteria 3054
1750 Ga0496101_0054290 3300048904 Bacteria 2892
1751 Ga0496101_0076766 3300048904 Bacteria 2461
1752 Ga0496101_0079570 3300048904 Bacteria 2420
1753 Ga0496101_0083648 3300048904 Bacteria 2363
1754 Ga0496101_0127115 3300048904 Bacteria 1932
1755 Ga0496101_0154657 3300048904 Bacteria 1756
1756 Ga0496101_0173364 3300048904 Bacteria 1658
1757 Ga0496101_0197565 3300048904 Bacteria 1554
1758 Ga0496101_0213559 3300048904 Bacteria 1495
1759 Ga0496101_0272717 3300048904 Bacteria 1321
1760 Ga0496101_0285225 3300048904 Bacteria 1291
1761 Ga0496101_0474275 3300048904 Bacteria 988
1762 Ga0496101_0503989 3300048904 Bacteria 956
1763 Ga0496101_0592638 3300048904 Bacteria 876
1764 Ga0496101_0629454 3300048904 Bacteria 848
1765 Ga0496102_0000028 3300048905 Bacteria 224124
1766 Ga0496102_0000820 3300048905 Bacteria 30171
1767 Ga0496102_0002409 3300048905 Bacteria 15971
1768 Ga0496102_0002741 3300048905 Bacteria 15014
1769 Ga0496102_0003481 3300048905 Bacteria 13347
1770 Ga0496102_0003652 3300048905 Bacteria 13015
1771 Ga0496102_0004997 3300048905 Bacteria 11234
1772 Ga0496102_0015341 3300048905 Bacteria 6672
1773 Ga0496102_0017563 3300048905 Bacteria 6267
1774 Ga0496102_0037325 3300048905 Bacteria 4383
1775 Ga0496102_0046603 3300048905 Bacteria 3937
1776 Ga0496102_0058304 3300048905 Bacteria 3527
1777 Ga0496102_0089221 3300048905 Bacteria 2852
1778 Ga0496102_0103287 3300048905 Bacteria 2651
1779 Ga0496102_0114744 3300048905 Bacteria 2513
1780 Ga0496102_0119866 3300048905 Bacteria 2457
1781 Ga0496102_0139439 3300048905 Bacteria 2273
1782 Ga0496102_0144475 3300048905 Bacteria 2232
1783 Ga0496102_0169955 3300048905 Bacteria 2052
1784 Ga0496102_0245179 3300048905 Bacteria 1689
1785 Ga0496102_0271514 3300048905 Bacteria 1599
1786 Ga0496102_0305399 3300048905 Bacteria 1499
1787 Ga0496102_0309636 3300048905 Bacteria 1488
1788 Ga0496102_0410960 3300048905 Bacteria 1271
1789 Ga0496102_0425231 3300048905 Bacteria 1247
1790 Ga0496102_0515208 3300048905 Bacteria 1118
1791 Ga0496102_0654926 3300048905 Bacteria 973
1792 Ga0496102_0792770 3300048905 Bacteria 870
1793 Ga0496102_1122902 3300048905 Bacteria 706
1794 Ga0496102_1208782 3300048905 Bacteria 675
1795 Ga0496103_0000024 3300048906 Bacteria 223336
1796 Ga0496103_0000473 3300048906 Bacteria 33859
1797 Ga0496103_0000662 3300048906 Bacteria 25938
1798 Ga0496103_0001547 3300048906 Bacteria 15288
1799 Ga0496103_0003299 3300048906 Bacteria 9877
1800 Ga0496103_0031142 3300048906 Bacteria 3249
1801 Ga0496103_0035934 3300048906 Bacteria 3033
1802 Ga0496103_0038692 3300048906 Bacteria 2928
1803 Ga0496103_0060285 3300048906 Bacteria 2358
1804 Ga0496103_0104994 3300048906 Bacteria 1791
1805 Ga0496103_0119967 3300048906 Bacteria 1675
1806 Ga0496103_0151194 3300048906 Bacteria 1487
1807 Ga0496103_0204229 3300048906 Bacteria 1271
1808 Ga0496103_0292102 3300048906 Bacteria 1048
1809 Ga0496103_0323156 3300048906 Bacteria 992
1810 Ga0496103_0373439 3300048906 Bacteria 916
1811 Ga0496103_0476747 3300048906 Bacteria 799
1812 Ga0496104_0000285 3300048907 Bacteria 44731
1813 Ga0496104_0004578 3300048907 Bacteria 12049
1814 Ga0496104_0006188 3300048907 Bacteria 10512
1815 Ga0496104_0007149 3300048907 Bacteria 9840
1816 Ga0496104_0008789 3300048907 Bacteria 8979
1817 Ga0496104_0040900 3300048907 Bacteria 4346
1818 Ga0496104_0078050 3300048907 Bacteria 3155
1819 Ga0496104_0082307 3300048907 Bacteria 3069
1820 Ga0496104_0095364 3300048907 Bacteria 2846
1821 Ga0496104_0146940 3300048907 Bacteria 2264
1822 Ga0496104_0170776 3300048907 Bacteria 2085
1823 Ga0496104_0208658 3300048907 Bacteria 1865
1824 Ga0496104_0433695 3300048907 Bacteria 1226
1825 Ga0496104_0520655 3300048907 Bacteria 1100
1826 Ga0496104_0608963 3300048907 Bacteria 1002
1827 Ga0496104_0786256 3300048907 Bacteria 858
1828 Ga0496104_1265268 3300048907 Bacteria 641
1829 Ga0496105_0000166 3300048908 Bacteria 43904
1830 Ga0496105_0002641 3300048908 Bacteria 13047
1831 Ga0496105_0008276 3300048908 Bacteria 8088
1832 Ga0496105_0010434 3300048908 Bacteria 7306
1833 Ga0496105_0015583 3300048908 Bacteria 6062
1834 Ga0496105_0040579 3300048908 Bacteria 3837
1835 Ga0496105_0040584 3300048908 Bacteria 3837
1836 Ga0496105_0124921 3300048908 Bacteria 2121
1837 Ga0496105_0128977 3300048908 Bacteria 2086
1838 Ga0496105_0150182 3300048908 Bacteria 1915
1839 Ga0496105_0216664 3300048908 Bacteria 1559
1840 Ga0496105_0355914 3300048908 Bacteria 1168
1841 Ga0496105_0398091 3300048908 Bacteria 1093
1842 Ga0496105_0434809 3300048908 Bacteria 1037
1843 Ga0496105_0626539 3300048908 Bacteria 832
1844 Ga0496106_0005366 3300048909 Bacteria 9485
1845 Ga0496106_0026975 3300048909 Bacteria 4277
1846 Ga0496106_0027196 3300048909 Bacteria 4260
1847 Ga0496106_0069153 3300048909 Bacteria 2694
1848 Ga0496106_0127629 3300048909 Bacteria 1992
1849 Ga0496106_0127923 3300048909 Bacteria 1990
1850 Ga0496106_0202239 3300048909 Bacteria 1581
1851 Ga0496106_0229615 3300048909 Bacteria 1481
1852 Ga0496106_0281250 3300048909 Bacteria 1333
1853 Ga0496106_0501993 3300048909 Bacteria 974
1854 Ga0496106_0630209 3300048909 Bacteria 858
1855 Ga0496107_0000152 3300048910 Bacteria 35028
1856 Ga0496107_0000364 3300048910 Bacteria 24565
1857 Ga0496107_0005278 3300048910 Bacteria 8827
1858 Ga0496107_0024200 3300048910 Bacteria 4295
1859 Ga0496107_0040147 3300048910 Bacteria 3358
1860 Ga0496107_0048375 3300048910 Bacteria 3063
1861 Ga0496107_0048545 3300048910 Bacteria 3058
1862 Ga0496107_0085934 3300048910 Bacteria 2295
1863 Ga0496107_0135190 3300048910 Bacteria 1821
1864 Ga0496107_0144518 3300048910 Bacteria 1758
1865 Ga0496107_0165413 3300048910 Bacteria 1640
1866 Ga0496107_0517517 3300048910 Bacteria 885
1867 Ga0496107_0520938 3300048910 Bacteria 881
1868 Ga0496107_0699068 3300048910 Bacteria 746
1869 Ga0496107_0722167 3300048910 Bacteria 732
1870 Ga0496108_0000520 3300048911 Bacteria 30186
1871 Ga0496108_0002258 3300048911 Bacteria 15427
1872 Ga0496108_0005587 3300048911 Bacteria 10174
1873 Ga0496108_0007290 3300048911 Bacteria 8965
1874 Ga0496108_0046790 3300048911 Bacteria 3615
1875 Ga0496108_0057354 3300048911 Bacteria 3272
1876 Ga0496108_0074453 3300048911 Bacteria 2867
1877 Ga0496108_0153751 3300048911 Bacteria 1986
1878 Ga0496108_0154625 3300048911 Bacteria 1980
1879 Ga0496108_0199607 3300048911 Bacteria 1736
1880 Ga0496108_0202888 3300048911 Bacteria 1721
1881 Ga0496108_0222998 3300048911 Bacteria 1638
1882 Ga0496108_0377256 3300048911 Bacteria 1238
1883 Ga0496108_0408518 3300048911 Bacteria 1186
1884 Ga0496108_0446218 3300048911 Bacteria 1130
1885 Ga0496108_0532391 3300048911 Bacteria 1025
1886 Ga0496109_0000214 3300048912 Bacteria 56898
1887 Ga0496109_0000639 3300048912 Bacteria 29179
1888 Ga0496109_0002624 3300048912 Bacteria 15074
1889 Ga0496109_0017274 3300048912 Bacteria 6320
1890 Ga0496109_0043331 3300048912 Bacteria 4079
1891 Ga0496109_0049297 3300048912 Bacteria 3833
1892 Ga0496109_0050983 3300048912 Bacteria 3769
1893 Ga0496109_0051609 3300048912 Bacteria 3746
1894 Ga0496109_0073845 3300048912 Bacteria 3134
1895 Ga0496109_0085154 3300048912 Bacteria 2917
1896 Ga0496109_0094256 3300048912 Bacteria 2771
1897 Ga0496109_0099637 3300048912 Bacteria 2695
1898 Ga0496109_0110152 3300048912 Bacteria 2560
1899 Ga0496109_0180328 3300048912 Bacteria 1983
1900 Ga0496109_0198771 3300048912 Bacteria 1885
1901 Ga0496109_0242540 3300048912 Bacteria 1696
1902 Ga0496109_0260169 3300048912 Bacteria 1634
1903 Ga0496109_0389441 3300048912 Bacteria 1317
1904 Ga0496109_0406404 3300048912 Bacteria 1286
1905 Ga0496110_0000703 3300048913 Bacteria 23096
1906 Ga0496110_0003699 3300048913 Bacteria 11777
1907 Ga0496110_0024790 3300048913 Bacteria 5117
1908 Ga0496110_0027678 3300048913 Bacteria 4861
1909 Ga0496110_0046922 3300048913 Bacteria 3780
1910 Ga0496110_0060578 3300048913 Bacteria 3338
1911 Ga0496110_0061833 3300048913 Bacteria 3306
1912 Ga0496110_0094841 3300048913 Bacteria 2672
1913 Ga0496110_0119854 3300048913 Bacteria 2370
1914 Ga0496110_0187305 3300048913 Bacteria 1879
1915 Ga0496110_0219871 3300048913 Bacteria 1727
1916 Ga0496110_0285687 3300048913 Bacteria 1502
1917 Ga0496110_0328582 3300048913 Bacteria 1393
1918 Ga0496110_0406382 3300048913 Bacteria 1241
1919 Ga0496110_0464341 3300048913 Bacteria 1153
1920 Ga0496110_0626743 3300048913 Bacteria 974
1921 Ga0496110_0782164 3300048913 Bacteria 858
1922 Ga0496110_0892603 3300048913 Bacteria 795
1923 Ga0496110_0930238 3300048913 Bacteria 776
1924 Ga0496110_1181641 3300048913 Bacteria 674
1925 Ga0496111_0000328 3300048914 Bacteria 23607
1926 Ga0496111_0002795 3300048914 Bacteria 10630
1927 Ga0496111_0005039 3300048914 Bacteria 8403
1928 Ga0496111_0008043 3300048914 Bacteria 6958
1929 Ga0496111_0015799 3300048914 Bacteria 5192
1930 Ga0496111_0028064 3300048914 Bacteria 3987
1931 Ga0496111_0050581 3300048914 Bacteria 2998
1932 Ga0496111_0064217 3300048914 Bacteria 2663
1933 Ga0496111_0097433 3300048914 Bacteria 2159
1934 Ga0496111_0144930 3300048914 Bacteria 1760
1935 Ga0496111_0166343 3300048914 Bacteria 1638
1936 Ga0496111_0204353 3300048914 Bacteria 1468
1937 Ga0496111_0271302 3300048914 Bacteria 1258
1938 Ga0496111_0479594 3300048914 Bacteria 916
1939 Ga0496111_0506336 3300048914 Bacteria 888
1940 Ga0496111_0687062 3300048914 Bacteria 745
1941 Ga0496112_0001718 3300048915 Bacteria 17115
1942 Ga0496112_0034180 3300048915 Bacteria 4947
1943 Ga0496112_0058551 3300048915 Bacteria 3794
1944 Ga0496112_0061103 3300048915 Bacteria 3714
1945 Ga0496112_0064234 3300048915 Bacteria 3622
1946 Ga0496112_0258951 3300048915 Bacteria 1689
1947 Ga0496112_0353193 3300048915 Bacteria 1412
1948 Ga0496112_0616075 3300048915 Bacteria 1017
1949 Ga0496112_0750358 3300048915 Bacteria 902
1950 Ga0496112_0981505 3300048915 Bacteria 765
1951 Ga0496113_0020637 3300048916 Bacteria 4636
1952 Ga0496113_0025333 3300048916 Bacteria 4227
1953 Ga0496113_0047080 3300048916 Bacteria 3204
1954 Ga0496113_0060036 3300048916 Bacteria 2866
1955 Ga0496113_0071290 3300048916 Bacteria 2643
1956 Ga0496113_0073636 3300048916 Bacteria 2603
1957 Ga0496113_0078979 3300048916 Bacteria 2518
1958 Ga0496113_0100999 3300048916 Bacteria 2236
1959 Ga0496113_0128606 3300048916 Bacteria 1985
1960 Ga0496113_0234288 3300048916 Bacteria 1464
1961 Ga0496113_0247229 3300048916 Bacteria 1423
1962 Ga0496113_0667037 3300048916 Bacteria 831
1963 Ga0496114_0000108 3300048917 Bacteria 59737
1964 Ga0496114_0000136 3300048917 Bacteria 53108
1965 Ga0496114_0000166 3300048917 Bacteria 47004
1966 Ga0496114_0001030 3300048917 Bacteria 20943
1967 Ga0496114_0014522 3300048917 Bacteria 6326
1968 Ga0496114_0015786 3300048917 Bacteria 6077
1969 Ga0496114_0018358 3300048917 Bacteria 5655
1970 Ga0496114_0032826 3300048917 Bacteria 4275
1971 Ga0496114_0034725 3300048917 Bacteria 4161
1972 Ga0496114_0043379 3300048917 Bacteria 3729
1973 Ga0496114_0045508 3300048917 Bacteria 3646
1974 Ga0496114_0100998 3300048917 Bacteria 2462
1975 Ga0496114_0102937 3300048917 Bacteria 2440
1976 Ga0496114_0108633 3300048917 Bacteria 2375
1977 Ga0496114_0142542 3300048917 Bacteria 2076
1978 Ga0496114_0154426 3300048917 Bacteria 1992
1979 Ga0496114_0173239 3300048917 Bacteria 1882
1980 Ga0496114_0184949 3300048917 Bacteria 1821
1981 Ga0496114_0214340 3300048917 Bacteria 1689
1982 Ga0496114_0235784 3300048917 Bacteria 1608
1983 Ga0496114_0487614 3300048917 Bacteria 1090
1984 Ga0496114_0587221 3300048917 Bacteria 983
1985 Ga0496114_0795328 3300048917 Bacteria 824
1986 Ga0496114_0943555 3300048917 Bacteria 745
1987 Ga0496114_0965435 3300048917 Bacteria 735
1988 Ga0496115_0000620 3300048918 Bacteria 26937
1989 Ga0496115_0002574 3300048918 Bacteria 13020
1990 Ga0496115_0003759 3300048918 Bacteria 10911
1991 Ga0496115_0008804 3300048918 Bacteria 7480
1992 Ga0496115_0093541 3300048918 Bacteria 2458
1993 Ga0496115_0100991 3300048918 Bacteria 2365
1994 Ga0496115_0141115 3300048918 Bacteria 1988
1995 Ga0496115_0171042 3300048918 Bacteria 1797
1996 Ga0496115_0183031 3300048918 Bacteria 1732
1997 Ga0496115_0219692 3300048918 Bacteria 1568
1998 Ga0496115_0520517 3300048918 Bacteria 954
1999 Ga0496115_0551624 3300048918 Bacteria 921
2000 Ga0496116_0000154 3300048919 Bacteria 141052
2001 Ga0496116_0010448 3300048919 Bacteria 7775
2002 Ga0496116_0047143 3300048919 Bacteria 2902
2003 Ga0496117_0000053 3300048920 Bacteria 279396
2004 Ga0496117_0000081 3300048920 Bacteria 223343
2005 Ga0496117_0000620 3300048920 Bacteria 57459
2006 Ga0496117_0001098 3300048920 Bacteria 40887
2007 Ga0496117_0001267 3300048920 Bacteria 37488
2008 Ga0496117_0002166 3300048920 Bacteria 25599
2009 Ga0496117_0007100 3300048920 Bacteria 11070
2010 Ga0496117_0021611 3300048920 Bacteria 5198
2011 Ga0496117_0031847 3300048920 Bacteria 4019
2012 Ga0496117_0039735 3300048920 Bacteria 3468
2013 Ga0496117_0061874 3300048920 Bacteria 2569
2014 Ga0496117_0091566 3300048920 Bacteria 1955
2015 Ga0496117_0203684 3300048920 Bacteria 1116
2016 Ga0496118_0000062 3300048921 Bacteria 219267
2017 Ga0496118_0000292 3300048921 Bacteria 87325
2018 Ga0496118_0000909 3300048921 Bacteria 46249
2019 Ga0496118_0004368 3300048921 Bacteria 16812
2020 Ga0496118_0004656 3300048921 Bacteria 16093
2021 Ga0496118_0007965 3300048921 Bacteria 11078
2022 Ga0496118_0012368 3300048921 Bacteria 8202
2023 Ga0496118_0024300 3300048921 Bacteria 5236
2024 Ga0496118_0025277 3300048921 Bacteria 5098
2025 Ga0496118_0027693 3300048921 Bacteria 4789
2026 Ga0496118_0047637 3300048921 Bacteria 3319
2027 Ga0496118_0078705 3300048921 Bacteria 2331
2028 Ga0496118_0294754 3300048921 Bacteria 894
2029 Ga0496118_0324889 3300048921 Bacteria 833
2030 Ga0496119_0001862 3300048922 Bacteria 24358
2031 Ga0496119_0002060 3300048922 Bacteria 22733
2032 Ga0496119_0002138 3300048922 Bacteria 22248
2033 Ga0496119_0005568 3300048922 Bacteria 11985
2034 Ga0496119_0006144 3300048922 Bacteria 11241
2035 Ga0496119_0030536 3300048922 Bacteria 3630
2036 Ga0496119_0102929 3300048922 Bacteria 1600
2037 Ga0496119_0196059 3300048922 Bacteria 1049
2038 Ga0496119_0362176 3300048922 Bacteria 700
2039 Ga0496120_0003934 3300048923 Bacteria 12949
2040 Ga0496120_0004461 3300048923 Bacteria 11730
2041 Ga0496120_0006808 3300048923 Bacteria 8665
2042 Ga0496120_0011223 3300048923 Bacteria 6178
2043 Ga0496120_0027465 3300048923 Bacteria 3500
2044 Ga0496120_0046757 3300048923 Bacteria 2499
2045 Ga0496120_0069299 3300048923 Bacteria 1943
2046 Ga0496121_0000023 3300048924 Bacteria 463448
2047 Ga0496121_0000025 3300048924 Bacteria 453467
2048 Ga0496121_0004517 3300048924 Bacteria 18633
2049 Ga0496121_0079763 3300048924 Bacteria 2597
2050 Ga0496121_0203788 3300048924 Bacteria 1408
2051 Ga0496122_0000031 3300048925 Bacteria 329726
2052 Ga0496122_0000164 3300048925 Bacteria 158055
2053 Ga0496122_0000194 3300048925 Bacteria 139191
2054 Ga0496122_0000534 3300048925 Bacteria 78704
2055 Ga0496122_0002890 3300048925 Bacteria 23494
2056 Ga0496122_0004113 3300048925 Bacteria 18414
2057 Ga0496122_0004115 3300048925 Bacteria 18403
2058 Ga0496122_0055191 3300048925 Bacteria 2975
2059 Ga0496122_0066191 3300048925 Bacteria 2613
2060 Ga0496122_0107778 3300048925 Bacteria 1840
2061 Ga0496122_0152973 3300048925 Bacteria 1421
2062 Ga0496122_0259958 3300048925 Bacteria 964
2063 Ga0496123_0000013 3300048926 Bacteria 439694
2064 Ga0496123_0000350 3300048926 Bacteria 86569
2065 Ga0496123_0000405 3300048926 Bacteria 79019
2066 Ga0496123_0006609 3300048926 Bacteria 11199
2067 Ga0496123_0012134 3300048926 Bacteria 7380
2068 Ga0496123_0019951 3300048926 Bacteria 5262
2069 Ga0496123_0062624 3300048926 Bacteria 2382
2070 Ga0496123_0073328 3300048926 Bacteria 2124
2071 Ga0496123_0164456 3300048926 Bacteria 1179
2072 Ga0496123_0188128 3300048926 Bacteria 1071
2073 Ga0496123_0209463 3300048926 Bacteria 992
2074 Ga0496124_0000014 3300048927 Bacteria 463448
2075 Ga0496124_0000639 3300048927 Bacteria 57891
2076 Ga0496124_0001934 3300048927 Bacteria 28387
2077 Ga0496124_0008009 3300048927 Bacteria 11120
2078 Ga0496124_0008422 3300048927 Bacteria 10785
2079 Ga0496124_0013019 3300048927 Bacteria 8152
2080 Ga0496124_0013529 3300048927 Bacteria 7958
2081 Ga0496124_0039796 3300048927 Bacteria 4071
2082 Ga0496124_0075059 3300048927 Bacteria 2794
2083 Ga0496124_0101982 3300048927 Bacteria 2323
2084 Ga0496124_0202138 3300048927 Bacteria 1510
2085 Ga0496124_0217065 3300048927 Bacteria 1442
2086 Ga0496125_0000020 3300048928 Bacteria 463448
2087 Ga0496125_0000077 3300048928 Bacteria 232629
2088 Ga0496125_0000214 3300048928 Bacteria 118625
2089 Ga0496125_0001148 3300048928 Bacteria 40166
2090 Ga0496125_0001794 3300048928 Bacteria 29677
2091 Ga0496125_0002783 3300048928 Bacteria 22123
2092 Ga0496125_0008936 3300048928 Bacteria 10400
2093 Ga0496125_0012221 3300048928 Bacteria 8541
2094 Ga0496125_0018219 3300048928 Bacteria 6673
2095 Ga0496125_0036927 3300048928 Bacteria 4256
2096 Ga0496125_0038013 3300048928 Bacteria 4175
2097 Ga0496125_0048465 3300048928 Bacteria 3542
2098 Ga0496125_0050127 3300048928 Bacteria 3460
2099 Ga0496125_0071585 3300048928 Bacteria 2707
2100 Ga0496125_0156675 3300048928 Bacteria 1555
2101 Ga0496125_0193599 3300048928 Bacteria 1340
2102 Ga0496125_0246893 3300048928 Bacteria 1129
2103 Ga0496126_0000023 3300048929 Bacteria 463448
2104 Ga0496126_0000148 3300048929 Bacteria 163288
2105 Ga0496126_0001990 3300048929 Bacteria 28976
2106 Ga0496126_0002423 3300048929 Bacteria 25250
2107 Ga0496126_0002459 3300048929 Bacteria 24976
2108 Ga0496126_0006797 3300048929 Bacteria 12687
2109 Ga0496126_0012100 3300048929 Bacteria 8858
2110 Ga0496126_0050007 3300048929 Bacteria 3813
2111 Ga0496126_0062614 3300048929 Bacteria 3337
2112 Ga0496126_0068432 3300048929 Bacteria 3170
2113 Ga0496126_0078199 3300048929 Bacteria 2932
2114 Ga0496126_0114972 3300048929 Bacteria 2340
2115 Ga0496126_0121367 3300048929 Bacteria 2266
2116 Ga0496126_0268555 3300048929 Bacteria 1416
2117 Ga0496126_0450459 3300048929 Bacteria 1036
2118 Ga0501311_031241 3300049527 Bacteria 772
2119 Ga0501323_020920 3300049539 Bacteria 862
2120 Ga0501324_014000 3300049540 Bacteria 765
2121 Ga0501325_009211 3300049541 Bacteria 872
2122 Ga0501031_0002402 3300049568 Bacteria 11907
2123 Ga0501031_0003411 3300049568 Bacteria 10198
2124 Ga0501031_0023629 3300049568 Bacteria 4007
2125 Ga0501031_0051451 3300049568 Bacteria 2683
2126 Ga0501031_0201152 3300049568 Bacteria 1300
2127 Ga0501031_0320430 3300049568 Bacteria 1004
2128 Ga0501031_0542561 3300049568 Bacteria 749
2129 Ga0501031_0621050 3300049568 Bacteria 695
2130 Ga0501031_0763917 3300049568 Bacteria 620
2131 Ga0501032_0001739 3300049569 Bacteria 17222
2132 Ga0501032_0006541 3300049569 Bacteria 8557
2133 Ga0501032_0008985 3300049569 Bacteria 7268
2134 Ga0501032_0023382 3300049569 Bacteria 4271
2135 Ga0501032_0023469 3300049569 Bacteria 4261
2136 Ga0501032_0037404 3300049569 Bacteria 3310
2137 Ga0501032_0042378 3300049569 Bacteria 3088
2138 Ga0501032_0115113 3300049569 Bacteria 1778
2139 Ga0501032_0217077 3300049569 Bacteria 1245
2140 Ga0501032_0627396 3300049569 Bacteria 683
2141 Ga0501033_0007861 3300049570 Bacteria 8264
2142 Ga0501033_0057125 3300049570 Bacteria 2885
2143 Ga0501033_0155186 3300049570 Bacteria 1650
2144 Ga0501033_0205054 3300049570 Bacteria 1407
2145 Ga0501033_0212357 3300049570 Bacteria 1380
2146 Ga0501034_0000123 3300049571 Bacteria 143688
2147 Ga0501034_0006051 3300049571 Bacteria 13067
2148 Ga0501034_0009822 3300049571 Bacteria 10006
2149 Ga0501034_0011109 3300049571 Bacteria 9348
2150 Ga0501034_0024319 3300049571 Bacteria 6161
2151 Ga0501034_0033073 3300049571 Bacteria 5251
2152 Ga0501034_0064237 3300049571 Bacteria 3685
2153 Ga0501034_0074634 3300049571 Bacteria 3399
2154 Ga0501034_0097073 3300049571 Bacteria 2943
2155 Ga0501034_0155749 3300049571 Bacteria 2259
2156 Ga0501034_0160200 3300049571 Bacteria 2222
2157 Ga0501034_0186543 3300049571 Bacteria 2037
2158 Ga0501034_0199933 3300049571 Bacteria 1957
2159 Ga0501034_0405360 3300049571 Bacteria 1286
2160 Ga0501034_0502382 3300049571 Bacteria 1126
2161 Ga0501034_0575650 3300049571 Bacteria 1033
2162 Ga0501036_0008345 3300049572 Bacteria 8487
2163 Ga0501036_0016634 3300049572 Bacteria 6141
2164 Ga0501036_0044342 3300049572 Bacteria 3767
2165 Ga0501036_0075540 3300049572 Bacteria 2849
2166 Ga0501036_0124413 3300049572 Bacteria 2178
2167 Ga0501036_0178840 3300049572 Bacteria 1786
2168 Ga0501036_0210665 3300049572 Bacteria 1633
2169 Ga0501036_0295530 3300049572 Bacteria 1355
2170 Ga0501036_0351722 3300049572 Bacteria 1230
2171 Ga0501036_0420751 3300049572 Bacteria 1114
2172 Ga0501037_0000584 3300049573 Bacteria 28691
2173 Ga0501037_0000863 3300049573 Bacteria 22612
2174 Ga0501037_0001957 3300049573 Bacteria 14880
2175 Ga0501037_0003783 3300049573 Bacteria 10981
2176 Ga0501037_0016798 3300049573 Bacteria 5384
2177 Ga0501037_0099864 3300049573 Bacteria 2096
2178 Ga0501037_0248068 3300049573 Bacteria 1246
2179 Ga0501038_0001295 3300049574 Bacteria 22770
2180 Ga0501038_0003008 3300049574 Bacteria 15716
2181 Ga0501038_0004282 3300049574 Bacteria 13269
2182 Ga0501038_0035852 3300049574 Bacteria 4354
2183 Ga0501038_0055449 3300049574 Bacteria 3404
2184 Ga0501038_0219033 3300049574 Bacteria 1519
2185 Ga0501038_0260863 3300049574 Bacteria 1370
2186 Ga0501038_0307987 3300049574 Bacteria 1241
2187 Ga0501038_0308723 3300049574 Bacteria 1240
2188 Ga0501038_0344258 3300049574 Bacteria 1162
2189 Ga0501038_0881465 3300049574 Bacteria 661
2190 Ga0501039_0002202 3300049575 Bacteria 14422
2191 Ga0501039_0006630 3300049575 Bacteria 8797
2192 Ga0501039_0011200 3300049575 Bacteria 6834
2193 Ga0501039_0035055 3300049575 Bacteria 3873
2194 Ga0501039_0049510 3300049575 Bacteria 3248
2195 Ga0501039_0137837 3300049575 Bacteria 1916
2196 Ga0501039_0158205 3300049575 Bacteria 1780
2197 Ga0501039_0189118 3300049575 Bacteria 1619
2198 Ga0501039_0291784 3300049575 Bacteria 1282
2199 Ga0501039_0541273 3300049575 Bacteria 914
2200 Ga0501040_0001421 3300049576 Bacteria 15151
2201 Ga0501040_0021274 3300049576 Bacteria 4330
2202 Ga0501040_0168508 3300049576 Bacteria 1550
2203 Ga0501040_0556618 3300049576 Bacteria 828
2204 Ga0501041_0002741 3300049577 Bacteria 10061
2205 Ga0501041_0093794 3300049577 Bacteria 1854
2206 Ga0501041_0101511 3300049577 Bacteria 1781
2207 Ga0501041_0172438 3300049577 Bacteria 1354
2208 Ga0501041_0258045 3300049577 Bacteria 1096
2209 Ga0501042_0000189 3300049578 Bacteria 28855
2210 Ga0501042_0002414 3300049578 Bacteria 11456
2211 Ga0501042_0012718 3300049578 Bacteria 5711
2212 Ga0501042_0038481 3300049578 Bacteria 3396
2213 Ga0501042_0435720 3300049578 Bacteria 950
2214 Ga0501043_0001037 3300049579 Bacteria 24401
2215 Ga0501043_0002604 3300049579 Bacteria 15216
2216 Ga0501043_0043512 3300049579 Bacteria 3529
2217 Ga0501043_0083344 3300049579 Bacteria 2514
2218 Ga0501043_0088651 3300049579 Bacteria 2431
2219 Ga0501043_0103315 3300049579 Bacteria 2239
2220 Ga0501043_0175548 3300049579 Bacteria 1670
2221 Ga0501043_0188970 3300049579 Bacteria 1602
2222 Ga0501043_0303731 3300049579 Bacteria 1219
2223 Ga0501046_0001804 3300049580 Bacteria 20417
2224 Ga0501046_0001835 3300049580 Bacteria 20253
2225 Ga0501046_0004159 3300049580 Bacteria 13175
2226 Ga0501046_0034241 3300049580 Bacteria 4100
2227 Ga0501046_0042468 3300049580 Bacteria 3625
2228 Ga0501047_0000372 3300049581 Bacteria 50660
2229 Ga0501047_0057925 3300049581 Bacteria 3744
2230 Ga0501047_0072206 3300049581 Bacteria 3322
2231 Ga0501047_0218046 3300049581 Bacteria 1764
2232 Ga0501047_0448173 3300049581 Bacteria 1120
2233 Ga0501047_0500029 3300049581 Bacteria 1042
2234 Ga0501047_0887076 3300049581 Bacteria 705
2235 Ga0501048_0001668 3300049582 Bacteria 16909
2236 Ga0501048_0006426 3300049582 Bacteria 8932
2237 Ga0501048_0019422 3300049582 Bacteria 4987
2238 Ga0501048_0031651 3300049582 Bacteria 3826
2239 Ga0501048_0345428 3300049582 Bacteria 1061
2240 Ga0501048_0423061 3300049582 Bacteria 953
2241 Ga0501048_0451943 3300049582 Bacteria 920
2242 Ga0501048_0501404 3300049582 Bacteria 870
2243 Ga0501067_0014756 3300049583 Bacteria 4322
2244 Ga0501067_0026865 3300049583 Bacteria 3188
2245 Ga0501067_0039898 3300049583 Bacteria 2607
2246 Ga0501067_0040779 3300049583 Bacteria 2578
2247 Ga0501067_0266973 3300049583 Bacteria 953
2248 Ga0501068_0165803 3300049584 Bacteria 1393
2249 Ga0501068_0175554 3300049584 Bacteria 1354
2250 Ga0501068_0279588 3300049584 Bacteria 1067
2251 Ga0501069_0027779 3300049585 Bacteria 3102
2252 Ga0501069_0060164 3300049585 Bacteria 2120
2253 Ga0501069_0162548 3300049585 Bacteria 1286
2254 Ga0501069_0243697 3300049585 Bacteria 1048
2255 Ga0501069_0408044 3300049585 Bacteria 804
2256 Ga0501069_0444067 3300049585 Bacteria 771
2257 Ga0501069_0512667 3300049585 Bacteria 716
2258 Ga0501070_0000578 3300049586 Bacteria 33378
2259 Ga0501070_0002976 3300049586 Bacteria 14755
2260 Ga0501070_0007031 3300049586 Bacteria 9574
2261 Ga0501070_0008628 3300049586 Bacteria 8617
2262 Ga0501070_0014025 3300049586 Bacteria 6746
2263 Ga0501070_0042424 3300049586 Bacteria 3789
2264 Ga0501070_0104461 3300049586 Bacteria 2342
2265 Ga0501070_0105217 3300049586 Bacteria 2333
2266 Ga0501070_0121929 3300049586 Bacteria 2154
2267 Ga0501070_0135715 3300049586 Bacteria 2032
2268 Ga0501070_0176220 3300049586 Bacteria 1760
2269 Ga0501070_0179835 3300049586 Bacteria 1741
2270 Ga0501070_0219133 3300049586 Bacteria 1561
2271 Ga0501070_0463296 3300049586 Bacteria 1021
2272 Ga0501070_0502008 3300049586 Bacteria 975
2273 Ga0501071_0006771 3300049587 Bacteria 7460
2274 Ga0501071_0012396 3300049587 Bacteria 5782
2275 Ga0501071_0130643 3300049587 Bacteria 1865
2276 Ga0501071_0309434 3300049587 Bacteria 1199
2277 Ga0501071_0311244 3300049587 Bacteria 1195
2278 Ga0501071_0597066 3300049587 Bacteria 849
2279 Ga0501072_0018778 3300049588 Bacteria 5332
2280 Ga0501072_0053277 3300049588 Bacteria 3186
2281 Ga0501072_0317010 3300049588 Bacteria 1239
2282 Ga0501072_0504029 3300049588 Bacteria 957
2283 Ga0501073_0024898 3300049589 Bacteria 4295
2284 Ga0501073_0025377 3300049589 Bacteria 4251
2285 Ga0501073_0046019 3300049589 Bacteria 3071
2286 Ga0501074_0018651 3300049590 Bacteria 5042
2287 Ga0501074_0046409 3300049590 Bacteria 3141
2288 Ga0501074_0065282 3300049590 Bacteria 2620
2289 Ga0501074_0127609 3300049590 Bacteria 1820
2290 Ga0501074_0266651 3300049590 Bacteria 1217
2291 Ga0501074_0636071 3300049590 Bacteria 754
2292 Ga0501074_0748344 3300049590 Bacteria 689
2293 Ga0501075_0011867 3300049591 Bacteria 6180
2294 Ga0501075_0045008 3300049591 Bacteria 3311
2295 Ga0501075_0709467 3300049591 Bacteria 766
2296 Ga0501076_0002548 3300049592 Bacteria 12542
2297 Ga0501076_0032441 3300049592 Bacteria 4076
2298 Ga0501076_0578788 3300049592 Bacteria 926
2299 Ga0501077_0366284 3300049593 Bacteria 920
2300 Ga0501077_0490108 3300049593 Bacteria 788
2301 Ga0501225_0049793 3300049705 Bacteria 1165
2302 Ga0501079_0018890 3300049741 Bacteria 5268
2303 Ga0501079_0041473 3300049741 Bacteria 3553
2304 Ga0501079_0306900 3300049741 Bacteria 1242
2305 Ga0501079_0571538 3300049741 Bacteria 889
2306 Ga0501079_0692977 3300049741 Bacteria 802
2307 Ga0501080_0012890 3300049742 Bacteria 7671
2308 Ga0501080_0017051 3300049742 Bacteria 6707
2309 Ga0501080_0042237 3300049742 Bacteria 4247
2310 Ga0501080_0244368 3300049742 Bacteria 1638
2311 Ga0501080_0316759 3300049742 Bacteria 1413
2312 Ga0501080_0386269 3300049742 Bacteria 1261
2313 Ga0501081_0013024 3300049743 Bacteria 5471
2314 Ga0501081_0034766 3300049743 Bacteria 3430
2315 Ga0501081_0357099 3300049743 Bacteria 1078
2316 Ga0501083_0000067 3300049744 Bacteria 71321
2317 Ga0501083_0010779 3300049744 Bacteria 6427
2318 Ga0501083_0170418 3300049744 Bacteria 1423
2319 Ga0501279_026464 3300049775 Bacteria 846
2320 Ga0501035_0001032 3300049822 Bacteria 29280
2321 Ga0501035_0037781 3300049822 Bacteria 4370
2322 Ga0501035_0164072 3300049822 Bacteria 1922
2323 Ga0501035_0258428 3300049822 Bacteria 1477
2324 Ga0501035_0272775 3300049822 Bacteria 1431
2325 Ga0501035_0442354 3300049822 Bacteria 1076
2326 Ga0501035_0449609 3300049822 Bacteria 1066
2327 Ga0501044_0002753 3300049823 Bacteria 20011
2328 Ga0501044_0005774 3300049823 Bacteria 13698
2329 Ga0501044_0006896 3300049823 Bacteria 12507
2330 Ga0501044_0021507 3300049823 Bacteria 6879
2331 Ga0501044_0042550 3300049823 Bacteria 4723
2332 Ga0501044_0077661 3300049823 Bacteria 3367
2333 Ga0501045_0003098 3300049824 Bacteria 11367
2334 Ga0501045_0007703 3300049824 Bacteria 7492
2335 Ga0501045_0031087 3300049824 Bacteria 3867
2336 Ga0501045_0032455 3300049824 Bacteria 3784
2337 Ga0501045_0063061 3300049824 Bacteria 2719
2338 Ga0501045_0087843 3300049824 Bacteria 2296
2339 Ga0501045_0239387 3300049824 Bacteria 1351
2340 Ga0501045_0514996 3300049824 Bacteria 888
2341 Ga0501045_0537658 3300049824 Bacteria 867
2342 Ga0501045_0818607 3300049824 Bacteria 685
2343 nmdc:mga03683_240832_c1 3300050489 Bacteria 838
2344 nmdc:mga03683_78144_c2 3300050489 Bacteria 913
2345 nmdc:mga03n38_155353_c1 3300050490 Bacteria 1154
2346 nmdc:mga03n38_170863_c1 3300050490 Bacteria 1107
2347 nmdc:mga03n38_3325_c1 3300050490 Bacteria 5147
2348 nmdc:mga03n38_40244_c1 3300050490 Bacteria 2031
2349 nmdc:mga03n38_4165_c1 3300050490 Bacteria 4753
2350 nmdc:mga03n38_48912_c1 3300050490 Bacteria 1878
2351 nmdc:mga03n38_5871_c1 3300050490 Bacteria 4220
2352 nmdc:mga03n38_5961_c1 3300050490 Bacteria 4196
2353 nmdc:mga00v17_10517_c1 3300050491 Bacteria 5054
2354 nmdc:mga00v17_105494_c1 3300050491 Bacteria 1783
2355 nmdc:mga00v17_10925_c1 3300050491 Bacteria 4976
2356 nmdc:mga00v17_147943_c1 3300050491 Bacteria 1508
2357 nmdc:mga00v17_1649_c1 3300050491 Bacteria 11309
2358 nmdc:mga00v17_184521_c1 3300050491 Bacteria 1346
2359 nmdc:mga00v17_194398_c1 3300050491 Bacteria 1311
2360 nmdc:mga00v17_208254_c1 3300050491 Bacteria 1265
2361 nmdc:mga00v17_23924_c1 3300050491 Bacteria 3538
2362 nmdc:mga00v17_26916_c1 3300050491 Bacteria 3354
2363 nmdc:mga00v17_2863_c1 3300050491 Bacteria 8839
2364 nmdc:mga00v17_306279_c1 3300050491 Bacteria 1032
2365 nmdc:mga00v17_309681_c1 3300050491 Bacteria 1026
2366 nmdc:mga00v17_365559_c1 3300050491 Bacteria 938
2367 nmdc:mga00v17_38431_c1 3300050491 Bacteria 2862
2368 nmdc:mga00v17_44519_c1 3300050491 Bacteria 2677
2369 nmdc:mga00v17_4701_c1 3300050491 Bacteria 7132
2370 nmdc:mga00v17_4704_c1 3300050491 Bacteria 7131
2371 nmdc:mga00v17_493121_c1 3300050491 Bacteria 794
2372 nmdc:mga00v17_493579_c1 3300050491 Bacteria 794
2373 nmdc:mga00v17_56226_c1 3300050491 Bacteria 2405
2374 nmdc:mga00v17_61808_c1 3300050491 Bacteria 2303
2375 nmdc:mga00v17_6620_c1 3300050491 Bacteria 6151
2376 nmdc:mga00v17_88686_c1 3300050491 Bacteria 1940
2377 nmdc:mga00v17_90848_c1 3300050491 Bacteria 1918
2378 nmdc:mga00v17_9487_c1 3300050491 Bacteria 5270
2379 nmdc:mga0yw44_10372_c1 3300050492 Bacteria 4757
2380 nmdc:mga0yw44_104012_c1 3300050492 Bacteria 1812
2381 nmdc:mga0yw44_123268_c1 3300050492 Bacteria 1671
2382 nmdc:mga0yw44_154586_c1 3300050492 Bacteria 1498
2383 nmdc:mga0yw44_173240_c1 3300050492 Bacteria 1418
2384 nmdc:mga0yw44_17768_c1 3300050492 Bacteria 3879
2385 nmdc:mga0yw44_196104_c1 3300050492 Bacteria 1333
2386 nmdc:mga0yw44_20184_c1 3300050492 Bacteria 3692
2387 nmdc:mga0yw44_23531_c1 3300050492 Bacteria 3472
2388 nmdc:mga0yw44_25618_c1 3300050492 Bacteria 3357
2389 nmdc:mga0yw44_258483_c1 3300050492 Bacteria 1160
2390 nmdc:mga0yw44_2653_c1 3300050492 Bacteria 7702
2391 nmdc:mga0yw44_272420_c1 3300050492 Bacteria 1130
2392 nmdc:mga0yw44_31744_c1 3300050492 Bacteria 3074
2393 nmdc:mga0yw44_426897_c1 3300050492 Bacteria 898
2394 nmdc:mga0yw44_430491_c1 3300050492 Bacteria 894
2395 nmdc:mga0yw44_44847_c1 3300050492 Bacteria 2647
2396 nmdc:mga0yw44_54851_c1 3300050492 Bacteria 2424
2397 nmdc:mga0yw44_55786_c1 3300050492 Bacteria 2405
2398 nmdc:mga0yw44_668238_c1 3300050492 Bacteria 706
2399 nmdc:mga0yw44_69425_c1 3300050492 Bacteria 2183
2400 nmdc:mga0yw44_715639_c1 3300050492 Bacteria 680
2401 nmdc:mga0k408_532670_c1 3300050493 Bacteria 695
2402 nmdc:mga06z11_115039_c1 3300050494 Bacteria 1494
2403 nmdc:mga06z11_133444_c1 3300050494 Bacteria 1397
2404 nmdc:mga06z11_229146_c1 3300050494 Bacteria 1088
2405 nmdc:mga06z11_242736_c1 3300050494 Bacteria 1058
2406 nmdc:mga06z11_24338_c1 3300050494 Bacteria 2855
2407 nmdc:mga06z11_245496_c1 3300050494 Bacteria 1053
2408 nmdc:mga06z11_38404_c1 3300050494 Bacteria 2378
2409 nmdc:mga06z11_42962_c1 3300050494 Bacteria 2270
2410 nmdc:mga06z11_430419_c1 3300050494 Bacteria 796
2411 nmdc:mga06z11_9271_c1 3300050494 Bacteria 4141
2412 nmdc:mga04h51_12279_c1 3300050495 Bacteria 2401
2413 nmdc:mga04h51_9531_c1 3300050495 Bacteria 2637
2414 nmdc:mga07m45_104888_c1 3300050496 Bacteria 1625
2415 nmdc:mga07m45_10919_c1 3300050496 Bacteria 4757
2416 nmdc:mga07m45_15975_c1 3300050496 Bacteria 4015
2417 nmdc:mga07m45_170758_c1 3300050496 Bacteria 1264
2418 nmdc:mga07m45_17140_c1 3300050496 Bacteria 3885
2419 nmdc:mga07m45_202120_c1 3300050496 Bacteria 1156
2420 nmdc:mga07m45_258990_c1 3300050496 Bacteria 1012
2421 nmdc:mga07m45_35551_c1 3300050496 Bacteria 2771
2422 nmdc:mga07m45_39648_c1 3300050496 Bacteria 2633
2423 nmdc:mga07m45_43434_c1 3300050496 Bacteria 2520
2424 nmdc:mga07m45_47019_c1 3300050496 Bacteria 2425
2425 nmdc:mga07m45_5220_c1 3300050496 Bacteria 6445
2426 nmdc:mga06r32_1532_c2 3300050510 Bacteria 7287
2427 nmdc:mga06r32_243069_c1 3300050510 Bacteria 1787
2428 nmdc:mga08y16_164725_c1 3300050511 Bacteria 2303
2429 nmdc:mga08y16_450569_c1 3300050511 Bacteria 1312
2430 nmdc:mga0rr50_211079_c1 3300050513 Bacteria 1599
2431 nmdc:mga0sz30_12553_c1 3300050516 Bacteria 3299
2432 nmdc:mga0sz30_17694_c1 3300050516 Bacteria 2845
2433 nmdc:mga0sz30_216499_c1 3300050516 Bacteria 851
2434 nmdc:mga0sz30_235498_c1 3300050516 Bacteria 815
2435 nmdc:mga0sz30_26662_c1 3300050516 Bacteria 2370
2436 nmdc:mga0sz30_36115_c1 3300050516 Bacteria 2065
2437 nmdc:mga0sz30_69261_c1 3300050516 Bacteria 1517
2438 nmdc:mga0sz30_83139_c1 3300050516 Bacteria 1387
2439 nmdc:mga0sz30_9473_c1 3300050516 Bacteria 3708
2440 nmdc:mga0sz30_9626_c1 3300050516 Bacteria 3684
2441 Ga0500610_0099170 3300053079 Bacteria 1508
2442 Ga0500635_0000023 3300053080 Bacteria 108024
2443 Ga0500635_0000695 3300053080 Bacteria 8518
2444 Ga0500635_0008873 3300053080 Bacteria 2772
2445 Ga0495655_0001030 3300053083 Bacteria 4302
2446 Ga0495595_0013782 3300053084 Bacteria 3420
2447 Ga0495619_0089017 3300053085 Bacteria 2088
2448 Ga0495619_0169034 3300053085 Bacteria 1512
2449 Ga0495619_0376405 3300053085 Bacteria 981
2450 Ga0495619_0553587 3300053085 Bacteria 789
2451 Ga0500578_0278165 3300053086 Bacteria 999
2452 Ga0500643_025929 3300053087 Bacteria 1842
2453 Ga0500644_0000106 3300053088 Bacteria 52751
2454 Ga0500644_0008183 3300053088 Bacteria 2753
2455 Ga0500644_0020802 3300053088 Bacteria 1957
2456 Ga0500644_0215917 3300053088 Bacteria 798
2457 Ga0500646_0136095 3300053090 Bacteria 803
2458 Ga0500640_103962 3300053095 Bacteria 1169
2459 Ga0500650_0017487 3300053098 Bacteria 3095
2460 Ga0500553_031523 3300053101 Bacteria 2644
2461 Ga0500556_0000001 3300053104 Bacteria 1135060
2462 Ga0500556_0001233 3300053104 Bacteria 11888
2463 Ga0500556_0003014 3300053104 Bacteria 5069
2464 Ga0500560_037300 3300053107 Bacteria 1506
2465 Ga0500593_000080 3300053117 Bacteria 35767
2466 Ga0500608_156891 3300053122 Bacteria 991
2467 Ga0500618_000077 3300053125 Bacteria 80520
2468 Ga0500628_057558 3300053129 Bacteria 941
2469 Ga0500642_0105745 3300053130 Bacteria 1312
2470 Ga0500642_0250087 3300053130 Bacteria 814
2471 Ga0500652_000535 3300053131 Bacteria 13353
2472 Ga0500652_044975 3300053131 Bacteria 1788
2473 Ga0500655_010128 3300053133 Bacteria 1701
2474 Ga0500658_0112817 3300053134 Bacteria 1198
2475 Ga0500559_0000043 3300053136 Bacteria 100617
2476 Ga0500559_0000183 3300053136 Bacteria 49768
2477 Ga0500559_0054388 3300053136 Bacteria 1773
2478 Ga0500559_0182057 3300053136 Bacteria 990
2479 Ga0500559_0248858 3300053136 Bacteria 837
2480 Ga0500568_0000003 3300053139 Bacteria 863587
2481 Ga0500568_0003139 3300053139 Bacteria 9419
2482 Ga0500568_0062693 3300053139 Bacteria 1436
2483 Ga0500573_0000303 3300053140 Bacteria 21072
2484 Ga0500573_0003200 3300053140 Bacteria 8418
2485 Ga0500573_0069636 3300053140 Bacteria 2007
2486 Ga0500577_0011231 3300053142 Bacteria 2664
2487 Ga0500577_0036766 3300053142 Bacteria 1755
2488 Ga0500577_0139630 3300053142 Bacteria 1021
2489 Ga0500577_0242403 3300053142 Bacteria 782
2490 Ga0500604_0033889 3300053151 Bacteria 1512
2491 Ga0500616_0000241 3300053153 Bacteria 86038
2492 Ga0500616_0001099 3300053153 Bacteria 28063
2493 Ga0500616_0002314 3300053153 Bacteria 16093
2494 Ga0500627_0019907 3300053158 Bacteria 2682
2495 Ga0500645_000075 3300053730 Bacteria 78736
2496 Ga0500645_002289 3300053730 Bacteria 8674
2497 Ga0500645_181638 3300053730 Bacteria 572
2498 Ga0501084_0004449 3300054114 Bacteria 11443
2499 Ga0501084_0571929 3300054114 Bacteria 955
2500 Ga0501084_0595501 3300054114 Bacteria 934
2501 Ga0501084_0715233 3300054114 Bacteria 844
2502 Ga0501084_1157219 3300054114 Bacteria 649
2503 Ga0590071_040775 3300059421 Bacteria 1117
2504 Ga0590075_043258 3300059424 Bacteria 1152
2505 Ga0587084_001185 3300059477 Bacteria 2412
2506 Ga0587083_0043316 3300059505 Bacteria 952
2507 Ga0587088_065670 3300059508 Bacteria 745
2508 Ga0587090_000021 3300059510 Bacteria 7644
2509 Ga0587125_005233 3300059607 Bacteria 1185
2510 Ga0587101_031036 3300059623 Bacteria 834
2511 Ga0587115_017161 3300059626 Bacteria 975
2512 Ga0587128_001669 3300059630 Bacteria 2153
2513 Ga0587068_041708 3300059641 Bacteria 832
2514 Ga0587076_046213 3300059645 Bacteria 832
2515 Ga0587100_001309 3300059648 Bacteria 1433
2516 Ga0501082_0114960 3300060353 Bacteria 2330
2517 Ga0501082_0135524 3300060353 Bacteria 2136
2518 Ga0501082_0515624 3300060353 Bacteria 1045
2519 Ga0501082_0591084 3300060353 Bacteria 971
2520 Ga0466962_0005853 3300061719 Bacteria 5906
2521 Ga0466962_0032314 3300061719 Bacteria 2505
2522 Ga0466962_0086094 3300061719 Bacteria 1504
2523 Ga0466962_0099518 3300061719 Bacteria 1396
2524 Ga0466962_0116559 3300061719 Bacteria 1287
2525 Ga0466962_0216866 3300061719 Bacteria 936
2526 Ga0466962_0317556 3300061719 Bacteria 772
2527 Ga0530510_0002178 3300061734 Bacteria 13433
2528 Ga0530510_0105234 3300061734 Bacteria 2065
2529 Ga0530510_0680317 3300061734 Bacteria 784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053730 Ga0500645_181638 Ga0500645_181638_15_524 161
2 3300014497 Ga0182008_10003852 Ga0182008_100038523 168
3 3300015261 Ga0182006_1042935 Ga0182006_10429352 168
4 3300048928 Ga0496125_0050127 Ga0496125_0050127_1820_2440 168
5 3300041451 Ga0451791_0875325 Ga0451791_0875325_82_633 171
6 3300053125 Ga0500618_000077 Ga0500618_000077_11283_11897 177
7 3300039437 Ga0436365_1183714 Ga0436365_1183714_3909_4463 179
8 3300039453 Ga0436362_0345588 Ga0436362_0345588_20827_21381 179
9 3300044719 Ga0466971_0166936 Ga0466971_0166936_466_1011 179
10 3300031456 Ga0307513_10118686 Ga0307513_101186861 180
11 3300005434 Ga0070709_10035781 Ga0070709_100357812 182
12 3300005435 Ga0070714_100097682 Ga0070714_1000976821 182
13 3300005436 Ga0070713_100010550 Ga0070713_1000105504 182
14 3300006173 Ga0070716_100248660 Ga0070716_1002486602 182
15 3300006175 Ga0070712_100375532 Ga0070712_1003755322 182
16 3300009545 Ga0105237_10037656 Ga0105237_100376562 182
17 3300013105 Ga0157369_10139662 Ga0157369_101396622 182
18 3300025898 Ga0207692_10011571 Ga0207692_100115714 182
19 3300025906 Ga0207699_10013278 Ga0207699_100132783 182
20 3300025914 Ga0207671_10433658 Ga0207671_104336582 182
21 3300025915 Ga0207693_10400335 Ga0207693_104003351 182
22 3300025928 Ga0207700_10208146 Ga0207700_102081462 182
23 3300025929 Ga0207664_10019234 Ga0207664_100192343 182
24 3300025939 Ga0207665_10350928 Ga0207665_103509282 182
25 3300049568 Ga0501031_0763917 Ga0501031_0763917_19_579 182
26 3300025916 Ga0207663_10434861 Ga0207663_104348612 183
27 3300047444 Ga0495675_0401456 Ga0495675_0401456_77_643 184
28 3300049590 Ga0501074_0636071 Ga0501074_0636071_170_730 186
29 3300049824 Ga0501045_0818607 Ga0501045_0818607_16_588 186
30 iso_pu_bacteria 2974315732 2974319068 190
31 iso_pu_bacteria 2643221561 2643825346 191
32 iso_pu_bacteria 2643221641 2644231434 191
33 iso_pu_bacteria 2643221681 2644456520 191
34 iso_pu_bacteria 2643221696 2644531339 191
35 iso_pu_bacteria 2675903060 2676488942 191
36 iso_pu_bacteria 2739367898 2740166763 191
37 iso_pu_bacteria 2784132109 2784472683 191
38 iso_pu_bacteria 2837268691 2837272877 191
39 iso_pu_bacteria 2842888712 2842889034 191
40 iso_pu_bacteria 2855386786 2855387580 191
41 iso_pu_bacteria 2868088558 2868093900 191
42 iso_pu_bacteria 2884693830 2884702517 191
43 iso_pu_bacteria 2895427314 2895429295 191
44 iso_pu_bacteria 2895442618 2895452016 191
45 iso_pu_bacteria 8016254467 8016255614 191
46 iso_pu_bacteria 8054609563 8054612498 191
47 3300048928 Ga0496125_0001148 Ga0496125_0001148_13494_14108 192
48 iso_pu_bacteria 2728369276 2729905946 192
49 iso_pu_bacteria 2751185782 2753267560 192
50 iso_pu_bacteria 2791355406 2793978292 192
51 iso_pu_bacteria 2837268691 2837270827 192
52 iso_pu_bacteria 2857481737 2857482812 192
53 iso_pu_bacteria 2866612099 2866616708 192
54 iso_pu_bacteria 2915358134 2915364333 192
55 iso_pu_bacteria 2990044586 2990046028 192
56 iso_pu_bacteria 8003314358 8003322944 192
57 iso_pu_bacteria 8047893842 8047895875 192
58 iso_pu_bacteria 8048127548 8048129140 192
59 iso_pu_bacteria 8048356638 8048363059 192
60 iso_pu_bacteria 8048369669 8048372899 192
61 iso_pu_bacteria 8048379754 8048381833 192
62 3300005288 Ga0065714_10068195 Ga0065714_100681954 193
63 3300005445 Ga0070708_100398506 Ga0070708_1003985062 193
64 3300005468 Ga0070707_100070332 Ga0070707_1000703322 193
65 3300005471 Ga0070698_100036887 Ga0070698_1000368875 193
66 3300025922 Ga0207646_10520655 Ga0207646_105206552 193
67 3300046454 Ga0495592_0014364 Ga0495592_0014364_2937_3560 193
68 3300046459 Ga0495629_0036577 Ga0495629_0036577_2172_2795 193
69 3300046462 Ga0495651_0004873 Ga0495651_0004873_9054_9677 193
70 3300046476 Ga0495662_0001536 Ga0495662_0001536_8184_8807 193
71 3300046477 Ga0495664_0003114 Ga0495664_0003114_2509_3132 193
72 3300046516 Ga0495628_0471375 Ga0495628_0471375_84_707 193
73 3300046524 Ga0495648_0000060 Ga0495648_0000060_117488_118105 193
74 3300046529 Ga0495652_0020548 Ga0495652_0020548_5101_5724 193
75 3300046536 Ga0495587_0015054 Ga0495587_0015054_1460_2083 193
76 3300046538 Ga0495609_0030682 Ga0495609_0030682_1076_1693 193
77 3300046557 Ga0495622_0000711 Ga0495622_0000711_14892_15509 193
78 3300046642 Ga0495634_0002254 Ga0495634_0002254_4827_5450 193
79 3300046663 Ga0495635_0007350 Ga0495635_0007350_2366_2989 193
80 3300046675 Ga0495657_0008139 Ga0495657_0008139_2587_3210 193
81 3300046680 Ga0495646_0000819 Ga0495646_0000819_2192_2815 193
82 3300046683 Ga0495658_0019238 Ga0495658_0019238_622_1245 193
83 3300046689 Ga0495613_0066413 Ga0495613_0066413_1308_1931 193
84 3300046809 Ga0495600_0017321 Ga0495600_0017321_3289_3912 193
85 3300047315 Ga0495581_0006577 Ga0495581_0006577_1906_2529 193
86 3300047317 Ga0495604_0000582 Ga0495604_0000582_7196_7819 193
87 3300047320 Ga0495672_0000112 Ga0495672_0000112_16738_17355 193
88 3300047321 Ga0495676_0047587 Ga0495676_0047587_1175_1798 193
89 3300047673 Ga0495593_0011893 Ga0495593_0011893_1570_2193 193
90 3300048089 Ga0495614_0004070 Ga0495614_0004070_2663_3286 193
91 3300048089 Ga0495614_0121854 Ga0495614_0121854_201_818 193
92 3300049571 Ga0501034_0199933 Ga0501034_0199933_246_842 193
93 3300053095 Ga0500640_103962 Ga0500640_103962_84_707 193
94 3300053101 Ga0500553_031523 Ga0500553_031523_438_1061 193
95 3300053107 Ga0500560_037300 Ga0500560_037300_313_936 193
96 iso_pu_bacteria 2523231044 2523384443 193
97 iso_pu_bacteria 2537561592 2537901163 193
98 iso_pu_bacteria 2547132424 2548697932 193
99 iso_pu_bacteria 2551306166 2552109599 193
100 iso_pu_bacteria 2554235227 2555231484 193
101 iso_pu_bacteria 2558860112 2558910808 193
102 iso_pu_bacteria 2558860280 2559429536 193
103 iso_pu_bacteria 2565956761 2566993121 193
104 iso_pu_bacteria 2582580736 2583150350 193
105 iso_pu_bacteria 2585427649 2586059078 193
106 iso_pu_bacteria 2585428157 2588108932 193
107 iso_pu_bacteria 2643221542 2643733893 193
108 iso_pu_bacteria 2643221546 2643753282 193
109 iso_pu_bacteria 2643221553 2643785515 193
110 iso_pu_bacteria 2643221566 2643848616 193
111 iso_pu_bacteria 2643221567 2643850840 193
112 iso_pu_bacteria 2643221572 2643875634 193
113 iso_pu_bacteria 2643221575 2643885695 193
114 iso_pu_bacteria 2643221597 2643996114 193
115 iso_pu_bacteria 2643221613 2644082092 193
116 iso_pu_bacteria 2643221615 2644089866 193
117 iso_pu_bacteria 2643221616 2644095697 193
118 iso_pu_bacteria 2643221617 2644102535 193
119 iso_pu_bacteria 2643221620 2644118198 193
120 iso_pu_bacteria 2643221624 2644134580 193
121 iso_pu_bacteria 2643221630 2644170474 193
122 iso_pu_bacteria 2643221649 2644277159 193
123 iso_pu_bacteria 2643221657 2644319711 193
124 iso_pu_bacteria 2643221669 2644382689 193
125 iso_pu_bacteria 2643221679 2644443973 193
126 iso_pu_bacteria 2643221687 2644486504 193
127 iso_pu_bacteria 2643221690 2644503253 193
128 iso_pu_bacteria 2643221692 2644513080 193
129 iso_pu_bacteria 2643221694 2644525565 193
130 iso_pu_bacteria 2643221711 2644608938 193
131 iso_pu_bacteria 2643221715 2644634932 193
132 iso_pu_bacteria 2643221721 2644664837 193
133 iso_pu_bacteria 2643221722 2644669643 193
134 iso_pu_bacteria 2643221724 2644679929 193
135 iso_pu_bacteria 2654587600 2655032345 193
136 iso_pu_bacteria 2675903058 2676478528 193
137 iso_pu_bacteria 2690315906 2691514387 193
138 iso_pu_bacteria 2728369380 2730229403 193
139 iso_pu_bacteria 2731639228 2731905780 193
140 iso_pu_bacteria 2738541264 2738667506 193
141 iso_pu_bacteria 2738541272 2738696663 193
142 iso_pu_bacteria 2738541274 2738706031 193
143 iso_pu_bacteria 2738541356 2739146576 193
144 iso_pu_bacteria 2738543005 2739203223 193
145 iso_pu_bacteria 2738543011 2739239705 193
146 iso_pu_bacteria 2738543027 2739324392 193
147 iso_pu_bacteria 2738543028 2739333069 193
148 iso_pu_bacteria 2738543034 2739362240 193
149 iso_pu_bacteria 2739367653 2739602599 193
150 iso_pu_bacteria 2739367654 2739606674 193
151 iso_pu_bacteria 2747842429 2747952418 193
152 iso_pu_bacteria 2751185734 2753070671 193
153 iso_pu_bacteria 2751185788 2753302458 193
154 iso_pu_bacteria 2757320536 2758225852 193
155 iso_pu_bacteria 2758568522 2760306502 193
156 iso_pu_bacteria 2758568621 2760625034 193
157 iso_pu_bacteria 2773857758 2774380157 193
158 iso_pu_bacteria 2773857759 2774384264 193
159 iso_pu_bacteria 2773857763 2774399276 193
160 iso_pu_bacteria 2775506735 2775655285 193
161 iso_pu_bacteria 2775506925 2776374250 193
162 iso_pu_bacteria 2791354901 2791910616 193
163 iso_pu_bacteria 2795385470 2795783597 193
164 iso_pu_bacteria 2795385472 2795794491 193
165 iso_pu_bacteria 2799112218 2799185249 193
166 iso_pu_bacteria 2808606306 2808630976 193
167 iso_pu_bacteria 2808606357 2808827471 193
168 iso_pu_bacteria 2808606360 2808852837 193
169 iso_pu_bacteria 2808606365 2808873395 193
170 iso_pu_bacteria 2808606366 2808878714 193
171 iso_pu_bacteria 2808606368 2808885832 193
172 iso_pu_bacteria 2808606370 2808891706 193
173 iso_pu_bacteria 2808606371 2808896836 193
174 iso_pu_bacteria 2808606394 2809029896 193
175 iso_pu_bacteria 2808606447 2809227619 193
176 iso_pu_bacteria 2808606522 2809592163 193
177 iso_pu_bacteria 2808606700 2810364020 193
178 iso_pu_bacteria 2811994871 2812320744 193
179 iso_pu_bacteria 2811994872 2812323428 193
180 iso_pu_bacteria 2811994880 2812364724 193
181 iso_pu_bacteria 2811994882 2812374081 193
182 iso_pu_bacteria 2816332139 2816504984 193
183 iso_pu_bacteria 2816332305 2817508928 193
184 iso_pu_bacteria 2818991318 2819426775 193
185 iso_pu_bacteria 2818991458 2819665789 193
186 iso_pu_bacteria 2818991462 2819692695 193
187 iso_pu_bacteria 2818991469 2819728942 193
188 iso_pu_bacteria 2821268502 2821270221 193
189 iso_pu_bacteria 2827628540 2827629588 193
190 iso_pu_bacteria 2835188231 2835188238 193
191 iso_pu_bacteria 2839986021 2839986052 193
192 iso_pu_bacteria 2842134933 2842138521 193
193 iso_pu_bacteria 2844841374 2844842078 193
194 iso_pu_bacteria 2844849076 2844849321 193
195 iso_pu_bacteria 2848551377 2848552725 193
196 iso_pu_bacteria 2852632344 2852634383 193
197 iso_pu_bacteria 2852646457 2852647121 193
198 iso_pu_bacteria 2852663356 2852665045 193
199 iso_pu_bacteria 2852677369 2852680093 193
200 iso_pu_bacteria 2857479173 2857480714 193
201 iso_pu_bacteria 2857632687 2857634201 193
202 iso_pu_bacteria 2857710386 2857713173 193
203 iso_pu_bacteria 2857720070 2857720110 193
204 iso_pu_bacteria 2857723135 2857723567 193
205 iso_pu_bacteria 2857727296 2857729200 193
206 iso_pu_bacteria 2857729791 2857730182 193
207 iso_pu_bacteria 2857740372 2857741551 193
208 iso_pu_bacteria 2863067949 2863070968 193
209 iso_pu_bacteria 2866552031 2866552738 193
210 iso_pu_bacteria 2870628048 2870630567 193
211 iso_pu_bacteria 2870721527 2870726770 193
212 iso_pu_bacteria 2870782633 2870784800 193
213 iso_pu_bacteria 2870801768 2870802779 193
214 iso_pu_bacteria 2870804320 2870804853 193
215 iso_pu_bacteria 2884763398 2884765065 193
216 iso_pu_bacteria 2884994152 2884996066 193
217 iso_pu_bacteria 2887443736 2887447645 193
218 iso_pu_bacteria 2889300758 2889300918 193
219 iso_pu_bacteria 2891326441 2891327416 193
220 iso_pu_bacteria 2893684298 2893686709 193
221 iso_pu_bacteria 2895660088 2895661692 193
222 iso_pu_bacteria 2899359706 2899365406 193
223 iso_pu_bacteria 2899370129 2899375261 193
224 iso_pu_bacteria 2902792274 2902798346 193
225 iso_pu_bacteria 2902799365 2902801786 193
226 iso_pu_bacteria 2902810491 2902817013 193
227 iso_pu_bacteria 2902837492 2902840079 193
228 iso_pu_bacteria 2904430863 2904432923 193
229 iso_pu_bacteria 2904497146 2904500083 193
230 iso_pu_bacteria 2904501621 2904503376 193
231 iso_pu_bacteria 2904509784 2904511776 193
232 iso_pu_bacteria 2904535858 2904538885 193
233 iso_pu_bacteria 2904765812 2904770149 193
234 iso_pu_bacteria 2904770941 2904771001 193
235 iso_pu_bacteria 2904776348 2904776404 193
236 iso_pu_bacteria 2905926851 2905927360 193
237 iso_pu_bacteria 2906799679 2906803090 193
238 iso_pu_bacteria 2908674828 2908675447 193
239 iso_pu_bacteria 2908678064 2908680702 193
240 iso_pu_bacteria 2908811453 2908815044 193
241 iso_pu_bacteria 2909074476 2909074503 193
242 iso_pu_bacteria 2915768154 2915773179 193
243 iso_pu_bacteria 2917736166 2917743398 193
244 iso_pu_bacteria 2919034639 2919037533 193
245 iso_pu_bacteria 2919039151 2919041485 193
246 iso_pu_bacteria 2919042368 2919045614 193
247 iso_pu_bacteria 2919051321 2919054703 193
248 iso_pu_bacteria 2919059106 2919063293 193
249 iso_pu_bacteria 2919069694 2919071747 193
250 iso_pu_bacteria 2919391150 2919391199 193
251 iso_pu_bacteria 2919395869 2919396409 193
252 iso_pu_bacteria 2919420072 2919424471 193
253 iso_pu_bacteria 2919432681 2919436864 193
254 iso_pu_bacteria 2919446982 2919449670 193
255 iso_pu_bacteria 2919523602 2919524121 193
256 iso_pu_bacteria 2919538618 2919541920 193
257 iso_pu_bacteria 2919713450 2919715892 193
258 iso_pu_bacteria 2922554459 2922556817 193
259 iso_pu_bacteria 2928090899 2928092059 193
260 iso_pu_bacteria 2928104781 2928107445 193
261 iso_pu_bacteria 2928121344 2928123405 193
262 iso_pu_bacteria 2928142448 2928142553 193
263 iso_pu_bacteria 2928500415 2928500432 193
264 iso_pu_bacteria 2929212328 2929214762 193
265 iso_pu_bacteria 2932426870 2932429021 193
266 iso_pu_bacteria 2932431166 2932432853 193
267 iso_pu_bacteria 2933418574 2933421235 193
268 iso_pu_bacteria 2935890801 2935893324 193
269 iso_pu_bacteria 2939582691 2939586654 193
270 iso_pu_bacteria 2939598168 2939598440 193
271 iso_pu_bacteria 2939647034 2939649092 193
272 iso_pu_bacteria 2939660829 2939662543 193
273 iso_pu_bacteria 2939674588 2939676286 193
274 iso_pu_bacteria 2939743619 2939744432 193
275 iso_pu_bacteria 2945916053 2945918504 193
276 iso_pu_bacteria 2945920336 2945921213 193
277 iso_pu_bacteria 2945941187 2945942625 193
278 iso_pu_bacteria 2945956166 2945959614 193
279 iso_pu_bacteria 2945968032 2945971574 193
280 iso_pu_bacteria 2946003308 2946005062 193
281 iso_pu_bacteria 2946033335 2946034007 193
282 iso_pu_bacteria 2946037020 2946038544 193
283 iso_pu_bacteria 2946041624 2946043951 193
284 iso_pu_bacteria 2946059875 2946062362 193
285 iso_pu_bacteria 2946080515 2946081176 193
286 iso_pu_bacteria 2946080515 2946084384 193
287 iso_pu_bacteria 2953998280 2953999817 193
288 iso_pu_bacteria 2956939328 2956939380 193
289 iso_pu_bacteria 2966921586 2966921596 193
290 iso_pu_bacteria 2974294766 2974297372 193
291 iso_pu_bacteria 2974302888 2974306535 193
292 iso_pu_bacteria 2974315732 2974317186 193
293 iso_pu_bacteria 2974324384 2974326390 193
294 iso_pu_bacteria 2977228692 2977231627 193
295 iso_pu_bacteria 2977236895 2977236982 193
296 iso_pu_bacteria 2977251589 2977254150 193
297 iso_pu_bacteria 2977264416 2977266850 193
298 iso_pu_bacteria 2984523437 2984525392 193
299 iso_pu_bacteria 2984542743 2984545225 193
300 iso_pu_bacteria 2984576629 2984577099 193
301 iso_pu_bacteria 2984580707 2984581175 193
302 iso_pu_bacteria 2990256926 2990258846 193
303 iso_pu_bacteria 3001119090 3001122173 193
304 iso_pu_bacteria 3001889506 3001890914 193
305 iso_pu_bacteria 8003314358 8003316279 193
306 iso_pu_bacteria 8004021418 8004021853 193
307 iso_pu_bacteria 8004025490 8004027683 193
308 iso_pu_bacteria 8004182704 8004185370 193
309 iso_pu_bacteria 8004212874 8004213898 193
310 iso_pu_bacteria 8016254467 8016257336 193
311 iso_pu_bacteria 8045830549 8045831800 193
312 iso_pu_bacteria 8047710418 8047715548 193
313 iso_pu_bacteria 8054107350 8054107886 193
314 iso_pu_bacteria 8055034563 8055036239 193
315 iso_pu_bacteria 8055037949 8055038289 193
316 iso_pu_bacteria 8056207758 8056211923 193
317 iso_pu_bacteria 8056579771 8056582756 193
318 iso_pu_bacteria 8057345674 8057348126 193
319 3300005435 Ga0070714_100929831 Ga0070714_1009298311 194
320 3300037471 Ga0395905_0018534 Ga0395905_0018534_1060_1653 194
321 3300038443 Ga0395901_0017149 Ga0395901_0017149_199_792 194
322 3300044658 Ga0466972_0194569 Ga0466972_0194569_229_822 194
323 3300044683 Ga0466965_0019242 Ga0466965_0019242_1812_2405 194
324 3300044735 Ga0466968_0126384 Ga0466968_0126384_272_865 194
325 3300044765 Ga0466970_0004725 Ga0466970_0004725_502_1095 194
326 3300044765 Ga0466970_0007605 Ga0466970_0007605_2938_3531 194
327 3300044901 Ga0466960_0011393 Ga0466960_0011393_2428_3021 194
328 3300044901 Ga0466960_0015560 Ga0466960_0015560_805_1392 194
329 3300049568 Ga0501031_0003411 Ga0501031_0003411_6233_6826 194
330 3300049569 Ga0501032_0023469 Ga0501032_0023469_1369_1962 194
331 3300049571 Ga0501034_0033073 Ga0501034_0033073_3629_4222 194
332 3300049572 Ga0501036_0075540 Ga0501036_0075540_1625_2218 194
333 3300049573 Ga0501037_0016798 Ga0501037_0016798_3396_3989 194
334 3300049574 Ga0501038_0004282 Ga0501038_0004282_730_1323 194
335 3300049575 Ga0501039_0035055 Ga0501039_0035055_1294_1887 194
336 3300049576 Ga0501040_0556618 Ga0501040_0556618_223_816 194
337 3300049578 Ga0501042_0435720 Ga0501042_0435720_135_722 194
338 3300049579 Ga0501043_0002604 Ga0501043_0002604_11382_11975 194
339 3300049580 Ga0501046_0042468 Ga0501046_0042468_2658_3251 194
340 3300049581 Ga0501047_0057925 Ga0501047_0057925_2649_3242 194
341 3300049582 Ga0501048_0001668 Ga0501048_0001668_12884_13477 194
342 3300049586 Ga0501070_0014025 Ga0501070_0014025_2550_3143 194
343 3300049590 Ga0501074_0127609 Ga0501074_0127609_678_1271 194
344 3300049742 Ga0501080_0017051 Ga0501080_0017051_1784_2377 194
345 3300049822 Ga0501035_0037781 Ga0501035_0037781_1187_1780 194
346 3300049823 Ga0501044_0042550 Ga0501044_0042550_1187_1780 194
347 3300054114 Ga0501084_0595501 Ga0501084_0595501_304_897 194
348 3300054114 Ga0501084_0715233 Ga0501084_0715233_143_730 194
349 3300054114 Ga0501084_1157219 Ga0501084_1157219_24_617 194
350 iso_pu_bacteria 2910809715 2910810810 194
351 3300000549 LJQas_1002763 LJQas_10027633 195
352 3300001989 JGI24739J22299_10030952 JGI24739J22299_100309521 195
353 3300001990 JGI24737J22298_10037221 JGI24737J22298_100372211 195
354 3300003162 Ga0006778J45830_1046883 Ga0006778J45830_10468832 195
355 3300003579 Ga0007429J51699_1064618 Ga0007429J51699_10646182 195
356 3300005327 Ga0070658_10036596 Ga0070658_100365961 195
357 3300005329 Ga0070683_100002925 Ga0070683_10000292514 195
358 3300005329 Ga0070683_100005291 Ga0070683_1000052915 195
359 3300005337 Ga0070682_100029896 Ga0070682_1000298961 195
360 3300005337 Ga0070682_100069578 Ga0070682_1000695783 195
361 3300005337 Ga0070682_100285939 Ga0070682_1002859391 195
362 3300005338 Ga0068868_100270642 Ga0068868_1002706422 195
363 3300005338 Ga0068868_100619552 Ga0068868_1006195522 195
364 3300005339 Ga0070660_100435252 Ga0070660_1004352521 195
365 3300005340 Ga0070689_100185179 Ga0070689_1001851792 195
366 3300005345 Ga0070692_10440528 Ga0070692_104405281 195
367 3300005367 Ga0070667_100222013 Ga0070667_1002220132 195
368 3300005438 Ga0070701_10058316 Ga0070701_100583162 195
369 3300005455 Ga0070663_100698980 Ga0070663_1006989801 195
370 3300005456 Ga0070678_100186562 Ga0070678_1001865621 195
371 3300005456 Ga0070678_100328699 Ga0070678_1003286991 195
372 3300005458 Ga0070681_10187707 Ga0070681_101877071 195
373 3300005458 Ga0070681_10462752 Ga0070681_104627522 195
374 3300005459 Ga0068867_100775014 Ga0068867_1007750141 195
375 3300005530 Ga0070679_100679874 Ga0070679_1006798742 195
376 3300005535 Ga0070684_100002996 Ga0070684_1000029963 195
377 3300005535 Ga0070684_100128019 Ga0070684_1001280191 195
378 3300005539 Ga0068853_100319131 Ga0068853_1003191311 195
379 3300005544 Ga0070686_100295262 Ga0070686_1002952621 195
380 3300005548 Ga0070665_100630898 Ga0070665_1006308982 195
381 3300005563 Ga0068855_100101899 Ga0068855_1001018994 195
382 3300005564 Ga0070664_100304863 Ga0070664_1003048632 195
383 3300005577 Ga0068857_100239231 Ga0068857_1002392312 195
384 3300005616 Ga0068852_100382475 Ga0068852_1003824751 195
385 3300005618 Ga0068864_100377908 Ga0068864_1003779082 195
386 3300005834 Ga0068851_10275388 Ga0068851_102753881 195
387 3300005843 Ga0068860_100140960 Ga0068860_1001409603 195
388 3300005844 Ga0068862_100977863 Ga0068862_1009778632 195
389 3300005985 Ga0081539_10011421 Ga0081539_100114212 195
390 3300006038 Ga0075365_10133449 Ga0075365_101334492 195
391 3300006038 Ga0075365_10142973 Ga0075365_101429732 195
392 3300006051 Ga0075364_10256766 Ga0075364_102567662 195
393 3300006177 Ga0075362_10045940 Ga0075362_100459403 195
394 3300006844 Ga0075428_100913642 Ga0075428_1009136422 195
395 3300006881 Ga0068865_100069240 Ga0068865_1000692401 195
396 3300009011 Ga0105251_10230767 Ga0105251_102307671 195
397 3300009094 Ga0111539_12002692 Ga0111539_120026921 195
398 3300009098 Ga0105245_10009129 Ga0105245_100091292 195
399 3300009098 Ga0105245_10114201 Ga0105245_101142012 195
400 3300009098 Ga0105245_10165675 Ga0105245_101656752 195
401 3300009098 Ga0105245_10394668 Ga0105245_103946682 195
402 3300009148 Ga0105243_10076149 Ga0105243_100761493 195
403 3300009148 Ga0105243_11306310 Ga0105243_113063102 195
404 3300009176 Ga0105242_10048975 Ga0105242_100489755 195
405 3300009177 Ga0105248_10206396 Ga0105248_102063962 195
406 3300009545 Ga0105237_10058531 Ga0105237_100585315 195
407 3300009551 Ga0105238_10191309 Ga0105238_101913092 195
408 3300010375 Ga0105239_10012474 Ga0105239_100124742 195
409 3300010375 Ga0105239_11017100 Ga0105239_110171001 195
410 3300011119 Ga0105246_10000453 Ga0105246_1000045324 195
411 3300011119 Ga0105246_10240468 Ga0105246_102404682 195
412 3300011119 Ga0105246_10384235 Ga0105246_103842352 195
413 3300013104 Ga0157370_10366195 Ga0157370_103661952 195
414 3300013105 Ga0157369_10502648 Ga0157369_105026481 195
415 3300013296 Ga0157374_10233253 Ga0157374_102332532 195
416 3300013296 Ga0157374_10523092 Ga0157374_105230921 195
417 3300013296 Ga0157374_10536436 Ga0157374_105364362 195
418 3300013306 Ga0163162_10008478 Ga0163162_100084787 195
419 3300013306 Ga0163162_10242409 Ga0163162_102424092 195
420 3300013306 Ga0163162_10549838 Ga0163162_105498382 195
421 3300013306 Ga0163162_11244451 Ga0163162_112444511 195
422 3300013307 Ga0157372_10007256 Ga0157372_1000725611 195
423 3300013307 Ga0157372_10198498 Ga0157372_101984984 195
424 3300013307 Ga0157372_10316858 Ga0157372_103168582 195
425 3300013307 Ga0157372_10682421 Ga0157372_106824212 195
426 3300013307 Ga0157372_10711593 Ga0157372_107115932 195
427 3300013308 Ga0157375_10031503 Ga0157375_100315036 195
428 3300013308 Ga0157375_10069146 Ga0157375_100691463 195
429 3300013308 Ga0157375_10181792 Ga0157375_101817923 195
430 3300013308 Ga0157375_11087099 Ga0157375_110870991 195
431 3300014325 Ga0163163_10014700 Ga0163163_100147004 195
432 3300014325 Ga0163163_10432712 Ga0163163_104327121 195
433 3300014326 Ga0157380_10310642 Ga0157380_103106423 195
434 3300014326 Ga0157380_10316718 Ga0157380_103167182 195
435 3300014326 Ga0157380_10352449 Ga0157380_103524492 195
436 3300014326 Ga0157380_10580437 Ga0157380_105804372 195
437 3300014326 Ga0157380_10977769 Ga0157380_109777691 195
438 3300014745 Ga0157377_10655686 Ga0157377_106556861 195
439 3300014968 Ga0157379_10078759 Ga0157379_100787593 195
440 3300014969 Ga0157376_11384130 Ga0157376_113841301 195
441 3300021384 Ga0213876_10045009 Ga0213876_100450092 195
442 3300025901 Ga0207688_10036380 Ga0207688_100363802 195
443 3300025901 Ga0207688_10517183 Ga0207688_105171831 195
444 3300025908 Ga0207643_10174754 Ga0207643_101747542 195
445 3300025912 Ga0207707_10373802 Ga0207707_103738022 195
446 3300025912 Ga0207707_10835629 Ga0207707_108356291 195
447 3300025913 Ga0207695_10341245 Ga0207695_103412452 195
448 3300025913 Ga0207695_10779348 Ga0207695_107793482 195
449 3300025914 Ga0207671_11002164 Ga0207671_110021641 195
450 3300025919 Ga0207657_10035850 Ga0207657_100358505 195
451 3300025919 Ga0207657_10284810 Ga0207657_102848102 195
452 3300025921 Ga0207652_11088857 Ga0207652_110888571 195
453 3300025924 Ga0207694_10824575 Ga0207694_108245752 195
454 3300025925 Ga0207650_10320443 Ga0207650_103204432 195
455 3300025927 Ga0207687_10006190 Ga0207687_100061907 195
456 3300025934 Ga0207686_10047600 Ga0207686_100476002 195
457 3300025934 Ga0207686_10775344 Ga0207686_107753441 195
458 3300025935 Ga0207709_10035744 Ga0207709_100357443 195
459 3300025935 Ga0207709_10962427 Ga0207709_109624271 195
460 3300025936 Ga0207670_10185364 Ga0207670_101853642 195
461 3300025937 Ga0207669_10269687 Ga0207669_102696872 195
462 3300025937 Ga0207669_10518063 Ga0207669_105180632 195
463 3300025938 Ga0207704_10096581 Ga0207704_100965811 195
464 3300025938 Ga0207704_10756838 Ga0207704_107568381 195
465 3300025941 Ga0207711_10109378 Ga0207711_101093782 195
466 3300025944 Ga0207661_10007359 Ga0207661_100073593 195
467 3300025944 Ga0207661_10542640 Ga0207661_105426402 195
468 3300025944 Ga0207661_10588874 Ga0207661_105888741 195
469 3300025949 Ga0207667_10320831 Ga0207667_103208312 195
470 3300025972 Ga0207668_10394774 Ga0207668_103947741 195
471 3300025972 Ga0207668_10672414 Ga0207668_106724141 195
472 3300026023 Ga0207677_10520298 Ga0207677_105202982 195
473 3300026023 Ga0207677_10912741 Ga0207677_109127411 195
474 3300026041 Ga0207639_10059075 Ga0207639_100590752 195
475 3300026067 Ga0207678_10091668 Ga0207678_100916682 195
476 3300026067 Ga0207678_10093126 Ga0207678_100931261 195
477 3300026075 Ga0207708_10043572 Ga0207708_100435722 195
478 3300026089 Ga0207648_10348666 Ga0207648_103486662 195
479 3300026116 Ga0207674_10073677 Ga0207674_100736773 195
480 3300026118 Ga0207675_100349542 Ga0207675_1003495422 195
481 3300026121 Ga0207683_10033631 Ga0207683_100336315 195
482 3300026121 Ga0207683_10176286 Ga0207683_101762862 195
483 3300026121 Ga0207683_10354123 Ga0207683_103541232 195
484 3300026121 Ga0207683_10490238 Ga0207683_104902381 195
485 3300026142 Ga0207698_10048023 Ga0207698_100480233 195
486 3300028379 Ga0268266_10004459 Ga0268266_1000445910 195
487 3300028381 Ga0268264_10318710 Ga0268264_103187101 195
488 3300028381 Ga0268264_11150541 Ga0268264_111505411 195
489 3300030736 Ga0316180_1152100 Ga0316180_11521001 195
490 3300031649 Ga0307514_10112618 Ga0307514_101126183 195
491 3300031727 Ga0316576_10033863 Ga0316576_100338632 195
492 3300031727 Ga0316576_10253739 Ga0316576_102537392 195
493 3300031728 Ga0316578_10014478 Ga0316578_100144782 195
494 3300031731 Ga0307405_10363089 Ga0307405_103630892 195
495 3300031731 Ga0307405_10404939 Ga0307405_104049391 195
496 3300031824 Ga0307413_10076674 Ga0307413_100766743 195
497 3300031824 Ga0307413_10105931 Ga0307413_101059312 195
498 3300031852 Ga0307410_10066312 Ga0307410_100663122 195
499 3300031852 Ga0307410_10151859 Ga0307410_101518592 195
500 3300031852 Ga0307410_10308212 Ga0307410_103082122 195
501 3300031852 Ga0307410_10360613 Ga0307410_103606132 195
502 3300031901 Ga0307406_10308237 Ga0307406_103082372 195
503 3300031901 Ga0307406_10420920 Ga0307406_104209202 195
504 3300031901 Ga0307406_10536323 Ga0307406_105363232 195
505 3300031903 Ga0307407_10009118 Ga0307407_100091183 195
506 3300031903 Ga0307407_10040578 Ga0307407_100405784 195
507 3300031903 Ga0307407_10081259 Ga0307407_100812593 195
508 3300031903 Ga0307407_10125801 Ga0307407_101258012 195
509 3300031995 Ga0307409_100096119 Ga0307409_1000961192 195
510 3300031995 Ga0307409_100111106 Ga0307409_1001111062 195
511 3300031995 Ga0307409_100142337 Ga0307409_1001423372 195
512 3300031995 Ga0307409_100542191 Ga0307409_1005421912 195
513 3300031995 Ga0307409_101605684 Ga0307409_1016056841 195
514 3300032002 Ga0307416_100010101 Ga0307416_1000101012 195
515 3300032002 Ga0307416_100081979 Ga0307416_1000819792 195
516 3300032002 Ga0307416_100304061 Ga0307416_1003040612 195
517 3300032002 Ga0307416_100423974 Ga0307416_1004239742 195
518 3300032004 Ga0307414_10242762 Ga0307414_102427622 195
519 3300032004 Ga0307414_10444021 Ga0307414_104440212 195
520 3300032004 Ga0307414_10666250 Ga0307414_106662501 195
521 3300032004 Ga0307414_11099943 Ga0307414_110999431 195
522 3300032005 Ga0307411_10048638 Ga0307411_100486382 195
523 3300032005 Ga0307411_10811817 Ga0307411_108118171 195
524 3300032126 Ga0307415_100000490 Ga0307415_10000049016 195
525 3300032126 Ga0307415_100079511 Ga0307415_1000795112 195
526 3300032126 Ga0307415_100163119 Ga0307415_1001631192 195
527 3300032126 Ga0307415_100177951 Ga0307415_1001779512 195
528 3300032126 Ga0307415_100318113 Ga0307415_1003181132 195
529 3300032126 Ga0307415_100348736 Ga0307415_1003487362 195
530 3300035398 Ga0316574_0001374 Ga0316574_0001374_10061_10648 195
531 3300035691 Ga0373931_0158929 Ga0373931_0158929_639_1226 195
532 3300036647 Ga0316582_0091332 Ga0316582_0091332_714_1301 195
533 3300036712 Ga0316584_0132859 Ga0316584_0132859_602_1189 195
534 3300036712 Ga0316584_0197293 Ga0316584_0197293_242_829 195
535 3300037418 Ga0395900_0014788 Ga0395900_0014788_3269_3856 195
536 3300037418 Ga0395900_0211502 Ga0395900_0211502_1128_1721 195
537 3300037418 Ga0395900_0403307 Ga0395900_0403307_131_718 195
538 3300037466 Ga0395898_0213897 Ga0395898_0213897_330_917 195
539 3300037466 Ga0395898_0314761 Ga0395898_0314761_890_1483 195
540 3300037471 Ga0395905_0482404 Ga0395905_0482404_49_636 195
541 3300037853 Ga0436364_0159458 Ga0436364_0159458_33_623 195
542 3300039437 Ga0436365_0024174 Ga0436365_0024174_1991_2578 195
543 3300041410 Ga0439461_0035095 Ga0439461_0035095_39_638 195
544 3300041411 Ga0439466_0096519 Ga0439466_0096519_59_658 195
545 3300041413 Ga0439465_0036951 Ga0439465_0036951_152_751 195
546 3300041443 Ga0451789_0528476 Ga0451789_0528476_125_712 195
547 3300041452 Ga0451793_0257821 Ga0451793_0257821_7811_8398 195
548 3300041452 Ga0451793_1068462 Ga0451793_1068462_146_745 195
549 3300041453 Ga0451797_1236370 Ga0451797_1236370_651_1238 195
550 3300041459 Ga0451800_1675357 Ga0451800_1675357_305_904 195
551 3300041491 Ga0451833_0567609 Ga0451833_0567609_8359_8949 195
552 3300041491 Ga0451833_0576784 Ga0451833_0576784_8040_8639 195
553 3300041494 Ga0451837_0512487 Ga0451837_0512487_792_1391 195
554 3300041496 Ga0451839_0032650 Ga0451839_0032650_683_1282 195
555 3300041498 Ga0451841_0312875 Ga0451841_0312875_691_1290 195
556 3300041498 Ga0451841_0983754 Ga0451841_0983754_405_992 195
557 3300041509 Ga0451843_0154978 Ga0451843_0154978_1091_1678 195
558 3300041509 Ga0451843_0385079 Ga0451843_0385079_132_731 195
559 3300041512 Ga0451853_3355307 Ga0451853_3355307_499_1098 195
560 3300041997 Ga0439431_0118006 Ga0439431_0118006_50_649 195
561 3300041997 Ga0439431_0132476 Ga0439431_0132476_70_669 195
562 3300042156 Ga0439446_0002186 Ga0439446_0002186_2330_2929 195
563 3300042435 Ga0439434_0014143 Ga0439434_0014143_334_933 195
564 3300042876 Ga0451577_0063035 Ga0451577_0063035_1402_1992 195
565 3300044683 Ga0466965_0007881 Ga0466965_0007881_3849_4448 195
566 3300044694 Ga0466963_0084493 Ga0466963_0084493_1007_1606 195
567 3300044694 Ga0466963_0096429 Ga0466963_0096429_581_1180 195
568 3300044694 Ga0466963_0149754 Ga0466963_0149754_996_1595 195
569 3300044694 Ga0466963_0801816 Ga0466963_0801816_38_637 195
570 3300044706 Ga0466964_0044120 Ga0466964_0044120_789_1376 195
571 3300044706 Ga0466964_0075615 Ga0466964_0075615_250_849 195
572 3300044719 Ga0466971_0060356 Ga0466971_0060356_327_914 195
573 3300044735 Ga0466968_0185629 Ga0466968_0185629_190_777 195
574 3300044765 Ga0466970_0039820 Ga0466970_0039820_916_1521 195
575 3300044842 Ga0466957_0009173 Ga0466957_0009173_2654_3241 195
576 3300044901 Ga0466960_0010089 Ga0466960_0010089_1298_1885 195
577 3300044901 Ga0466960_0015534 Ga0466960_0015534_1030_1617 195
578 3300045051 Ga0451576_0277383 Ga0451576_0277383_1009_1608 195
579 3300045836 Ga0466958_0012316 Ga0466958_0012316_3435_4022 195
580 3300045976 Ga0466967_0020955 Ga0466967_0020955_1506_2105 195
581 3300045976 Ga0466967_0026568 Ga0466967_0026568_2639_3238 195
582 3300046461 Ga0495641_0101382 Ga0495641_0101382_81_668 195
583 3300046461 Ga0495641_0319281 Ga0495641_0319281_51_650 195
584 3300046462 Ga0495651_0584879 Ga0495651_0584879_92_679 195
585 3300046473 Ga0495582_0385366 Ga0495582_0385366_96_683 195
586 3300046476 Ga0495662_0108611 Ga0495662_0108611_271_858 195
587 3300046499 Ga0495594_0166227 Ga0495594_0166227_236_835 195
588 3300046499 Ga0495594_0455961 Ga0495594_0455961_81_668 195
589 3300046511 Ga0495608_0120974 Ga0495608_0120974_544_1131 195
590 3300046516 Ga0495628_0620817 Ga0495628_0620817_95_682 195
591 3300046543 Ga0495645_0145984 Ga0495645_0145984_274_861 195
592 3300046615 Ga0495656_0226731 Ga0495656_0226731_203_802 195
593 3300046683 Ga0495658_0361519 Ga0495658_0361519_200_799 195
594 3300046690 Ga0495624_0241576 Ga0495624_0241576_207_794 195
595 3300046692 Ga0495671_0375187 Ga0495671_0375187_34_621 195
596 3300048089 Ga0495614_0361640 Ga0495614_0361640_42_629 195
597 3300048903 Ga0496100_0026768 Ga0496100_0026768_1885_2484 195
598 3300048903 Ga0496100_0029481 Ga0496100_0029481_2329_2928 195
599 3300048904 Ga0496101_0016494 Ga0496101_0016494_3336_3935 195
600 3300048904 Ga0496101_0197565 Ga0496101_0197565_46_645 195
601 3300048904 Ga0496101_0272717 Ga0496101_0272717_337_936 195
602 3300048904 Ga0496101_0503989 Ga0496101_0503989_239_838 195
603 3300048904 Ga0496101_0629454 Ga0496101_0629454_123_710 195
604 3300048905 Ga0496102_0002741 Ga0496102_0002741_10977_11576 195
605 3300048905 Ga0496102_0058304 Ga0496102_0058304_2596_3183 195
606 3300048905 Ga0496102_0089221 Ga0496102_0089221_1778_2365 195
607 3300048905 Ga0496102_0119866 Ga0496102_0119866_1748_2335 195
608 3300048905 Ga0496102_0245179 Ga0496102_0245179_312_911 195
609 3300048905 Ga0496102_0305399 Ga0496102_0305399_833_1432 195
610 3300048906 Ga0496103_0060285 Ga0496103_0060285_1362_1961 195
611 3300048906 Ga0496103_0104994 Ga0496103_0104994_1106_1693 195
612 3300048906 Ga0496103_0151194 Ga0496103_0151194_617_1204 195
613 3300048906 Ga0496103_0323156 Ga0496103_0323156_263_850 195
614 3300048906 Ga0496103_0476747 Ga0496103_0476747_32_631 195
615 3300048907 Ga0496104_0004578 Ga0496104_0004578_2439_3026 195
616 3300048907 Ga0496104_0006188 Ga0496104_0006188_3593_4192 195
617 3300048907 Ga0496104_0433695 Ga0496104_0433695_283_870 195
618 3300048908 Ga0496105_0002641 Ga0496105_0002641_8991_9578 195
619 3300048908 Ga0496105_0010434 Ga0496105_0010434_5911_6510 195
620 3300048908 Ga0496105_0124921 Ga0496105_0124921_309_908 195
621 3300048909 Ga0496106_0501993 Ga0496106_0501993_347_946 195
622 3300048910 Ga0496107_0024200 Ga0496107_0024200_2519_3118 195
623 3300048910 Ga0496107_0517517 Ga0496107_0517517_195_794 195
624 3300048910 Ga0496107_0699068 Ga0496107_0699068_17_616 195
625 3300048911 Ga0496108_0002258 Ga0496108_0002258_7841_8440 195
626 3300048911 Ga0496108_0007290 Ga0496108_0007290_5949_6536 195
627 3300048911 Ga0496108_0222998 Ga0496108_0222998_219_818 195
628 3300048911 Ga0496108_0377256 Ga0496108_0377256_539_1138 195
629 3300048912 Ga0496109_0000639 Ga0496109_0000639_19071_19658 195
630 3300048912 Ga0496109_0043331 Ga0496109_0043331_31_630 195
631 3300048912 Ga0496109_0049297 Ga0496109_0049297_3138_3737 195
632 3300048912 Ga0496109_0050983 Ga0496109_0050983_1526_2125 195
633 3300048912 Ga0496109_0085154 Ga0496109_0085154_1369_1968 195
634 3300048912 Ga0496109_0094256 Ga0496109_0094256_792_1391 195
635 3300048912 Ga0496109_0180328 Ga0496109_0180328_764_1351 195
636 3300048912 Ga0496109_0406404 Ga0496109_0406404_665_1264 195
637 3300048913 Ga0496110_0000703 Ga0496110_0000703_8708_9307 195
638 3300048913 Ga0496110_0003699 Ga0496110_0003699_10274_10861 195
639 3300048913 Ga0496110_0094841 Ga0496110_0094841_1362_1961 195
640 3300048913 Ga0496110_0328582 Ga0496110_0328582_572_1171 195
641 3300048914 Ga0496111_0000328 Ga0496111_0000328_21620_22207 195
642 3300048914 Ga0496111_0002795 Ga0496111_0002795_7248_7847 195
643 3300048914 Ga0496111_0166343 Ga0496111_0166343_468_1067 195
644 3300048914 Ga0496111_0687062 Ga0496111_0687062_52_639 195
645 3300048915 Ga0496112_0061103 Ga0496112_0061103_1068_1655 195
646 3300048915 Ga0496112_0616075 Ga0496112_0616075_220_819 195
647 3300048915 Ga0496112_0750358 Ga0496112_0750358_192_791 195
648 3300048916 Ga0496113_0025333 Ga0496113_0025333_1989_2588 195
649 3300048916 Ga0496113_0060036 Ga0496113_0060036_2000_2599 195
650 3300048916 Ga0496113_0234288 Ga0496113_0234288_714_1301 195
651 3300048917 Ga0496114_0015786 Ga0496114_0015786_803_1402 195
652 3300048917 Ga0496114_0034725 Ga0496114_0034725_2201_2800 195
653 3300048917 Ga0496114_0487614 Ga0496114_0487614_125_712 195
654 3300048917 Ga0496114_0943555 Ga0496114_0943555_72_659 195
655 3300048918 Ga0496115_0003759 Ga0496115_0003759_879_1478 195
656 3300048918 Ga0496115_0100991 Ga0496115_0100991_1653_2252 195
657 3300048918 Ga0496115_0219692 Ga0496115_0219692_483_1070 195
658 3300048920 Ga0496117_0031847 Ga0496117_0031847_1096_1701 195
659 3300048921 Ga0496118_0004656 Ga0496118_0004656_14636_15241 195
660 3300048922 Ga0496119_0002138 Ga0496119_0002138_2215_2820 195
661 3300048923 Ga0496120_0006808 Ga0496120_0006808_1242_1847 195
662 3300048925 Ga0496122_0000031 Ga0496122_0000031_135412_136017 195
663 3300048926 Ga0496123_0000013 Ga0496123_0000013_135422_136027 195
664 3300048926 Ga0496123_0062624 Ga0496123_0062624_326_925 195
665 3300048927 Ga0496124_0013529 Ga0496124_0013529_6417_7022 195
666 3300048927 Ga0496124_0075059 Ga0496124_0075059_1112_1711 195
667 3300048928 Ga0496125_0001794 Ga0496125_0001794_13883_14488 195
668 3300048929 Ga0496126_0012100 Ga0496126_0012100_1327_1932 195
669 3300049527 Ga0501311_031241 Ga0501311_031241_116_715 195
670 3300049540 Ga0501324_014000 Ga0501324_014000_123_722 195
671 3300049568 Ga0501031_0002402 Ga0501031_0002402_7750_8349 195
672 3300049568 Ga0501031_0051451 Ga0501031_0051451_978_1577 195
673 3300049568 Ga0501031_0542561 Ga0501031_0542561_10_597 195
674 3300049569 Ga0501032_0042378 Ga0501032_0042378_80_679 195
675 3300049569 Ga0501032_0627396 Ga0501032_0627396_18_617 195
676 3300049570 Ga0501033_0057125 Ga0501033_0057125_1519_2118 195
677 3300049570 Ga0501033_0155186 Ga0501033_0155186_971_1570 195
678 3300049572 Ga0501036_0178840 Ga0501036_0178840_598_1197 195
679 3300049572 Ga0501036_0420751 Ga0501036_0420751_201_788 195
680 3300049573 Ga0501037_0248068 Ga0501037_0248068_59_658 195
681 3300049574 Ga0501038_0881465 Ga0501038_0881465_41_628 195
682 3300049575 Ga0501039_0011200 Ga0501039_0011200_4938_5537 195
683 3300049575 Ga0501039_0049510 Ga0501039_0049510_2379_2978 195
684 3300049575 Ga0501039_0137837 Ga0501039_0137837_788_1387 195
685 3300049575 Ga0501039_0291784 Ga0501039_0291784_263_862 195
686 3300049576 Ga0501040_0021274 Ga0501040_0021274_2333_2932 195
687 3300049576 Ga0501040_0168508 Ga0501040_0168508_924_1511 195
688 3300049577 Ga0501041_0093794 Ga0501041_0093794_739_1338 195
689 3300049577 Ga0501041_0101511 Ga0501041_0101511_464_1063 195
690 3300049578 Ga0501042_0000189 Ga0501042_0000189_18013_18612 195
691 3300049578 Ga0501042_0012718 Ga0501042_0012718_2762_3361 195
692 3300049582 Ga0501048_0019422 Ga0501048_0019422_1689_2288 195
693 3300049582 Ga0501048_0345428 Ga0501048_0345428_337_936 195
694 3300049583 Ga0501067_0014756 Ga0501067_0014756_1170_1757 195
695 3300049584 Ga0501068_0165803 Ga0501068_0165803_486_1073 195
696 3300049585 Ga0501069_0027779 Ga0501069_0027779_1841_2428 195
697 3300049585 Ga0501069_0060164 Ga0501069_0060164_881_1480 195
698 3300049585 Ga0501069_0444067 Ga0501069_0444067_152_751 195
699 3300049586 Ga0501070_0008628 Ga0501070_0008628_5908_6507 195
700 3300049586 Ga0501070_0105217 Ga0501070_0105217_1355_1954 195
701 3300049586 Ga0501070_0179835 Ga0501070_0179835_480_1079 195
702 3300049587 Ga0501071_0006771 Ga0501071_0006771_1510_2109 195
703 3300049587 Ga0501071_0130643 Ga0501071_0130643_596_1195 195
704 3300049587 Ga0501071_0311244 Ga0501071_0311244_150_749 195
705 3300049588 Ga0501072_0053277 Ga0501072_0053277_1013_1612 195
706 3300049588 Ga0501072_0317010 Ga0501072_0317010_16_615 195
707 3300049589 Ga0501073_0046019 Ga0501073_0046019_877_1476 195
708 3300049590 Ga0501074_0018651 Ga0501074_0018651_3411_4010 195
709 3300049590 Ga0501074_0065282 Ga0501074_0065282_1727_2326 195
710 3300049590 Ga0501074_0266651 Ga0501074_0266651_273_872 195
711 3300049591 Ga0501075_0045008 Ga0501075_0045008_513_1112 195
712 3300049591 Ga0501075_0709467 Ga0501075_0709467_148_747 195
713 3300049592 Ga0501076_0032441 Ga0501076_0032441_3439_4038 195
714 3300049592 Ga0501076_0578788 Ga0501076_0578788_39_626 195
715 3300049593 Ga0501077_0490108 Ga0501077_0490108_116_715 195
716 3300049705 Ga0501225_0049793 Ga0501225_0049793_325_918 195
717 3300049741 Ga0501079_0306900 Ga0501079_0306900_513_1112 195
718 3300049741 Ga0501079_0571538 Ga0501079_0571538_194_793 195
719 3300049741 Ga0501079_0692977 Ga0501079_0692977_143_730 195
720 3300049742 Ga0501080_0244368 Ga0501080_0244368_366_968 195
721 3300049743 Ga0501081_0034766 Ga0501081_0034766_2567_3166 195
722 3300049743 Ga0501081_0357099 Ga0501081_0357099_36_623 195
723 3300049822 Ga0501035_0272775 Ga0501035_0272775_137_736 195
724 3300049822 Ga0501035_0442354 Ga0501035_0442354_283_882 195
725 3300049824 Ga0501045_0003098 Ga0501045_0003098_6363_6962 195
726 3300049824 Ga0501045_0063061 Ga0501045_0063061_1286_1885 195
727 3300049824 Ga0501045_0087843 Ga0501045_0087843_246_845 195
728 3300050489 nmdc:mga03683_240832_c1 nmdc:mga03683_240832_c1_169_756 195
729 3300050490 nmdc:mga03n38_170863_c1 nmdc:mga03n38_170863_c1_504_1091 195
730 3300050491 nmdc:mga00v17_10517_c1 nmdc:mga00v17_10517_c1_2095_2694 195
731 3300050491 nmdc:mga00v17_208254_c1 nmdc:mga00v17_208254_c1_374_973 195
732 3300050492 nmdc:mga0yw44_123268_c1 nmdc:mga0yw44_123268_c1_848_1447 195
733 3300050492 nmdc:mga0yw44_154586_c1 nmdc:mga0yw44_154586_c1_705_1304 195
734 3300050492 nmdc:mga0yw44_23531_c1 nmdc:mga0yw44_23531_c1_2211_2810 195
735 3300050492 nmdc:mga0yw44_54851_c1 nmdc:mga0yw44_54851_c1_860_1459 195
736 3300050494 nmdc:mga06z11_245496_c1 nmdc:mga06z11_245496_c1_444_1043 195
737 3300050510 nmdc:mga06r32_1532_c2 nmdc:mga06r32_1532_c2_5994_6581 195
738 3300053085 Ga0495619_0169034 Ga0495619_0169034_389_988 195
739 3300059424 Ga0590075_043258 Ga0590075_043258_515_1102 195
740 3300060353 Ga0501082_0515624 Ga0501082_0515624_212_811 195
741 3300000549 LJQas_1007556 LJQas_10075562 196
742 3300005327 Ga0070658_10052407 Ga0070658_100524074 196
743 3300005328 Ga0070676_10108855 Ga0070676_101088552 196
744 3300005329 Ga0070683_100376374 Ga0070683_1003763741 196
745 3300005338 Ga0068868_100058460 Ga0068868_1000584602 196
746 3300005366 Ga0070659_100116239 Ga0070659_1001162392 196
747 3300005438 Ga0070701_10113895 Ga0070701_101138952 196
748 3300005441 Ga0070700_100023501 Ga0070700_1000235012 196
749 3300005455 Ga0070663_100951066 Ga0070663_1009510661 196
750 3300005456 Ga0070678_100669366 Ga0070678_1006693662 196
751 3300005466 Ga0070685_10038005 Ga0070685_100380052 196
752 3300005539 Ga0068853_100271861 Ga0068853_1002718612 196
753 3300005547 Ga0070693_100091220 Ga0070693_1000912203 196
754 3300005548 Ga0070665_100651929 Ga0070665_1006519292 196
755 3300005564 Ga0070664_100053809 Ga0070664_1000538094 196
756 3300005564 Ga0070664_100060127 Ga0070664_1000601273 196
757 3300005578 Ga0068854_100077266 Ga0068854_1000772663 196
758 3300005616 Ga0068852_100061563 Ga0068852_1000615634 196
759 3300005617 Ga0068859_100136415 Ga0068859_1001364152 196
760 3300005618 Ga0068864_100051792 Ga0068864_1000517923 196
761 3300005841 Ga0068863_100000740 Ga0068863_10000074016 196
762 3300005937 Ga0081455_10077029 Ga0081455_100770292 196
763 3300006038 Ga0075365_10038012 Ga0075365_100380123 196
764 3300006048 Ga0075363_100055140 Ga0075363_1000551403 196
765 3300006051 Ga0075364_10054415 Ga0075364_100544152 196
766 3300006178 Ga0075367_10226819 Ga0075367_102268192 196
767 3300006353 Ga0075370_10053682 Ga0075370_100536823 196
768 3300006881 Ga0068865_100273685 Ga0068865_1002736852 196
769 3300006931 Ga0097620_100136415 Ga0097620_1001364152 196
770 3300009093 Ga0105240_10858087 Ga0105240_108580872 196
771 3300009094 Ga0111539_10127148 Ga0111539_101271482 196
772 3300009098 Ga0105245_10389919 Ga0105245_103899192 196
773 3300009098 Ga0105245_10879446 Ga0105245_108794462 196
774 3300009148 Ga0105243_10190325 Ga0105243_101903252 196
775 3300009148 Ga0105243_10602177 Ga0105243_106021772 196
776 3300009176 Ga0105242_10189303 Ga0105242_101893032 196
777 3300009551 Ga0105238_11367643 Ga0105238_113676431 196
778 3300009986 Ga0105033_109591 Ga0105033_1095911 196
779 3300010375 Ga0105239_10189334 Ga0105239_101893344 196
780 3300010375 Ga0105239_11033230 Ga0105239_110332302 196
781 3300012482 Ga0157318_1004668 Ga0157318_10046681 196
782 3300013297 Ga0157378_10200269 Ga0157378_102002693 196
783 3300013306 Ga0163162_10206622 Ga0163162_102066222 196
784 3300013307 Ga0157372_10887642 Ga0157372_108876422 196
785 3300013307 Ga0157372_11203304 Ga0157372_112033042 196
786 3300013308 Ga0157375_10214662 Ga0157375_102146622 196
787 3300013308 Ga0157375_11352433 Ga0157375_113524331 196
788 3300014326 Ga0157380_10070769 Ga0157380_100707692 196
789 3300014745 Ga0157377_10263320 Ga0157377_102633202 196
790 3300014968 Ga0157379_10010438 Ga0157379_100104384 196
791 3300014968 Ga0157379_10098804 Ga0157379_100988044 196
792 3300020082 Ga0206353_11704142 Ga0206353_117041422 196
793 3300021384 Ga0213876_10459845 Ga0213876_104598451 196
794 3300021388 Ga0213875_10003439 Ga0213875_100034398 196
795 3300021388 Ga0213875_10056891 Ga0213875_100568912 196
796 3300025302 Ga0207426_1018189 Ga0207426_10181894 196
797 3300025899 Ga0207642_10193023 Ga0207642_101930232 196
798 3300025901 Ga0207688_10062433 Ga0207688_100624333 196
799 3300025901 Ga0207688_10110505 Ga0207688_101105052 196
800 3300025903 Ga0207680_10046958 Ga0207680_100469583 196
801 3300025904 Ga0207647_10056436 Ga0207647_100564362 196
802 3300025904 Ga0207647_10192515 Ga0207647_101925152 196
803 3300025907 Ga0207645_10059697 Ga0207645_100596972 196
804 3300025924 Ga0207694_10585157 Ga0207694_105851572 196
805 3300025927 Ga0207687_10186796 Ga0207687_101867962 196
806 3300025932 Ga0207690_10383259 Ga0207690_103832591 196
807 3300025934 Ga0207686_10601788 Ga0207686_106017881 196
808 3300025935 Ga0207709_10568692 Ga0207709_105686922 196
809 3300025944 Ga0207661_10284259 Ga0207661_102842592 196
810 3300025945 Ga0207679_10408148 Ga0207679_104081481 196
811 3300025961 Ga0207712_10135798 Ga0207712_101357982 196
812 3300025981 Ga0207640_10063136 Ga0207640_100631362 196
813 3300026023 Ga0207677_10082631 Ga0207677_100826314 196
814 3300026075 Ga0207708_10021548 Ga0207708_100215482 196
815 3300026078 Ga0207702_10417068 Ga0207702_104170682 196
816 3300026088 Ga0207641_10024733 Ga0207641_100247334 196
817 3300026089 Ga0207648_10013968 Ga0207648_100139684 196
818 3300026095 Ga0207676_10474797 Ga0207676_104747972 196
819 3300026116 Ga0207674_10164705 Ga0207674_101647052 196
820 3300026118 Ga0207675_100032244 Ga0207675_1000322444 196
821 3300026118 Ga0207675_100365543 Ga0207675_1003655431 196
822 3300026121 Ga0207683_10538283 Ga0207683_105382831 196
823 3300026142 Ga0207698_10148211 Ga0207698_101482113 196
824 3300027907 Ga0207428_10056631 Ga0207428_100566312 196
825 3300028379 Ga0268266_10238730 Ga0268266_102387302 196
826 3300031649 Ga0307514_10064722 Ga0307514_100647225 196
827 3300031665 Ga0316575_10011282 Ga0316575_100112823 196
828 3300031691 Ga0316579_10009211 Ga0316579_100092116 196
829 3300031727 Ga0316576_10001035 Ga0316576_100010352 196
830 3300031727 Ga0316576_10004053 Ga0316576_100040535 196
831 3300031727 Ga0316576_10373535 Ga0316576_103735351 196
832 3300031728 Ga0316578_10009754 Ga0316578_100097541 196
833 3300031728 Ga0316578_10034715 Ga0316578_100347153 196
834 3300031728 Ga0316578_10069495 Ga0316578_100694952 196
835 3300031733 Ga0316577_10073843 Ga0316577_100738432 196
836 3300031733 Ga0316577_10285474 Ga0316577_102854741 196
837 3300031995 Ga0307409_100139552 Ga0307409_1001395523 196
838 3300032133 Ga0316583_10004706 Ga0316583_100047065 196
839 3300032133 Ga0316583_10017611 Ga0316583_100176112 196
840 3300032137 Ga0316585_10001298 Ga0316585_100012986 196
841 3300032137 Ga0316585_10007275 Ga0316585_100072753 196
842 3300032139 Ga0316580_10000717 Ga0316580_100007175 196
843 3300032139 Ga0316580_10035069 Ga0316580_100350692 196
844 3300032168 Ga0316593_10046437 Ga0316593_100464372 196
845 3300032168 Ga0316593_10144336 Ga0316593_101443362 196
846 3300033541 Ga0316596_1029852 Ga0316596_10298521 196
847 3300035121 Ga0373960_0140268 Ga0373960_0140268_191_781 196
848 3300035398 Ga0316574_0040766 Ga0316574_0040766_832_1422 196
849 3300035398 Ga0316574_0189779 Ga0316574_0189779_222_845 196
850 3300036647 Ga0316582_0001126 Ga0316582_0001126_9846_10436 196
851 3300036647 Ga0316582_0193607 Ga0316582_0193607_578_1201 196
852 3300036712 Ga0316584_0022330 Ga0316584_0022330_3008_3631 196
853 3300036712 Ga0316584_0130464 Ga0316584_0130464_746_1336 196
854 3300037312 Ga0395899_0045398 Ga0395899_0045398_623_1225 196
855 3300037418 Ga0395900_0334909 Ga0395900_0334909_186_788 196
856 3300037471 Ga0395905_0737646 Ga0395905_0737646_43_642 196
857 3300037588 Ga0316581_0008048 Ga0316581_0008048_502_1125 196
858 3300037588 Ga0316581_0026717 Ga0316581_0026717_398_988 196
859 3300037853 Ga0436364_0117105 Ga0436364_0117105_759_1361 196
860 3300037853 Ga0436364_0473109 Ga0436364_0473109_5399_6001 196
861 3300038443 Ga0395901_0418456 Ga0395901_0418456_377_979 196
862 3300039437 Ga0436365_1821963 Ga0436365_1821963_87_689 196
863 3300044658 Ga0466972_0262719 Ga0466972_0262719_149_748 196
864 3300044683 Ga0466965_0032452 Ga0466965_0032452_1458_2057 196
865 3300044683 Ga0466965_0097637 Ga0466965_0097637_477_1076 196
866 3300044683 Ga0466965_0134744 Ga0466965_0134744_91_690 196
867 3300044694 Ga0466963_0040021 Ga0466963_0040021_959_1558 196
868 3300044706 Ga0466964_0014897 Ga0466964_0014897_2226_2825 196
869 3300044765 Ga0466970_0017830 Ga0466970_0017830_923_1522 196
870 3300044765 Ga0466970_0025056 Ga0466970_0025056_1184_1783 196
871 3300044765 Ga0466970_0028904 Ga0466970_0028904_1653_2255 196
872 3300044842 Ga0466957_0370175 Ga0466957_0370175_181_780 196
873 3300044842 Ga0466957_0427001 Ga0466957_0427001_84_683 196
874 3300045836 Ga0466958_0410796 Ga0466958_0410796_18_617 196
875 3300045976 Ga0466967_0213475 Ga0466967_0213475_96_695 196
876 3300048903 Ga0496100_0009017 Ga0496100_0009017_2194_2784 196
877 3300048904 Ga0496101_0037409 Ga0496101_0037409_802_1392 196
878 3300048905 Ga0496102_0000028 Ga0496102_0000028_179602_180192 196
879 3300048905 Ga0496102_0309636 Ga0496102_0309636_42_632 196
880 3300048906 Ga0496103_0000024 Ga0496103_0000024_178840_179430 196
881 3300048906 Ga0496103_0119967 Ga0496103_0119967_195_785 196
882 3300048907 Ga0496104_0208658 Ga0496104_0208658_27_617 196
883 3300048908 Ga0496105_0150182 Ga0496105_0150182_948_1538 196
884 3300048911 Ga0496108_0446218 Ga0496108_0446218_294_884 196
885 3300048912 Ga0496109_0073845 Ga0496109_0073845_2456_3046 196
886 3300048913 Ga0496110_0060578 Ga0496110_0060578_1398_1988 196
887 3300048913 Ga0496110_0119854 Ga0496110_0119854_1163_1765 196
888 3300048914 Ga0496111_0008043 Ga0496111_0008043_128_718 196
889 3300048914 Ga0496111_0204353 Ga0496111_0204353_730_1320 196
890 3300048917 Ga0496114_0108633 Ga0496114_0108633_1684_2286 196
891 3300048917 Ga0496114_0795328 Ga0496114_0795328_106_708 196
892 3300048918 Ga0496115_0183031 Ga0496115_0183031_1129_1719 196
893 3300048919 Ga0496116_0000154 Ga0496116_0000154_96528_97118 196
894 3300048920 Ga0496117_0000081 Ga0496117_0000081_43927_44517 196
895 3300048921 Ga0496118_0000062 Ga0496118_0000062_43933_44523 196
896 3300048922 Ga0496119_0002060 Ga0496119_0002060_5267_5857 196
897 3300048924 Ga0496121_0079763 Ga0496121_0079763_1197_1787 196
898 3300048927 Ga0496124_0013019 Ga0496124_0013019_3025_3615 196
899 3300048927 Ga0496124_0217065 Ga0496124_0217065_758_1360 196
900 3300048928 Ga0496125_0012221 Ga0496125_0012221_5176_5766 196
901 3300048929 Ga0496126_0000148 Ga0496126_0000148_37729_38319 196
902 3300049539 Ga0501323_020920 Ga0501323_020920_235_846 196
903 3300049541 Ga0501325_009211 Ga0501325_009211_221_832 196
904 3300049568 Ga0501031_0621050 Ga0501031_0621050_29_628 196
905 3300049579 Ga0501043_0303731 Ga0501043_0303731_197_787 196
906 3300049580 Ga0501046_0001835 Ga0501046_0001835_17508_18107 196
907 3300049583 Ga0501067_0040779 Ga0501067_0040779_1240_1842 196
908 3300050491 nmdc:mga00v17_365559_c1 nmdc:mga00v17_365559_c1_33_635 196
909 3300050491 nmdc:mga00v17_493579_c1 nmdc:mga00v17_493579_c1_20_622 196
910 3300050491 nmdc:mga00v17_88686_c1 nmdc:mga00v17_88686_c1_1131_1733 196
911 3300050492 nmdc:mga0yw44_10372_c1 nmdc:mga0yw44_10372_c1_2220_2822 196
912 3300050492 nmdc:mga0yw44_272420_c1 nmdc:mga0yw44_272420_c1_288_890 196
913 3300050492 nmdc:mga0yw44_715639_c1 nmdc:mga0yw44_715639_c1_56_658 196
914 3300050494 nmdc:mga06z11_115039_c1 nmdc:mga06z11_115039_c1_509_1111 196
915 3300050496 nmdc:mga07m45_39648_c1 nmdc:mga07m45_39648_c1_917_1519 196
916 3300050511 nmdc:mga08y16_164725_c1 nmdc:mga08y16_164725_c1_213_803 196
917 3300050513 nmdc:mga0rr50_211079_c1 nmdc:mga0rr50_211079_c1_29_619 196
918 3300061719 Ga0466962_0086094 Ga0466962_0086094_184_783 196
919 3300000545 CNXas_1001015 CNXas_10010152 197
920 3300000549 LJQas_1000855 LJQas_10008553 197
921 3300001979 JGI24740J21852_10059155 JGI24740J21852_100591552 197
922 3300001990 JGI24737J22298_10018187 JGI24737J22298_100181872 197
923 3300001990 JGI24737J22298_10021654 JGI24737J22298_100216542 197
924 3300001990 JGI24737J22298_10142156 JGI24737J22298_101421561 197
925 3300001991 JGI24743J22301_10009702 JGI24743J22301_100097023 197
926 3300002067 JGI24735J21928_10034642 JGI24735J21928_100346422 197
927 3300002067 JGI24735J21928_10043912 JGI24735J21928_100439121 197
928 3300002070 JGI24750J21931_1025667 JGI24750J21931_10256671 197
929 3300002077 JGI24744J21845_10000011 JGI24744J21845_100000112 197
930 3300002077 JGI24744J21845_10000356 JGI24744J21845_100003567 197
931 3300002077 JGI24744J21845_10000383 JGI24744J21845_100003838 197
932 3300002239 JGI24034J26672_10016186 JGI24034J26672_100161861 197
933 3300002244 JGI24742J22300_10000643 JGI24742J22300_100006436 197
934 3300002244 JGI24742J22300_10011245 JGI24742J22300_100112452 197
935 3300002738 JGI25154J39366_1000846 JGI25154J39366_10008466 197
936 3300002772 JGI25164J39214_1003843 JGI25164J39214_10038432 197
937 3300002773 JGI25152J39213_1000824 JGI25152J39213_10008247 197
938 3300003187 JGI25151J46595_10032830 JGI25151J46595_100328302 197
939 3300003203 JGI25406J46586_10004772 JGI25406J46586_100047725 197
940 3300003203 JGI25406J46586_10006188 JGI25406J46586_100061881 197
941 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002354 197
942 3300003285 Ga0007423J48922_100245 Ga0007423J48922_1002453 197
943 3300003568 Ga0006781J51513_1017245 Ga0006781J51513_10172451 197
944 3300003578 Ga0006562J51391_1032679 Ga0006562J51391_10326799 197
945 3300003578 Ga0006562J51391_1032682 Ga0006562J51391_10326827 197
946 3300003579 Ga0007429J51699_1045605 Ga0007429J51699_10456052 197
947 3300003735 Ga0006780_1011353 Ga0006780_10113532 197
948 3300003752 Ga0055539_1006455 Ga0055539_10064552 197
949 3300003762 Ga0055542_1000017 Ga0055542_1000017226 197
950 3300003763 Ga0055529_1000023 Ga0055529_1000023193 197
951 3300003792 Ga0055540_1000057 Ga0055540_100005744 197
952 3300003792 Ga0055540_1004388 Ga0055540_10043881 197
953 3300003792 Ga0055540_1009880 Ga0055540_10098801 197
954 3300003792 Ga0055540_1016644 Ga0055540_10166441 197
955 3300003911 JGI25405J52794_10023184 JGI25405J52794_100231842 197
956 3300005288 Ga0065714_10127339 Ga0065714_101273392 197
957 3300005288 Ga0065714_10128825 Ga0065714_101288252 197
958 3300005288 Ga0065714_10180099 Ga0065714_101800992 197
959 3300005288 Ga0065714_10225455 Ga0065714_102254551 197
960 3300005288 Ga0065714_10226292 Ga0065714_102262921 197
961 3300005290 Ga0065712_10099900 Ga0065712_100999001 197
962 3300005327 Ga0070658_10007350 Ga0070658_100073503 197
963 3300005327 Ga0070658_10065597 Ga0070658_100655973 197
964 3300005327 Ga0070658_10170067 Ga0070658_101700671 197
965 3300005327 Ga0070658_10207444 Ga0070658_102074442 197
966 3300005327 Ga0070658_10245614 Ga0070658_102456142 197
967 3300005328 Ga0070676_10013868 Ga0070676_100138685 197
968 3300005328 Ga0070676_10649297 Ga0070676_106492971 197
969 3300005330 Ga0070690_100001859 Ga0070690_1000018596 197
970 3300005330 Ga0070690_100232940 Ga0070690_1002329401 197
971 3300005331 Ga0070670_100058829 Ga0070670_1000588292 197
972 3300005334 Ga0068869_100084842 Ga0068869_1000848422 197
973 3300005335 Ga0070666_10004074 Ga0070666_100040749 197
974 3300005335 Ga0070666_10202121 Ga0070666_102021212 197
975 3300005337 Ga0070682_100016306 Ga0070682_1000163064 197
976 3300005337 Ga0070682_100057509 Ga0070682_1000575092 197
977 3300005337 Ga0070682_100227290 Ga0070682_1002272902 197
978 3300005337 Ga0070682_100272480 Ga0070682_1002724802 197
979 3300005338 Ga0068868_100001302 Ga0068868_1000013028 197
980 3300005338 Ga0068868_100153555 Ga0068868_1001535552 197
981 3300005338 Ga0068868_100632007 Ga0068868_1006320071 197
982 3300005339 Ga0070660_100097022 Ga0070660_1000970222 197
983 3300005339 Ga0070660_100126694 Ga0070660_1001266942 197
984 3300005339 Ga0070660_100378725 Ga0070660_1003787252 197
985 3300005340 Ga0070689_100038951 Ga0070689_1000389514 197
986 3300005341 Ga0070691_10000684 Ga0070691_100006849 197
987 3300005341 Ga0070691_10055518 Ga0070691_100555182 197
988 3300005343 Ga0070687_100330061 Ga0070687_1003300612 197
989 3300005343 Ga0070687_100332120 Ga0070687_1003321201 197
990 3300005345 Ga0070692_10092708 Ga0070692_100927082 197
991 3300005345 Ga0070692_10393311 Ga0070692_103933112 197
992 3300005345 Ga0070692_10596993 Ga0070692_105969931 197
993 3300005347 Ga0070668_100001456 Ga0070668_1000014566 197
994 3300005347 Ga0070668_100020142 Ga0070668_1000201422 197
995 3300005347 Ga0070668_100084941 Ga0070668_1000849412 197
996 3300005347 Ga0070668_100102518 Ga0070668_1001025183 197
997 3300005347 Ga0070668_100279222 Ga0070668_1002792222 197
998 3300005347 Ga0070668_100554718 Ga0070668_1005547182 197
999 3300005347 Ga0070668_101169999 Ga0070668_1011699991 197
1000 3300005353 Ga0070669_100004418 Ga0070669_1000044185 197
1001 3300005353 Ga0070669_100044484 Ga0070669_1000444842 197
1002 3300005353 Ga0070669_100133619 Ga0070669_1001336192 197
1003 3300005354 Ga0070675_101140593 Ga0070675_1011405931 197
1004 3300005355 Ga0070671_100002781 Ga0070671_1000027815 197
1005 3300005355 Ga0070671_100075602 Ga0070671_1000756022 197
1006 3300005355 Ga0070671_100428683 Ga0070671_1004286832 197
1007 3300005355 Ga0070671_100467829 Ga0070671_1004678292 197
1008 3300005356 Ga0070674_100001031 Ga0070674_10000103117 197
1009 3300005356 Ga0070674_100004224 Ga0070674_1000042244 197
1010 3300005356 Ga0070674_100163583 Ga0070674_1001635831 197
1011 3300005356 Ga0070674_100313073 Ga0070674_1003130732 197
1012 3300005364 Ga0070673_100057901 Ga0070673_1000579013 197
1013 3300005364 Ga0070673_100202797 Ga0070673_1002027971 197
1014 3300005365 Ga0070688_100040398 Ga0070688_1000403982 197
1015 3300005365 Ga0070688_100108325 Ga0070688_1001083253 197
1016 3300005367 Ga0070667_100000063 Ga0070667_10000006369 197
1017 3300005367 Ga0070667_100003592 Ga0070667_1000035926 197
1018 3300005367 Ga0070667_100020470 Ga0070667_1000204704 197
1019 3300005367 Ga0070667_100077308 Ga0070667_1000773083 197
1020 3300005367 Ga0070667_100586459 Ga0070667_1005864591 197
1021 3300005367 Ga0070667_100955093 Ga0070667_1009550931 197
1022 3300005434 Ga0070709_10012771 Ga0070709_100127712 197
1023 3300005434 Ga0070709_10106104 Ga0070709_101061041 197
1024 3300005435 Ga0070714_100131541 Ga0070714_1001315412 197
1025 3300005435 Ga0070714_100220314 Ga0070714_1002203142 197
1026 3300005435 Ga0070714_100426128 Ga0070714_1004261281 197
1027 3300005435 Ga0070714_100836029 Ga0070714_1008360291 197
1028 3300005436 Ga0070713_100063045 Ga0070713_1000630452 197
1029 3300005437 Ga0070710_10000170 Ga0070710_1000017023 197
1030 3300005437 Ga0070710_10086143 Ga0070710_100861432 197
1031 3300005437 Ga0070710_10091914 Ga0070710_100919142 197
1032 3300005438 Ga0070701_10017749 Ga0070701_100177492 197
1033 3300005439 Ga0070711_100000327 Ga0070711_10000032729 197
1034 3300005439 Ga0070711_100057285 Ga0070711_1000572852 197
1035 3300005440 Ga0070705_100009547 Ga0070705_1000095472 197
1036 3300005440 Ga0070705_100016831 Ga0070705_1000168312 197
1037 3300005440 Ga0070705_100066626 Ga0070705_1000666262 197
1038 3300005441 Ga0070700_100015828 Ga0070700_1000158284 197
1039 3300005441 Ga0070700_100074882 Ga0070700_1000748822 197
1040 3300005444 Ga0070694_100092053 Ga0070694_1000920532 197
1041 3300005444 Ga0070694_100461561 Ga0070694_1004615612 197
1042 3300005455 Ga0070663_100000066 Ga0070663_10000006633 197
1043 3300005455 Ga0070663_100095231 Ga0070663_1000952312 197
1044 3300005455 Ga0070663_100244187 Ga0070663_1002441872 197
1045 3300005456 Ga0070678_100000105 Ga0070678_10000010513 197
1046 3300005456 Ga0070678_100181660 Ga0070678_1001816602 197
1047 3300005456 Ga0070678_100267679 Ga0070678_1002676792 197
1048 3300005456 Ga0070678_100433832 Ga0070678_1004338321 197
1049 3300005456 Ga0070678_100696239 Ga0070678_1006962392 197
1050 3300005456 Ga0070678_100711350 Ga0070678_1007113502 197
1051 3300005457 Ga0070662_100013920 Ga0070662_1000139203 197
1052 3300005458 Ga0070681_11026109 Ga0070681_110261091 197
1053 3300005459 Ga0068867_100000723 Ga0068867_10000072324 197
1054 3300005459 Ga0068867_100084233 Ga0068867_1000842332 197
1055 3300005459 Ga0068867_100898079 Ga0068867_1008980792 197
1056 3300005466 Ga0070685_10068320 Ga0070685_100683202 197
1057 3300005530 Ga0070679_100168141 Ga0070679_1001681412 197
1058 3300005530 Ga0070679_100179119 Ga0070679_1001791191 197
1059 3300005530 Ga0070679_100192160 Ga0070679_1001921601 197
1060 3300005530 Ga0070679_100218819 Ga0070679_1002188192 197
1061 3300005535 Ga0070684_100664926 Ga0070684_1006649262 197
1062 3300005535 Ga0070684_100801116 Ga0070684_1008011161 197
1063 3300005539 Ga0068853_100004749 Ga0068853_1000047499 197
1064 3300005539 Ga0068853_100105330 Ga0068853_1001053303 197
1065 3300005539 Ga0068853_100113957 Ga0068853_1001139573 197
1066 3300005539 Ga0068853_100341205 Ga0068853_1003412052 197
1067 3300005539 Ga0068853_100865855 Ga0068853_1008658551 197
1068 3300005543 Ga0070672_100233895 Ga0070672_1002338952 197
1069 3300005543 Ga0070672_100545062 Ga0070672_1005450622 197
1070 3300005544 Ga0070686_100183266 Ga0070686_1001832662 197
1071 3300005544 Ga0070686_100255224 Ga0070686_1002552242 197
1072 3300005545 Ga0070695_100138181 Ga0070695_1001381812 197
1073 3300005546 Ga0070696_100001184 Ga0070696_1000011842 197
1074 3300005546 Ga0070696_100029704 Ga0070696_1000297044 197
1075 3300005546 Ga0070696_100207002 Ga0070696_1002070022 197
1076 3300005546 Ga0070696_100252580 Ga0070696_1002525802 197
1077 3300005547 Ga0070693_100001801 Ga0070693_1000018012 197
1078 3300005548 Ga0070665_100003486 Ga0070665_1000034863 197
1079 3300005548 Ga0070665_100004232 Ga0070665_1000042326 197
1080 3300005548 Ga0070665_100016876 Ga0070665_1000168766 197
1081 3300005548 Ga0070665_100021912 Ga0070665_1000219125 197
1082 3300005548 Ga0070665_100077582 Ga0070665_1000775821 197
1083 3300005548 Ga0070665_100149255 Ga0070665_1001492552 197
1084 3300005548 Ga0070665_100303804 Ga0070665_1003038042 197
1085 3300005548 Ga0070665_100774285 Ga0070665_1007742851 197
1086 3300005549 Ga0070704_100000016 Ga0070704_10000001617 197
1087 3300005549 Ga0070704_100206369 Ga0070704_1002063692 197
1088 3300005563 Ga0068855_100373522 Ga0068855_1003735222 197
1089 3300005564 Ga0070664_100448781 Ga0070664_1004487812 197
1090 3300005577 Ga0068857_100165705 Ga0068857_1001657051 197
1091 3300005577 Ga0068857_100198908 Ga0068857_1001989082 197
1092 3300005578 Ga0068854_100061462 Ga0068854_1000614623 197
1093 3300005578 Ga0068854_100137026 Ga0068854_1001370261 197
1094 3300005578 Ga0068854_100221202 Ga0068854_1002212021 197
1095 3300005614 Ga0068856_100356286 Ga0068856_1003562862 197
1096 3300005614 Ga0068856_100670502 Ga0068856_1006705022 197
1097 3300005615 Ga0070702_100005010 Ga0070702_1000050107 197
1098 3300005615 Ga0070702_100078712 Ga0070702_1000787122 197
1099 3300005615 Ga0070702_100121090 Ga0070702_1001210902 197
1100 3300005617 Ga0068859_100000777 Ga0068859_10000077716 197
1101 3300005617 Ga0068859_100000989 Ga0068859_1000009895 197
1102 3300005617 Ga0068859_100414924 Ga0068859_1004149242 197
1103 3300005617 Ga0068859_100450299 Ga0068859_1004502992 197
1104 3300005618 Ga0068864_100246904 Ga0068864_1002469042 197
1105 3300005618 Ga0068864_100396433 Ga0068864_1003964332 197
1106 3300005718 Ga0068866_10000152 Ga0068866_1000015228 197
1107 3300005718 Ga0068866_10106627 Ga0068866_101066272 197
1108 3300005718 Ga0068866_10108479 Ga0068866_101084791 197
1109 3300005719 Ga0068861_100000157 Ga0068861_1000001578 197
1110 3300005719 Ga0068861_100491494 Ga0068861_1004914942 197
1111 3300005841 Ga0068863_100000159 Ga0068863_10000015914 197
1112 3300005841 Ga0068863_100003604 Ga0068863_10000360414 197
1113 3300005841 Ga0068863_100037599 Ga0068863_1000375995 197
1114 3300005842 Ga0068858_100001068 Ga0068858_1000010682 197
1115 3300005842 Ga0068858_100019278 Ga0068858_1000192784 197
1116 3300005842 Ga0068858_100081614 Ga0068858_1000816142 197
1117 3300005842 Ga0068858_100285182 Ga0068858_1002851822 197
1118 3300005842 Ga0068858_100854422 Ga0068858_1008544222 197
1119 3300005843 Ga0068860_100000065 Ga0068860_10000006568 197
1120 3300005843 Ga0068860_100000214 Ga0068860_10000021446 197
1121 3300005843 Ga0068860_100000520 Ga0068860_10000052010 197
1122 3300005843 Ga0068860_100000663 Ga0068860_10000066327 197
1123 3300005843 Ga0068860_100050567 Ga0068860_1000505674 197
1124 3300005843 Ga0068860_100621157 Ga0068860_1006211572 197
1125 3300005843 Ga0068860_100651399 Ga0068860_1006513992 197
1126 3300005844 Ga0068862_100000028 Ga0068862_10000002892 197
1127 3300005844 Ga0068862_100052035 Ga0068862_1000520354 197
1128 3300005844 Ga0068862_100233169 Ga0068862_1002331692 197
1129 3300005844 Ga0068862_100554728 Ga0068862_1005547282 197
1130 3300005937 Ga0081455_10000873 Ga0081455_1000087335 197
1131 3300005937 Ga0081455_10009524 Ga0081455_100095243 197
1132 3300005937 Ga0081455_10021629 Ga0081455_100216292 197
1133 3300005937 Ga0081455_10116150 Ga0081455_101161502 197
1134 3300005981 Ga0081538_10138881 Ga0081538_101388812 197
1135 3300005983 Ga0081540_1048325 Ga0081540_10483253 197
1136 3300005985 Ga0081539_10001153 Ga0081539_1000115338 197
1137 3300005985 Ga0081539_10001159 Ga0081539_1000115950 197
1138 3300005985 Ga0081539_10039734 Ga0081539_100397344 197
1139 3300005985 Ga0081539_10088852 Ga0081539_100888521 197
1140 3300005985 Ga0081539_10102540 Ga0081539_101025401 197
1141 3300006028 Ga0070717_10377339 Ga0070717_103773392 197
1142 3300006038 Ga0075365_10018905 Ga0075365_100189053 197
1143 3300006038 Ga0075365_10033559 Ga0075365_100335593 197
1144 3300006038 Ga0075365_10047812 Ga0075365_100478122 197
1145 3300006038 Ga0075365_10050161 Ga0075365_100501612 197
1146 3300006038 Ga0075365_10080556 Ga0075365_100805562 197
1147 3300006038 Ga0075365_10100827 Ga0075365_101008272 197
1148 3300006038 Ga0075365_10174172 Ga0075365_101741721 197
1149 3300006038 Ga0075365_10252513 Ga0075365_102525132 197
1150 3300006038 Ga0075365_10326759 Ga0075365_103267592 197
1151 3300006038 Ga0075365_10348690 Ga0075365_103486901 197
1152 3300006042 Ga0075368_10001314 Ga0075368_1000131410 197
1153 3300006042 Ga0075368_10010344 Ga0075368_100103442 197
1154 3300006048 Ga0075363_100000364 Ga0075363_10000036413 197
1155 3300006048 Ga0075363_100002709 Ga0075363_1000027096 197
1156 3300006048 Ga0075363_100009318 Ga0075363_1000093183 197
1157 3300006048 Ga0075363_100020572 Ga0075363_1000205722 197
1158 3300006048 Ga0075363_100035986 Ga0075363_1000359862 197
1159 3300006048 Ga0075363_100040621 Ga0075363_1000406212 197
1160 3300006048 Ga0075363_100068975 Ga0075363_1000689752 197
1161 3300006048 Ga0075363_100077541 Ga0075363_1000775412 197
1162 3300006048 Ga0075363_100141102 Ga0075363_1001411022 197
1163 3300006048 Ga0075363_100507485 Ga0075363_1005074851 197
1164 3300006051 Ga0075364_10003349 Ga0075364_1000334910 197
1165 3300006051 Ga0075364_10004420 Ga0075364_100044203 197
1166 3300006051 Ga0075364_10008281 Ga0075364_100082813 197
1167 3300006051 Ga0075364_10017035 Ga0075364_100170352 197
1168 3300006051 Ga0075364_10017435 Ga0075364_100174353 197
1169 3300006051 Ga0075364_10036950 Ga0075364_100369501 197
1170 3300006051 Ga0075364_10041030 Ga0075364_100410302 197
1171 3300006051 Ga0075364_10050012 Ga0075364_100500123 197
1172 3300006051 Ga0075364_10075060 Ga0075364_100750603 197
1173 3300006051 Ga0075364_10108791 Ga0075364_101087912 197
1174 3300006051 Ga0075364_10135076 Ga0075364_101350762 197
1175 3300006051 Ga0075364_10283624 Ga0075364_102836242 197
1176 3300006051 Ga0075364_10314977 Ga0075364_103149771 197
1177 3300006051 Ga0075364_10352998 Ga0075364_103529981 197
1178 3300006058 Ga0075432_10005548 Ga0075432_100055484 197
1179 3300006058 Ga0075432_10089176 Ga0075432_100891762 197
1180 3300006058 Ga0075432_10163937 Ga0075432_101639371 197
1181 3300006163 Ga0070715_10218788 Ga0070715_102187882 197
1182 3300006173 Ga0070716_100032534 Ga0070716_1000325343 197
1183 3300006173 Ga0070716_100085602 Ga0070716_1000856022 197
1184 3300006175 Ga0070712_100000926 Ga0070712_10000092621 197
1185 3300006175 Ga0070712_100019484 Ga0070712_1000194844 197
1186 3300006177 Ga0075362_10028655 Ga0075362_100286552 197
1187 3300006177 Ga0075362_10090970 Ga0075362_100909702 197
1188 3300006177 Ga0075362_10265740 Ga0075362_102657401 197
1189 3300006178 Ga0075367_10000349 Ga0075367_100003494 197
1190 3300006178 Ga0075367_10006336 Ga0075367_100063362 197
1191 3300006178 Ga0075367_10008508 Ga0075367_100085083 197
1192 3300006178 Ga0075367_10106767 Ga0075367_101067672 197
1193 3300006178 Ga0075367_10204965 Ga0075367_102049652 197
1194 3300006178 Ga0075367_10219744 Ga0075367_102197442 197
1195 3300006178 Ga0075367_10441324 Ga0075367_104413242 197
1196 3300006178 Ga0075367_10444307 Ga0075367_104443072 197
1197 3300006178 Ga0075367_10525892 Ga0075367_105258921 197
1198 3300006186 Ga0075369_10006451 Ga0075369_100064512 197
1199 3300006186 Ga0075369_10008548 Ga0075369_100085483 197
1200 3300006186 Ga0075369_10011511 Ga0075369_100115112 197
1201 3300006186 Ga0075369_10012427 Ga0075369_100124272 197
1202 3300006186 Ga0075369_10027424 Ga0075369_100274242 197
1203 3300006186 Ga0075369_10029755 Ga0075369_100297552 197
1204 3300006186 Ga0075369_10040367 Ga0075369_100403672 197
1205 3300006186 Ga0075369_10055060 Ga0075369_100550603 197
1206 3300006186 Ga0075369_10059194 Ga0075369_100591941 197
1207 3300006186 Ga0075369_10168347 Ga0075369_101683472 197
1208 3300006186 Ga0075369_10181246 Ga0075369_101812461 197
1209 3300006195 Ga0075366_10338460 Ga0075366_103384601 197
1210 3300006237 Ga0097621_100079038 Ga0097621_1000790383 197
1211 3300006237 Ga0097621_100245407 Ga0097621_1002454071 197
1212 3300006353 Ga0075370_10001708 Ga0075370_100017087 197
1213 3300006353 Ga0075370_10001851 Ga0075370_100018518 197
1214 3300006353 Ga0075370_10024027 Ga0075370_100240274 197
1215 3300006353 Ga0075370_10028681 Ga0075370_100286813 197
1216 3300006353 Ga0075370_10073119 Ga0075370_100731192 197
1217 3300006353 Ga0075370_10122697 Ga0075370_101226972 197
1218 3300006353 Ga0075370_10149920 Ga0075370_101499202 197
1219 3300006353 Ga0075370_10302414 Ga0075370_103024142 197
1220 3300006358 Ga0068871_100055089 Ga0068871_1000550893 197
1221 3300006358 Ga0068871_100204039 Ga0068871_1002040392 197
1222 3300006358 Ga0068871_100385217 Ga0068871_1003852172 197
1223 3300006358 Ga0068871_100560249 Ga0068871_1005602492 197
1224 3300006844 Ga0075428_100710879 Ga0075428_1007108792 197
1225 3300006847 Ga0075431_100471737 Ga0075431_1004717372 197
1226 3300006871 Ga0075434_100945825 Ga0075434_1009458252 197
1227 3300006881 Ga0068865_100001042 Ga0068865_1000010423 197
1228 3300006881 Ga0068865_100240174 Ga0068865_1002401741 197
1229 3300006881 Ga0068865_100473349 Ga0068865_1004733491 197
1230 3300006914 Ga0075436_100661462 Ga0075436_1006614621 197
1231 3300006931 Ga0097620_100000777 Ga0097620_10000077716 197
1232 3300006931 Ga0097620_100000989 Ga0097620_10000098930 197
1233 3300006931 Ga0097620_100414926 Ga0097620_1004149262 197
1234 3300006931 Ga0097620_100450311 Ga0097620_1004503112 197
1235 3300007788 Ga0099795_10027588 Ga0099795_100275882 197
1236 3300007788 Ga0099795_10112493 Ga0099795_101124932 197
1237 3300009011 Ga0105251_10013879 Ga0105251_100138791 197
1238 3300009036 Ga0105244_10013549 Ga0105244_100135492 197
1239 3300009036 Ga0105244_10105049 Ga0105244_101050492 197
1240 3300009036 Ga0105244_10114558 Ga0105244_101145582 197
1241 3300009036 Ga0105244_10125464 Ga0105244_101254641 197
1242 3300009036 Ga0105244_10292098 Ga0105244_102920981 197
1243 3300009092 Ga0105250_10056956 Ga0105250_100569562 197
1244 3300009092 Ga0105250_10092952 Ga0105250_100929521 197
1245 3300009092 Ga0105250_10190799 Ga0105250_101907991 197
1246 3300009093 Ga0105240_11158795 Ga0105240_111587952 197
1247 3300009093 Ga0105240_11531599 Ga0105240_115315991 197
1248 3300009094 Ga0111539_10161618 Ga0111539_101616183 197
1249 3300009094 Ga0111539_10470214 Ga0111539_104702142 197
1250 3300009098 Ga0105245_10000172 Ga0105245_1000017238 197
1251 3300009098 Ga0105245_10056993 Ga0105245_100569932 197
1252 3300009098 Ga0105245_10158054 Ga0105245_101580542 197
1253 3300009098 Ga0105245_10214561 Ga0105245_102145612 197
1254 3300009098 Ga0105245_10271765 Ga0105245_102717651 197
1255 3300009098 Ga0105245_10297267 Ga0105245_102972671 197
1256 3300009098 Ga0105245_10416694 Ga0105245_104166942 197
1257 3300009098 Ga0105245_10764125 Ga0105245_107641252 197
1258 3300009098 Ga0105245_10888474 Ga0105245_108884741 197
1259 3300009101 Ga0105247_10000009 Ga0105247_1000000926 197
1260 3300009101 Ga0105247_10000451 Ga0105247_1000045120 197
1261 3300009101 Ga0105247_10070046 Ga0105247_100700463 197
1262 3300009101 Ga0105247_10129360 Ga0105247_101293602 197
1263 3300009101 Ga0105247_10166960 Ga0105247_101669602 197
1264 3300009147 Ga0114129_10251226 Ga0114129_102512262 197
1265 3300009147 Ga0114129_10365314 Ga0114129_103653142 197
1266 3300009148 Ga0105243_10001407 Ga0105243_100014077 197
1267 3300009148 Ga0105243_10010174 Ga0105243_100101742 197
1268 3300009148 Ga0105243_10036529 Ga0105243_100365294 197
1269 3300009148 Ga0105243_10043093 Ga0105243_100430933 197
1270 3300009148 Ga0105243_10048710 Ga0105243_100487103 197
1271 3300009174 Ga0105241_10017718 Ga0105241_100177183 197
1272 3300009174 Ga0105241_10052975 Ga0105241_100529753 197
1273 3300009176 Ga0105242_10000281 Ga0105242_100002812 197
1274 3300009176 Ga0105242_10008466 Ga0105242_100084667 197
1275 3300009176 Ga0105242_10307760 Ga0105242_103077602 197
1276 3300009176 Ga0105242_10335033 Ga0105242_103350332 197
1277 3300009176 Ga0105242_10488746 Ga0105242_104887461 197
1278 3300009176 Ga0105242_11012757 Ga0105242_110127571 197
1279 3300009176 Ga0105242_11295074 Ga0105242_112950742 197
1280 3300009177 Ga0105248_10000186 Ga0105248_100001864 197
1281 3300009177 Ga0105248_10001346 Ga0105248_100013468 197
1282 3300009177 Ga0105248_10026572 Ga0105248_100265722 197
1283 3300009177 Ga0105248_10058233 Ga0105248_100582332 197
1284 3300009177 Ga0105248_10319926 Ga0105248_103199261 197
1285 3300009177 Ga0105248_10682811 Ga0105248_106828111 197
1286 3300009177 Ga0105248_10880487 Ga0105248_108804872 197
1287 3300009545 Ga0105237_10067816 Ga0105237_100678163 197
1288 3300009545 Ga0105237_10195641 Ga0105237_101956413 197
1289 3300009545 Ga0105237_10245778 Ga0105237_102457782 197
1290 3300009551 Ga0105238_10027437 Ga0105238_100274373 197
1291 3300009551 Ga0105238_10038061 Ga0105238_100380616 197
1292 3300009551 Ga0105238_10256238 Ga0105238_102562382 197
1293 3300009551 Ga0105238_10691082 Ga0105238_106910822 197
1294 3300009553 Ga0105249_10000011 Ga0105249_10000011182 197
1295 3300009553 Ga0105249_10089379 Ga0105249_100893792 197
1296 3300009553 Ga0105249_10175830 Ga0105249_101758302 197
1297 3300009553 Ga0105249_10228292 Ga0105249_102282923 197
1298 3300009553 Ga0105249_10245276 Ga0105249_102452762 197
1299 3300009553 Ga0105249_10318134 Ga0105249_103181342 197
1300 3300009553 Ga0105249_10575465 Ga0105249_105754652 197
1301 3300009553 Ga0105249_10708684 Ga0105249_107086842 197
1302 3300009978 Ga0105148_111343 Ga0105148_1113431 197
1303 3300009986 Ga0105033_104336 Ga0105033_1043362 197
1304 3300009988 Ga0105035_102655 Ga0105035_1026552 197
1305 3300009993 Ga0105028_106112 Ga0105028_1061122 197
1306 3300010159 Ga0099796_10290635 Ga0099796_102906351 197
1307 3300010375 Ga0105239_10046896 Ga0105239_100468962 197
1308 3300010375 Ga0105239_10118564 Ga0105239_101185642 197
1309 3300010375 Ga0105239_10202287 Ga0105239_102022872 197
1310 3300010375 Ga0105239_10248624 Ga0105239_102486242 197
1311 3300010375 Ga0105239_10615116 Ga0105239_106151162 197
1312 3300010375 Ga0105239_11179299 Ga0105239_111792992 197
1313 3300011119 Ga0105246_10001313 Ga0105246_100013136 197
1314 3300011119 Ga0105246_10002230 Ga0105246_100022307 197
1315 3300011119 Ga0105246_10085286 Ga0105246_100852862 197
1316 3300011119 Ga0105246_10106504 Ga0105246_101065042 197
1317 3300011119 Ga0105246_10172365 Ga0105246_101723652 197
1318 3300011119 Ga0105246_10212260 Ga0105246_102122602 197
1319 3300011119 Ga0105246_10237858 Ga0105246_102378582 197
1320 3300011119 Ga0105246_10267002 Ga0105246_102670022 197
1321 3300012513 Ga0157326_1031416 Ga0157326_10314161 197
1322 3300013100 Ga0157373_10128811 Ga0157373_101288112 197
1323 3300013102 Ga0157371_10113804 Ga0157371_101138042 197
1324 3300013104 Ga0157370_10006087 Ga0157370_100060874 197
1325 3300013104 Ga0157370_10316337 Ga0157370_103163372 197
1326 3300013104 Ga0157370_10391765 Ga0157370_103917652 197
1327 3300013104 Ga0157370_10443519 Ga0157370_104435192 197
1328 3300013104 Ga0157370_10590337 Ga0157370_105903371 197
1329 3300013105 Ga0157369_10003564 Ga0157369_1000356419 197
1330 3300013105 Ga0157369_10014492 Ga0157369_100144928 197
1331 3300013105 Ga0157369_10041050 Ga0157369_100410503 197
1332 3300013105 Ga0157369_10141293 Ga0157369_101412931 197
1333 3300013105 Ga0157369_10200194 Ga0157369_102001942 197
1334 3300013105 Ga0157369_10258875 Ga0157369_102588752 197
1335 3300013105 Ga0157369_10292514 Ga0157369_102925141 197
1336 3300013105 Ga0157369_10362610 Ga0157369_103626102 197
1337 3300013105 Ga0157369_10406694 Ga0157369_104066942 197
1338 3300013105 Ga0157369_10413156 Ga0157369_104131562 197
1339 3300013105 Ga0157369_10491545 Ga0157369_104915452 197
1340 3300013105 Ga0157369_10572874 Ga0157369_105728742 197
1341 3300013105 Ga0157369_10601143 Ga0157369_106011431 197
1342 3300013105 Ga0157369_11457221 Ga0157369_114572211 197
1343 3300013250 Ga0171462_1003 Ga0171462_1003183 197
1344 3300013296 Ga0157374_10058502 Ga0157374_100585021 197
1345 3300013297 Ga0157378_10000282 Ga0157378_100002827 197
1346 3300013297 Ga0157378_10033250 Ga0157378_100332502 197
1347 3300013297 Ga0157378_10868244 Ga0157378_108682441 197
1348 3300013306 Ga0163162_10001346 Ga0163162_1000134615 197
1349 3300013306 Ga0163162_10074340 Ga0163162_100743402 197
1350 3300013306 Ga0163162_10168713 Ga0163162_101687132 197
1351 3300013306 Ga0163162_10281134 Ga0163162_102811342 197
1352 3300013306 Ga0163162_10391488 Ga0163162_103914881 197
1353 3300013306 Ga0163162_10411219 Ga0163162_104112192 197
1354 3300013306 Ga0163162_11023250 Ga0163162_110232501 197
1355 3300013306 Ga0163162_11162481 Ga0163162_111624811 197
1356 3300013306 Ga0163162_11309445 Ga0163162_113094452 197
1357 3300013307 Ga0157372_10008436 Ga0157372_100084369 197
1358 3300013307 Ga0157372_10189646 Ga0157372_101896462 197
1359 3300013307 Ga0157372_10203453 Ga0157372_102034532 197
1360 3300013307 Ga0157372_10377278 Ga0157372_103772782 197
1361 3300013307 Ga0157372_10577699 Ga0157372_105776992 197
1362 3300013307 Ga0157372_11317968 Ga0157372_113179682 197
1363 3300013307 Ga0157372_11416180 Ga0157372_114161802 197
1364 3300013308 Ga0157375_10000443 Ga0157375_1000044330 197
1365 3300013308 Ga0157375_10063616 Ga0157375_100636161 197
1366 3300013308 Ga0157375_10175751 Ga0157375_101757514 197
1367 3300013308 Ga0157375_10321371 Ga0157375_103213712 197
1368 3300013308 Ga0157375_10494367 Ga0157375_104943672 197
1369 3300013308 Ga0157375_10640399 Ga0157375_106403992 197
1370 3300013308 Ga0157375_11293691 Ga0157375_112936911 197
1371 3300013308 Ga0157375_11317860 Ga0157375_113178602 197
1372 3300013308 Ga0157375_11970479 Ga0157375_119704791 197
1373 3300014325 Ga0163163_10032885 Ga0163163_100328854 197
1374 3300014325 Ga0163163_10072127 Ga0163163_100721272 197
1375 3300014325 Ga0163163_10106281 Ga0163163_101062812 197
1376 3300014325 Ga0163163_10564973 Ga0163163_105649732 197
1377 3300014325 Ga0163163_10886233 Ga0163163_108862332 197
1378 3300014325 Ga0163163_11229117 Ga0163163_112291171 197
1379 3300014326 Ga0157380_10035286 Ga0157380_100352862 197
1380 3300014326 Ga0157380_10049176 Ga0157380_100491763 197
1381 3300014326 Ga0157380_10362272 Ga0157380_103622722 197
1382 3300014326 Ga0157380_10571509 Ga0157380_105715092 197
1383 3300014326 Ga0157380_11001072 Ga0157380_110010721 197
1384 3300014326 Ga0157380_11190060 Ga0157380_111900601 197
1385 3300014326 Ga0157380_11319791 Ga0157380_113197911 197
1386 3300014497 Ga0182008_10059022 Ga0182008_100590222 197
1387 3300014497 Ga0182008_10270969 Ga0182008_102709692 197
1388 3300014745 Ga0157377_10046561 Ga0157377_100465614 197
1389 3300014745 Ga0157377_10125556 Ga0157377_101255562 197
1390 3300014968 Ga0157379_10123989 Ga0157379_101239892 197
1391 3300014968 Ga0157379_10189879 Ga0157379_101898792 197
1392 3300014968 Ga0157379_10385140 Ga0157379_103851401 197
1393 3300014968 Ga0157379_10441834 Ga0157379_104418342 197
1394 3300014968 Ga0157379_10743543 Ga0157379_107435431 197
1395 3300014968 Ga0157379_11010874 Ga0157379_110108741 197
1396 3300014969 Ga0157376_10192353 Ga0157376_101923532 197
1397 3300017792 Ga0163161_10001593 Ga0163161_1000159311 197
1398 3300017792 Ga0163161_10178525 Ga0163161_101785251 197
1399 3300017792 Ga0163161_10283852 Ga0163161_102838522 197
1400 3300017792 Ga0163161_10336265 Ga0163161_103362652 197
1401 3300017792 Ga0163161_10379019 Ga0163161_103790191 197
1402 3300017792 Ga0163161_10576226 Ga0163161_105762261 197
1403 3300017792 Ga0163161_10679646 Ga0163161_106796461 197
1404 3300017792 Ga0163161_10810301 Ga0163161_108103011 197
1405 3300017792 Ga0163161_11063373 Ga0163161_110633731 197
1406 3300020069 Ga0197907_10053258 Ga0197907_100532585 197
1407 3300020070 Ga0206356_10128213 Ga0206356_101282131 197
1408 3300020075 Ga0206349_1184288 Ga0206349_11842881 197
1409 3300020075 Ga0206349_1248741 Ga0206349_12487412 197
1410 3300020075 Ga0206349_1380049 Ga0206349_13800492 197
1411 3300020078 Ga0206352_11295339 Ga0206352_112953392 197
1412 3300020080 Ga0206350_10317472 Ga0206350_103174722 197
1413 3300020080 Ga0206350_11611524 Ga0206350_116115242 197
1414 3300020081 Ga0206354_10526698 Ga0206354_105266981 197
1415 3300020081 Ga0206354_10663781 Ga0206354_106637814 197
1416 3300020082 Ga0206353_10607526 Ga0206353_106075261 197
1417 3300020082 Ga0206353_11560231 Ga0206353_115602314 197
1418 3300020082 Ga0206353_11794715 Ga0206353_117947152 197
1419 3300021377 Ga0213874_10231079 Ga0213874_102310791 197
1420 3300021384 Ga0213876_10021702 Ga0213876_100217023 197
1421 3300021384 Ga0213876_10036533 Ga0213876_100365332 197
1422 3300021388 Ga0213875_10014919 Ga0213875_100149192 197
1423 3300025228 Ga0209672_100003 Ga0209672_100003120 197
1424 3300025229 Ga0209147_100633 Ga0209147_10063312 197
1425 3300025230 Ga0209563_100388 Ga0209563_1003884 197
1426 3300025231 Ga0207427_100034 Ga0207427_100034282 197
1427 3300025233 Ga0209437_100486 Ga0209437_1004869 197
1428 3300025242 Ga0209258_101954 Ga0209258_1019541 197
1429 3300025245 Ga0207425_1019073 Ga0207425_10190732 197
1430 3300025246 Ga0209646_1000168 Ga0209646_100016867 197
1431 3300025253 Ga0209677_100321 Ga0209677_10032110 197
1432 3300025254 Ga0209148_1000004 Ga0209148_1000004415 197
1433 3300025254 Ga0209148_1003685 Ga0209148_10036852 197
1434 3300025254 Ga0209148_1003974 Ga0209148_10039742 197
1435 3300025258 Ga0209129_1000028 Ga0209129_100002890 197
1436 3300025261 Ga0209233_1000001 Ga0209233_10000012451 197
1437 3300025272 Ga0209455_1000022 Ga0209455_1000022569 197
1438 3300025272 Ga0209455_1001078 Ga0209455_10010785 197
1439 3300025273 Ga0209673_1018161 Ga0209673_10181612 197
1440 3300025294 Ga0209025_1002052 Ga0209025_100205216 197
1441 3300025303 Ga0209051_1000075 Ga0209051_100007596 197
1442 3300025303 Ga0209051_1000448 Ga0209051_10004481 197
1443 3300025303 Ga0209051_1002630 Ga0209051_10026307 197
1444 3300025303 Ga0209051_1009355 Ga0209051_10093556 197
1445 3300025315 Ga0207697_10002620 Ga0207697_100026206 197
1446 3300025315 Ga0207697_10033332 Ga0207697_100333321 197
1447 3300025711 Ga0207696_1040603 Ga0207696_10406032 197
1448 3300025711 Ga0207696_1048985 Ga0207696_10489852 197
1449 3300025711 Ga0207696_1049774 Ga0207696_10497741 197
1450 3300025728 Ga0207655_1002079 Ga0207655_10020792 197
1451 3300025728 Ga0207655_1012416 Ga0207655_10124163 197
1452 3300025728 Ga0207655_1026275 Ga0207655_10262752 197
1453 3300025728 Ga0207655_1050757 Ga0207655_10507571 197
1454 3300025735 Ga0207713_1075046 Ga0207713_10750461 197
1455 3300025885 Ga0207653_10053415 Ga0207653_100534152 197
1456 3300025893 Ga0207682_10030373 Ga0207682_100303732 197
1457 3300025898 Ga0207692_10000599 Ga0207692_100005993 197
1458 3300025898 Ga0207692_10002256 Ga0207692_100022566 197
1459 3300025899 Ga0207642_10000264 Ga0207642_1000026419 197
1460 3300025899 Ga0207642_10114528 Ga0207642_101145282 197
1461 3300025900 Ga0207710_10000014 Ga0207710_1000001443 197
1462 3300025900 Ga0207710_10000721 Ga0207710_1000072116 197
1463 3300025901 Ga0207688_10000335 Ga0207688_1000033516 197
1464 3300025901 Ga0207688_10002023 Ga0207688_100020239 197
1465 3300025901 Ga0207688_10386280 Ga0207688_103862801 197
1466 3300025903 Ga0207680_10104139 Ga0207680_101041392 197
1467 3300025903 Ga0207680_10168644 Ga0207680_101686442 197
1468 3300025903 Ga0207680_10201881 Ga0207680_102018812 197
1469 3300025904 Ga0207647_10014486 Ga0207647_100144862 197
1470 3300025904 Ga0207647_10156503 Ga0207647_101565031 197
1471 3300025904 Ga0207647_10273485 Ga0207647_102734851 197
1472 3300025904 Ga0207647_10543617 Ga0207647_105436171 197
1473 3300025905 Ga0207685_10363474 Ga0207685_103634741 197
1474 3300025906 Ga0207699_10006639 Ga0207699_100066395 197
1475 3300025907 Ga0207645_10015972 Ga0207645_100159721 197
1476 3300025907 Ga0207645_10247597 Ga0207645_102475972 197
1477 3300025909 Ga0207705_10016193 Ga0207705_100161932 197
1478 3300025911 Ga0207654_10042464 Ga0207654_100424642 197
1479 3300025911 Ga0207654_10135341 Ga0207654_101353411 197
1480 3300025912 Ga0207707_10784043 Ga0207707_107840431 197
1481 3300025914 Ga0207671_10098190 Ga0207671_100981902 197
1482 3300025915 Ga0207693_10000049 Ga0207693_1000004957 197
1483 3300025915 Ga0207693_10000258 Ga0207693_1000025825 197
1484 3300025916 Ga0207663_10000314 Ga0207663_100003148 197
1485 3300025916 Ga0207663_10034113 Ga0207663_100341133 197
1486 3300025916 Ga0207663_10760927 Ga0207663_107609272 197
1487 3300025918 Ga0207662_10013512 Ga0207662_100135124 197
1488 3300025918 Ga0207662_10781823 Ga0207662_107818231 197
1489 3300025919 Ga0207657_10033008 Ga0207657_100330086 197
1490 3300025919 Ga0207657_10113217 Ga0207657_101132172 197
1491 3300025919 Ga0207657_10175963 Ga0207657_101759633 197
1492 3300025919 Ga0207657_10213205 Ga0207657_102132052 197
1493 3300025919 Ga0207657_10492642 Ga0207657_104926421 197
1494 3300025919 Ga0207657_10507447 Ga0207657_105074472 197
1495 3300025921 Ga0207652_10088979 Ga0207652_100889791 197
1496 3300025921 Ga0207652_10161826 Ga0207652_101618262 197
1497 3300025921 Ga0207652_10425977 Ga0207652_104259772 197
1498 3300025923 Ga0207681_10003263 Ga0207681_100032636 197
1499 3300025923 Ga0207681_10021594 Ga0207681_100215941 197
1500 3300025923 Ga0207681_10026475 Ga0207681_100264755 197
1501 3300025924 Ga0207694_10022807 Ga0207694_100228073 197
1502 3300025924 Ga0207694_10160437 Ga0207694_101604372 197
1503 3300025924 Ga0207694_10180071 Ga0207694_101800712 197
1504 3300025924 Ga0207694_10723162 Ga0207694_107231621 197
1505 3300025925 Ga0207650_10054492 Ga0207650_100544921 197
1506 3300025927 Ga0207687_10000153 Ga0207687_1000015347 197
1507 3300025927 Ga0207687_10015346 Ga0207687_100153462 197
1508 3300025927 Ga0207687_10130971 Ga0207687_101309712 197
1509 3300025927 Ga0207687_11123759 Ga0207687_111237591 197
1510 3300025929 Ga0207664_10002749 Ga0207664_100027497 197
1511 3300025929 Ga0207664_10029135 Ga0207664_100291357 197
1512 3300025929 Ga0207664_10246438 Ga0207664_102464382 197
1513 3300025931 Ga0207644_10005846 Ga0207644_100058465 197
1514 3300025931 Ga0207644_10112848 Ga0207644_101128482 197
1515 3300025931 Ga0207644_10133398 Ga0207644_101333983 197
1516 3300025931 Ga0207644_10487923 Ga0207644_104879231 197
1517 3300025933 Ga0207706_10010210 Ga0207706_100102105 197
1518 3300025933 Ga0207706_10074314 Ga0207706_100743143 197
1519 3300025934 Ga0207686_10165113 Ga0207686_101651132 197
1520 3300025935 Ga0207709_10004736 Ga0207709_1000473610 197
1521 3300025935 Ga0207709_10016230 Ga0207709_100162302 197
1522 3300025935 Ga0207709_10214170 Ga0207709_102141702 197
1523 3300025935 Ga0207709_10254401 Ga0207709_102544012 197
1524 3300025935 Ga0207709_10375087 Ga0207709_103750871 197
1525 3300025935 Ga0207709_10400688 Ga0207709_104006882 197
1526 3300025935 Ga0207709_10448446 Ga0207709_104484462 197
1527 3300025936 Ga0207670_10030292 Ga0207670_100302922 197
1528 3300025936 Ga0207670_10418883 Ga0207670_104188832 197
1529 3300025937 Ga0207669_10000277 Ga0207669_100002773 197
1530 3300025937 Ga0207669_10016487 Ga0207669_100164872 197
1531 3300025937 Ga0207669_10225519 Ga0207669_102255191 197
1532 3300025937 Ga0207669_10307933 Ga0207669_103079331 197
1533 3300025937 Ga0207669_10362644 Ga0207669_103626441 197
1534 3300025938 Ga0207704_10000115 Ga0207704_1000011530 197
1535 3300025938 Ga0207704_10301161 Ga0207704_103011612 197
1536 3300025939 Ga0207665_10003528 Ga0207665_1000352810 197
1537 3300025939 Ga0207665_10011384 Ga0207665_100113843 197
1538 3300025939 Ga0207665_10053737 Ga0207665_100537371 197
1539 3300025939 Ga0207665_10232995 Ga0207665_102329951 197
1540 3300025939 Ga0207665_10461719 Ga0207665_104617192 197
1541 3300025940 Ga0207691_10000233 Ga0207691_100002332 197
1542 3300025940 Ga0207691_10054880 Ga0207691_100548802 197
1543 3300025940 Ga0207691_10071886 Ga0207691_100718864 197
1544 3300025940 Ga0207691_10450599 Ga0207691_104505992 197
1545 3300025940 Ga0207691_10820040 Ga0207691_108200401 197
1546 3300025941 Ga0207711_10000373 Ga0207711_1000037317 197
1547 3300025941 Ga0207711_10103833 Ga0207711_101038331 197
1548 3300025941 Ga0207711_10217068 Ga0207711_102170683 197
1549 3300025941 Ga0207711_10356647 Ga0207711_103566471 197
1550 3300025941 Ga0207711_10390839 Ga0207711_103908392 197
1551 3300025942 Ga0207689_10014356 Ga0207689_100143562 197
1552 3300025942 Ga0207689_10049054 Ga0207689_100490544 197
1553 3300025944 Ga0207661_10117609 Ga0207661_101176093 197
1554 3300025944 Ga0207661_10516679 Ga0207661_105166792 197
1555 3300025945 Ga0207679_10602442 Ga0207679_106024421 197
1556 3300025945 Ga0207679_11104161 Ga0207679_111041611 197
1557 3300025949 Ga0207667_10034806 Ga0207667_100348065 197
1558 3300025949 Ga0207667_10452949 Ga0207667_104529492 197
1559 3300025960 Ga0207651_10038678 Ga0207651_100386781 197
1560 3300025961 Ga0207712_10000020 Ga0207712_1000002099 197
1561 3300025961 Ga0207712_10005489 Ga0207712_100054897 197
1562 3300025961 Ga0207712_10017769 Ga0207712_100177694 197
1563 3300025961 Ga0207712_10106493 Ga0207712_101064932 197
1564 3300025961 Ga0207712_10125455 Ga0207712_101254551 197
1565 3300025961 Ga0207712_10208731 Ga0207712_102087312 197
1566 3300025972 Ga0207668_10003692 Ga0207668_100036922 197
1567 3300025972 Ga0207668_10062888 Ga0207668_100628883 197
1568 3300025972 Ga0207668_10091025 Ga0207668_100910252 197
1569 3300025972 Ga0207668_10114285 Ga0207668_101142852 197
1570 3300025972 Ga0207668_10523393 Ga0207668_105233931 197
1571 3300025972 Ga0207668_10531294 Ga0207668_105312941 197
1572 3300025972 Ga0207668_10610342 Ga0207668_106103421 197
1573 3300025981 Ga0207640_10037694 Ga0207640_100376943 197
1574 3300025981 Ga0207640_10190096 Ga0207640_101900962 197
1575 3300025986 Ga0207658_10000573 Ga0207658_1000057310 197
1576 3300025986 Ga0207658_10008307 Ga0207658_100083076 197
1577 3300025986 Ga0207658_10028388 Ga0207658_100283883 197
1578 3300025986 Ga0207658_10058175 Ga0207658_100581752 197
1579 3300025986 Ga0207658_10112722 Ga0207658_101127222 197
1580 3300025986 Ga0207658_10121217 Ga0207658_101212172 197
1581 3300025986 Ga0207658_10299785 Ga0207658_102997851 197
1582 3300025986 Ga0207658_10349572 Ga0207658_103495722 197
1583 3300026023 Ga0207677_10003884 Ga0207677_100038847 197
1584 3300026023 Ga0207677_10362580 Ga0207677_103625802 197
1585 3300026023 Ga0207677_10381424 Ga0207677_103814242 197
1586 3300026035 Ga0207703_10011762 Ga0207703_100117627 197
1587 3300026035 Ga0207703_10023372 Ga0207703_100233722 197
1588 3300026035 Ga0207703_10030413 Ga0207703_100304133 197
1589 3300026035 Ga0207703_10219706 Ga0207703_102197062 197
1590 3300026041 Ga0207639_10008892 Ga0207639_100088924 197
1591 3300026041 Ga0207639_10108887 Ga0207639_101088872 197
1592 3300026041 Ga0207639_10257115 Ga0207639_102571152 197
1593 3300026041 Ga0207639_10279370 Ga0207639_102793702 197
1594 3300026067 Ga0207678_10000511 Ga0207678_1000051127 197
1595 3300026067 Ga0207678_10186551 Ga0207678_101865512 197
1596 3300026067 Ga0207678_10218859 Ga0207678_102188592 197
1597 3300026067 Ga0207678_10249935 Ga0207678_102499352 197
1598 3300026067 Ga0207678_10366785 Ga0207678_103667852 197
1599 3300026067 Ga0207678_10408417 Ga0207678_104084172 197
1600 3300026067 Ga0207678_10628589 Ga0207678_106285892 197
1601 3300026067 Ga0207678_11164763 Ga0207678_111647631 197
1602 3300026075 Ga0207708_10003058 Ga0207708_1000305811 197
1603 3300026075 Ga0207708_10064113 Ga0207708_100641132 197
1604 3300026088 Ga0207641_10000156 Ga0207641_1000015627 197
1605 3300026088 Ga0207641_10005483 Ga0207641_1000548313 197
1606 3300026088 Ga0207641_10027827 Ga0207641_100278275 197
1607 3300026088 Ga0207641_10376380 Ga0207641_103763801 197
1608 3300026088 Ga0207641_10549820 Ga0207641_105498202 197
1609 3300026089 Ga0207648_10001288 Ga0207648_100012887 197
1610 3300026089 Ga0207648_10004514 Ga0207648_1000451411 197
1611 3300026095 Ga0207676_10019892 Ga0207676_100198922 197
1612 3300026095 Ga0207676_10122972 Ga0207676_101229723 197
1613 3300026116 Ga0207674_10003834 Ga0207674_100038347 197
1614 3300026116 Ga0207674_10212961 Ga0207674_102129612 197
1615 3300026118 Ga0207675_100000220 Ga0207675_10000022018 197
1616 3300026118 Ga0207675_100048224 Ga0207675_1000482241 197
1617 3300026118 Ga0207675_100856631 Ga0207675_1008566312 197
1618 3300026118 Ga0207675_101219904 Ga0207675_1012199042 197
1619 3300026121 Ga0207683_10000184 Ga0207683_100001843 197
1620 3300026121 Ga0207683_10005628 Ga0207683_100056282 197
1621 3300026121 Ga0207683_10178711 Ga0207683_101787112 197
1622 3300026121 Ga0207683_10204404 Ga0207683_102044042 197
1623 3300026121 Ga0207683_10309385 Ga0207683_103093852 197
1624 3300026121 Ga0207683_10377572 Ga0207683_103775722 197
1625 3300026121 Ga0207683_10926190 Ga0207683_109261902 197
1626 3300026142 Ga0207698_10844850 Ga0207698_108448501 197
1627 3300027512 Ga0209179_1025078 Ga0209179_10250781 197
1628 3300027866 Ga0209813_10003608 Ga0209813_100036082 197
1629 3300027866 Ga0209813_10134778 Ga0209813_101347782 197
1630 3300027907 Ga0207428_10000930 Ga0207428_1000093018 197
1631 3300027907 Ga0207428_10034774 Ga0207428_100347743 197
1632 3300028379 Ga0268266_10001619 Ga0268266_1000161912 197
1633 3300028379 Ga0268266_10002233 Ga0268266_1000223313 197
1634 3300028379 Ga0268266_10005268 Ga0268266_100052688 197
1635 3300028379 Ga0268266_10035723 Ga0268266_100357235 197
1636 3300028379 Ga0268266_10112275 Ga0268266_101122752 197
1637 3300028379 Ga0268266_10352788 Ga0268266_103527882 197
1638 3300028379 Ga0268266_10387528 Ga0268266_103875282 197
1639 3300028379 Ga0268266_10847355 Ga0268266_108473552 197
1640 3300028380 Ga0268265_10000004 Ga0268265_10000004358 197
1641 3300028380 Ga0268265_10022153 Ga0268265_100221535 197
1642 3300028381 Ga0268264_10000024 Ga0268264_10000024338 197
1643 3300028381 Ga0268264_10000027 Ga0268264_10000027170 197
1644 3300028381 Ga0268264_10000242 Ga0268264_1000024228 197
1645 3300028381 Ga0268264_10000925 Ga0268264_1000092515 197
1646 3300028381 Ga0268264_10040710 Ga0268264_100407104 197
1647 3300028381 Ga0268264_10755160 Ga0268264_107551602 197
1648 3300028381 Ga0268264_11122354 Ga0268264_111223542 197
1649 3300028573 Ga0265334_10001010 Ga0265334_100010104 197
1650 3300028794 Ga0307515_10036541 Ga0307515_100365415 197
1651 3300028794 Ga0307515_10110667 Ga0307515_101106672 197
1652 3300030521 Ga0307511_10000622 Ga0307511_100006222 197
1653 3300030522 Ga0307512_10031225 Ga0307512_100312254 197
1654 3300030522 Ga0307512_10176339 Ga0307512_101763392 197
1655 3300030731 Ga0316177_1052389 Ga0316177_10523891 197
1656 3300030734 Ga0316179_1056474 Ga0316179_10564741 197
1657 3300030744 Ga0316181_1237503 Ga0316181_12375032 197
1658 3300031247 Ga0265340_10000824 Ga0265340_100008247 197
1659 3300031251 Ga0265327_10000018 Ga0265327_1000001852 197
1660 3300031251 Ga0265327_10000408 Ga0265327_1000040865 197
1661 3300031251 Ga0265327_10018468 Ga0265327_100184684 197
1662 3300031251 Ga0265327_10102653 Ga0265327_101026532 197
1663 3300031456 Ga0307513_10015857 Ga0307513_1001585710 197
1664 3300031456 Ga0307513_10262858 Ga0307513_102628581 197
1665 3300031507 Ga0307509_10144912 Ga0307509_101449122 197
1666 3300031548 Ga0307408_100021303 Ga0307408_1000213032 197
1667 3300031548 Ga0307408_100030981 Ga0307408_1000309812 197
1668 3300031548 Ga0307408_100047580 Ga0307408_1000475801 197
1669 3300031548 Ga0307408_100108271 Ga0307408_1001082712 197
1670 3300031548 Ga0307408_100128282 Ga0307408_1001282822 197
1671 3300031548 Ga0307408_100173665 Ga0307408_1001736651 197
1672 3300031548 Ga0307408_100363769 Ga0307408_1003637692 197
1673 3300031548 Ga0307408_100407167 Ga0307408_1004071671 197
1674 3300031548 Ga0307408_100484095 Ga0307408_1004840952 197
1675 3300031616 Ga0307508_10072357 Ga0307508_100723572 197
1676 3300031665 Ga0316575_10000020 Ga0316575_1000002015 197
1677 3300031665 Ga0316575_10010297 Ga0316575_100102972 197
1678 3300031691 Ga0316579_10000554 Ga0316579_100005544 197
1679 3300031691 Ga0316579_10004265 Ga0316579_100042655 197
1680 3300031727 Ga0316576_10015891 Ga0316576_100158913 197
1681 3300031727 Ga0316576_10108724 Ga0316576_101087243 197
1682 3300031727 Ga0316576_10196786 Ga0316576_101967862 197
1683 3300031727 Ga0316576_10277953 Ga0316576_102779532 197
1684 3300031728 Ga0316578_10002936 Ga0316578_100029361 197
1685 3300031728 Ga0316578_10079589 Ga0316578_100795893 197
1686 3300031730 Ga0307516_10095936 Ga0307516_100959361 197
1687 3300031731 Ga0307405_10002212 Ga0307405_100022126 197
1688 3300031731 Ga0307405_10005056 Ga0307405_100050565 197
1689 3300031731 Ga0307405_10165646 Ga0307405_101656462 197
1690 3300031731 Ga0307405_10338772 Ga0307405_103387721 197
1691 3300031731 Ga0307405_10352944 Ga0307405_103529442 197
1692 3300031731 Ga0307405_10417302 Ga0307405_104173022 197
1693 3300031731 Ga0307405_10430617 Ga0307405_104306171 197
1694 3300031824 Ga0307413_10000562 Ga0307413_1000056210 197
1695 3300031824 Ga0307413_10039323 Ga0307413_100393232 197
1696 3300031824 Ga0307413_10137772 Ga0307413_101377722 197
1697 3300031824 Ga0307413_10151949 Ga0307413_101519491 197
1698 3300031824 Ga0307413_10161284 Ga0307413_101612841 197
1699 3300031824 Ga0307413_10267830 Ga0307413_102678302 197
1700 3300031824 Ga0307413_10277600 Ga0307413_102776002 197
1701 3300031824 Ga0307413_10287469 Ga0307413_102874692 197
1702 3300031824 Ga0307413_10696277 Ga0307413_106962771 197
1703 3300031838 Ga0307518_10002521 Ga0307518_100025214 197
1704 3300031852 Ga0307410_10010201 Ga0307410_100102013 197
1705 3300031852 Ga0307410_10018809 Ga0307410_100188093 197
1706 3300031852 Ga0307410_10020465 Ga0307410_100204654 197
1707 3300031852 Ga0307410_10038280 Ga0307410_100382803 197
1708 3300031852 Ga0307410_10056924 Ga0307410_100569242 197
1709 3300031852 Ga0307410_10060351 Ga0307410_100603512 197
1710 3300031852 Ga0307410_10096056 Ga0307410_100960562 197
1711 3300031852 Ga0307410_10141309 Ga0307410_101413091 197
1712 3300031852 Ga0307410_10168478 Ga0307410_101684782 197
1713 3300031852 Ga0307410_10175687 Ga0307410_101756872 197
1714 3300031852 Ga0307410_10309692 Ga0307410_103096921 197
1715 3300031852 Ga0307410_10329738 Ga0307410_103297382 197
1716 3300031852 Ga0307410_10376423 Ga0307410_103764232 197
1717 3300031852 Ga0307410_10542527 Ga0307410_105425272 197
1718 3300031901 Ga0307406_10000217 Ga0307406_100002172 197
1719 3300031901 Ga0307406_10000795 Ga0307406_1000079518 197
1720 3300031901 Ga0307406_10013566 Ga0307406_100135662 197
1721 3300031901 Ga0307406_10022194 Ga0307406_100221942 197
1722 3300031901 Ga0307406_10184758 Ga0307406_101847582 197
1723 3300031901 Ga0307406_10197990 Ga0307406_101979902 197
1724 3300031901 Ga0307406_10206894 Ga0307406_102068941 197
1725 3300031901 Ga0307406_10222593 Ga0307406_102225932 197
1726 3300031901 Ga0307406_10440472 Ga0307406_104404722 197
1727 3300031901 Ga0307406_10609877 Ga0307406_106098772 197
1728 3300031903 Ga0307407_10062466 Ga0307407_100624662 197
1729 3300031903 Ga0307407_10066373 Ga0307407_100663732 197
1730 3300031903 Ga0307407_10188591 Ga0307407_101885911 197
1731 3300031903 Ga0307407_10277476 Ga0307407_102774761 197
1732 3300031903 Ga0307407_10586450 Ga0307407_105864501 197
1733 3300031911 Ga0307412_10007306 Ga0307412_100073064 197
1734 3300031911 Ga0307412_10011923 Ga0307412_100119235 197
1735 3300031911 Ga0307412_10022049 Ga0307412_100220494 197
1736 3300031911 Ga0307412_10038443 Ga0307412_100384432 197
1737 3300031911 Ga0307412_10047139 Ga0307412_100471393 197
1738 3300031911 Ga0307412_10058349 Ga0307412_100583492 197
1739 3300031911 Ga0307412_10107762 Ga0307412_101077622 197
1740 3300031911 Ga0307412_10133628 Ga0307412_101336281 197
1741 3300031911 Ga0307412_10234388 Ga0307412_102343881 197
1742 3300031911 Ga0307412_10254355 Ga0307412_102543552 197
1743 3300031911 Ga0307412_10798893 Ga0307412_107988932 197
1744 3300031995 Ga0307409_100019274 Ga0307409_1000192742 197
1745 3300031995 Ga0307409_100044212 Ga0307409_1000442122 197
1746 3300031995 Ga0307409_100045235 Ga0307409_1000452352 197
1747 3300031995 Ga0307409_100050805 Ga0307409_1000508053 197
1748 3300031995 Ga0307409_100064126 Ga0307409_1000641262 197
1749 3300031995 Ga0307409_100072330 Ga0307409_1000723302 197
1750 3300031995 Ga0307409_100105789 Ga0307409_1001057892 197
1751 3300031995 Ga0307409_100191519 Ga0307409_1001915192 197
1752 3300031995 Ga0307409_100333127 Ga0307409_1003331272 197
1753 3300031995 Ga0307409_100349377 Ga0307409_1003493772 197
1754 3300031995 Ga0307409_100395866 Ga0307409_1003958661 197
1755 3300031995 Ga0307409_100396955 Ga0307409_1003969552 197
1756 3300031995 Ga0307409_100398183 Ga0307409_1003981832 197
1757 3300031995 Ga0307409_100407915 Ga0307409_1004079152 197
1758 3300031995 Ga0307409_100424015 Ga0307409_1004240151 197
1759 3300031995 Ga0307409_100437051 Ga0307409_1004370511 197
1760 3300031995 Ga0307409_100511406 Ga0307409_1005114061 197
1761 3300031995 Ga0307409_100546541 Ga0307409_1005465411 197
1762 3300031995 Ga0307409_100638038 Ga0307409_1006380381 197
1763 3300031995 Ga0307409_100701578 Ga0307409_1007015782 197
1764 3300031995 Ga0307409_100962030 Ga0307409_1009620302 197
1765 3300031995 Ga0307409_101218841 Ga0307409_1012188411 197
1766 3300032002 Ga0307416_100036552 Ga0307416_1000365522 197
1767 3300032002 Ga0307416_100046082 Ga0307416_1000460822 197
1768 3300032002 Ga0307416_100047414 Ga0307416_1000474142 197
1769 3300032002 Ga0307416_100122476 Ga0307416_1001224762 197
1770 3300032002 Ga0307416_100202584 Ga0307416_1002025841 197
1771 3300032002 Ga0307416_100228765 Ga0307416_1002287652 197
1772 3300032002 Ga0307416_100297599 Ga0307416_1002975992 197
1773 3300032002 Ga0307416_100313235 Ga0307416_1003132352 197
1774 3300032002 Ga0307416_100390335 Ga0307416_1003903352 197
1775 3300032002 Ga0307416_100412241 Ga0307416_1004122412 197
1776 3300032002 Ga0307416_100753655 Ga0307416_1007536551 197
1777 3300032002 Ga0307416_100943428 Ga0307416_1009434281 197
1778 3300032002 Ga0307416_100999227 Ga0307416_1009992271 197
1779 3300032002 Ga0307416_101223402 Ga0307416_1012234022 197
1780 3300032002 Ga0307416_101257888 Ga0307416_1012578882 197
1781 3300032002 Ga0307416_101278103 Ga0307416_1012781031 197
1782 3300032002 Ga0307416_101359537 Ga0307416_1013595372 197
1783 3300032002 Ga0307416_101665320 Ga0307416_1016653201 197
1784 3300032004 Ga0307414_10024948 Ga0307414_100249484 197
1785 3300032004 Ga0307414_10031241 Ga0307414_100312413 197
1786 3300032004 Ga0307414_10164807 Ga0307414_101648072 197
1787 3300032004 Ga0307414_10195431 Ga0307414_101954312 197
1788 3300032004 Ga0307414_10323246 Ga0307414_103232462 197
1789 3300032004 Ga0307414_10332053 Ga0307414_103320532 197
1790 3300032004 Ga0307414_10420489 Ga0307414_104204892 197
1791 3300032004 Ga0307414_10473750 Ga0307414_104737501 197
1792 3300032004 Ga0307414_10597811 Ga0307414_105978112 197
1793 3300032004 Ga0307414_10758727 Ga0307414_107587272 197
1794 3300032004 Ga0307414_10895441 Ga0307414_108954411 197
1795 3300032004 Ga0307414_10950352 Ga0307414_109503521 197
1796 3300032005 Ga0307411_10057509 Ga0307411_100575093 197
1797 3300032005 Ga0307411_10101613 Ga0307411_101016132 197
1798 3300032005 Ga0307411_10495896 Ga0307411_104958962 197
1799 3300032126 Ga0307415_100066166 Ga0307415_1000661662 197
1800 3300032126 Ga0307415_100082014 Ga0307415_1000820142 197
1801 3300032126 Ga0307415_100103756 Ga0307415_1001037562 197
1802 3300032126 Ga0307415_100112283 Ga0307415_1001122832 197
1803 3300032126 Ga0307415_100145848 Ga0307415_1001458481 197
1804 3300032126 Ga0307415_100315264 Ga0307415_1003152642 197
1805 3300032126 Ga0307415_100345042 Ga0307415_1003450421 197
1806 3300032126 Ga0307415_100616430 Ga0307415_1006164302 197
1807 3300032126 Ga0307415_100721345 Ga0307415_1007213452 197
1808 3300032126 Ga0307415_101016556 Ga0307415_1010165561 197
1809 3300032137 Ga0316585_10079369 Ga0316585_100793691 197
1810 3300032139 Ga0316580_10024904 Ga0316580_100249042 197
1811 3300032139 Ga0316580_10034015 Ga0316580_100340152 197
1812 3300033179 Ga0307507_10020058 Ga0307507_100200583 197
1813 3300033179 Ga0307507_10022107 Ga0307507_100221073 197
1814 3300033179 Ga0307507_10134964 Ga0307507_101349641 197
1815 3300033179 Ga0307507_10153152 Ga0307507_101531522 197
1816 3300033180 Ga0307510_10022713 Ga0307510_100227132 197
1817 3300033541 Ga0316596_1011025 Ga0316596_10110252 197
1818 3300034817 Ga0373948_0018181 Ga0373948_0018181_698_1291 197
1819 3300035092 Ga0373952_0058465 Ga0373952_0058465_158_751 197
1820 3300035121 Ga0373960_0082015 Ga0373960_0082015_45_638 197
1821 3300035242 Ga0373962_0015361 Ga0373962_0015361_108_701 197
1822 3300035398 Ga0316574_0011993 Ga0316574_0011993_4213_4809 197
1823 3300035398 Ga0316574_0082047 Ga0316574_0082047_418_1014 197
1824 3300035398 Ga0316574_0216544 Ga0316574_0216544_506_1108 197
1825 3300035410 Ga0373924_0290841 Ga0373924_0290841_14_613 197
1826 3300035691 Ga0373931_0018347 Ga0373931_0018347_1367_1960 197
1827 3300035691 Ga0373931_0018520 Ga0373931_0018520_1031_1624 197
1828 3300036647 Ga0316582_0036139 Ga0316582_0036139_54_656 197
1829 3300036712 Ga0316584_0005823 Ga0316584_0005823_760_1362 197
1830 3300036712 Ga0316584_0166448 Ga0316584_0166448_396_992 197
1831 3300037068 Ga0373925_0051265 Ga0373925_0051265_98_700 197
1832 3300037068 Ga0373925_0131715 Ga0373925_0131715_602_1201 197
1833 3300037312 Ga0395899_0016256 Ga0395899_0016256_3741_4340 197
1834 3300037312 Ga0395899_0022477 Ga0395899_0022477_442_1044 197
1835 3300037312 Ga0395899_0055711 Ga0395899_0055711_1321_1920 197
1836 3300037312 Ga0395899_0086896 Ga0395899_0086896_1363_1962 197
1837 3300037312 Ga0395899_0108241 Ga0395899_0108241_1321_1914 197
1838 3300037312 Ga0395899_0344910 Ga0395899_0344910_307_909 197
1839 3300037312 Ga0395899_0442672 Ga0395899_0442672_26_628 197
1840 3300037312 Ga0395899_0629563 Ga0395899_0629563_56_667 197
1841 3300037418 Ga0395900_0016528 Ga0395900_0016528_1600_2199 197
1842 3300037418 Ga0395900_0022895 Ga0395900_0022895_2556_3155 197
1843 3300037418 Ga0395900_0041026 Ga0395900_0041026_3482_4075 197
1844 3300037418 Ga0395900_0070795 Ga0395900_0070795_2648_3280 197
1845 3300037418 Ga0395900_0074807 Ga0395900_0074807_1606_2202 197
1846 3300037418 Ga0395900_0083636 Ga0395900_0083636_1545_2144 197
1847 3300037418 Ga0395900_0100965 Ga0395900_0100965_2119_2718 197
1848 3300037418 Ga0395900_0112045 Ga0395900_0112045_540_1139 197
1849 3300037418 Ga0395900_0116189 Ga0395900_0116189_1905_2507 197
1850 3300037418 Ga0395900_0120956 Ga0395900_0120956_782_1375 197
1851 3300037418 Ga0395900_0145531 Ga0395900_0145531_639_1238 197
1852 3300037418 Ga0395900_0150001 Ga0395900_0150001_1124_1717 197
1853 3300037418 Ga0395900_0356986 Ga0395900_0356986_290_895 197
1854 3300037466 Ga0395898_0009247 Ga0395898_0009247_6280_6873 197
1855 3300037466 Ga0395898_0014659 Ga0395898_0014659_1295_1897 197
1856 3300037466 Ga0395898_0015605 Ga0395898_0015605_2752_3351 197
1857 3300037466 Ga0395898_0017262 Ga0395898_0017262_3360_3959 197
1858 3300037466 Ga0395898_0066293 Ga0395898_0066293_1222_1821 197
1859 3300037466 Ga0395898_0078068 Ga0395898_0078068_192_791 197
1860 3300037466 Ga0395898_0085089 Ga0395898_0085089_1017_1610 197
1861 3300037466 Ga0395898_0138944 Ga0395898_0138944_134_766 197
1862 3300037466 Ga0395898_0152568 Ga0395898_0152568_1123_1722 197
1863 3300037466 Ga0395898_0160733 Ga0395898_0160733_102_704 197
1864 3300037466 Ga0395898_0168267 Ga0395898_0168267_1133_1726 197
1865 3300037466 Ga0395898_0373648 Ga0395898_0373648_346_948 197
1866 3300037466 Ga0395898_0488560 Ga0395898_0488560_393_1004 197
1867 3300037466 Ga0395898_0493551 Ga0395898_0493551_400_993 197
1868 3300037471 Ga0395905_0668759 Ga0395905_0668759_208_810 197
1869 3300037853 Ga0436364_0159364 Ga0436364_0159364_566_1162 197
1870 3300037853 Ga0436364_0250930 Ga0436364_0250930_1647_2249 197
1871 3300037853 Ga0436364_0290389 Ga0436364_0290389_56567_57187 197
1872 3300037853 Ga0436364_0796641 Ga0436364_0796641_10299_10895 197
1873 3300037853 Ga0436364_1102635 Ga0436364_1102635_2296_2904 197
1874 3300038443 Ga0395901_0048319 Ga0395901_0048319_1600_2199 197
1875 3300038443 Ga0395901_0052609 Ga0395901_0052609_1218_1820 197
1876 3300038443 Ga0395901_0058668 Ga0395901_0058668_27_626 197
1877 3300038443 Ga0395901_0062427 Ga0395901_0062427_32_631 197
1878 3300038443 Ga0395901_0067255 Ga0395901_0067255_2682_3275 197
1879 3300038443 Ga0395901_0089901 Ga0395901_0089901_1884_2477 197
1880 3300038443 Ga0395901_0107455 Ga0395901_0107455_27_626 197
1881 3300038443 Ga0395901_0118878 Ga0395901_0118878_1299_1898 197
1882 3300038443 Ga0395901_0135886 Ga0395901_0135886_28_639 197
1883 3300038443 Ga0395901_0159694 Ga0395901_0159694_1258_1851 197
1884 3300038443 Ga0395901_0271228 Ga0395901_0271228_997_1596 197
1885 3300038443 Ga0395901_0329282 Ga0395901_0329282_208_810 197
1886 3300038443 Ga0395901_0409189 Ga0395901_0409189_701_1300 197
1887 3300038443 Ga0395901_0415915 Ga0395901_0415915_253_858 197
1888 3300038443 Ga0395901_0452187 Ga0395901_0452187_323_922 197
1889 3300038443 Ga0395901_0535491 Ga0395901_0535491_51_662 197
1890 3300038735 Ga0400485_18908 Ga0400485_18908_43681_44277 197
1891 3300038742 Ga0400486_23235 Ga0400486_23235_692_1291 197
1892 3300038742 Ga0400486_28504 Ga0400486_28504_5059_5655 197
1893 3300039437 Ga0436365_0070434 Ga0436365_0070434_1993_2589 197
1894 3300039437 Ga0436365_0201441 Ga0436365_0201441_20392_20988 197
1895 3300039437 Ga0436365_0585474 Ga0436365_0585474_19202_19804 197
1896 3300039437 Ga0436365_0606366 Ga0436365_0606366_2333_2953 197
1897 3300039437 Ga0436365_1739919 Ga0436365_1739919_114_719 197
1898 3300039437 Ga0436365_1920746 Ga0436365_1920746_10274_10912 197
1899 3300039438 Ga0436360_0766235 Ga0436360_0766235_289_885 197
1900 3300039450 Ga0436363_1398133 Ga0436363_1398133_439_1041 197
1901 3300039450 Ga0436363_1528557 Ga0436363_1528557_520_1119 197
1902 3300039450 Ga0436363_1657942 Ga0436363_1657942_310_906 197
1903 3300041404 Ga0439436_0003699 Ga0439436_0003699_3622_4221 197
1904 3300041404 Ga0439436_0011136 Ga0439436_0011136_1308_1910 197
1905 3300041404 Ga0439436_0015206 Ga0439436_0015206_1160_1762 197
1906 3300041405 Ga0439438_016946 Ga0439438_016946_1312_1914 197
1907 3300041405 Ga0439438_018633 Ga0439438_018633_591_1193 197
1908 3300041405 Ga0439438_024607 Ga0439438_024607_853_1452 197
1909 3300041406 Ga0439439_0018664 Ga0439439_0018664_447_1046 197
1910 3300041407 Ga0439447_011196 Ga0439447_011196_454_1053 197
1911 3300041410 Ga0439461_0000735 Ga0439461_0000735_117_716 197
1912 3300041410 Ga0439461_0003823 Ga0439461_0003823_720_1313 197
1913 3300041410 Ga0439461_0016624 Ga0439461_0016624_592_1191 197
1914 3300041410 Ga0439461_0027979 Ga0439461_0027979_480_1073 197
1915 3300041411 Ga0439466_0001603 Ga0439466_0001603_5241_5834 197
1916 3300041411 Ga0439466_0009389 Ga0439466_0009389_1043_1642 197
1917 3300041411 Ga0439466_0029654 Ga0439466_0029654_205_807 197
1918 3300041411 Ga0439466_0033829 Ga0439466_0033829_1067_1669 197
1919 3300041413 Ga0439465_0001837 Ga0439465_0001837_1173_1766 197
1920 3300041413 Ga0439465_0003484 Ga0439465_0003484_1248_1841 197
1921 3300041413 Ga0439465_0021728 Ga0439465_0021728_639_1232 197
1922 3300041413 Ga0439465_0130441 Ga0439465_0130441_241_861 197
1923 3300041441 Ga0451787_456576 Ga0451787_456576_200_796 197
1924 3300041443 Ga0451789_0258112 Ga0451789_0258112_161_769 197
1925 3300041443 Ga0451789_0555308 Ga0451789_0555308_40_636 197
1926 3300041451 Ga0451791_1921000 Ga0451791_1921000_246_848 197
1927 3300041452 Ga0451793_0181067 Ga0451793_0181067_183_779 197
1928 3300041453 Ga0451797_0728331 Ga0451797_0728331_532_1128 197
1929 3300041453 Ga0451797_1475442 Ga0451797_1475442_210_806 197
1930 3300041456 Ga0451795_0004404 Ga0451795_0004404_447_1043 197
1931 3300041456 Ga0451795_0247050 Ga0451795_0247050_705_1301 197
1932 3300041456 Ga0451795_0522910 Ga0451795_0522910_112_705 197
1933 3300041459 Ga0451800_0023653 Ga0451800_0023653_133_747 197
1934 3300041463 Ga0451804_0302612 Ga0451804_0302612_407_1003 197
1935 3300041486 Ga0451807_2379788 Ga0451807_2379788_35_631 197
1936 3300041491 Ga0451833_0136467 Ga0451833_0136467_43_636 197
1937 3300041496 Ga0451839_1031148 Ga0451839_1031148_149_742 197
1938 3300041498 Ga0451841_1307443 Ga0451841_1307443_75_689 197
1939 3300041498 Ga0451841_1366994 Ga0451841_1366994_265_867 197
1940 3300041503 Ga0451847_0352736 Ga0451847_0352736_49_645 197
1941 3300041509 Ga0451843_1082564 Ga0451843_1082564_13_615 197
1942 3300041509 Ga0451843_1233444 Ga0451843_1233444_136_729 197
1943 3300041512 Ga0451853_0724352 Ga0451853_0724352_747_1343 197
1944 3300041512 Ga0451853_1387346 Ga0451853_1387346_112_711 197
1945 3300041512 Ga0451853_3031538 Ga0451853_3031538_616_1212 197
1946 3300041512 Ga0451853_3487584 Ga0451853_3487584_106_705 197
1947 3300041512 Ga0451853_3654876 Ga0451853_3654876_272_883 197
1948 3300041997 Ga0439431_0003207 Ga0439431_0003207_2248_2841 197
1949 3300041997 Ga0439431_0032418 Ga0439431_0032418_207_806 197
1950 3300041999 Ga0439433_0000454 Ga0439433_0000454_1701_2303 197
1951 3300041999 Ga0439433_0000518 Ga0439433_0000518_357_956 197
1952 3300042002 Ga0439442_000017 Ga0439442_000017_2869_3471 197
1953 3300042002 Ga0439442_000210 Ga0439442_000210_5250_5852 197
1954 3300042002 Ga0439442_000606 Ga0439442_000606_269_871 197
1955 3300042002 Ga0439442_002097 Ga0439442_002097_2265_2864 197
1956 3300042002 Ga0439442_004672 Ga0439442_004672_1637_2230 197
1957 3300042002 Ga0439442_013293 Ga0439442_013293_240_839 197
1958 3300042004 Ga0439445_0001633 Ga0439445_0001633_602_1195 197
1959 3300042004 Ga0439445_0005519 Ga0439445_0005519_276_875 197
1960 3300042004 Ga0439445_0072852 Ga0439445_0072852_349_942 197
1961 3300042005 Ga0439448_0017962 Ga0439448_0017962_1166_1759 197
1962 3300042006 Ga0439432_032498 Ga0439432_032498_956_1555 197
1963 3300042007 Ga0439449_0002498 Ga0439449_0002498_3218_3820 197
1964 3300042007 Ga0439449_0002526 Ga0439449_0002526_4444_5046 197
1965 3300042007 Ga0439449_0016340 Ga0439449_0016340_955_1557 197
1966 3300042007 Ga0439449_0017891 Ga0439449_0017891_932_1534 197
1967 3300042007 Ga0439449_0151279 Ga0439449_0151279_89_691 197
1968 3300042010 Ga0439452_015513 Ga0439452_015513_902_1501 197
1969 3300042010 Ga0439452_026761 Ga0439452_026761_295_897 197
1970 3300042014 Ga0439457_001341 Ga0439457_001341_4749_5348 197
1971 3300042014 Ga0439457_004829 Ga0439457_004829_2774_3376 197
1972 3300042014 Ga0439457_082769 Ga0439457_082769_73_675 197
1973 3300042015 Ga0439462_0015923 Ga0439462_0015923_1263_1865 197
1974 3300042015 Ga0439462_0019359 Ga0439462_0019359_854_1453 197
1975 3300042115 Ga0450911_004128 Ga0450911_004128_508_1107 197
1976 3300042121 Ga0450919_000638 Ga0450919_000638_119_718 197
1977 3300042122 Ga0450920_001582 Ga0450920_001582_3076_3675 197
1978 3300042122 Ga0450920_004454 Ga0450920_004454_1518_2120 197
1979 3300042122 Ga0450920_028106 Ga0450920_028106_457_1059 197
1980 3300042146 Ga0450907_000065 Ga0450907_000065_17432_18034 197
1981 3300042146 Ga0450907_008464 Ga0450907_008464_576_1175 197
1982 3300042146 Ga0450907_023914 Ga0450907_023914_51_653 197
1983 3300042157 Ga0439458_0128700 Ga0439458_0128700_19_612 197
1984 3300042435 Ga0439434_0000100 Ga0439434_0000100_4492_5094 197
1985 3300042435 Ga0439434_0003973 Ga0439434_0003973_690_1289 197
1986 3300042435 Ga0439434_0004091 Ga0439434_0004091_1323_1916 197
1987 3300042435 Ga0439434_0004608 Ga0439434_0004608_2152_2751 197
1988 3300042531 Ga0450918_001384 Ga0450918_001384_1575_2177 197
1989 3300042531 Ga0450918_003902 Ga0450918_003902_120_719 197
1990 3300044656 Ga0466969_0054397 Ga0466969_0054397_17_619 197
1991 3300044658 Ga0466972_0004495 Ga0466972_0004495_1888_2481 197
1992 3300044658 Ga0466972_0010542 Ga0466972_0010542_1669_2271 197
1993 3300044658 Ga0466972_0019259 Ga0466972_0019259_52_657 197
1994 3300044658 Ga0466972_0028483 Ga0466972_0028483_1694_2287 197
1995 3300044658 Ga0466972_0038637 Ga0466972_0038637_572_1168 197
1996 3300044658 Ga0466972_0072821 Ga0466972_0072821_741_1340 197
1997 3300044658 Ga0466972_0078519 Ga0466972_0078519_769_1362 197
1998 3300044683 Ga0466965_0001067 Ga0466965_0001067_7504_8097 197
1999 3300044683 Ga0466965_0001750 Ga0466965_0001750_1932_2525 197
2000 3300044683 Ga0466965_0001891 Ga0466965_0001891_1746_2342 197
2001 3300044683 Ga0466965_0005761 Ga0466965_0005761_2907_3509 197
2002 3300044683 Ga0466965_0007511 Ga0466965_0007511_1160_1753 197
2003 3300044683 Ga0466965_0007733 Ga0466965_0007733_1836_2438 197
2004 3300044683 Ga0466965_0013083 Ga0466965_0013083_495_1097 197
2005 3300044683 Ga0466965_0024262 Ga0466965_0024262_269_868 197
2006 3300044683 Ga0466965_0030137 Ga0466965_0030137_1759_2379 197
2007 3300044683 Ga0466965_0034643 Ga0466965_0034643_1822_2430 197
2008 3300044683 Ga0466965_0044424 Ga0466965_0044424_210_803 197
2009 3300044683 Ga0466965_0102448 Ga0466965_0102448_492_1094 197
2010 3300044683 Ga0466965_0112635 Ga0466965_0112635_207_800 197
2011 3300044683 Ga0466965_0134832 Ga0466965_0134832_102_749 197
2012 3300044683 Ga0466965_0148542 Ga0466965_0148542_172_765 197
2013 3300044683 Ga0466965_0203180 Ga0466965_0203180_29_625 197
2014 3300044684 Ga0466966_0005894 Ga0466966_0005894_2000_2593 197
2015 3300044684 Ga0466966_0010547 Ga0466966_0010547_2860_3456 197
2016 3300044684 Ga0466966_0022584 Ga0466966_0022584_2221_2823 197
2017 3300044684 Ga0466966_0056933 Ga0466966_0056933_1631_2233 197
2018 3300044684 Ga0466966_0057153 Ga0466966_0057153_1055_1663 197
2019 3300044684 Ga0466966_0117078 Ga0466966_0117078_394_993 197
2020 3300044684 Ga0466966_0117471 Ga0466966_0117471_499_1098 197
2021 3300044684 Ga0466966_0142434 Ga0466966_0142434_378_986 197
2022 3300044693 Ga0466961_0002946 Ga0466961_0002946_2729_3331 197
2023 3300044693 Ga0466961_0010095 Ga0466961_0010095_5396_5992 197
2024 3300044693 Ga0466961_0013068 Ga0466961_0013068_499_1095 197
2025 3300044693 Ga0466961_0055510 Ga0466961_0055510_1369_1968 197
2026 3300044693 Ga0466961_0249709 Ga0466961_0249709_433_1032 197
2027 3300044694 Ga0466963_0027470 Ga0466963_0027470_1246_1839 197
2028 3300044694 Ga0466963_0066677 Ga0466963_0066677_1712_2308 197
2029 3300044694 Ga0466963_0070225 Ga0466963_0070225_836_1444 197
2030 3300044694 Ga0466963_0209804 Ga0466963_0209804_253_846 197
2031 3300044694 Ga0466963_0330843 Ga0466963_0330843_255_863 197
2032 3300044706 Ga0466964_0221621 Ga0466964_0221621_284_877 197
2033 3300044706 Ga0466964_0290458 Ga0466964_0290458_20_619 197
2034 3300044719 Ga0466971_0003674 Ga0466971_0003674_3300_3893 197
2035 3300044719 Ga0466971_0056955 Ga0466971_0056955_949_1542 197
2036 3300044735 Ga0466968_0001388 Ga0466968_0001388_3863_4456 197
2037 3300044735 Ga0466968_0012577 Ga0466968_0012577_1302_1895 197
2038 3300044735 Ga0466968_0025444 Ga0466968_0025444_1799_2401 197
2039 3300044735 Ga0466968_0037356 Ga0466968_0037356_1234_1827 197
2040 3300044735 Ga0466968_0059966 Ga0466968_0059966_348_968 197
2041 3300044735 Ga0466968_0064888 Ga0466968_0064888_406_1008 197
2042 3300044735 Ga0466968_0278841 Ga0466968_0278841_149_748 197
2043 3300044765 Ga0466970_0000176 Ga0466970_0000176_1872_2468 197
2044 3300044765 Ga0466970_0008421 Ga0466970_0008421_1787_2386 197
2045 3300044765 Ga0466970_0013259 Ga0466970_0013259_1864_2466 197
2046 3300044765 Ga0466970_0020199 Ga0466970_0020199_778_1380 197
2047 3300044765 Ga0466970_0023859 Ga0466970_0023859_791_1384 197
2048 3300044765 Ga0466970_0024826 Ga0466970_0024826_2477_3097 197
2049 3300044765 Ga0466970_0027328 Ga0466970_0027328_2216_2818 197
2050 3300044765 Ga0466970_0027997 Ga0466970_0027997_1311_1907 197
2051 3300044765 Ga0466970_0049723 Ga0466970_0049723_761_1354 197
2052 3300044765 Ga0466970_0053951 Ga0466970_0053951_635_1234 197
2053 3300044765 Ga0466970_0067141 Ga0466970_0067141_712_1308 197
2054 3300044765 Ga0466970_0071824 Ga0466970_0071824_1254_1847 197
2055 3300044765 Ga0466970_0075091 Ga0466970_0075091_665_1273 197
2056 3300044765 Ga0466970_0075935 Ga0466970_0075935_145_747 197
2057 3300044765 Ga0466970_0083590 Ga0466970_0083590_647_1246 197
2058 3300044765 Ga0466970_0110731 Ga0466970_0110731_554_1150 197
2059 3300044765 Ga0466970_0505993 Ga0466970_0505993_82_675 197
2060 3300044842 Ga0466957_0002569 Ga0466957_0002569_3488_4084 197
2061 3300044842 Ga0466957_0015040 Ga0466957_0015040_3302_3895 197
2062 3300044842 Ga0466957_0017272 Ga0466957_0017272_1087_1686 197
2063 3300044842 Ga0466957_0017419 Ga0466957_0017419_917_1510 197
2064 3300044842 Ga0466957_0026962 Ga0466957_0026962_348_947 197
2065 3300044842 Ga0466957_0056361 Ga0466957_0056361_1186_1788 197
2066 3300044842 Ga0466957_0117939 Ga0466957_0117939_913_1509 197
2067 3300044842 Ga0466957_0175232 Ga0466957_0175232_565_1161 197
2068 3300044842 Ga0466957_0197065 Ga0466957_0197065_321_929 197
2069 3300044901 Ga0466960_0000108 Ga0466960_0000108_15494_16087 197
2070 3300044901 Ga0466960_0005615 Ga0466960_0005615_2551_3153 197
2071 3300044901 Ga0466960_0009070 Ga0466960_0009070_1910_2509 197
2072 3300044901 Ga0466960_0010838 Ga0466960_0010838_2130_2723 197
2073 3300044901 Ga0466960_0011366 Ga0466960_0011366_3040_3681 197
2074 3300044901 Ga0466960_0011813 Ga0466960_0011813_1906_2508 197
2075 3300044901 Ga0466960_0015183 Ga0466960_0015183_2378_2986 197
2076 3300044901 Ga0466960_0016732 Ga0466960_0016732_1580_2176 197
2077 3300044901 Ga0466960_0029533 Ga0466960_0029533_1518_2111 197
2078 3300044901 Ga0466960_0071076 Ga0466960_0071076_266_865 197
2079 3300044901 Ga0466960_0194572 Ga0466960_0194572_140_748 197
2080 3300044901 Ga0466960_0247326 Ga0466960_0247326_294_887 197
2081 3300045049 Ga0466959_0001743 Ga0466959_0001743_8276_8869 197
2082 3300045049 Ga0466959_0002933 Ga0466959_0002933_3301_3894 197
2083 3300045049 Ga0466959_0005367 Ga0466959_0005367_7466_8062 197
2084 3300045049 Ga0466959_0007058 Ga0466959_0007058_3539_4141 197
2085 3300045049 Ga0466959_0022541 Ga0466959_0022541_2457_3056 197
2086 3300045049 Ga0466959_0102150 Ga0466959_0102150_1125_1721 197
2087 3300045049 Ga0466959_0310808 Ga0466959_0310808_200_793 197
2088 3300045049 Ga0466959_0339296 Ga0466959_0339296_196_798 197
2089 3300045836 Ga0466958_0000249 Ga0466958_0000249_11585_12181 197
2090 3300045836 Ga0466958_0014386 Ga0466958_0014386_3067_3660 197
2091 3300045836 Ga0466958_0024769 Ga0466958_0024769_2921_3517 197
2092 3300045836 Ga0466958_0038815 Ga0466958_0038815_1866_2465 197
2093 3300045836 Ga0466958_0049943 Ga0466958_0049943_950_1552 197
2094 3300045836 Ga0466958_0100440 Ga0466958_0100440_46_639 197
2095 3300045836 Ga0466958_0130840 Ga0466958_0130840_127_726 197
2096 3300045836 Ga0466958_0165840 Ga0466958_0165840_754_1362 197
2097 3300045836 Ga0466958_0242593 Ga0466958_0242593_30_626 197
2098 3300045836 Ga0466958_0311975 Ga0466958_0311975_177_785 197
2099 3300045836 Ga0466958_0316095 Ga0466958_0316095_37_639 197
2100 3300045976 Ga0466967_0004216 Ga0466967_0004216_4011_4604 197
2101 3300045976 Ga0466967_0005152 Ga0466967_0005152_7039_7647 197
2102 3300045976 Ga0466967_0017156 Ga0466967_0017156_64_660 197
2103 3300045976 Ga0466967_0019813 Ga0466967_0019813_1831_2424 197
2104 3300045976 Ga0466967_0025921 Ga0466967_0025921_959_1552 197
2105 3300045976 Ga0466967_0031674 Ga0466967_0031674_530_1123 197
2106 3300045976 Ga0466967_0033247 Ga0466967_0033247_3398_4000 197
2107 3300045976 Ga0466967_0164985 Ga0466967_0164985_758_1351 197
2108 3300045976 Ga0466967_0222432 Ga0466967_0222432_885_1493 197
2109 3300045976 Ga0466967_0316601 Ga0466967_0316601_260_853 197
2110 3300045976 Ga0466967_0746291 Ga0466967_0746291_356_952 197
2111 3300046453 Ga0495627_000401 Ga0495627_000401_2763_3359 197
2112 3300046455 Ga0495603_0014689 Ga0495603_0014689_2794_3393 197
2113 3300046455 Ga0495603_0372243 Ga0495603_0372243_163_771 197
2114 3300046459 Ga0495629_0197022 Ga0495629_0197022_727_1329 197
2115 3300046459 Ga0495629_0482862 Ga0495629_0482862_90_692 197
2116 3300046460 Ga0495638_0001617 Ga0495638_0001617_7829_8422 197
2117 3300046460 Ga0495638_0017392 Ga0495638_0017392_3477_4073 197
2118 3300046460 Ga0495638_0265773 Ga0495638_0265773_271_867 197
2119 3300046460 Ga0495638_0274217 Ga0495638_0274217_103_699 197
2120 3300046461 Ga0495641_0078306 Ga0495641_0078306_852_1445 197
2121 3300046461 Ga0495641_0095047 Ga0495641_0095047_700_1293 197
2122 3300046461 Ga0495641_0102962 Ga0495641_0102962_607_1248 197
2123 3300046463 Ga0495653_0098109 Ga0495653_0098109_1408_2049 197
2124 3300046463 Ga0495653_0461373 Ga0495653_0461373_150_752 197
2125 3300046471 Ga0495650_0080504 Ga0495650_0080504_40_642 197
2126 3300046472 Ga0495580_0002953 Ga0495580_0002953_13843_14445 197
2127 3300046472 Ga0495580_0186130 Ga0495580_0186130_787_1389 197
2128 3300046473 Ga0495582_0021508 Ga0495582_0021508_1784_2383 197
2129 3300046473 Ga0495582_0232945 Ga0495582_0232945_140_742 197
2130 3300046473 Ga0495582_0307198 Ga0495582_0307198_240_833 197
2131 3300046475 Ga0495639_0005090 Ga0495639_0005090_3956_4558 197
2132 3300046476 Ga0495662_0041219 Ga0495662_0041219_1359_1958 197
2133 3300046477 Ga0495664_0417087 Ga0495664_0417087_159_761 197
2134 3300046499 Ga0495594_0025885 Ga0495594_0025885_2148_2747 197
2135 3300046507 Ga0495606_0044325 Ga0495606_0044325_1782_2375 197
2136 3300046511 Ga0495608_0105115 Ga0495608_0105115_146_739 197
2137 3300046515 Ga0495620_0074180 Ga0495620_0074180_202_801 197
2138 3300046517 Ga0495630_0316816 Ga0495630_0316816_267_866 197
2139 3300046518 Ga0495631_0112966 Ga0495631_0112966_264_863 197
2140 3300046518 Ga0495631_0164415 Ga0495631_0164415_199_795 197
2141 3300046522 Ga0495643_0224251 Ga0495643_0224251_214_813 197
2142 3300046526 Ga0495666_0244541 Ga0495666_0244541_189_788 197
2143 3300046528 Ga0495642_0059247 Ga0495642_0059247_371_973 197
2144 3300046533 Ga0495640_0065503 Ga0495640_0065503_953_1552 197
2145 3300046536 Ga0495587_0175689 Ga0495587_0175689_103_705 197
2146 3300046538 Ga0495609_0018232 Ga0495609_0018232_2518_3114 197
2147 3300046543 Ga0495645_0119000 Ga0495645_0119000_640_1242 197
2148 3300046615 Ga0495656_0012675 Ga0495656_0012675_1950_2546 197
2149 3300046615 Ga0495656_0073969 Ga0495656_0073969_835_1443 197
2150 3300046615 Ga0495656_0327176 Ga0495656_0327176_56_658 197
2151 3300046616 Ga0495668_0007903 Ga0495668_0007903_868_1476 197
2152 3300046616 Ga0495668_0143873 Ga0495668_0143873_83_685 197
2153 3300046642 Ga0495634_0181551 Ga0495634_0181551_434_1033 197
2154 3300046660 Ga0495625_0038469 Ga0495625_0038469_2584_3180 197
2155 3300046660 Ga0495625_0100904 Ga0495625_0100904_959_1552 197
2156 3300046663 Ga0495635_0031993 Ga0495635_0031993_287_889 197
2157 3300046663 Ga0495635_0083317 Ga0495635_0083317_984_1625 197
2158 3300046663 Ga0495635_0241094 Ga0495635_0241094_52_645 197
2159 3300046664 Ga0495659_0198060 Ga0495659_0198060_125_727 197
2160 3300046674 Ga0495588_0039616 Ga0495588_0039616_490_1092 197
2161 3300046674 Ga0495588_0104338 Ga0495588_0104338_576_1184 197
2162 3300046674 Ga0495588_0127746 Ga0495588_0127746_391_990 197
2163 3300046674 Ga0495588_0249312 Ga0495588_0249312_260_868 197
2164 3300046680 Ga0495646_0118028 Ga0495646_0118028_111_710 197
2165 3300046683 Ga0495658_0007185 Ga0495658_0007185_4248_4847 197
2166 3300046690 Ga0495624_0026430 Ga0495624_0026430_761_1360 197
2167 3300046690 Ga0495624_0419312 Ga0495624_0419312_85_726 197
2168 3300046691 Ga0495670_0037917 Ga0495670_0037917_1688_2290 197
2169 3300046691 Ga0495670_0292938 Ga0495670_0292938_221_823 197
2170 3300046692 Ga0495671_0177018 Ga0495671_0177018_208_801 197
2171 3300046694 Ga0495649_0080004 Ga0495649_0080004_595_1191 197
2172 3300046694 Ga0495649_0286404 Ga0495649_0286404_25_621 197
2173 3300046809 Ga0495600_0021040 Ga0495600_0021040_3411_4013 197
2174 3300046809 Ga0495600_0064568 Ga0495600_0064568_656_1258 197
2175 3300046809 Ga0495600_0257032 Ga0495600_0257032_451_1044 197
2176 3300047315 Ga0495581_0007818 Ga0495581_0007818_5014_5613 197
2177 3300047315 Ga0495581_0024721 Ga0495581_0024721_2118_2726 197
2178 3300047315 Ga0495581_0029889 Ga0495581_0029889_803_1405 197
2179 3300047315 Ga0495581_0119456 Ga0495581_0119456_791_1399 197
2180 3300047315 Ga0495581_0125390 Ga0495581_0125390_321_923 197
2181 3300047315 Ga0495581_0155323 Ga0495581_0155323_641_1243 197
2182 3300047318 Ga0495636_0080315 Ga0495636_0080315_696_1298 197
2183 3300047319 Ga0495674_0031514 Ga0495674_0031514_233_832 197
2184 3300047319 Ga0495674_0476453 Ga0495674_0476453_253_846 197
2185 3300047320 Ga0495672_0026633 Ga0495672_0026633_695_1288 197
2186 3300047320 Ga0495672_0115532 Ga0495672_0115532_497_1093 197
2187 3300047321 Ga0495676_0280730 Ga0495676_0280730_361_969 197
2188 3300047322 Ga0495680_0147266 Ga0495680_0147266_122_715 197
2189 3300047322 Ga0495680_0189407 Ga0495680_0189407_622_1215 197
2190 3300047322 Ga0495680_0240797 Ga0495680_0240797_384_986 197
2191 3300047323 Ga0495683_0012837 Ga0495683_0012837_2431_3039 197
2192 3300047444 Ga0495675_0011607 Ga0495675_0011607_128_730 197
2193 3300047444 Ga0495675_0063350 Ga0495675_0063350_636_1229 197
2194 3300047470 Ga0495681_0084543 Ga0495681_0084543_68_670 197
2195 3300047471 Ga0495684_0549858 Ga0495684_0549858_93_695 197
2196 3300047472 Ga0495686_0021284 Ga0495686_0021284_2951_3544 197
2197 3300047472 Ga0495686_0094890 Ga0495686_0094890_341_937 197
2198 3300047472 Ga0495686_0326737 Ga0495686_0326737_87_683 197
2199 3300047673 Ga0495593_0201603 Ga0495593_0201603_69_671 197
2200 3300048088 Ga0495602_0492253 Ga0495602_0492253_56_649 197
2201 3300048090 Ga0495615_0058873 Ga0495615_0058873_328_930 197
2202 3300048091 Ga0495626_0178033 Ga0495626_0178033_264_857 197
2203 3300048903 Ga0496100_0000009 Ga0496100_0000009_52705_53298 197
2204 3300048903 Ga0496100_0000555 Ga0496100_0000555_15655_16248 197
2205 3300048903 Ga0496100_0008062 Ga0496100_0008062_774_1367 197
2206 3300048903 Ga0496100_0027772 Ga0496100_0027772_2662_3255 197
2207 3300048903 Ga0496100_0030954 Ga0496100_0030954_707_1300 197
2208 3300048903 Ga0496100_0060751 Ga0496100_0060751_722_1318 197
2209 3300048903 Ga0496100_0077378 Ga0496100_0077378_1579_2184 197
2210 3300048903 Ga0496100_0166658 Ga0496100_0166658_23_616 197
2211 3300048903 Ga0496100_0379734 Ga0496100_0379734_364_957 197
2212 3300048903 Ga0496100_0549379 Ga0496100_0549379_201_794 197
2213 3300048904 Ga0496101_0000018 Ga0496101_0000018_114446_115039 197
2214 3300048904 Ga0496101_0002057 Ga0496101_0002057_8981_9574 197
2215 3300048904 Ga0496101_0003076 Ga0496101_0003076_1813_2406 197
2216 3300048904 Ga0496101_0004515 Ga0496101_0004515_3305_3898 197
2217 3300048904 Ga0496101_0035458 Ga0496101_0035458_787_1380 197
2218 3300048904 Ga0496101_0048441 Ga0496101_0048441_2288_2881 197
2219 3300048904 Ga0496101_0054290 Ga0496101_0054290_2169_2780 197
2220 3300048904 Ga0496101_0076766 Ga0496101_0076766_1256_1849 197
2221 3300048904 Ga0496101_0079570 Ga0496101_0079570_334_930 197
2222 3300048904 Ga0496101_0083648 Ga0496101_0083648_1470_2063 197
2223 3300048904 Ga0496101_0127115 Ga0496101_0127115_382_984 197
2224 3300048904 Ga0496101_0154657 Ga0496101_0154657_780_1373 197
2225 3300048904 Ga0496101_0173364 Ga0496101_0173364_301_894 197
2226 3300048904 Ga0496101_0213559 Ga0496101_0213559_748_1353 197
2227 3300048904 Ga0496101_0285225 Ga0496101_0285225_115_711 197
2228 3300048904 Ga0496101_0474275 Ga0496101_0474275_359_955 197
2229 3300048904 Ga0496101_0592638 Ga0496101_0592638_185_790 197
2230 3300048905 Ga0496102_0000820 Ga0496102_0000820_15333_15926 197
2231 3300048905 Ga0496102_0002409 Ga0496102_0002409_11354_11947 197
2232 3300048905 Ga0496102_0003481 Ga0496102_0003481_9409_10002 197
2233 3300048905 Ga0496102_0003652 Ga0496102_0003652_4884_5477 197
2234 3300048905 Ga0496102_0004997 Ga0496102_0004997_213_806 197
2235 3300048905 Ga0496102_0015341 Ga0496102_0015341_5286_5879 197
2236 3300048905 Ga0496102_0017563 Ga0496102_0017563_3150_3749 197
2237 3300048905 Ga0496102_0037325 Ga0496102_0037325_1423_2019 197
2238 3300048905 Ga0496102_0046603 Ga0496102_0046603_1397_1990 197
2239 3300048905 Ga0496102_0103287 Ga0496102_0103287_1912_2553 197
2240 3300048905 Ga0496102_0114744 Ga0496102_0114744_739_1335 197
2241 3300048905 Ga0496102_0139439 Ga0496102_0139439_1566_2162 197
2242 3300048905 Ga0496102_0144475 Ga0496102_0144475_771_1370 197
2243 3300048905 Ga0496102_0169955 Ga0496102_0169955_830_1429 197
2244 3300048905 Ga0496102_0271514 Ga0496102_0271514_989_1582 197
2245 3300048905 Ga0496102_0410960 Ga0496102_0410960_27_629 197
2246 3300048905 Ga0496102_0425231 Ga0496102_0425231_179_784 197
2247 3300048905 Ga0496102_0515208 Ga0496102_0515208_265_858 197
2248 3300048905 Ga0496102_0654926 Ga0496102_0654926_287_880 197
2249 3300048905 Ga0496102_0792770 Ga0496102_0792770_227_823 197
2250 3300048905 Ga0496102_1122902 Ga0496102_1122902_27_620 197
2251 3300048905 Ga0496102_1208782 Ga0496102_1208782_60_653 197
2252 3300048906 Ga0496103_0000473 Ga0496103_0000473_19436_20029 197
2253 3300048906 Ga0496103_0000662 Ga0496103_0000662_18374_18967 197
2254 3300048906 Ga0496103_0001547 Ga0496103_0001547_6628_7221 197
2255 3300048906 Ga0496103_0003299 Ga0496103_0003299_1654_2247 197
2256 3300048906 Ga0496103_0031142 Ga0496103_0031142_1746_2357 197
2257 3300048906 Ga0496103_0035934 Ga0496103_0035934_993_1586 197
2258 3300048906 Ga0496103_0038692 Ga0496103_0038692_788_1381 197
2259 3300048906 Ga0496103_0204229 Ga0496103_0204229_356_952 197
2260 3300048906 Ga0496103_0292102 Ga0496103_0292102_364_969 197
2261 3300048906 Ga0496103_0373439 Ga0496103_0373439_26_622 197
2262 3300048907 Ga0496104_0000285 Ga0496104_0000285_14942_15535 197
2263 3300048907 Ga0496104_0007149 Ga0496104_0007149_8274_8867 197
2264 3300048907 Ga0496104_0008789 Ga0496104_0008789_829_1422 197
2265 3300048907 Ga0496104_0040900 Ga0496104_0040900_2299_2895 197
2266 3300048907 Ga0496104_0078050 Ga0496104_0078050_62_655 197
2267 3300048907 Ga0496104_0082307 Ga0496104_0082307_1871_2473 197
2268 3300048907 Ga0496104_0095364 Ga0496104_0095364_2166_2765 197
2269 3300048907 Ga0496104_0146940 Ga0496104_0146940_1006_1599 197
2270 3300048907 Ga0496104_0170776 Ga0496104_0170776_1314_1955 197
2271 3300048907 Ga0496104_0520655 Ga0496104_0520655_322_915 197
2272 3300048907 Ga0496104_0608963 Ga0496104_0608963_362_955 197
2273 3300048907 Ga0496104_0786256 Ga0496104_0786256_156_749 197
2274 3300048907 Ga0496104_1265268 Ga0496104_1265268_23_625 197
2275 3300048908 Ga0496105_0000166 Ga0496105_0000166_11854_12447 197
2276 3300048908 Ga0496105_0008276 Ga0496105_0008276_7013_7609 197
2277 3300048908 Ga0496105_0015583 Ga0496105_0015583_4860_5453 197
2278 3300048908 Ga0496105_0040579 Ga0496105_0040579_990_1583 197
2279 3300048908 Ga0496105_0040584 Ga0496105_0040584_976_1569 197
2280 3300048908 Ga0496105_0128977 Ga0496105_0128977_630_1223 197
2281 3300048908 Ga0496105_0216664 Ga0496105_0216664_154_792 197
2282 3300048908 Ga0496105_0355914 Ga0496105_0355914_194_796 197
2283 3300048908 Ga0496105_0398091 Ga0496105_0398091_144_740 197
2284 3300048908 Ga0496105_0434809 Ga0496105_0434809_97_690 197
2285 3300048908 Ga0496105_0626539 Ga0496105_0626539_61_657 197
2286 3300048909 Ga0496106_0005366 Ga0496106_0005366_6109_6702 197
2287 3300048909 Ga0496106_0026975 Ga0496106_0026975_992_1585 197
2288 3300048909 Ga0496106_0027196 Ga0496106_0027196_2853_3449 197
2289 3300048909 Ga0496106_0069153 Ga0496106_0069153_1799_2392 197
2290 3300048909 Ga0496106_0127629 Ga0496106_0127629_765_1367 197
2291 3300048909 Ga0496106_0127923 Ga0496106_0127923_40_633 197
2292 3300048909 Ga0496106_0202239 Ga0496106_0202239_353_958 197
2293 3300048909 Ga0496106_0229615 Ga0496106_0229615_146_748 197
2294 3300048909 Ga0496106_0281250 Ga0496106_0281250_37_639 197
2295 3300048909 Ga0496106_0630209 Ga0496106_0630209_123_764 197
2296 3300048910 Ga0496107_0000152 Ga0496107_0000152_17194_17787 197
2297 3300048910 Ga0496107_0000364 Ga0496107_0000364_3245_3838 197
2298 3300048910 Ga0496107_0005278 Ga0496107_0005278_1961_2554 197
2299 3300048910 Ga0496107_0040147 Ga0496107_0040147_765_1361 197
2300 3300048910 Ga0496107_0048375 Ga0496107_0048375_2404_2997 197
2301 3300048910 Ga0496107_0048545 Ga0496107_0048545_1531_2124 197
2302 3300048910 Ga0496107_0085934 Ga0496107_0085934_531_1136 197
2303 3300048910 Ga0496107_0135190 Ga0496107_0135190_524_1135 197
2304 3300048910 Ga0496107_0144518 Ga0496107_0144518_546_1148 197
2305 3300048910 Ga0496107_0165413 Ga0496107_0165413_805_1398 197
2306 3300048910 Ga0496107_0520938 Ga0496107_0520938_200_841 197
2307 3300048910 Ga0496107_0722167 Ga0496107_0722167_73_672 197
2308 3300048911 Ga0496108_0000520 Ga0496108_0000520_7086_7679 197
2309 3300048911 Ga0496108_0005587 Ga0496108_0005587_1511_2104 197
2310 3300048911 Ga0496108_0046790 Ga0496108_0046790_292_885 197
2311 3300048911 Ga0496108_0057354 Ga0496108_0057354_1969_2577 197
2312 3300048911 Ga0496108_0074453 Ga0496108_0074453_626_1219 197
2313 3300048911 Ga0496108_0153751 Ga0496108_0153751_1201_1842 197
2314 3300048911 Ga0496108_0154625 Ga0496108_0154625_641_1240 197
2315 3300048911 Ga0496108_0199607 Ga0496108_0199607_273_869 197
2316 3300048911 Ga0496108_0202888 Ga0496108_0202888_861_1460 197
2317 3300048911 Ga0496108_0408518 Ga0496108_0408518_479_1072 197
2318 3300048911 Ga0496108_0532391 Ga0496108_0532391_42_644 197
2319 3300048912 Ga0496109_0000214 Ga0496109_0000214_48321_48914 197
2320 3300048912 Ga0496109_0002624 Ga0496109_0002624_7638_8231 197
2321 3300048912 Ga0496109_0017274 Ga0496109_0017274_5168_5767 197
2322 3300048912 Ga0496109_0051609 Ga0496109_0051609_2994_3587 197
2323 3300048912 Ga0496109_0099637 Ga0496109_0099637_1148_1741 197
2324 3300048912 Ga0496109_0110152 Ga0496109_0110152_986_1579 197
2325 3300048912 Ga0496109_0198771 Ga0496109_0198771_192_788 197
2326 3300048912 Ga0496109_0242540 Ga0496109_0242540_218_823 197
2327 3300048912 Ga0496109_0260169 Ga0496109_0260169_482_1084 197
2328 3300048912 Ga0496109_0389441 Ga0496109_0389441_26_667 197
2329 3300048913 Ga0496110_0024790 Ga0496110_0024790_2428_3021 197
2330 3300048913 Ga0496110_0027678 Ga0496110_0027678_1479_2072 197
2331 3300048913 Ga0496110_0046922 Ga0496110_0046922_2690_3283 197
2332 3300048913 Ga0496110_0061833 Ga0496110_0061833_2103_2702 197
2333 3300048913 Ga0496110_0187305 Ga0496110_0187305_527_1138 197
2334 3300048913 Ga0496110_0219871 Ga0496110_0219871_343_942 197
2335 3300048913 Ga0496110_0285687 Ga0496110_0285687_13_606 197
2336 3300048913 Ga0496110_0406382 Ga0496110_0406382_365_970 197
2337 3300048913 Ga0496110_0464341 Ga0496110_0464341_218_823 197
2338 3300048913 Ga0496110_0626743 Ga0496110_0626743_315_908 197
2339 3300048913 Ga0496110_0782164 Ga0496110_0782164_243_836 197
2340 3300048913 Ga0496110_0892603 Ga0496110_0892603_160_756 197
2341 3300048913 Ga0496110_0930238 Ga0496110_0930238_41_682 197
2342 3300048913 Ga0496110_1181641 Ga0496110_1181641_50_661 197
2343 3300048914 Ga0496111_0005039 Ga0496111_0005039_3279_3872 197
2344 3300048914 Ga0496111_0015799 Ga0496111_0015799_297_908 197
2345 3300048914 Ga0496111_0028064 Ga0496111_0028064_2826_3419 197
2346 3300048914 Ga0496111_0050581 Ga0496111_0050581_1360_2019 197
2347 3300048914 Ga0496111_0064217 Ga0496111_0064217_1089_1682 197
2348 3300048914 Ga0496111_0097433 Ga0496111_0097433_779_1372 197
2349 3300048914 Ga0496111_0144930 Ga0496111_0144930_352_957 197
2350 3300048914 Ga0496111_0271302 Ga0496111_0271302_635_1237 197
2351 3300048914 Ga0496111_0479594 Ga0496111_0479594_43_654 197
2352 3300048914 Ga0496111_0506336 Ga0496111_0506336_266_859 197
2353 3300048915 Ga0496112_0001718 Ga0496112_0001718_12075_12674 197
2354 3300048915 Ga0496112_0034180 Ga0496112_0034180_670_1269 197
2355 3300048915 Ga0496112_0058551 Ga0496112_0058551_37_639 197
2356 3300048915 Ga0496112_0064234 Ga0496112_0064234_587_1180 197
2357 3300048915 Ga0496112_0258951 Ga0496112_0258951_553_1164 197
2358 3300048915 Ga0496112_0353193 Ga0496112_0353193_259_852 197
2359 3300048915 Ga0496112_0981505 Ga0496112_0981505_89_682 197
2360 3300048916 Ga0496113_0020637 Ga0496113_0020637_3507_4118 197
2361 3300048916 Ga0496113_0047080 Ga0496113_0047080_185_778 197
2362 3300048916 Ga0496113_0071290 Ga0496113_0071290_1014_1613 197
2363 3300048916 Ga0496113_0073636 Ga0496113_0073636_1907_2500 197
2364 3300048916 Ga0496113_0078979 Ga0496113_0078979_508_1101 197
2365 3300048916 Ga0496113_0100999 Ga0496113_0100999_669_1262 197
2366 3300048916 Ga0496113_0128606 Ga0496113_0128606_587_1180 197
2367 3300048916 Ga0496113_0247229 Ga0496113_0247229_382_984 197
2368 3300048916 Ga0496113_0667037 Ga0496113_0667037_42_635 197
2369 3300048917 Ga0496114_0000108 Ga0496114_0000108_53240_53833 197
2370 3300048917 Ga0496114_0000136 Ga0496114_0000136_15969_16562 197
2371 3300048917 Ga0496114_0000166 Ga0496114_0000166_20159_20752 197
2372 3300048917 Ga0496114_0001030 Ga0496114_0001030_1026_1625 197
2373 3300048917 Ga0496114_0014522 Ga0496114_0014522_3143_3736 197
2374 3300048917 Ga0496114_0018358 Ga0496114_0018358_1967_2578 197
2375 3300048917 Ga0496114_0032826 Ga0496114_0032826_893_1486 197
2376 3300048917 Ga0496114_0043379 Ga0496114_0043379_1961_2554 197
2377 3300048917 Ga0496114_0045508 Ga0496114_0045508_198_809 197
2378 3300048917 Ga0496114_0100998 Ga0496114_0100998_1049_1648 197
2379 3300048917 Ga0496114_0102937 Ga0496114_0102937_1767_2360 197
2380 3300048917 Ga0496114_0142542 Ga0496114_0142542_1467_2060 197
2381 3300048917 Ga0496114_0154426 Ga0496114_0154426_1320_1925 197
2382 3300048917 Ga0496114_0173239 Ga0496114_0173239_35_628 197
2383 3300048917 Ga0496114_0184949 Ga0496114_0184949_459_1052 197
2384 3300048917 Ga0496114_0214340 Ga0496114_0214340_353_946 197
2385 3300048917 Ga0496114_0235784 Ga0496114_0235784_534_1127 197
2386 3300048917 Ga0496114_0587221 Ga0496114_0587221_189_782 197
2387 3300048917 Ga0496114_0965435 Ga0496114_0965435_128_724 197
2388 3300048918 Ga0496115_0000620 Ga0496115_0000620_4876_5469 197
2389 3300048918 Ga0496115_0002574 Ga0496115_0002574_7161_7754 197
2390 3300048918 Ga0496115_0008804 Ga0496115_0008804_1345_1956 197
2391 3300048918 Ga0496115_0093541 Ga0496115_0093541_1169_1762 197
2392 3300048918 Ga0496115_0141115 Ga0496115_0141115_952_1545 197
2393 3300048918 Ga0496115_0171042 Ga0496115_0171042_611_1207 197
2394 3300048918 Ga0496115_0520517 Ga0496115_0520517_176_787 197
2395 3300048918 Ga0496115_0551624 Ga0496115_0551624_263_856 197
2396 3300048919 Ga0496116_0010448 Ga0496116_0010448_2913_3506 197
2397 3300048919 Ga0496116_0047143 Ga0496116_0047143_2097_2690 197
2398 3300048920 Ga0496117_0000053 Ga0496117_0000053_85919_86515 197
2399 3300048920 Ga0496117_0000620 Ga0496117_0000620_22709_23305 197
2400 3300048920 Ga0496117_0001098 Ga0496117_0001098_9975_10571 197
2401 3300048920 Ga0496117_0001267 Ga0496117_0001267_35190_35783 197
2402 3300048920 Ga0496117_0002166 Ga0496117_0002166_7124_7735 197
2403 3300048920 Ga0496117_0007100 Ga0496117_0007100_9609_10205 197
2404 3300048920 Ga0496117_0021611 Ga0496117_0021611_1740_2336 197
2405 3300048920 Ga0496117_0039735 Ga0496117_0039735_2207_2803 197
2406 3300048920 Ga0496117_0061874 Ga0496117_0061874_102_695 197
2407 3300048920 Ga0496117_0091566 Ga0496117_0091566_38_637 197
2408 3300048920 Ga0496117_0203684 Ga0496117_0203684_74_670 197
2409 3300048921 Ga0496118_0000292 Ga0496118_0000292_50050_50646 197
2410 3300048921 Ga0496118_0000909 Ga0496118_0000909_16185_16781 197
2411 3300048921 Ga0496118_0004368 Ga0496118_0004368_11853_12446 197
2412 3300048921 Ga0496118_0007965 Ga0496118_0007965_9479_10072 197
2413 3300048921 Ga0496118_0012368 Ga0496118_0012368_3686_4285 197
2414 3300048921 Ga0496118_0024300 Ga0496118_0024300_1988_2653 197
2415 3300048921 Ga0496118_0025277 Ga0496118_0025277_2366_2962 197
2416 3300048921 Ga0496118_0027693 Ga0496118_0027693_750_1346 197
2417 3300048921 Ga0496118_0047637 Ga0496118_0047637_2401_3069 197
2418 3300048921 Ga0496118_0078705 Ga0496118_0078705_348_986 197
2419 3300048921 Ga0496118_0294754 Ga0496118_0294754_285_881 197
2420 3300048921 Ga0496118_0324889 Ga0496118_0324889_28_624 197
2421 3300048922 Ga0496119_0001862 Ga0496119_0001862_15169_15762 197
2422 3300048922 Ga0496119_0005568 Ga0496119_0005568_6134_6730 197
2423 3300048922 Ga0496119_0006144 Ga0496119_0006144_7307_7918 197
2424 3300048922 Ga0496119_0030536 Ga0496119_0030536_1007_1600 197
2425 3300048922 Ga0496119_0102929 Ga0496119_0102929_965_1558 197
2426 3300048922 Ga0496119_0196059 Ga0496119_0196059_316_912 197
2427 3300048922 Ga0496119_0362176 Ga0496119_0362176_39_635 197
2428 3300048923 Ga0496120_0003934 Ga0496120_0003934_2605_3198 197
2429 3300048923 Ga0496120_0004461 Ga0496120_0004461_9584_10180 197
2430 3300048923 Ga0496120_0011223 Ga0496120_0011223_1234_1830 197
2431 3300048923 Ga0496120_0027465 Ga0496120_0027465_2288_2881 197
2432 3300048923 Ga0496120_0046757 Ga0496120_0046757_1817_2455 197
2433 3300048923 Ga0496120_0069299 Ga0496120_0069299_366_977 197
2434 3300048924 Ga0496121_0000023 Ga0496121_0000023_338466_339059 197
2435 3300048924 Ga0496121_0000025 Ga0496121_0000025_64253_64849 197
2436 3300048924 Ga0496121_0004517 Ga0496121_0004517_5687_6280 197
2437 3300048924 Ga0496121_0203788 Ga0496121_0203788_63_665 197
2438 3300048925 Ga0496122_0000164 Ga0496122_0000164_42803_43396 197
2439 3300048925 Ga0496122_0000194 Ga0496122_0000194_7393_8004 197
2440 3300048925 Ga0496122_0000534 Ga0496122_0000534_67_735 197
2441 3300048925 Ga0496122_0002890 Ga0496122_0002890_2384_3049 197
2442 3300048925 Ga0496122_0004113 Ga0496122_0004113_6158_6754 197
2443 3300048925 Ga0496122_0004115 Ga0496122_0004115_6022_6618 197
2444 3300048925 Ga0496122_0055191 Ga0496122_0055191_588_1181 197
2445 3300048925 Ga0496122_0066191 Ga0496122_0066191_1555_2151 197
2446 3300048925 Ga0496122_0107778 Ga0496122_0107778_22_618 197
2447 3300048925 Ga0496122_0152973 Ga0496122_0152973_777_1370 197
2448 3300048925 Ga0496122_0259958 Ga0496122_0259958_155_751 197
2449 3300048926 Ga0496123_0000350 Ga0496123_0000350_7380_7991 197
2450 3300048926 Ga0496123_0000405 Ga0496123_0000405_17062_17727 197
2451 3300048926 Ga0496123_0006609 Ga0496123_0006609_6684_7277 197
2452 3300048926 Ga0496123_0012134 Ga0496123_0012134_2446_3039 197
2453 3300048926 Ga0496123_0019951 Ga0496123_0019951_2044_2640 197
2454 3300048926 Ga0496123_0073328 Ga0496123_0073328_452_1048 197
2455 3300048926 Ga0496123_0164456 Ga0496123_0164456_191_787 197
2456 3300048926 Ga0496123_0188128 Ga0496123_0188128_413_1021 197
2457 3300048926 Ga0496123_0209463 Ga0496123_0209463_69_665 197
2458 3300048927 Ga0496124_0000014 Ga0496124_0000014_338466_339059 197
2459 3300048927 Ga0496124_0000639 Ga0496124_0000639_185_781 197
2460 3300048927 Ga0496124_0001934 Ga0496124_0001934_26874_27539 197
2461 3300048927 Ga0496124_0008009 Ga0496124_0008009_7235_7846 197
2462 3300048927 Ga0496124_0008422 Ga0496124_0008422_7039_7635 197
2463 3300048927 Ga0496124_0039796 Ga0496124_0039796_185_781 197
2464 3300048927 Ga0496124_0101982 Ga0496124_0101982_1186_1782 197
2465 3300048927 Ga0496124_0202138 Ga0496124_0202138_690_1349 197
2466 3300048928 Ga0496125_0000020 Ga0496125_0000020_124390_124983 197
2467 3300048928 Ga0496125_0000077 Ga0496125_0000077_68223_68819 197
2468 3300048928 Ga0496125_0000214 Ga0496125_0000214_20611_21279 197
2469 3300048928 Ga0496125_0002783 Ga0496125_0002783_12703_13368 197
2470 3300048928 Ga0496125_0008936 Ga0496125_0008936_8887_9483 197
2471 3300048928 Ga0496125_0018219 Ga0496125_0018219_5106_5702 197
2472 3300048928 Ga0496125_0036927 Ga0496125_0036927_824_1420 197
2473 3300048928 Ga0496125_0038013 Ga0496125_0038013_845_1456 197
2474 3300048928 Ga0496125_0048465 Ga0496125_0048465_517_1113 197
2475 3300048928 Ga0496125_0071585 Ga0496125_0071585_2024_2620 197
2476 3300048928 Ga0496125_0156675 Ga0496125_0156675_186_779 197
2477 3300048928 Ga0496125_0193599 Ga0496125_0193599_124_726 197
2478 3300048928 Ga0496125_0246893 Ga0496125_0246893_364_960 197
2479 3300048929 Ga0496126_0000023 Ga0496126_0000023_338466_339059 197
2480 3300048929 Ga0496126_0001990 Ga0496126_0001990_730_1323 197
2481 3300048929 Ga0496126_0002423 Ga0496126_0002423_2761_3357 197
2482 3300048929 Ga0496126_0002459 Ga0496126_0002459_13612_14205 197
2483 3300048929 Ga0496126_0006797 Ga0496126_0006797_10364_10960 197
2484 3300048929 Ga0496126_0050007 Ga0496126_0050007_2167_2763 197
2485 3300048929 Ga0496126_0062614 Ga0496126_0062614_955_1590 197
2486 3300048929 Ga0496126_0068432 Ga0496126_0068432_1370_2035 197
2487 3300048929 Ga0496126_0078199 Ga0496126_0078199_1871_2467 197
2488 3300048929 Ga0496126_0114972 Ga0496126_0114972_676_1272 197
2489 3300048929 Ga0496126_0121367 Ga0496126_0121367_909_1505 197
2490 3300048929 Ga0496126_0268555 Ga0496126_0268555_590_1198 197
2491 3300048929 Ga0496126_0450459 Ga0496126_0450459_329_925 197
2492 3300049568 Ga0501031_0023629 Ga0501031_0023629_1058_1651 197
2493 3300049568 Ga0501031_0201152 Ga0501031_0201152_371_967 197
2494 3300049568 Ga0501031_0320430 Ga0501031_0320430_80_673 197
2495 3300049569 Ga0501032_0001739 Ga0501032_0001739_2927_3526 197
2496 3300049569 Ga0501032_0006541 Ga0501032_0006541_1131_1733 197
2497 3300049569 Ga0501032_0008985 Ga0501032_0008985_5456_6049 197
2498 3300049569 Ga0501032_0023382 Ga0501032_0023382_2100_2702 197
2499 3300049569 Ga0501032_0037404 Ga0501032_0037404_877_1473 197
2500 3300049569 Ga0501032_0115113 Ga0501032_0115113_341_937 197
2501 3300049569 Ga0501032_0217077 Ga0501032_0217077_192_863 197
2502 3300049570 Ga0501033_0007861 Ga0501033_0007861_759_1352 197
2503 3300049570 Ga0501033_0205054 Ga0501033_0205054_53_655 197
2504 3300049570 Ga0501033_0212357 Ga0501033_0212357_322_993 197
2505 3300049571 Ga0501034_0000123 Ga0501034_0000123_48710_49309 197
2506 3300049571 Ga0501034_0006051 Ga0501034_0006051_2412_3014 197
2507 3300049571 Ga0501034_0009822 Ga0501034_0009822_4572_5210 197
2508 3300049571 Ga0501034_0011109 Ga0501034_0011109_120_713 197
2509 3300049571 Ga0501034_0024319 Ga0501034_0024319_5080_5718 197
2510 3300049571 Ga0501034_0064237 Ga0501034_0064237_2068_2688 197
2511 3300049571 Ga0501034_0074634 Ga0501034_0074634_336_929 197
2512 3300049571 Ga0501034_0097073 Ga0501034_0097073_354_992 197
2513 3300049571 Ga0501034_0155749 Ga0501034_0155749_445_1044 197
2514 3300049571 Ga0501034_0160200 Ga0501034_0160200_664_1302 197
2515 3300049571 Ga0501034_0186543 Ga0501034_0186543_216_854 197
2516 3300049571 Ga0501034_0405360 Ga0501034_0405360_569_1162 197
2517 3300049571 Ga0501034_0502382 Ga0501034_0502382_464_1102 197
2518 3300049571 Ga0501034_0575650 Ga0501034_0575650_20_691 197
2519 3300049572 Ga0501036_0008345 Ga0501036_0008345_5462_6055 197
2520 3300049572 Ga0501036_0016634 Ga0501036_0016634_2535_3128 197
2521 3300049572 Ga0501036_0044342 Ga0501036_0044342_3023_3625 197
2522 3300049572 Ga0501036_0124413 Ga0501036_0124413_325_963 197
2523 3300049572 Ga0501036_0210665 Ga0501036_0210665_662_1333 197
2524 3300049572 Ga0501036_0295530 Ga0501036_0295530_462_1067 197
2525 3300049572 Ga0501036_0351722 Ga0501036_0351722_624_1220 197
2526 3300049573 Ga0501037_0000584 Ga0501037_0000584_22102_22695 197
2527 3300049573 Ga0501037_0000863 Ga0501037_0000863_2440_3042 197
2528 3300049573 Ga0501037_0001957 Ga0501037_0001957_10581_11180 197
2529 3300049573 Ga0501037_0003783 Ga0501037_0003783_842_1444 197
2530 3300049573 Ga0501037_0099864 Ga0501037_0099864_653_1246 197
2531 3300049574 Ga0501038_0001295 Ga0501038_0001295_11665_12336 197
2532 3300049574 Ga0501038_0003008 Ga0501038_0003008_8636_9229 197
2533 3300049574 Ga0501038_0035852 Ga0501038_0035852_279_872 197
2534 3300049574 Ga0501038_0055449 Ga0501038_0055449_1718_2338 197
2535 3300049574 Ga0501038_0219033 Ga0501038_0219033_410_1006 197
2536 3300049574 Ga0501038_0260863 Ga0501038_0260863_355_951 197
2537 3300049574 Ga0501038_0307987 Ga0501038_0307987_163_765 197
2538 3300049574 Ga0501038_0308723 Ga0501038_0308723_313_909 197
2539 3300049574 Ga0501038_0344258 Ga0501038_0344258_37_633 197
2540 3300049575 Ga0501039_0002202 Ga0501039_0002202_7214_7807 197
2541 3300049575 Ga0501039_0006630 Ga0501039_0006630_5309_5902 197
2542 3300049575 Ga0501039_0158205 Ga0501039_0158205_1030_1626 197
2543 3300049575 Ga0501039_0189118 Ga0501039_0189118_439_1035 197
2544 3300049575 Ga0501039_0541273 Ga0501039_0541273_253_846 197
2545 3300049576 Ga0501040_0001421 Ga0501040_0001421_10219_10812 197
2546 3300049577 Ga0501041_0002741 Ga0501041_0002741_7157_7750 197
2547 3300049577 Ga0501041_0172438 Ga0501041_0172438_261_866 197
2548 3300049577 Ga0501041_0258045 Ga0501041_0258045_308_901 197
2549 3300049578 Ga0501042_0002414 Ga0501042_0002414_6322_6921 197
2550 3300049578 Ga0501042_0038481 Ga0501042_0038481_954_1547 197
2551 3300049579 Ga0501043_0001037 Ga0501043_0001037_9159_9752 197
2552 3300049579 Ga0501043_0043512 Ga0501043_0043512_1004_1606 197
2553 3300049579 Ga0501043_0083344 Ga0501043_0083344_467_1138 197
2554 3300049579 Ga0501043_0088651 Ga0501043_0088651_961_1563 197
2555 3300049579 Ga0501043_0103315 Ga0501043_0103315_958_1560 197
2556 3300049579 Ga0501043_0175548 Ga0501043_0175548_169_762 197
2557 3300049579 Ga0501043_0188970 Ga0501043_0188970_660_1256 197
2558 3300049580 Ga0501046_0001804 Ga0501046_0001804_16871_17473 197
2559 3300049580 Ga0501046_0004159 Ga0501046_0004159_11496_12167 197
2560 3300049580 Ga0501046_0034241 Ga0501046_0034241_975_1568 197
2561 3300049581 Ga0501047_0000372 Ga0501047_0000372_9383_9985 197
2562 3300049581 Ga0501047_0072206 Ga0501047_0072206_565_1203 197
2563 3300049581 Ga0501047_0218046 Ga0501047_0218046_792_1463 197
2564 3300049581 Ga0501047_0448173 Ga0501047_0448173_119_715 197
2565 3300049581 Ga0501047_0500029 Ga0501047_0500029_244_840 197
2566 3300049581 Ga0501047_0887076 Ga0501047_0887076_27_623 197
2567 3300049582 Ga0501048_0006426 Ga0501048_0006426_7468_8061 197
2568 3300049582 Ga0501048_0031651 Ga0501048_0031651_17_619 197
2569 3300049582 Ga0501048_0423061 Ga0501048_0423061_308_913 197
2570 3300049582 Ga0501048_0451943 Ga0501048_0451943_234_827 197
2571 3300049582 Ga0501048_0501404 Ga0501048_0501404_177_776 197
2572 3300049583 Ga0501067_0026865 Ga0501067_0026865_796_1389 197
2573 3300049583 Ga0501067_0039898 Ga0501067_0039898_682_1287 197
2574 3300049583 Ga0501067_0266973 Ga0501067_0266973_76_672 197
2575 3300049584 Ga0501068_0175554 Ga0501068_0175554_739_1332 197
2576 3300049584 Ga0501068_0279588 Ga0501068_0279588_450_1052 197
2577 3300049585 Ga0501069_0162548 Ga0501069_0162548_145_738 197
2578 3300049585 Ga0501069_0243697 Ga0501069_0243697_267_872 197
2579 3300049585 Ga0501069_0408044 Ga0501069_0408044_143_739 197
2580 3300049585 Ga0501069_0512667 Ga0501069_0512667_80_682 197
2581 3300049586 Ga0501070_0000578 Ga0501070_0000578_12381_12974 197
2582 3300049586 Ga0501070_0002976 Ga0501070_0002976_6000_6602 197
2583 3300049586 Ga0501070_0007031 Ga0501070_0007031_3376_3972 197
2584 3300049586 Ga0501070_0042424 Ga0501070_0042424_2206_2811 197
2585 3300049586 Ga0501070_0104461 Ga0501070_0104461_1269_1874 197
2586 3300049586 Ga0501070_0121929 Ga0501070_0121929_593_1195 197
2587 3300049586 Ga0501070_0135715 Ga0501070_0135715_474_1070 197
2588 3300049586 Ga0501070_0176220 Ga0501070_0176220_852_1457 197
2589 3300049586 Ga0501070_0219133 Ga0501070_0219133_568_1164 197
2590 3300049586 Ga0501070_0463296 Ga0501070_0463296_204_797 197
2591 3300049586 Ga0501070_0502008 Ga0501070_0502008_288_881 197
2592 3300049587 Ga0501071_0012396 Ga0501071_0012396_2637_3230 197
2593 3300049587 Ga0501071_0309434 Ga0501071_0309434_291_884 197
2594 3300049587 Ga0501071_0597066 Ga0501071_0597066_220_819 197
2595 3300049588 Ga0501072_0018778 Ga0501072_0018778_1079_1672 197
2596 3300049588 Ga0501072_0504029 Ga0501072_0504029_27_632 197
2597 3300049589 Ga0501073_0024898 Ga0501073_0024898_3010_3603 197
2598 3300049589 Ga0501073_0025377 Ga0501073_0025377_1402_1995 197
2599 3300049590 Ga0501074_0046409 Ga0501074_0046409_216_809 197
2600 3300049590 Ga0501074_0748344 Ga0501074_0748344_55_660 197
2601 3300049591 Ga0501075_0011867 Ga0501075_0011867_5264_5857 197
2602 3300049592 Ga0501076_0002548 Ga0501076_0002548_6844_7437 197
2603 3300049593 Ga0501077_0366284 Ga0501077_0366284_23_622 197
2604 3300049741 Ga0501079_0018890 Ga0501079_0018890_100_726 197
2605 3300049741 Ga0501079_0041473 Ga0501079_0041473_391_984 197
2606 3300049742 Ga0501080_0012890 Ga0501080_0012890_4476_5069 197
2607 3300049742 Ga0501080_0042237 Ga0501080_0042237_2503_3096 197
2608 3300049742 Ga0501080_0316759 Ga0501080_0316759_192_785 197
2609 3300049742 Ga0501080_0386269 Ga0501080_0386269_509_1108 197
2610 3300049743 Ga0501081_0013024 Ga0501081_0013024_1216_1809 197
2611 3300049744 Ga0501083_0000067 Ga0501083_0000067_24175_24774 197
2612 3300049744 Ga0501083_0010779 Ga0501083_0010779_5522_6193 197
2613 3300049744 Ga0501083_0170418 Ga0501083_0170418_56_658 197
2614 3300049775 Ga0501279_026464 Ga0501279_026464_28_630 197
2615 3300049822 Ga0501035_0001032 Ga0501035_0001032_19119_19721 197
2616 3300049822 Ga0501035_0164072 Ga0501035_0164072_367_1038 197
2617 3300049822 Ga0501035_0258428 Ga0501035_0258428_640_1278 197
2618 3300049822 Ga0501035_0449609 Ga0501035_0449609_151_747 197
2619 3300049823 Ga0501044_0002753 Ga0501044_0002753_18087_18758 197
2620 3300049823 Ga0501044_0005774 Ga0501044_0005774_9294_9932 197
2621 3300049823 Ga0501044_0006896 Ga0501044_0006896_9436_10029 197
2622 3300049823 Ga0501044_0021507 Ga0501044_0021507_6102_6704 197
2623 3300049823 Ga0501044_0077661 Ga0501044_0077661_2616_3218 197
2624 3300049824 Ga0501045_0007703 Ga0501045_0007703_2536_3129 197
2625 3300049824 Ga0501045_0031087 Ga0501045_0031087_2447_3127 197
2626 3300049824 Ga0501045_0032455 Ga0501045_0032455_468_1061 197
2627 3300049824 Ga0501045_0239387 Ga0501045_0239387_266_865 197
2628 3300049824 Ga0501045_0514996 Ga0501045_0514996_267_860 197
2629 3300049824 Ga0501045_0537658 Ga0501045_0537658_207_812 197
2630 3300050489 nmdc:mga03683_78144_c2 nmdc:mga03683_78144_c2_106_702 197
2631 3300050490 nmdc:mga03n38_155353_c1 nmdc:mga03n38_155353_c1_168_761 197
2632 3300050490 nmdc:mga03n38_3325_c1 nmdc:mga03n38_3325_c1_1882_2475 197
2633 3300050490 nmdc:mga03n38_40244_c1 nmdc:mga03n38_40244_c1_1061_1669 197
2634 3300050490 nmdc:mga03n38_4165_c1 nmdc:mga03n38_4165_c1_1699_2304 197
2635 3300050490 nmdc:mga03n38_48912_c1 nmdc:mga03n38_48912_c1_563_1171 197
2636 3300050490 nmdc:mga03n38_5871_c1 nmdc:mga03n38_5871_c1_1968_2567 197
2637 3300050490 nmdc:mga03n38_5961_c1 nmdc:mga03n38_5961_c1_1666_2259 197
2638 3300050491 nmdc:mga00v17_105494_c1 nmdc:mga00v17_105494_c1_388_996 197
2639 3300050491 nmdc:mga00v17_10925_c1 nmdc:mga00v17_10925_c1_2429_3040 197
2640 3300050491 nmdc:mga00v17_147943_c1 nmdc:mga00v17_147943_c1_668_1261 197
2641 3300050491 nmdc:mga00v17_1649_c1 nmdc:mga00v17_1649_c1_1776_2369 197
2642 3300050491 nmdc:mga00v17_184521_c1 nmdc:mga00v17_184521_c1_611_1213 197
2643 3300050491 nmdc:mga00v17_194398_c1 nmdc:mga00v17_194398_c1_606_1214 197
2644 3300050491 nmdc:mga00v17_23924_c1 nmdc:mga00v17_23924_c1_1061_1657 197
2645 3300050491 nmdc:mga00v17_26916_c1 nmdc:mga00v17_26916_c1_505_1098 197
2646 3300050491 nmdc:mga00v17_2863_c1 nmdc:mga00v17_2863_c1_1585_2202 197
2647 3300050491 nmdc:mga00v17_306279_c1 nmdc:mga00v17_306279_c1_378_971 197
2648 3300050491 nmdc:mga00v17_309681_c1 nmdc:mga00v17_309681_c1_49_657 197
2649 3300050491 nmdc:mga00v17_38431_c1 nmdc:mga00v17_38431_c1_1009_1602 197
2650 3300050491 nmdc:mga00v17_44519_c1 nmdc:mga00v17_44519_c1_1088_1681 197
2651 3300050491 nmdc:mga00v17_4701_c1 nmdc:mga00v17_4701_c1_4444_5037 197
2652 3300050491 nmdc:mga00v17_4704_c1 nmdc:mga00v17_4704_c1_5577_6170 197
2653 3300050491 nmdc:mga00v17_493121_c1 nmdc:mga00v17_493121_c1_83_676 197
2654 3300050491 nmdc:mga00v17_56226_c1 nmdc:mga00v17_56226_c1_1616_2221 197
2655 3300050491 nmdc:mga00v17_61808_c1 nmdc:mga00v17_61808_c1_53_649 197
2656 3300050491 nmdc:mga00v17_6620_c1 nmdc:mga00v17_6620_c1_3589_4185 197
2657 3300050491 nmdc:mga00v17_90848_c1 nmdc:mga00v17_90848_c1_205_798 197
2658 3300050491 nmdc:mga00v17_9487_c1 nmdc:mga00v17_9487_c1_1620_2216 197
2659 3300050492 nmdc:mga0yw44_104012_c1 nmdc:mga0yw44_104012_c1_780_1388 197
2660 3300050492 nmdc:mga0yw44_173240_c1 nmdc:mga0yw44_173240_c1_518_1111 197
2661 3300050492 nmdc:mga0yw44_17768_c1 nmdc:mga0yw44_17768_c1_2506_3099 197
2662 3300050492 nmdc:mga0yw44_196104_c1 nmdc:mga0yw44_196104_c1_704_1312 197
2663 3300050492 nmdc:mga0yw44_20184_c1 nmdc:mga0yw44_20184_c1_937_1530 197
2664 3300050492 nmdc:mga0yw44_25618_c1 nmdc:mga0yw44_25618_c1_600_1196 197
2665 3300050492 nmdc:mga0yw44_258483_c1 nmdc:mga0yw44_258483_c1_452_1045 197
2666 3300050492 nmdc:mga0yw44_2653_c1 nmdc:mga0yw44_2653_c1_1496_2101 197
2667 3300050492 nmdc:mga0yw44_31744_c1 nmdc:mga0yw44_31744_c1_2144_2755 197
2668 3300050492 nmdc:mga0yw44_426897_c1 nmdc:mga0yw44_426897_c1_69_674 197
2669 3300050492 nmdc:mga0yw44_430491_c1 nmdc:mga0yw44_430491_c1_231_839 197
2670 3300050492 nmdc:mga0yw44_44847_c1 nmdc:mga0yw44_44847_c1_685_1278 197
2671 3300050492 nmdc:mga0yw44_55786_c1 nmdc:mga0yw44_55786_c1_1497_2093 197
2672 3300050492 nmdc:mga0yw44_668238_c1 nmdc:mga0yw44_668238_c1_63_656 197
2673 3300050492 nmdc:mga0yw44_69425_c1 nmdc:mga0yw44_69425_c1_280_885 197
2674 3300050493 nmdc:mga0k408_532670_c1 nmdc:mga0k408_532670_c1_45_638 197
2675 3300050494 nmdc:mga06z11_133444_c1 nmdc:mga06z11_133444_c1_142_750 197
2676 3300050494 nmdc:mga06z11_229146_c1 nmdc:mga06z11_229146_c1_398_1006 197
2677 3300050494 nmdc:mga06z11_242736_c1 nmdc:mga06z11_242736_c1_12_617 197
2678 3300050494 nmdc:mga06z11_24338_c1 nmdc:mga06z11_24338_c1_97_690 197
2679 3300050494 nmdc:mga06z11_38404_c1 nmdc:mga06z11_38404_c1_851_1456 197
2680 3300050494 nmdc:mga06z11_42962_c1 nmdc:mga06z11_42962_c1_976_1569 197
2681 3300050494 nmdc:mga06z11_430419_c1 nmdc:mga06z11_430419_c1_187_780 197
2682 3300050494 nmdc:mga06z11_9271_c1 nmdc:mga06z11_9271_c1_2233_2826 197
2683 3300050495 nmdc:mga04h51_12279_c1 nmdc:mga04h51_12279_c1_446_1051 197
2684 3300050495 nmdc:mga04h51_9531_c1 nmdc:mga04h51_9531_c1_684_1292 197
2685 3300050496 nmdc:mga07m45_104888_c1 nmdc:mga07m45_104888_c1_520_1119 197
2686 3300050496 nmdc:mga07m45_10919_c1 nmdc:mga07m45_10919_c1_3672_4268 197
2687 3300050496 nmdc:mga07m45_15975_c1 nmdc:mga07m45_15975_c1_2834_3430 197
2688 3300050496 nmdc:mga07m45_170758_c1 nmdc:mga07m45_170758_c1_104_697 197
2689 3300050496 nmdc:mga07m45_17140_c1 nmdc:mga07m45_17140_c1_775_1368 197
2690 3300050496 nmdc:mga07m45_202120_c1 nmdc:mga07m45_202120_c1_132_728 197
2691 3300050496 nmdc:mga07m45_258990_c1 nmdc:mga07m45_258990_c1_180_791 197
2692 3300050496 nmdc:mga07m45_35551_c1 nmdc:mga07m45_35551_c1_1169_1762 197
2693 3300050496 nmdc:mga07m45_43434_c1 nmdc:mga07m45_43434_c1_1263_1871 197
2694 3300050496 nmdc:mga07m45_47019_c1 nmdc:mga07m45_47019_c1_1544_2137 197
2695 3300050496 nmdc:mga07m45_5220_c1 nmdc:mga07m45_5220_c1_2178_2771 197
2696 3300050510 nmdc:mga06r32_243069_c1 nmdc:mga06r32_243069_c1_1109_1702 197
2697 3300050511 nmdc:mga08y16_450569_c1 nmdc:mga08y16_450569_c1_377_970 197
2698 3300050516 nmdc:mga0sz30_12553_c1 nmdc:mga0sz30_12553_c1_959_1552 197
2699 3300050516 nmdc:mga0sz30_17694_c1 nmdc:mga0sz30_17694_c1_218_811 197
2700 3300050516 nmdc:mga0sz30_216499_c1 nmdc:mga0sz30_216499_c1_58_651 197
2701 3300050516 nmdc:mga0sz30_235498_c1 nmdc:mga0sz30_235498_c1_192_785 197
2702 3300050516 nmdc:mga0sz30_26662_c1 nmdc:mga0sz30_26662_c1_604_1215 197
2703 3300050516 nmdc:mga0sz30_36115_c1 nmdc:mga0sz30_36115_c1_944_1537 197
2704 3300050516 nmdc:mga0sz30_69261_c1 nmdc:mga0sz30_69261_c1_380_976 197
2705 3300050516 nmdc:mga0sz30_83139_c1 nmdc:mga0sz30_83139_c1_573_1166 197
2706 3300050516 nmdc:mga0sz30_9473_c1 nmdc:mga0sz30_9473_c1_1793_2386 197
2707 3300050516 nmdc:mga0sz30_9626_c1 nmdc:mga0sz30_9626_c1_3067_3660 197
2708 3300053079 Ga0500610_0099170 Ga0500610_0099170_110_703 197
2709 3300053080 Ga0500635_0000023 Ga0500635_0000023_15670_16269 197
2710 3300053080 Ga0500635_0000695 Ga0500635_0000695_176_772 197
2711 3300053080 Ga0500635_0008873 Ga0500635_0008873_1349_1945 197
2712 3300053083 Ga0495655_0001030 Ga0495655_0001030_584_1183 197
2713 3300053084 Ga0495595_0013782 Ga0495595_0013782_2098_2739 197
2714 3300053085 Ga0495619_0089017 Ga0495619_0089017_799_1398 197
2715 3300053085 Ga0495619_0376405 Ga0495619_0376405_31_666 197
2716 3300053085 Ga0495619_0553587 Ga0495619_0553587_76_669 197
2717 3300053086 Ga0500578_0278165 Ga0500578_0278165_178_774 197
2718 3300053087 Ga0500643_025929 Ga0500643_025929_779_1375 197
2719 3300053088 Ga0500644_0000106 Ga0500644_0000106_29655_30260 197
2720 3300053088 Ga0500644_0008183 Ga0500644_0008183_1551_2150 197
2721 3300053088 Ga0500644_0020802 Ga0500644_0020802_423_1031 197
2722 3300053088 Ga0500644_0215917 Ga0500644_0215917_140_748 197
2723 3300053090 Ga0500646_0136095 Ga0500646_0136095_76_669 197
2724 3300053098 Ga0500650_0017487 Ga0500650_0017487_1870_2466 197
2725 3300053104 Ga0500556_0000001 Ga0500556_0000001_835868_836464 197
2726 3300053104 Ga0500556_0001233 Ga0500556_0001233_7717_8325 197
2727 3300053104 Ga0500556_0003014 Ga0500556_0003014_894_1487 197
2728 3300053117 Ga0500593_000080 Ga0500593_000080_27420_28028 197
2729 3300053122 Ga0500608_156891 Ga0500608_156891_298_894 197
2730 3300053129 Ga0500628_057558 Ga0500628_057558_315_911 197
2731 3300053130 Ga0500642_0105745 Ga0500642_0105745_198_794 197
2732 3300053130 Ga0500642_0250087 Ga0500642_0250087_43_639 197
2733 3300053131 Ga0500652_000535 Ga0500652_000535_11610_12206 197
2734 3300053131 Ga0500652_044975 Ga0500652_044975_466_1062 197
2735 3300053133 Ga0500655_010128 Ga0500655_010128_660_1259 197
2736 3300053134 Ga0500658_0112817 Ga0500658_0112817_544_1140 197
2737 3300053136 Ga0500559_0000043 Ga0500559_0000043_23003_23605 197
2738 3300053136 Ga0500559_0000183 Ga0500559_0000183_44621_45298 197
2739 3300053136 Ga0500559_0054388 Ga0500559_0054388_748_1344 197
2740 3300053136 Ga0500559_0182057 Ga0500559_0182057_317_913 197
2741 3300053136 Ga0500559_0248858 Ga0500559_0248858_214_816 197
2742 3300053139 Ga0500568_0000003 Ga0500568_0000003_787461_788057 197
2743 3300053139 Ga0500568_0003139 Ga0500568_0003139_4200_4796 197
2744 3300053139 Ga0500568_0062693 Ga0500568_0062693_287_883 197
2745 3300053140 Ga0500573_0000303 Ga0500573_0000303_7508_8116 197
2746 3300053140 Ga0500573_0003200 Ga0500573_0003200_1238_1849 197
2747 3300053140 Ga0500573_0069636 Ga0500573_0069636_875_1471 197
2748 3300053142 Ga0500577_0011231 Ga0500577_0011231_429_1025 197
2749 3300053142 Ga0500577_0036766 Ga0500577_0036766_840_1439 197
2750 3300053142 Ga0500577_0139630 Ga0500577_0139630_376_978 197
2751 3300053142 Ga0500577_0242403 Ga0500577_0242403_156_752 197
2752 3300053151 Ga0500604_0033889 Ga0500604_0033889_705_1301 197
2753 3300053153 Ga0500616_0000241 Ga0500616_0000241_67997_68593 197
2754 3300053153 Ga0500616_0001099 Ga0500616_0001099_13901_14497 197
2755 3300053153 Ga0500616_0002314 Ga0500616_0002314_13249_13845 197
2756 3300053158 Ga0500627_0019907 Ga0500627_0019907_1212_1808 197
2757 3300053730 Ga0500645_000075 Ga0500645_000075_44209_44805 197
2758 3300053730 Ga0500645_002289 Ga0500645_002289_8059_8655 197
2759 3300054114 Ga0501084_0004449 Ga0501084_0004449_8760_9353 197
2760 3300054114 Ga0501084_0571929 Ga0501084_0571929_235_906 197
2761 3300059421 Ga0590071_040775 Ga0590071_040775_101_700 197
2762 3300059477 Ga0587084_001185 Ga0587084_001185_1255_1875 197
2763 3300059505 Ga0587083_0043316 Ga0587083_0043316_147_740 197
2764 3300059508 Ga0587088_065670 Ga0587088_065670_67_666 197
2765 3300059510 Ga0587090_000021 Ga0587090_000021_1567_2169 197
2766 3300059607 Ga0587125_005233 Ga0587125_005233_447_1049 197
2767 3300059623 Ga0587101_031036 Ga0587101_031036_85_678 197
2768 3300059626 Ga0587115_017161 Ga0587115_017161_182_802 197
2769 3300059630 Ga0587128_001669 Ga0587128_001669_1465_2067 197
2770 3300059641 Ga0587068_041708 Ga0587068_041708_69_662 197
2771 3300059645 Ga0587076_046213 Ga0587076_046213_133_741 197
2772 3300059648 Ga0587100_001309 Ga0587100_001309_145_747 197
2773 3300060353 Ga0501082_0114960 Ga0501082_0114960_777_1370 197
2774 3300060353 Ga0501082_0135524 Ga0501082_0135524_570_1241 197
2775 3300060353 Ga0501082_0591084 Ga0501082_0591084_115_753 197
2776 3300061719 Ga0466962_0005853 Ga0466962_0005853_916_1509 197
2777 3300061719 Ga0466962_0032314 Ga0466962_0032314_145_741 197
2778 3300061719 Ga0466962_0099518 Ga0466962_0099518_727_1323 197
2779 3300061719 Ga0466962_0116559 Ga0466962_0116559_615_1211 197
2780 3300061719 Ga0466962_0216866 Ga0466962_0216866_155_763 197
2781 3300061719 Ga0466962_0317556 Ga0466962_0317556_133_741 197
2782 3300061734 Ga0530510_0002178 Ga0530510_0002178_7739_8332 197
2783 3300061734 Ga0530510_0105234 Ga0530510_0105234_405_998 197
2784 3300061734 Ga0530510_0680317 Ga0530510_0680317_103_696 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

1

118

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9937 1 168
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9878 1 168
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9731 4 155
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9668 4 155
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9585 1 169
ID Description Score Start End Superfamily
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9937 1 168 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9878 1 168 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.957 3 171 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9512 1 169 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9229 2 168 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A7G3D6B9-F1-model_v4 deleted 1.002 1 147
AF-X7Z4V8-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 1 13 132 GO:0003861
GO:0009098
GO:0009316
AF-A0A6I3DV29-F1-model_v4 deleted 0.9986 1 138
AF-A0A7K2L3S6-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9959 1 126 GO:0003861
GO:0009098
GO:0009316
AF-A0A7G3D6B9-F1-model_v4 deleted 0.9952 1 147

Feature Viewer

pLDDT pTM Quality
95.23 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map