F496933

General Info

Members Datasets Scaffolds Average Seq Length
2586 490 2578 109

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_11364608|Ga0307405_113646082
Length 122
Sequence MKLIKCIIRPNKVDEVKDALAKLNIAGMTVTEVRGHGKQKGHTAIYRGKEYNVSLLPKMEVEVVVADNMVDDVVKAVVQAARTGEIGDGRVFVYPVEESIRIRTGEFGEDSVRHEEPVGWGH

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
138 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
139 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
140 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
241 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
242 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
243 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
250 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
265 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
266 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
298 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
301 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
302 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
303 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
304 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
305 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
306 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
307 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
308 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
309 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
310 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
311 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
312 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
313 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
314 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
315 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
316 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
317 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
318 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
319 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
322 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
323 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
324 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
325 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
326 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
327 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
328 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
329 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
330 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
353 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
354 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
355 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
361 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
375 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
376 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
377 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
378 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
379 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
410 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
411 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
412 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
413 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
414 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
415 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
431 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
432 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
433 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
434 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
435 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
436 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
437 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
438 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
439 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
440 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
441 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
442 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
443 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
444 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
445 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
446 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
447 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
448 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
449 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
450 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
451 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
452 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
453 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
459 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
460 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
461 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
462 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
476 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
480 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
487 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
488 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
489 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
490 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 2.59
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c015219 3300000044 Unclassified 658
2 JGI24746J21847_1001104 3300001977 Bacteria 4245
3 JGI24743J22301_10152721 3300001991 Unclassified 518
4 JGI24745J21846_1035581 3300002073 Unclassified 608
5 JGI24035J26624_1018769 3300002126 Bacteria 722
6 JGI24033J26618_1014535 3300002155 Unclassified 964
7 JGI24751J29686_10039997 3300002459 Bacteria 971
8 JGI24751J29686_10092875 3300002459 Unclassified 628
9 JGI25406J46586_10001848 3300003203 Bacteria 9938
10 JGI25406J46586_10015761 3300003203 Unclassified 3176
11 Ga0007409J51694_1094330 3300003575 Unclassified 591
12 Ga0007429J51699_1091030 3300003579 Unclassified 603
13 Ga0058859_11801951 3300004798 Bacteria 599
14 Ga0058860_11976869 3300004801 Bacteria 572
15 Ga0058860_11990331 3300004801 Bacteria 585
16 Ga0065714_10076628 3300005288 Bacteria 2771
17 Ga0065714_10083759 3300005288 Bacteria 2233
18 Ga0065714_10127161 3300005288 Bacteria 1284
19 Ga0065714_10314071 3300005288 Bacteria 677
20 Ga0065704_10073095 3300005289 Bacteria 7590
21 Ga0065704_10414867 3300005289 Unclassified 738
22 Ga0065704_10580918 3300005289 Bacteria 618
23 Ga0065704_10585035 3300005289 Bacteria 615
24 Ga0065704_10655043 3300005289 Unclassified 581
25 Ga0065712_10000606 3300005290 Bacteria 17755
26 Ga0065712_10001610 3300005290 Bacteria 15557
27 Ga0065712_10003904 3300005290 Bacteria 4284
28 Ga0065712_10031832 3300005290 Unclassified 1049
29 Ga0065712_10068769 3300005290 Bacteria 9072
30 Ga0065712_10091814 3300005290 Bacteria 2356
31 Ga0065712_10094945 3300005290 Bacteria 2235
32 Ga0065712_10141090 3300005290 Bacteria 1449
33 Ga0065712_10158009 3300005290 Bacteria 1322
34 Ga0065712_10159214 3300005290 Bacteria 1314
35 Ga0065712_10338388 3300005290 Bacteria 804
36 Ga0065712_10605506 3300005290 Bacteria 588
37 Ga0065712_10668066 3300005290 Unclassified 560
38 Ga0065715_10000608 3300005293 Bacteria 11704
39 Ga0065715_10103698 3300005293 Bacteria 3013
40 Ga0065715_10134926 3300005293 Bacteria 1946
41 Ga0065715_10171014 3300005293 Bacteria 1547
42 Ga0065715_10371651 3300005293 Bacteria 920
43 Ga0065715_10484167 3300005293 Unclassified 754
44 Ga0065715_10502292 3300005293 Unclassified 778
45 Ga0065715_10588216 3300005293 Unclassified 715
46 Ga0065715_10634163 3300005293 Bacteria 688
47 Ga0065715_10719491 3300005293 Bacteria 644
48 Ga0065715_10764053 3300005293 Bacteria 624
49 Ga0065715_10874796 3300005293 Bacteria 583
50 Ga0065715_10959652 3300005293 Unclassified 557
51 Ga0065715_10995081 3300005293 Bacteria 546
52 Ga0065707_10001625 3300005295 Bacteria 10772
53 Ga0065707_10025113 3300005295 Bacteria 1414
54 Ga0065707_10052146 3300005295 Unclassified 704
55 Ga0065707_10113954 3300005295 Unclassified 2311
56 Ga0065707_10115210 3300005295 Bacteria 2274
57 Ga0065707_10117763 3300005295 Bacteria 2204
58 Ga0065707_10121036 3300005295 Unclassified 2119
59 Ga0065707_10143401 3300005295 Bacteria 1743
60 Ga0065707_10427017 3300005295 Bacteria 824
61 Ga0065707_10437955 3300005295 Bacteria 801
62 Ga0065707_10500829 3300005295 Bacteria 750
63 Ga0065707_10774695 3300005295 Bacteria 609
64 Ga0065707_10913582 3300005295 Bacteria 563
65 Ga0070658_10024349 3300005327 Bacteria 4857
66 Ga0070676_10017097 3300005328 Bacteria 4011
67 Ga0070676_10044432 3300005328 Bacteria 2585
68 Ga0070676_10053805 3300005328 Unclassified 2372
69 Ga0070676_10105547 3300005328 Bacteria 1747
70 Ga0070676_10127756 3300005328 Bacteria 1604
71 Ga0070676_10310803 3300005328 Bacteria 1071
72 Ga0070676_10478139 3300005328 Bacteria 881
73 Ga0070676_10498232 3300005328 Unclassified 864
74 Ga0070676_11177469 3300005328 Bacteria 582
75 Ga0070683_100028120 3300005329 Bacteria 5079
76 Ga0070683_100032991 3300005329 Bacteria 4718
77 Ga0070683_100413841 3300005329 Unclassified 1286
78 Ga0070683_101239933 3300005329 Unclassified 717
79 Ga0070683_101310690 3300005329 Unclassified 696
80 Ga0070690_100029489 3300005330 Bacteria 3404
81 Ga0070690_100029519 3300005330 Bacteria 3402
82 Ga0070690_100031442 3300005330 Bacteria 3307
83 Ga0070690_100072866 3300005330 Bacteria 2234
84 Ga0070690_100204853 3300005330 Unclassified 1374
85 Ga0070690_100242064 3300005330 Bacteria 1272
86 Ga0070670_100005242 3300005331 Bacteria 10913
87 Ga0070670_100016095 3300005331 Bacteria 6419
88 Ga0070670_100026591 3300005331 Bacteria 4978
89 Ga0070670_100080922 3300005331 Bacteria 2791
90 Ga0070670_100128918 3300005331 Bacteria 2184
91 Ga0070670_100134769 3300005331 Bacteria 2134
92 Ga0070670_100268650 3300005331 Bacteria 1488
93 Ga0070670_100433912 3300005331 Bacteria 1163
94 Ga0070670_100492261 3300005331 Bacteria 1090
95 Ga0070670_100532565 3300005331 Bacteria 1047
96 Ga0070670_100723340 3300005331 Bacteria 896
97 Ga0070670_101025573 3300005331 Bacteria 751
98 Ga0070670_101787004 3300005331 Unclassified 566
99 Ga0070677_10016037 3300005333 Bacteria 2663
100 Ga0070677_10026731 3300005333 Bacteria 2166
101 Ga0070677_10520465 3300005333 Bacteria 647
102 Ga0070677_10528286 3300005333 Bacteria 643
103 Ga0070677_10898464 3300005333 Bacteria 512
104 Ga0068869_100061574 3300005334 Bacteria 2753
105 Ga0068869_100070719 3300005334 Bacteria 2582
106 Ga0068869_100115629 3300005334 Bacteria 2046
107 Ga0068869_100285361 3300005334 Bacteria 1329
108 Ga0068869_100304936 3300005334 Unclassified 1287
109 Ga0068869_100405883 3300005334 Bacteria 1122
110 Ga0068869_100587127 3300005334 Bacteria 940
111 Ga0068869_100619234 3300005334 Bacteria 916
112 Ga0068869_101161982 3300005334 Bacteria 677
113 Ga0068869_101245466 3300005334 Unclassified 655
114 Ga0068869_101275269 3300005334 Bacteria 647
115 Ga0068869_101649782 3300005334 Bacteria 571
116 Ga0070666_10015435 3300005335 Bacteria 4873
117 Ga0070666_10025573 3300005335 Bacteria 3849
118 Ga0070666_10063003 3300005335 Bacteria 2512
119 Ga0070666_10141298 3300005335 Bacteria 1677
120 Ga0070666_10249856 3300005335 Bacteria 1255
121 Ga0070666_10363174 3300005335 Bacteria 1037
122 Ga0070666_10462801 3300005335 Bacteria 917
123 Ga0070666_10509488 3300005335 Unclassified 873
124 Ga0070666_11107230 3300005335 Unclassified 589
125 Ga0070680_100081806 3300005336 Bacteria 2664
126 Ga0070680_100274873 3300005336 Bacteria 1427
127 Ga0070682_100177524 3300005337 Bacteria 1485
128 Ga0070682_100393341 3300005337 Bacteria 1046
129 Ga0070682_100408628 3300005337 Bacteria 1029
130 Ga0068868_100002613 3300005338 Bacteria 12492
131 Ga0068868_100125325 3300005338 Bacteria 2098
132 Ga0068868_100168029 3300005338 Bacteria 1815
133 Ga0068868_100181016 3300005338 Bacteria 1748
134 Ga0068868_100406504 3300005338 Bacteria 1176
135 Ga0068868_100474576 3300005338 Bacteria 1092
136 Ga0068868_100753819 3300005338 Bacteria 875
137 Ga0068868_100896550 3300005338 Bacteria 806
138 Ga0068868_101754862 3300005338 Bacteria 586
139 Ga0070660_100790408 3300005339 Bacteria 798
140 Ga0070689_100004747 3300005340 Bacteria 9220
141 Ga0070689_100008229 3300005340 Bacteria 7335
142 Ga0070689_100014545 3300005340 Bacteria 5719
143 Ga0070689_100017434 3300005340 Bacteria 5274
144 Ga0070689_100020726 3300005340 Bacteria 4882
145 Ga0070689_100046423 3300005340 Bacteria 3348
146 Ga0070689_100633346 3300005340 Bacteria 929
147 Ga0070689_101011754 3300005340 Bacteria 740
148 Ga0070691_10034977 3300005341 Bacteria 2365
149 Ga0070691_10133947 3300005341 Bacteria 1258
150 Ga0070691_10247625 3300005341 Bacteria 955
151 Ga0070691_10440904 3300005341 Bacteria 742
152 Ga0070691_10521898 3300005341 Bacteria 690
153 Ga0070691_10650128 3300005341 Unclassified 628
154 Ga0070687_100002751 3300005343 Bacteria 6675
155 Ga0070687_100071459 3300005343 Bacteria 1865
156 Ga0070687_100091341 3300005343 Bacteria 1685
157 Ga0070687_100141709 3300005343 Bacteria 1401
158 Ga0070687_100403390 3300005343 Bacteria 897
159 Ga0070687_100426936 3300005343 Bacteria 876
160 Ga0070687_100581574 3300005343 Unclassified 766
161 Ga0070687_100619469 3300005343 Bacteria 746
162 Ga0070687_100876420 3300005343 Bacteria 642
163 Ga0070661_100073736 3300005344 Bacteria 2513
164 Ga0070661_100154837 3300005344 Bacteria 1734
165 Ga0070661_100158947 3300005344 Bacteria 1711
166 Ga0070661_100360176 3300005344 Bacteria 1143
167 Ga0070661_100425917 3300005344 Bacteria 1052
168 Ga0070661_100527358 3300005344 Unclassified 948
169 Ga0070661_101075215 3300005344 Bacteria 669
170 Ga0070661_101303844 3300005344 Bacteria 609
171 Ga0070661_101891011 3300005344 Bacteria 507
172 Ga0070692_10026150 3300005345 Bacteria 2882
173 Ga0070692_10053127 3300005345 Bacteria 2112
174 Ga0070692_10107616 3300005345 Bacteria 1538
175 Ga0070692_10112288 3300005345 Bacteria 1509
176 Ga0070692_10163313 3300005345 Bacteria 1278
177 Ga0070692_10348102 3300005345 Bacteria 920
178 Ga0070668_100011207 3300005347 Bacteria 6675
179 Ga0070668_100034459 3300005347 Bacteria 3857
180 Ga0070668_100236894 3300005347 Bacteria 1510
181 Ga0070668_100308244 3300005347 Unclassified 1329
182 Ga0070668_100793733 3300005347 Bacteria 841
183 Ga0070668_100825367 3300005347 Bacteria 825
184 Ga0070668_101633597 3300005347 Bacteria 591
185 Ga0070668_101740917 3300005347 Unclassified 572
186 Ga0070668_102005199 3300005347 Bacteria 534
187 Ga0070669_100003660 3300005353 Bacteria 11085
188 Ga0070669_100023915 3300005353 Bacteria 4377
189 Ga0070669_100027137 3300005353 Bacteria 4122
190 Ga0070669_100068139 3300005353 Unclassified 2626
191 Ga0070669_100139991 3300005353 Bacteria 1865
192 Ga0070669_100167787 3300005353 Bacteria 1710
193 Ga0070669_100190989 3300005353 Bacteria 1607
194 Ga0070669_100306614 3300005353 Unclassified 1278
195 Ga0070669_100328516 3300005353 Bacteria 1236
196 Ga0070669_100482997 3300005353 Bacteria 1025
197 Ga0070669_100572812 3300005353 Bacteria 943
198 Ga0070669_100803504 3300005353 Bacteria 799
199 Ga0070669_100974136 3300005353 Bacteria 727
200 Ga0070669_101036047 3300005353 Bacteria 705
201 Ga0070669_101391786 3300005353 Bacteria 609
202 Ga0070675_100012940 3300005354 Bacteria 6548
203 Ga0070675_100016195 3300005354 Bacteria 5913
204 Ga0070675_100023187 3300005354 Bacteria 4959
205 Ga0070675_100028016 3300005354 Bacteria 4530
206 Ga0070675_100032799 3300005354 Bacteria 4205
207 Ga0070675_100043086 3300005354 Bacteria 3687
208 Ga0070675_100043190 3300005354 Bacteria 3683
209 Ga0070675_100054777 3300005354 Bacteria 3282
210 Ga0070675_100092883 3300005354 Bacteria 2530
211 Ga0070675_100094360 3300005354 Bacteria 2510
212 Ga0070675_100106368 3300005354 Bacteria 2368
213 Ga0070675_100124332 3300005354 Unclassified 2194
214 Ga0070675_100140257 3300005354 Bacteria 2066
215 Ga0070675_100140848 3300005354 Bacteria 2062
216 Ga0070675_100161639 3300005354 Bacteria 1926
217 Ga0070675_100252931 3300005354 Bacteria 1543
218 Ga0070675_100348204 3300005354 Bacteria 1313
219 Ga0070675_100898481 3300005354 Unclassified 812
220 Ga0070675_100953523 3300005354 Bacteria 787
221 Ga0070675_101025816 3300005354 Bacteria 758
222 Ga0070675_101082920 3300005354 Bacteria 737
223 Ga0070675_101148262 3300005354 Bacteria 715
224 Ga0070671_100018697 3300005355 Bacteria 5630
225 Ga0070671_100027473 3300005355 Bacteria 4684
226 Ga0070671_100037768 3300005355 Bacteria 4007
227 Ga0070671_100226603 3300005355 Bacteria 1586
228 Ga0070671_100239244 3300005355 Bacteria 1541
229 Ga0070671_100268189 3300005355 Bacteria 1451
230 Ga0070671_100511295 3300005355 Bacteria 1034
231 Ga0070671_101088131 3300005355 Bacteria 702
232 Ga0070671_101218468 3300005355 Bacteria 663
233 Ga0070674_100023482 3300005356 Bacteria 3992
234 Ga0070674_100030097 3300005356 Bacteria 3584
235 Ga0070674_100108249 3300005356 Bacteria 2036
236 Ga0070674_100145197 3300005356 Bacteria 1785
237 Ga0070674_100164633 3300005356 Bacteria 1685
238 Ga0070674_100189381 3300005356 Bacteria 1581
239 Ga0070674_100299300 3300005356 Bacteria 1282
240 Ga0070674_100350905 3300005356 Bacteria 1192
241 Ga0070674_100375091 3300005356 Bacteria 1156
242 Ga0070674_100410449 3300005356 Bacteria 1109
243 Ga0070674_100428067 3300005356 Bacteria 1087
244 Ga0070674_100645872 3300005356 Bacteria 899
245 Ga0070674_100694804 3300005356 Bacteria 869
246 Ga0070674_100705686 3300005356 Unclassified 863
247 Ga0070674_100747991 3300005356 Bacteria 840
248 Ga0070674_100875338 3300005356 Bacteria 781
249 Ga0070674_101028974 3300005356 Unclassified 724
250 Ga0070674_101177315 3300005356 Bacteria 680
251 Ga0070674_101328677 3300005356 Unclassified 642
252 Ga0070674_101491724 3300005356 Bacteria 607
253 Ga0070674_101505806 3300005356 Unclassified 605
254 Ga0070674_102092931 3300005356 Bacteria 516
255 Ga0070673_100002420 3300005364 Bacteria 11363
256 Ga0070673_100088599 3300005364 Bacteria 2524
257 Ga0070673_100116081 3300005364 Bacteria 2226
258 Ga0070673_100156089 3300005364 Bacteria 1937
259 Ga0070673_100158464 3300005364 Bacteria 1923
260 Ga0070673_100207926 3300005364 Unclassified 1688
261 Ga0070673_100242943 3300005364 Bacteria 1566
262 Ga0070673_100251410 3300005364 Bacteria 1541
263 Ga0070673_100272696 3300005364 Unclassified 1481
264 Ga0070673_100373103 3300005364 Bacteria 1271
265 Ga0070673_100588565 3300005364 Bacteria 1014
266 Ga0070673_100879958 3300005364 Bacteria 830
267 Ga0070673_101084985 3300005364 Bacteria 747
268 Ga0070673_101089057 3300005364 Bacteria 746
269 Ga0070688_100001753 3300005365 Bacteria 10839
270 Ga0070688_100021218 3300005365 Bacteria 3791
271 Ga0070688_100028061 3300005365 Unclassified 3356
272 Ga0070688_100029021 3300005365 Bacteria 3308
273 Ga0070688_100100222 3300005365 Bacteria 1909
274 Ga0070688_100122052 3300005365 Bacteria 1747
275 Ga0070688_100176393 3300005365 Bacteria 1479
276 Ga0070688_100180496 3300005365 Unclassified 1464
277 Ga0070688_100288123 3300005365 Bacteria 1182
278 Ga0070688_100565502 3300005365 Bacteria 866
279 Ga0070688_101139966 3300005365 Unclassified 625
280 Ga0070659_100236015 3300005366 Bacteria 1512
281 Ga0070659_100623034 3300005366 Unclassified 929
282 Ga0070659_101214932 3300005366 Bacteria 667
283 Ga0070667_100013896 3300005367 Bacteria 6656
284 Ga0070667_100066891 3300005367 Bacteria 3054
285 Ga0070667_100234216 3300005367 Bacteria 1638
286 Ga0070667_100301068 3300005367 Bacteria 1444
287 Ga0070667_100344106 3300005367 Unclassified 1349
288 Ga0070667_100562263 3300005367 Bacteria 1049
289 Ga0070667_100917851 3300005367 Bacteria 815
290 Ga0070667_101392029 3300005367 Unclassified 658
291 Ga0070667_102300926 3300005367 Bacteria 507
292 Ga0070703_10009612 3300005406 Bacteria 2728
293 Ga0070703_10291958 3300005406 Bacteria 677
294 Ga0070703_10298510 3300005406 Bacteria 671
295 Ga0070703_10300647 3300005406 Bacteria 669
296 Ga0070703_10314820 3300005406 Unclassified 657
297 Ga0070703_10336997 3300005406 Unclassified 640
298 Ga0070703_10526263 3300005406 Bacteria 536
299 Ga0070709_10005339 3300005434 Bacteria 6960
300 Ga0070709_10050658 3300005434 Bacteria 2603
301 Ga0070709_10210736 3300005434 Bacteria 1381
302 Ga0070709_10714089 3300005434 Bacteria 781
303 Ga0070714_100009036 3300005435 Bacteria 7807
304 Ga0070713_100023853 3300005436 Bacteria 4755
305 Ga0070713_100027285 3300005436 Bacteria 4494
306 Ga0070713_100080898 3300005436 Bacteria 2771
307 Ga0070713_100406747 3300005436 Bacteria 1272
308 Ga0070713_100463062 3300005436 Unclassified 1192
309 Ga0070710_10769953 3300005437 Bacteria 685
310 Ga0070701_10012529 3300005438 Bacteria 3828
311 Ga0070701_10016470 3300005438 Bacteria 3437
312 Ga0070701_10125174 3300005438 Bacteria 1453
313 Ga0070701_10169327 3300005438 Bacteria 1271
314 Ga0070701_10194546 3300005438 Bacteria 1195
315 Ga0070701_10248957 3300005438 Bacteria 1072
316 Ga0070701_10289216 3300005438 Bacteria 1003
317 Ga0070701_10758140 3300005438 Bacteria 658
318 Ga0070701_11208803 3300005438 Bacteria 536
319 Ga0070711_100295535 3300005439 Bacteria 1286
320 Ga0070711_100457063 3300005439 Bacteria 1046
321 Ga0070711_101395811 3300005439 Bacteria 609
322 Ga0070705_100000897 3300005440 Bacteria 16613
323 Ga0070705_100006850 3300005440 Bacteria 5599
324 Ga0070705_100124191 3300005440 Bacteria 1672
325 Ga0070705_100205457 3300005440 Bacteria 1354
326 Ga0070705_100242684 3300005440 Bacteria 1260
327 Ga0070705_100246944 3300005440 Bacteria 1250
328 Ga0070705_100367941 3300005440 Bacteria 1054
329 Ga0070705_100571827 3300005440 Bacteria 870
330 Ga0070705_100662030 3300005440 Bacteria 815
331 Ga0070705_100666645 3300005440 Bacteria 813
332 Ga0070705_100739537 3300005440 Bacteria 776
333 Ga0070705_100813033 3300005440 Bacteria 745
334 Ga0070705_100894032 3300005440 Bacteria 714
335 Ga0070700_100007200 3300005441 Bacteria 5992
336 Ga0070700_100022411 3300005441 Bacteria 3683
337 Ga0070700_100037500 3300005441 Bacteria 2949
338 Ga0070700_100053729 3300005441 Bacteria 2515
339 Ga0070700_100088454 3300005441 Bacteria 2016
340 Ga0070700_100104342 3300005441 Bacteria 1873
341 Ga0070700_100270299 3300005441 Bacteria 1228
342 Ga0070700_100312355 3300005441 Bacteria 1151
343 Ga0070700_100400437 3300005441 Bacteria 1032
344 Ga0070700_100559901 3300005441 Bacteria 889
345 Ga0070700_101053215 3300005441 Bacteria 672
346 Ga0070700_101325125 3300005441 Unclassified 606
347 Ga0070700_101525443 3300005441 Bacteria 569
348 Ga0070700_101982619 3300005441 Bacteria 505
349 Ga0070694_100001253 3300005444 Bacteria 14731
350 Ga0070694_100001998 3300005444 Bacteria 12113
351 Ga0070694_100115736 3300005444 Bacteria 1917
352 Ga0070694_100128153 3300005444 Bacteria 1830
353 Ga0070694_100131235 3300005444 Unclassified 1810
354 Ga0070694_100167894 3300005444 Bacteria 1615
355 Ga0070694_100177663 3300005444 Bacteria 1573
356 Ga0070694_100237418 3300005444 Bacteria 1374
357 Ga0070694_100328764 3300005444 Unclassified 1178
358 Ga0070694_100376892 3300005444 Bacteria 1105
359 Ga0070694_100395988 3300005444 Unclassified 1080
360 Ga0070694_100932338 3300005444 Unclassified 718
361 Ga0070708_100370669 3300005445 Bacteria 1350
362 Ga0070708_100469016 3300005445 Bacteria 1188
363 Ga0070708_100860041 3300005445 Unclassified 852
364 Ga0070708_100960275 3300005445 Bacteria 802
365 Ga0070663_100074691 3300005455 Bacteria 2476
366 Ga0070663_101513983 3300005455 Bacteria 596
367 Ga0070678_100038726 3300005456 Bacteria 3358
368 Ga0070678_100041676 3300005456 Bacteria 3257
369 Ga0070678_100069671 3300005456 Bacteria 2627
370 Ga0070678_100091538 3300005456 Bacteria 2334
371 Ga0070678_100139864 3300005456 Bacteria 1936
372 Ga0070678_100169062 3300005456 Bacteria 1779
373 Ga0070678_100179023 3300005456 Bacteria 1734
374 Ga0070678_100295380 3300005456 Unclassified 1375
375 Ga0070678_100418905 3300005456 Bacteria 1167
376 Ga0070678_100554615 3300005456 Bacteria 1020
377 Ga0070678_100657645 3300005456 Bacteria 940
378 Ga0070678_100742766 3300005456 Bacteria 887
379 Ga0070678_100835535 3300005456 Bacteria 838
380 Ga0070678_100845601 3300005456 Bacteria 833
381 Ga0070678_100862061 3300005456 Unclassified 826
382 Ga0070678_101094782 3300005456 Bacteria 735
383 Ga0070678_101521889 3300005456 Unclassified 627
384 Ga0070662_100043913 3300005457 Bacteria 3200
385 Ga0070662_100083192 3300005457 Unclassified 2388
386 Ga0070662_100160289 3300005457 Unclassified 1759
387 Ga0070662_100189813 3300005457 Bacteria 1624
388 Ga0070662_100354017 3300005457 Bacteria 1203
389 Ga0070662_100473685 3300005457 Bacteria 1042
390 Ga0070662_100501443 3300005457 Bacteria 1012
391 Ga0070662_100655831 3300005457 Bacteria 885
392 Ga0070662_100739496 3300005457 Bacteria 834
393 Ga0070662_100958487 3300005457 Bacteria 731
394 Ga0070662_101139730 3300005457 Bacteria 670
395 Ga0070662_101201037 3300005457 Bacteria 652
396 Ga0070662_101341898 3300005457 Bacteria 616
397 Ga0070681_10036359 3300005458 Bacteria 4945
398 Ga0070681_10234728 3300005458 Unclassified 1748
399 Ga0070681_10245415 3300005458 Bacteria 1704
400 Ga0070681_10315070 3300005458 Bacteria 1474
401 Ga0070681_10353760 3300005458 Bacteria 1379
402 Ga0070681_10544930 3300005458 Bacteria 1074
403 Ga0070681_11123333 3300005458 Unclassified 707
404 Ga0068867_100007393 3300005459 Bacteria 7771
405 Ga0068867_100008654 3300005459 Bacteria 7186
406 Ga0068867_100012752 3300005459 Bacteria 5948
407 Ga0068867_100016089 3300005459 Bacteria 5311
408 Ga0068867_100145700 3300005459 Bacteria 1856
409 Ga0068867_100286851 3300005459 Bacteria 1352
410 Ga0068867_100311441 3300005459 Bacteria 1301
411 Ga0068867_100521265 3300005459 Bacteria 1025
412 Ga0068867_101345790 3300005459 Bacteria 660
413 Ga0068867_101365680 3300005459 Bacteria 656
414 Ga0068867_101520011 3300005459 Bacteria 624
415 Ga0068867_101754969 3300005459 Unclassified 583
416 Ga0068867_101761317 3300005459 Unclassified 582
417 Ga0068867_102056289 3300005459 Bacteria 540
418 Ga0070685_10000947 3300005466 Bacteria 15612
419 Ga0070685_10202006 3300005466 Bacteria 1292
420 Ga0070685_10214530 3300005466 Bacteria 1258
421 Ga0070685_10309048 3300005466 Bacteria 1068
422 Ga0070685_10360382 3300005466 Bacteria 996
423 Ga0070685_10374420 3300005466 Bacteria 979
424 Ga0070685_10425666 3300005466 Bacteria 925
425 Ga0070685_10561825 3300005466 Bacteria 816
426 Ga0070685_11007625 3300005466 Unclassified 625
427 Ga0070685_11579551 3300005466 Bacteria 507
428 Ga0070706_100313699 3300005467 Bacteria 1463
429 Ga0070706_100433779 3300005467 Bacteria 1223
430 Ga0070706_100501160 3300005467 Bacteria 1130
431 Ga0070706_100581790 3300005467 Bacteria 1041
432 Ga0070706_100983878 3300005467 Unclassified 778
433 Ga0070706_101123123 3300005467 Bacteria 723
434 Ga0070706_101271203 3300005467 Unclassified 675
435 Ga0070706_101283085 3300005467 Bacteria 672
436 Ga0070707_100106563 3300005468 Bacteria 2718
437 Ga0070707_100116361 3300005468 Bacteria 2595
438 Ga0070707_100118656 3300005468 Bacteria 2568
439 Ga0070707_100176549 3300005468 Unclassified 2082
440 Ga0070707_100676427 3300005468 Bacteria 995
441 Ga0070707_100737860 3300005468 Bacteria 948
442 Ga0070707_101767055 3300005468 Bacteria 586
443 Ga0070707_102271565 3300005468 Bacteria 510
444 Ga0070698_100036634 3300005471 Bacteria 5065
445 Ga0070698_100077203 3300005471 Bacteria 3331
446 Ga0070698_100084104 3300005471 Bacteria 3170
447 Ga0070698_100141206 3300005471 Bacteria 2359
448 Ga0070698_100292134 3300005471 Unclassified 1561
449 Ga0070698_100392553 3300005471 Bacteria 1321
450 Ga0070698_100572122 3300005471 Bacteria 1070
451 Ga0070698_100623826 3300005471 Bacteria 1019
452 Ga0070698_100627389 3300005471 Unclassified 1016
453 Ga0070698_100765102 3300005471 Bacteria 909
454 Ga0070698_100919765 3300005471 Bacteria 821
455 Ga0070698_100927033 3300005471 Bacteria 817
456 Ga0070698_101139025 3300005471 Bacteria 729
457 Ga0070698_102055084 3300005471 Bacteria 525
458 Ga0070699_100000410 3300005518 Bacteria 41278
459 Ga0070699_100000753 3300005518 Bacteria 29961
460 Ga0070699_100017510 3300005518 Bacteria 6150
461 Ga0070699_100032358 3300005518 Unclassified 4515
462 Ga0070699_100072950 3300005518 Bacteria 2986
463 Ga0070699_100091280 3300005518 Bacteria 2663
464 Ga0070699_100135537 3300005518 Unclassified 2172
465 Ga0070699_100245741 3300005518 Bacteria 1598
466 Ga0070699_100390198 3300005518 Bacteria 1258
467 Ga0070699_100489514 3300005518 Bacteria 1117
468 Ga0070699_100847762 3300005518 Bacteria 837
469 Ga0070699_101095718 3300005518 Unclassified 730
470 Ga0070699_101172278 3300005518 Bacteria 705
471 Ga0070699_101389000 3300005518 Bacteria 644
472 Ga0070699_101479520 3300005518 Bacteria 623
473 Ga0070679_100059093 3300005530 Bacteria 3822
474 Ga0070679_100179646 3300005530 Bacteria 2089
475 Ga0070679_101106211 3300005530 Bacteria 737
476 Ga0070679_101360741 3300005530 Bacteria 656
477 Ga0070684_100098813 3300005535 Bacteria 2604
478 Ga0070684_100646836 3300005535 Unclassified 984
479 Ga0070684_100763403 3300005535 Unclassified 903
480 Ga0070684_101290966 3300005535 Bacteria 687
481 Ga0070684_101347554 3300005535 Bacteria 672
482 Ga0070684_101497389 3300005535 Bacteria 636
483 Ga0070697_100033368 3300005536 Bacteria 4145
484 Ga0070697_100240185 3300005536 Bacteria 1547
485 Ga0070697_100349499 3300005536 Bacteria 1277
486 Ga0070697_100590548 3300005536 Bacteria 976
487 Ga0070697_100691193 3300005536 Bacteria 900
488 Ga0070697_100835451 3300005536 Bacteria 816
489 Ga0070697_102022129 3300005536 Bacteria 516
490 Ga0068853_100300755 3300005539 Bacteria 1483
491 Ga0068853_100491875 3300005539 Bacteria 1157
492 Ga0070672_100005033 3300005543 Bacteria 8713
493 Ga0070672_100018161 3300005543 Bacteria 5079
494 Ga0070672_100018273 3300005543 Bacteria 5063
495 Ga0070672_100028636 3300005543 Bacteria 4169
496 Ga0070672_100057910 3300005543 Bacteria 3043
497 Ga0070672_100091670 3300005543 Bacteria 2452
498 Ga0070672_100132620 3300005543 Bacteria 2049
499 Ga0070672_100137378 3300005543 Bacteria 2014
500 Ga0070672_100138059 3300005543 Bacteria 2009
501 Ga0070672_100154028 3300005543 Bacteria 1903
502 Ga0070672_100218002 3300005543 Bacteria 1600
503 Ga0070672_100400931 3300005543 Bacteria 1176
504 Ga0070672_100428513 3300005543 Unclassified 1137
505 Ga0070672_100522166 3300005543 Bacteria 1029
506 Ga0070672_100590641 3300005543 Bacteria 966
507 Ga0070672_101133921 3300005543 Bacteria 695
508 Ga0070672_101149525 3300005543 Bacteria 691
509 Ga0070672_101465441 3300005543 Bacteria 611
510 Ga0070686_100001410 3300005544 Bacteria 13562
511 Ga0070686_100018367 3300005544 Bacteria 4102
512 Ga0070686_100066401 3300005544 Bacteria 2346
513 Ga0070686_100073995 3300005544 Unclassified 2238
514 Ga0070686_100096363 3300005544 Bacteria 1989
515 Ga0070686_100182542 3300005544 Bacteria 1492
516 Ga0070686_100322083 3300005544 Bacteria 1153
517 Ga0070686_100455187 3300005544 Unclassified 985
518 Ga0070686_100473925 3300005544 Unclassified 967
519 Ga0070686_100473950 3300005544 Bacteria 967
520 Ga0070686_100548966 3300005544 Bacteria 903
521 Ga0070686_101240827 3300005544 Unclassified 620
522 Ga0070686_101788966 3300005544 Unclassified 523
523 Ga0070686_101918884 3300005544 Unclassified 506
524 Ga0070686_101952522 3300005544 Bacteria 501
525 Ga0070695_100000939 3300005545 Bacteria 15776
526 Ga0070695_100041621 3300005545 Bacteria 2913
527 Ga0070695_100058755 3300005545 Bacteria 2488
528 Ga0070695_100088445 3300005545 Bacteria 2062
529 Ga0070695_100141576 3300005545 Bacteria 1668
530 Ga0070695_100191216 3300005545 Bacteria 1457
531 Ga0070695_100723857 3300005545 Unclassified 791
532 Ga0070695_101281754 3300005545 Bacteria 605
533 Ga0070696_100001074 3300005546 Bacteria 17644
534 Ga0070696_100008820 3300005546 Bacteria 6746
535 Ga0070696_100038629 3300005546 Bacteria 3295
536 Ga0070696_100103211 3300005546 Bacteria 2046
537 Ga0070696_100107749 3300005546 Bacteria 2004
538 Ga0070696_100251895 3300005546 Bacteria 1336
539 Ga0070696_100456033 3300005546 Bacteria 1010
540 Ga0070696_100681800 3300005546 Bacteria 836
541 Ga0070693_100261677 3300005547 Bacteria 1151
542 Ga0070693_100897588 3300005547 Bacteria 664
543 Ga0070665_100012666 3300005548 Bacteria 8491
544 Ga0070665_100029781 3300005548 Bacteria 5493
545 Ga0070665_100034631 3300005548 Bacteria 5078
546 Ga0070665_101007899 3300005548 Bacteria 845
547 Ga0070704_100001249 3300005549 Bacteria 13402
548 Ga0070704_100004940 3300005549 Bacteria 7741
549 Ga0070704_100025590 3300005549 Unclassified 3887
550 Ga0070704_100102200 3300005549 Unclassified 2162
551 Ga0070704_100111026 3300005549 Unclassified 2086
552 Ga0070704_100122788 3300005549 Bacteria 1999
553 Ga0070704_100184666 3300005549 Bacteria 1671
554 Ga0070704_100251466 3300005549 Bacteria 1452
555 Ga0070704_100525243 3300005549 Bacteria 1031
556 Ga0070704_100627521 3300005549 Bacteria 947
557 Ga0070704_100685322 3300005549 Bacteria 908
558 Ga0070704_100994962 3300005549 Unclassified 758
559 Ga0070704_101019325 3300005549 Bacteria 749
560 Ga0070704_101100846 3300005549 Bacteria 721
561 Ga0070704_101386655 3300005549 Bacteria 644
562 Ga0070704_101397212 3300005549 Unclassified 642
563 Ga0070704_101598784 3300005549 Bacteria 601
564 Ga0070664_100006618 3300005564 Bacteria 9344
565 Ga0070664_100023419 3300005564 Bacteria 5100
566 Ga0070664_100041208 3300005564 Unclassified 3895
567 Ga0070664_100101236 3300005564 Bacteria 2505
568 Ga0070664_100149280 3300005564 Bacteria 2063
569 Ga0070664_100432279 3300005564 Bacteria 1207
570 Ga0070664_100451037 3300005564 Bacteria 1181
571 Ga0070664_100658297 3300005564 Bacteria 974
572 Ga0070664_100722954 3300005564 Unclassified 928
573 Ga0070664_100733423 3300005564 Bacteria 922
574 Ga0070664_101076178 3300005564 Unclassified 757
575 Ga0070664_101357864 3300005564 Bacteria 671
576 Ga0070664_101380279 3300005564 Bacteria 666
577 Ga0068857_100079371 3300005577 Bacteria 2929
578 Ga0068857_100150832 3300005577 Bacteria 2106
579 Ga0068857_100174209 3300005577 Bacteria 1956
580 Ga0068857_100452499 3300005577 Bacteria 1200
581 Ga0068857_100535693 3300005577 Bacteria 1102
582 Ga0068857_101610488 3300005577 Bacteria 634
583 Ga0068857_101959580 3300005577 Bacteria 574
584 Ga0068854_100010562 3300005578 Bacteria 5990
585 Ga0068854_100076351 3300005578 Unclassified 2462
586 Ga0068854_100077452 3300005578 Bacteria 2447
587 Ga0068854_100450182 3300005578 Unclassified 1075
588 Ga0068854_100749467 3300005578 Unclassified 847
589 Ga0068854_101176832 3300005578 Bacteria 686
590 Ga0070702_100015349 3300005615 Bacteria 3910
591 Ga0070702_100031935 3300005615 Bacteria 2885
592 Ga0070702_100201913 3300005615 Bacteria 1317
593 Ga0070702_100273570 3300005615 Bacteria 1156
594 Ga0070702_100436024 3300005615 Bacteria 947
595 Ga0070702_100555985 3300005615 Unclassified 853
596 Ga0070702_100825978 3300005615 Bacteria 719
597 Ga0068852_100075870 3300005616 Bacteria 2967
598 Ga0068852_101016662 3300005616 Bacteria 848
599 Ga0068859_100023275 3300005617 Bacteria 6217
600 Ga0068859_100033707 3300005617 Bacteria 5141
601 Ga0068859_100048146 3300005617 Bacteria 4282
602 Ga0068859_100055252 3300005617 Bacteria 3995
603 Ga0068859_100061540 3300005617 Bacteria 3782
604 Ga0068859_100066190 3300005617 Bacteria 3648
605 Ga0068859_100111753 3300005617 Bacteria 2795
606 Ga0068859_100113988 3300005617 Bacteria 2767
607 Ga0068859_100140184 3300005617 Bacteria 2492
608 Ga0068859_100187875 3300005617 Bacteria 2150
609 Ga0068859_100235859 3300005617 Bacteria 1918
610 Ga0068859_100256618 3300005617 Bacteria 1839
611 Ga0068859_100521796 3300005617 Bacteria 1283
612 Ga0068859_100880755 3300005617 Unclassified 981
613 Ga0068859_101321780 3300005617 Bacteria 795
614 Ga0068859_101337837 3300005617 Unclassified 790
615 Ga0068859_101920698 3300005617 Unclassified 654
616 Ga0068859_102254685 3300005617 Unclassified 601
617 Ga0068864_100001449 3300005618 Bacteria 19557
618 Ga0068864_100033085 3300005618 Bacteria 4394
619 Ga0068864_100116552 3300005618 Bacteria 2383
620 Ga0068864_100119189 3300005618 Unclassified 2358
621 Ga0068864_100171845 3300005618 Bacteria 1976
622 Ga0068864_100653142 3300005618 Bacteria 1024
623 Ga0068864_100784206 3300005618 Bacteria 936
624 Ga0068864_100938612 3300005618 Unclassified 856
625 Ga0068864_100980107 3300005618 Bacteria 838
626 Ga0068864_101330219 3300005618 Bacteria 719
627 Ga0068864_101429478 3300005618 Unclassified 694
628 Ga0068864_101907656 3300005618 Bacteria 600
629 Ga0068864_102055217 3300005618 Unclassified 578
630 Ga0068866_10031836 3300005718 Bacteria 2544
631 Ga0068866_10094288 3300005718 Bacteria 1637
632 Ga0068866_10368368 3300005718 Bacteria 918
633 Ga0068866_10409648 3300005718 Bacteria 877
634 Ga0068866_10537328 3300005718 Bacteria 779
635 Ga0068866_10785301 3300005718 Bacteria 661
636 Ga0068866_11140695 3300005718 Bacteria 560
637 Ga0068861_100016299 3300005719 Bacteria 5255
638 Ga0068861_100016649 3300005719 Bacteria 5205
639 Ga0068861_100016863 3300005719 Bacteria 5175
640 Ga0068861_100053065 3300005719 Bacteria 3083
641 Ga0068861_100062481 3300005719 Bacteria 2861
642 Ga0068861_100071472 3300005719 Unclassified 2690
643 Ga0068861_100084971 3300005719 Bacteria 2485
644 Ga0068861_100135619 3300005719 Bacteria 2002
645 Ga0068861_100209677 3300005719 Bacteria 1640
646 Ga0068861_100331464 3300005719 Bacteria 1329
647 Ga0068861_100388542 3300005719 Bacteria 1235
648 Ga0068861_100450132 3300005719 Bacteria 1154
649 Ga0068861_100506764 3300005719 Bacteria 1092
650 Ga0068861_100547697 3300005719 Bacteria 1054
651 Ga0068861_102233858 3300005719 Unclassified 548
652 Ga0068861_102532428 3300005719 Bacteria 517
653 Ga0068851_10101840 3300005834 Bacteria 1525
654 Ga0068870_10007356 3300005840 Bacteria 4903
655 Ga0068870_10012486 3300005840 Bacteria 3971
656 Ga0068870_10052341 3300005840 Bacteria 2165
657 Ga0068870_10055842 3300005840 Unclassified 2105
658 Ga0068870_10099479 3300005840 Bacteria 1641
659 Ga0068870_10112032 3300005840 Bacteria 1560
660 Ga0068870_10396432 3300005840 Bacteria 897
661 Ga0068870_10539540 3300005840 Unclassified 784
662 Ga0068870_10673927 3300005840 Bacteria 711
663 Ga0068870_11317444 3300005840 Bacteria 527
664 Ga0068863_100001998 3300005841 Bacteria 20231
665 Ga0068863_100003338 3300005841 Bacteria 15848
666 Ga0068863_100010691 3300005841 Bacteria 8913
667 Ga0068863_100296914 3300005841 Bacteria 1567
668 Ga0068863_100351308 3300005841 Bacteria 1436
669 Ga0068863_100394671 3300005841 Bacteria 1352
670 Ga0068863_100553528 3300005841 Bacteria 1136
671 Ga0068863_100731439 3300005841 Bacteria 985
672 Ga0068863_101208102 3300005841 Bacteria 762
673 Ga0068863_101499439 3300005841 Unclassified 683
674 Ga0068863_101657212 3300005841 Bacteria 649
675 Ga0068858_100017315 3300005842 Bacteria 6759
676 Ga0068858_100018057 3300005842 Bacteria 6606
677 Ga0068858_100041117 3300005842 Bacteria 4288
678 Ga0068858_100052285 3300005842 Bacteria 3779
679 Ga0068858_100055021 3300005842 Bacteria 3678
680 Ga0068858_100078536 3300005842 Bacteria 3067
681 Ga0068858_100085768 3300005842 Unclassified 2930
682 Ga0068858_100150435 3300005842 Bacteria 2189
683 Ga0068858_100155455 3300005842 Unclassified 2152
684 Ga0068858_100226785 3300005842 Bacteria 1770
685 Ga0068858_100248451 3300005842 Bacteria 1689
686 Ga0068858_100297298 3300005842 Bacteria 1540
687 Ga0068858_100618020 3300005842 Unclassified 1052
688 Ga0068858_100637000 3300005842 Bacteria 1035
689 Ga0068858_100830798 3300005842 Bacteria 902
690 Ga0068858_101200908 3300005842 Bacteria 746
691 Ga0068858_101300602 3300005842 Bacteria 716
692 Ga0068858_101399910 3300005842 Bacteria 689
693 Ga0068858_101578364 3300005842 Unclassified 647
694 Ga0068858_101836407 3300005842 Bacteria 599
695 Ga0068858_101873047 3300005842 Bacteria 593
696 Ga0068860_100038835 3300005843 Bacteria 4555
697 Ga0068860_100076543 3300005843 Bacteria 3182
698 Ga0068860_100087884 3300005843 Bacteria 2959
699 Ga0068860_100132440 3300005843 Bacteria 2393
700 Ga0068860_100193257 3300005843 Bacteria 1970
701 Ga0068860_100391717 3300005843 Bacteria 1373
702 Ga0068860_100502177 3300005843 Bacteria 1211
703 Ga0068860_100566985 3300005843 Bacteria 1138
704 Ga0068860_100623495 3300005843 Bacteria 1085
705 Ga0068860_100629188 3300005843 Bacteria 1080
706 Ga0068860_100733962 3300005843 Bacteria 999
707 Ga0068860_101417381 3300005843 Bacteria 716
708 Ga0068860_102266689 3300005843 Bacteria 564
709 Ga0068862_100002296 3300005844 Bacteria 17092
710 Ga0068862_100006007 3300005844 Bacteria 10111
711 Ga0068862_100021571 3300005844 Bacteria 5384
712 Ga0068862_100066542 3300005844 Bacteria 3105
713 Ga0068862_100344154 3300005844 Bacteria 1382
714 Ga0068862_100441079 3300005844 Bacteria 1225
715 Ga0068862_100689126 3300005844 Unclassified 989
716 Ga0068862_100826185 3300005844 Unclassified 906
717 Ga0068862_100894987 3300005844 Bacteria 872
718 Ga0068862_101399557 3300005844 Bacteria 703
719 Ga0068862_102081918 3300005844 Unclassified 578
720 Ga0068862_102300737 3300005844 Bacteria 551
721 Ga0068862_102300860 3300005844 Eukaryota 551
722 Ga0081455_10140765 3300005937 Bacteria 1874
723 Ga0081455_10589558 3300005937 Bacteria 727
724 Ga0081538_10206388 3300005981 Bacteria 799
725 Ga0081539_10000142 3300005985 Bacteria 165444
726 Ga0081539_10000215 3300005985 Bacteria 135054
727 Ga0081539_10003297 3300005985 Bacteria 20197
728 Ga0081539_10059468 3300005985 Bacteria 2104
729 Ga0081539_10260238 3300005985 Bacteria 766
730 Ga0070717_10403199 3300006028 Bacteria 1229
731 Ga0070717_11255778 3300006028 Bacteria 674
732 Ga0075365_10032125 3300006038 Bacteria 3372
733 Ga0075365_11343602 3300006038 Bacteria 502
734 Ga0075368_10018816 3300006042 Bacteria 2601
735 Ga0075368_10034977 3300006042 Bacteria 1959
736 Ga0075364_10005699 3300006051 Bacteria 7263
737 Ga0075364_10071778 3300006051 Bacteria 2281
738 Ga0075432_10144842 3300006058 Bacteria 909
739 Ga0075432_10323013 3300006058 Bacteria 647
740 Ga0075432_10403306 3300006058 Bacteria 591
741 Ga0070715_10009391 3300006163 Bacteria 3446
742 Ga0070715_10564482 3300006163 Unclassified 662
743 Ga0070716_100613314 3300006173 Unclassified 820
744 Ga0070716_100741513 3300006173 Bacteria 755
745 Ga0070712_100253943 3300006175 Bacteria 1406
746 Ga0075362_10070036 3300006177 Bacteria 1600
747 Ga0075367_10024774 3300006178 Bacteria 3385
748 Ga0075367_10145935 3300006178 Bacteria 1467
749 Ga0075367_10271666 3300006178 Bacteria 1065
750 Ga0075366_10005878 3300006195 Bacteria 6672
751 Ga0075366_10009758 3300006195 Bacteria 5367
752 Ga0075366_10130555 3300006195 Unclassified 1516
753 Ga0075366_10168442 3300006195 Bacteria 1329
754 Ga0097621_100000865 3300006237 Bacteria 21270
755 Ga0097621_100007424 3300006237 Bacteria 7841
756 Ga0097621_100017573 3300006237 Bacteria 5435
757 Ga0097621_100028797 3300006237 Bacteria 4381
758 Ga0097621_100033597 3300006237 Bacteria 4086
759 Ga0097621_100052497 3300006237 Bacteria 3321
760 Ga0097621_100057308 3300006237 Bacteria 3185
761 Ga0097621_100068357 3300006237 Bacteria 2930
762 Ga0097621_100070983 3300006237 Bacteria 2877
763 Ga0097621_100116424 3300006237 Bacteria 2263
764 Ga0097621_100187025 3300006237 Bacteria 1792
765 Ga0097621_100246149 3300006237 Bacteria 1564
766 Ga0097621_100255643 3300006237 Bacteria 1535
767 Ga0097621_100419571 3300006237 Bacteria 1201
768 Ga0097621_100504670 3300006237 Bacteria 1096
769 Ga0097621_100522573 3300006237 Archaea 1077
770 Ga0097621_100571254 3300006237 Bacteria 1031
771 Ga0097621_100866837 3300006237 Bacteria 839
772 Ga0097621_101266095 3300006237 Bacteria 696
773 Ga0075370_10008938 3300006353 Bacteria 5178
774 Ga0075370_10490814 3300006353 Bacteria 741
775 Ga0068871_100000059 3300006358 Bacteria 59353
776 Ga0068871_100002585 3300006358 Bacteria 12357
777 Ga0068871_100002961 3300006358 Bacteria 11654
778 Ga0068871_100016611 3300006358 Bacteria 5550
779 Ga0068871_100052496 3300006358 Bacteria 3301
780 Ga0068871_100081776 3300006358 Bacteria 2677
781 Ga0068871_100133827 3300006358 Bacteria 2104
782 Ga0068871_100144872 3300006358 Bacteria 2022
783 Ga0068871_100166908 3300006358 Bacteria 1885
784 Ga0068871_100390354 3300006358 Bacteria 1238
785 Ga0068871_100395821 3300006358 Unclassified 1229
786 Ga0068871_100609372 3300006358 Bacteria 993
787 Ga0068871_100757814 3300006358 Bacteria 893
788 Ga0068871_100857766 3300006358 Unclassified 840
789 Ga0068871_101221149 3300006358 Bacteria 705
790 Ga0068871_101275118 3300006358 Bacteria 690
791 Ga0068871_101543558 3300006358 Bacteria 628
792 Ga0075428_100000008 3300006844 Bacteria 271300
793 Ga0075428_100000566 3300006844 Bacteria 37713
794 Ga0075428_100007672 3300006844 Bacteria 11961
795 Ga0075428_100009392 3300006844 Bacteria 10849
796 Ga0075428_100020179 3300006844 Bacteria 7381
797 Ga0075428_100020584 3300006844 Bacteria 7305
798 Ga0075428_100032218 3300006844 Bacteria 5789
799 Ga0075428_100035640 3300006844 Bacteria 5484
800 Ga0075428_100048480 3300006844 Bacteria 4662
801 Ga0075428_100075003 3300006844 Bacteria 3695
802 Ga0075428_100298362 3300006844 Unclassified 1733
803 Ga0075428_100666966 3300006844 Unclassified 1109
804 Ga0075428_101236637 3300006844 Bacteria 786
805 Ga0075430_100002270 3300006846 Bacteria 15920
806 Ga0075430_100005144 3300006846 Bacteria 11013
807 Ga0075430_100008641 3300006846 Bacteria 8591
808 Ga0075430_100013718 3300006846 Bacteria 6906
809 Ga0075430_100031566 3300006846 Bacteria 4496
810 Ga0075430_100073946 3300006846 Bacteria 2857
811 Ga0075430_100200512 3300006846 Bacteria 1657
812 Ga0075430_100204815 3300006846 Bacteria 1638
813 Ga0075430_100231480 3300006846 Bacteria 1532
814 Ga0075430_100232505 3300006846 Bacteria 1528
815 Ga0075430_100298359 3300006846 Bacteria 1333
816 Ga0075430_101119123 3300006846 Unclassified 648
817 Ga0075430_101284695 3300006846 Unclassified 602
818 Ga0075431_100002134 3300006847 Bacteria 18908
819 Ga0075431_100010616 3300006847 Bacteria 9262
820 Ga0075431_100052863 3300006847 Bacteria 4188
821 Ga0075431_100070686 3300006847 Bacteria 3602
822 Ga0075431_100155262 3300006847 Bacteria 2355
823 Ga0075431_100216098 3300006847 Bacteria 1957
824 Ga0075431_100382412 3300006847 Bacteria 1411
825 Ga0075431_100382706 3300006847 Bacteria 1411
826 Ga0075431_100389377 3300006847 Bacteria 1396
827 Ga0075431_101123518 3300006847 Bacteria 750
828 Ga0075431_101251114 3300006847 Unclassified 704
829 Ga0075433_10000724 3300006852 Bacteria 22572
830 Ga0075433_10010506 3300006852 Bacteria 7433
831 Ga0075433_10018386 3300006852 Bacteria 5809
832 Ga0075433_10037380 3300006852 Bacteria 4189
833 Ga0075433_10047241 3300006852 Bacteria 3744
834 Ga0075433_10062491 3300006852 Bacteria 3261
835 Ga0075433_10195949 3300006852 Bacteria 1797
836 Ga0075433_10207482 3300006852 Bacteria 1742
837 Ga0075433_10302351 3300006852 Bacteria 1417
838 Ga0075433_10362658 3300006852 Bacteria 1280
839 Ga0075433_10425523 3300006852 Bacteria 1171
840 Ga0075433_10535697 3300006852 Bacteria 1030
841 Ga0075433_10650558 3300006852 Bacteria 924
842 Ga0075433_10656242 3300006852 Unclassified 920
843 Ga0075433_10919154 3300006852 Bacteria 763
844 Ga0075433_11257987 3300006852 Bacteria 642
845 Ga0075434_100000793 3300006871 Bacteria 24957
846 Ga0075434_100002391 3300006871 Bacteria 16475
847 Ga0075434_100002842 3300006871 Bacteria 15346
848 Ga0075434_100019631 3300006871 Bacteria 6541
849 Ga0075434_100044204 3300006871 Bacteria 4419
850 Ga0075434_100048758 3300006871 Unclassified 4202
851 Ga0075434_100057737 3300006871 Bacteria 3857
852 Ga0075434_100069185 3300006871 Bacteria 3519
853 Ga0075434_100075740 3300006871 Bacteria 3359
854 Ga0075434_100214320 3300006871 Bacteria 1946
855 Ga0075434_100404055 3300006871 Bacteria 1387
856 Ga0075434_100472009 3300006871 Bacteria 1276
857 Ga0075434_100501634 3300006871 Bacteria 1234
858 Ga0075434_100683762 3300006871 Bacteria 1044
859 Ga0075434_100905748 3300006871 Unclassified 897
860 Ga0075434_101215138 3300006871 Unclassified 766
861 Ga0075434_101279279 3300006871 Bacteria 744
862 Ga0075429_100002891 3300006880 Bacteria 14555
863 Ga0075429_100006250 3300006880 Bacteria 10311
864 Ga0075429_100032448 3300006880 Bacteria 4539
865 Ga0075429_100060972 3300006880 Bacteria 3285
866 Ga0075429_100061831 3300006880 Bacteria 3263
867 Ga0075429_100162057 3300006880 Bacteria 1959
868 Ga0075429_100191132 3300006880 Bacteria 1794
869 Ga0075429_100250088 3300006880 Bacteria 1552
870 Ga0075429_100363290 3300006880 Bacteria 1267
871 Ga0075429_100492723 3300006880 Unclassified 1074
872 Ga0075429_100519075 3300006880 Bacteria 1044
873 Ga0075429_100864569 3300006880 Unclassified 791
874 Ga0075429_101226394 3300006880 Bacteria 655
875 Ga0075429_101454530 3300006880 Bacteria 596
876 Ga0068865_100002965 3300006881 Bacteria 10123
877 Ga0068865_100008261 3300006881 Bacteria 6427
878 Ga0068865_100008264 3300006881 Bacteria 6426
879 Ga0068865_100069535 3300006881 Bacteria 2491
880 Ga0068865_100095345 3300006881 Bacteria 2167
881 Ga0068865_100238053 3300006881 Bacteria 1431
882 Ga0068865_100261227 3300006881 Unclassified 1371
883 Ga0068865_100426217 3300006881 Bacteria 1092
884 Ga0068865_100457464 3300006881 Bacteria 1056
885 Ga0068865_100550692 3300006881 Bacteria 969
886 Ga0068865_100784408 3300006881 Bacteria 821
887 Ga0068865_100940680 3300006881 Bacteria 754
888 Ga0068865_101138237 3300006881 Bacteria 689
889 Ga0068865_101233901 3300006881 Bacteria 663
890 Ga0068865_101287967 3300006881 Bacteria 649
891 Ga0068865_101556149 3300006881 Bacteria 593
892 Ga0075436_100004571 3300006914 Bacteria 9473
893 Ga0075436_100026299 3300006914 Bacteria 4006
894 Ga0075436_100113306 3300006914 Bacteria 1894
895 Ga0075436_100960028 3300006914 Unclassified 641
896 Ga0097620_100023274 3300006931 Bacteria 6217
897 Ga0097620_100033707 3300006931 Bacteria 5141
898 Ga0097620_100048149 3300006931 Bacteria 4282
899 Ga0097620_100055251 3300006931 Bacteria 3995
900 Ga0097620_100061552 3300006931 Bacteria 3782
901 Ga0097620_100066188 3300006931 Bacteria 3648
902 Ga0097620_100111746 3300006931 Bacteria 2795
903 Ga0097620_100113990 3300006931 Bacteria 2767
904 Ga0097620_100140172 3300006931 Bacteria 2492
905 Ga0097620_100187872 3300006931 Bacteria 2150
906 Ga0097620_100235869 3300006931 Bacteria 1918
907 Ga0097620_100256622 3300006931 Bacteria 1839
908 Ga0097620_100521712 3300006931 Bacteria 1283
909 Ga0097620_100880742 3300006931 Unclassified 981
910 Ga0097620_101321761 3300006931 Bacteria 795
911 Ga0097620_101337752 3300006931 Unclassified 790
912 Ga0097620_101920535 3300006931 Unclassified 654
913 Ga0097620_102254837 3300006931 Unclassified 601
914 Ga0075435_100010153 3300007076 Bacteria 6875
915 Ga0075435_100015456 3300007076 Bacteria 5738
916 Ga0075435_100031693 3300007076 Bacteria 4168
917 Ga0075435_100035634 3300007076 Unclassified 3949
918 Ga0075435_100049414 3300007076 Bacteria 3383
919 Ga0075435_100054740 3300007076 Bacteria 3221
920 Ga0075435_100073632 3300007076 Bacteria 2793
921 Ga0075435_100086353 3300007076 Bacteria 2583
922 Ga0075435_100174587 3300007076 Bacteria 1814
923 Ga0075435_100283680 3300007076 Bacteria 1414
924 Ga0075435_100405717 3300007076 Unclassified 1172
925 Ga0075435_100893542 3300007076 Bacteria 775
926 Ga0075435_101891585 3300007076 Bacteria 524
927 Ga0099794_10434603 3300007265 Bacteria 687
928 Ga0099795_10190345 3300007788 Unclassified 861
929 Ga0105251_10129608 3300009011 Unclassified 1143
930 Ga0105250_10346198 3300009092 Bacteria 650
931 Ga0105250_10523649 3300009092 Bacteria 541
932 Ga0105240_10288130 3300009093 Bacteria 1884
933 Ga0105240_12214746 3300009093 Bacteria 570
934 Ga0111539_10000015 3300009094 Bacteria 296576
935 Ga0111539_10000614 3300009094 Bacteria 46152
936 Ga0111539_10001499 3300009094 Bacteria 31175
937 Ga0111539_10008113 3300009094 Bacteria 13378
938 Ga0111539_10026203 3300009094 Bacteria 7133
939 Ga0111539_10032217 3300009094 Bacteria 6367
940 Ga0111539_10046019 3300009094 Bacteria 5222
941 Ga0111539_10055675 3300009094 Bacteria 4702
942 Ga0111539_10060965 3300009094 Bacteria 4470
943 Ga0111539_10258932 3300009094 Bacteria 2025
944 Ga0111539_10281546 3300009094 Bacteria 1935
945 Ga0111539_10294241 3300009094 Bacteria 1889
946 Ga0111539_10682624 3300009094 Bacteria 1196
947 Ga0111539_10742142 3300009094 Bacteria 1143
948 Ga0111539_10779300 3300009094 Bacteria 1113
949 Ga0111539_10883858 3300009094 Bacteria 1039
950 Ga0111539_10990243 3300009094 Bacteria 977
951 Ga0111539_10999903 3300009094 Bacteria 972
952 Ga0111539_11095186 3300009094 Unclassified 926
953 Ga0111539_11114285 3300009094 Bacteria 917
954 Ga0111539_11348489 3300009094 Bacteria 828
955 Ga0111539_11388806 3300009094 Bacteria 815
956 Ga0111539_11648623 3300009094 Bacteria 744
957 Ga0111539_11744952 3300009094 Bacteria 722
958 Ga0111539_12481063 3300009094 Bacteria 601
959 Ga0111539_12737730 3300009094 Bacteria 571
960 Ga0111539_12847257 3300009094 Bacteria 560
961 Ga0105245_10055993 3300009098 Bacteria 3543
962 Ga0105245_10065038 3300009098 Bacteria 3297
963 Ga0105245_10083644 3300009098 Unclassified 2922
964 Ga0105245_10148512 3300009098 Bacteria 2214
965 Ga0105245_11402745 3300009098 Bacteria 749
966 Ga0105245_12335310 3300009098 Unclassified 588
967 Ga0105245_12421108 3300009098 Bacteria 578
968 Ga0105245_13265724 3300009098 Unclassified 502
969 Ga0105247_10001718 3300009101 Bacteria 15435
970 Ga0105247_10023026 3300009101 Bacteria 3751
971 Ga0105247_10085979 3300009101 Bacteria 1989
972 Ga0105247_10160572 3300009101 Bacteria 1488
973 Ga0105247_10837386 3300009101 Bacteria 705
974 Ga0114129_10005721 3300009147 Bacteria 17612
975 Ga0114129_10019565 3300009147 Bacteria 9638
976 Ga0114129_10031894 3300009147 Bacteria 7449
977 Ga0114129_10035574 3300009147 Bacteria 7036
978 Ga0114129_10040259 3300009147 Bacteria 6588
979 Ga0114129_10051572 3300009147 Bacteria 5775
980 Ga0114129_10087222 3300009147 Bacteria 4328
981 Ga0114129_10102117 3300009147 Bacteria 3966
982 Ga0114129_10130531 3300009147 Bacteria 3451
983 Ga0114129_10147174 3300009147 Bacteria 3226
984 Ga0114129_10191711 3300009147 Bacteria 2775
985 Ga0114129_10216144 3300009147 Bacteria 2589
986 Ga0114129_10217395 3300009147 Bacteria 2580
987 Ga0114129_10250077 3300009147 Bacteria 2380
988 Ga0114129_10290917 3300009147 Bacteria 2180
989 Ga0114129_10671763 3300009147 Bacteria 1335
990 Ga0114129_10913818 3300009147 Archaea 1111
991 Ga0114129_11418320 3300009147 Bacteria 856
992 Ga0114129_11504330 3300009147 Bacteria 827
993 Ga0114129_11669653 3300009147 Unclassified 778
994 Ga0114129_11873210 3300009147 Bacteria 728
995 Ga0114129_12147865 3300009147 Bacteria 673
996 Ga0114129_12304585 3300009147 Bacteria 646
997 Ga0114129_13390892 3300009147 Unclassified 513
998 Ga0105243_10049256 3300009148 Bacteria 3323
999 Ga0105243_10065794 3300009148 Bacteria 2913
1000 Ga0105243_10068538 3300009148 Bacteria 2859
1001 Ga0105243_10070835 3300009148 Bacteria 2817
1002 Ga0105243_10436594 3300009148 Bacteria 1225
1003 Ga0105243_10688698 3300009148 Bacteria 995
1004 Ga0105243_10905728 3300009148 Bacteria 878
1005 Ga0105243_10906855 3300009148 Bacteria 877
1006 Ga0105243_11930934 3300009148 Unclassified 624
1007 Ga0105243_11975873 3300009148 Bacteria 617
1008 Ga0105243_12085271 3300009148 Eukaryota 602
1009 Ga0105243_12484706 3300009148 Bacteria 557
1010 Ga0105241_10113334 3300009174 Bacteria 2174
1011 Ga0105241_10968288 3300009174 Bacteria 794
1012 Ga0105241_10974497 3300009174 Bacteria 792
1013 Ga0105242_10012357 3300009176 Bacteria 6572
1014 Ga0105242_10016561 3300009176 Bacteria 5732
1015 Ga0105242_10017161 3300009176 Bacteria 5637
1016 Ga0105242_10017753 3300009176 Bacteria 5551
1017 Ga0105242_10018186 3300009176 Bacteria 5492
1018 Ga0105242_10076151 3300009176 Bacteria 2796
1019 Ga0105242_10098074 3300009176 Bacteria 2478
1020 Ga0105242_10276600 3300009176 Bacteria 1523
1021 Ga0105242_10365403 3300009176 Bacteria 1337
1022 Ga0105242_10576818 3300009176 Bacteria 1083
1023 Ga0105242_10748397 3300009176 Bacteria 962
1024 Ga0105242_10760264 3300009176 Bacteria 955
1025 Ga0105242_10952459 3300009176 Bacteria 863
1026 Ga0105242_11322920 3300009176 Unclassified 745
1027 Ga0105242_11733222 3300009176 Unclassified 662
1028 Ga0105242_12805022 3300009176 Unclassified 538
1029 Ga0105242_13075752 3300009176 Bacteria 517
1030 Ga0105248_10001370 3300009177 Bacteria 27206
1031 Ga0105248_10031364 3300009177 Bacteria 5941
1032 Ga0105248_10050366 3300009177 Bacteria 4670
1033 Ga0105248_10100829 3300009177 Bacteria 3254
1034 Ga0105248_10111207 3300009177 Bacteria 3089
1035 Ga0105248_10115869 3300009177 Bacteria 3022
1036 Ga0105248_10133137 3300009177 Bacteria 2805
1037 Ga0105248_10236464 3300009177 Unclassified 2056
1038 Ga0105248_10509054 3300009177 Bacteria 1357
1039 Ga0105248_10587885 3300009177 Bacteria 1256
1040 Ga0105248_10615351 3300009177 Bacteria 1225
1041 Ga0105248_10689302 3300009177 Unclassified 1153
1042 Ga0105248_10762898 3300009177 Archaea 1092
1043 Ga0105248_10765905 3300009177 Bacteria 1089
1044 Ga0105248_10777537 3300009177 Bacteria 1080
1045 Ga0105248_10852570 3300009177 Bacteria 1028
1046 Ga0105248_10906759 3300009177 Bacteria 995
1047 Ga0105248_11245928 3300009177 Unclassified 841
1048 Ga0105248_11425742 3300009177 Bacteria 784
1049 Ga0105248_11917719 3300009177 Bacteria 672
1050 Ga0105248_12782256 3300009177 Bacteria 558
1051 Ga0105248_13416828 3300009177 Bacteria 504
1052 Ga0105248_13438476 3300009177 Unclassified 503
1053 Ga0105237_11385511 3300009545 Unclassified 709
1054 Ga0105238_10005196 3300009551 Bacteria 12866
1055 Ga0105238_10238192 3300009551 Bacteria 1797
1056 Ga0105238_10494359 3300009551 Bacteria 1223
1057 Ga0105238_12564432 3300009551 Bacteria 546
1058 Ga0105249_10000649 3300009553 Bacteria 31693
1059 Ga0105249_10009366 3300009553 Bacteria 8568
1060 Ga0105249_10029742 3300009553 Bacteria 4935
1061 Ga0105249_10284787 3300009553 Bacteria 1652
1062 Ga0105249_10449552 3300009553 Bacteria 1327
1063 Ga0105249_10508561 3300009553 Bacteria 1251
1064 Ga0105249_10697434 3300009553 Unclassified 1075
1065 Ga0105249_10723204 3300009553 Bacteria 1057
1066 Ga0105249_11014393 3300009553 Bacteria 899
1067 Ga0105249_11267996 3300009553 Bacteria 808
1068 Ga0105249_11628161 3300009553 Bacteria 718
1069 Ga0099796_10574844 3300010159 Unclassified 507
1070 Ga0105239_10032758 3300010375 Bacteria 5711
1071 Ga0105239_10928638 3300010375 Bacteria 999
1072 Ga0105239_11221616 3300010375 Bacteria 866
1073 Ga0105239_13188317 3300010375 Bacteria 534
1074 Ga0105239_13456811 3300010375 Bacteria 513
1075 Ga0105246_10192154 3300011119 Bacteria 1581
1076 Ga0105246_11120484 3300011119 Unclassified 720
1077 Ga0105246_11219835 3300011119 Bacteria 693
1078 Ga0105246_11297646 3300011119 Unclassified 674
1079 Ga0157328_1022269 3300012478 Unclassified 544
1080 Ga0157328_1023021 3300012478 Unclassified 540
1081 Ga0157325_1038831 3300012485 Bacteria 510
1082 Ga0157323_1034993 3300012495 Bacteria 551
1083 Ga0157339_1072190 3300012505 Unclassified 500
1084 Ga0157373_10959965 3300013100 Unclassified 636
1085 Ga0157371_10188614 3300013102 Unclassified 1476
1086 Ga0157371_10482124 3300013102 Unclassified 914
1087 Ga0157371_10890394 3300013102 Bacteria 674
1088 Ga0157370_10620678 3300013104 Unclassified 989
1089 Ga0157370_11235337 3300013104 Bacteria 674
1090 Ga0157369_12220078 3300013105 Bacteria 556
1091 Ga0157369_12522979 3300013105 Bacteria 520
1092 Ga0157374_10197987 3300013296 Bacteria 1967
1093 Ga0157374_10209676 3300013296 Bacteria 1910
1094 Ga0157374_10681886 3300013296 Bacteria 1040
1095 Ga0157374_10819470 3300013296 Unclassified 947
1096 Ga0157374_10908549 3300013296 Bacteria 898
1097 Ga0157378_10001288 3300013297 Bacteria 22567
1098 Ga0157378_10013431 3300013297 Bacteria 7159
1099 Ga0157378_10022222 3300013297 Bacteria 5583
1100 Ga0157378_10190523 3300013297 Bacteria 1934
1101 Ga0157378_10290680 3300013297 Bacteria 1579
1102 Ga0157378_10340369 3300013297 Unclassified 1463
1103 Ga0157378_10691402 3300013297 Bacteria 1039
1104 Ga0157378_10788647 3300013297 Bacteria 975
1105 Ga0157378_10969956 3300013297 Bacteria 883
1106 Ga0157378_11056683 3300013297 Bacteria 848
1107 Ga0157378_11374119 3300013297 Bacteria 749
1108 Ga0157378_11404491 3300013297 Bacteria 741
1109 Ga0157378_11898156 3300013297 Bacteria 645
1110 Ga0157378_12523049 3300013297 Bacteria 566
1111 Ga0163162_10020439 3300013306 Bacteria 6507
1112 Ga0163162_10106674 3300013306 Bacteria 2896
1113 Ga0163162_10276266 3300013306 Unclassified 1812
1114 Ga0163162_10333100 3300013306 Bacteria 1650
1115 Ga0163162_10372383 3300013306 Bacteria 1561
1116 Ga0163162_11285172 3300013306 Unclassified 831
1117 Ga0163162_11535983 3300013306 Unclassified 759
1118 Ga0163162_11690372 3300013306 Bacteria 723
1119 Ga0163162_12065647 3300013306 Bacteria 653
1120 Ga0163162_12107423 3300013306 Unclassified 647
1121 Ga0163162_12698906 3300013306 Unclassified 572
1122 Ga0157372_10131584 3300013307 Bacteria 2879
1123 Ga0157372_12564209 3300013307 Bacteria 585
1124 Ga0157375_10022924 3300013308 Bacteria 5753
1125 Ga0157375_10024718 3300013308 Bacteria 5565
1126 Ga0157375_10169053 3300013308 Bacteria 2333
1127 Ga0157375_10232019 3300013308 Bacteria 2004
1128 Ga0157375_10241579 3300013308 Bacteria 1966
1129 Ga0157375_10251020 3300013308 Bacteria 1930
1130 Ga0157375_10637308 3300013308 Bacteria 1223
1131 Ga0157375_10786672 3300013308 Bacteria 1101
1132 Ga0157375_10888477 3300013308 Bacteria 1036
1133 Ga0157375_10904311 3300013308 Bacteria 1026
1134 Ga0157375_11121992 3300013308 Unclassified 921
1135 Ga0157375_11131371 3300013308 Bacteria 917
1136 Ga0157375_11370078 3300013308 Bacteria 833
1137 Ga0157375_11454239 3300013308 Unclassified 808
1138 Ga0157375_11860980 3300013308 Bacteria 714
1139 Ga0157375_12372732 3300013308 Bacteria 633
1140 Ga0157375_13014863 3300013308 Bacteria 562
1141 Ga0163163_10000717 3300014325 Bacteria 28089
1142 Ga0163163_10009403 3300014325 Bacteria 8727
1143 Ga0163163_10074861 3300014325 Bacteria 3379
1144 Ga0163163_10250007 3300014325 Bacteria 1823
1145 Ga0163163_10553369 3300014325 Bacteria 1213
1146 Ga0163163_10704694 3300014325 Bacteria 1073
1147 Ga0163163_10778547 3300014325 Bacteria 1020
1148 Ga0163163_11256238 3300014325 Bacteria 803
1149 Ga0157380_10006726 3300014326 Bacteria 8123
1150 Ga0157380_10007218 3300014326 Bacteria 7876
1151 Ga0157380_10023279 3300014326 Bacteria 4671
1152 Ga0157380_10046654 3300014326 Bacteria 3404
1153 Ga0157380_10085336 3300014326 Bacteria 2591
1154 Ga0157380_10279374 3300014326 Bacteria 1527
1155 Ga0157380_10301850 3300014326 Bacteria 1475
1156 Ga0157380_10328315 3300014326 Bacteria 1421
1157 Ga0157380_10470602 3300014326 Bacteria 1212
1158 Ga0157380_10611936 3300014326 Bacteria 1080
1159 Ga0157380_10779636 3300014326 Bacteria 971
1160 Ga0157380_10979954 3300014326 Bacteria 877
1161 Ga0157380_11813429 3300014326 Bacteria 669
1162 Ga0157380_12258795 3300014326 Unclassified 608
1163 Ga0157380_12264878 3300014326 Bacteria 608
1164 Ga0157380_12919959 3300014326 Bacteria 544
1165 Ga0182008_10814496 3300014497 Unclassified 543
1166 Ga0157377_10025400 3300014745 Bacteria 3160
1167 Ga0157377_10166001 3300014745 Unclassified 1377
1168 Ga0157377_10301950 3300014745 Bacteria 1057
1169 Ga0157377_10339280 3300014745 Bacteria 1004
1170 Ga0157377_10399472 3300014745 Bacteria 936
1171 Ga0157377_10669131 3300014745 Bacteria 750
1172 Ga0157377_11029621 3300014745 Bacteria 626
1173 Ga0157379_10003113 3300014968 Bacteria 14032
1174 Ga0157379_10054418 3300014968 Bacteria 3575
1175 Ga0157379_10059336 3300014968 Bacteria 3421
1176 Ga0157379_10087318 3300014968 Unclassified 2797
1177 Ga0157379_10323502 3300014968 Bacteria 1408
1178 Ga0157379_10382130 3300014968 Bacteria 1292
1179 Ga0157379_10957081 3300014968 Unclassified 814
1180 Ga0157376_10016289 3300014969 Bacteria 5639
1181 Ga0157376_10030353 3300014969 Bacteria 4316
1182 Ga0157376_10040405 3300014969 Bacteria 3812
1183 Ga0157376_10049730 3300014969 Bacteria 3474
1184 Ga0157376_10060290 3300014969 Bacteria 3186
1185 Ga0157376_10076563 3300014969 Bacteria 2859
1186 Ga0157376_10088434 3300014969 Bacteria 2676
1187 Ga0157376_10216296 3300014969 Bacteria 1772
1188 Ga0157376_10277547 3300014969 Bacteria 1577
1189 Ga0157376_10540816 3300014969 Bacteria 1151
1190 Ga0157376_10568706 3300014969 Bacteria 1124
1191 Ga0157376_10616443 3300014969 Bacteria 1082
1192 Ga0157376_10667238 3300014969 Bacteria 1042
1193 Ga0157376_10734995 3300014969 Bacteria 995
1194 Ga0157376_10832661 3300014969 Bacteria 937
1195 Ga0157376_10885766 3300014969 Unclassified 910
1196 Ga0157376_12023276 3300014969 Unclassified 614
1197 Ga0182007_10401862 3300015262 Bacteria 522
1198 Ga0163161_10091292 3300017792 Bacteria 2254
1199 Ga0163161_10185396 3300017792 Bacteria 1597
1200 Ga0163161_10451381 3300017792 Bacteria 1039
1201 Ga0163161_10576695 3300017792 Bacteria 925
1202 Ga0163161_11963672 3300017792 Unclassified 521
1203 Ga0213876_10032805 3300021384 Bacteria 2738
1204 Ga0213876_10244367 3300021384 Bacteria 954
1205 Ga0213876_10333909 3300021384 Bacteria 806
1206 Ga0207666_1051100 3300025271 Bacteria 655
1207 Ga0207697_10003624 3300025315 Bacteria 7575
1208 Ga0207697_10015956 3300025315 Bacteria 3098
1209 Ga0207697_10103317 3300025315 Unclassified 1216
1210 Ga0207697_10141949 3300025315 Bacteria 1042
1211 Ga0207697_10150675 3300025315 Bacteria 1012
1212 Ga0207697_10159818 3300025315 Bacteria 983
1213 Ga0207697_10468761 3300025315 Bacteria 558
1214 Ga0207697_10503975 3300025315 Bacteria 534
1215 Ga0207713_1246112 3300025735 Bacteria 529
1216 Ga0207653_10012866 3300025885 Bacteria 2616
1217 Ga0207653_10149889 3300025885 Bacteria 858
1218 Ga0207653_10277309 3300025885 Bacteria 647
1219 Ga0207653_10416724 3300025885 Bacteria 527
1220 Ga0207682_10003849 3300025893 Bacteria 6441
1221 Ga0207682_10005690 3300025893 Bacteria 5057
1222 Ga0207682_10075178 3300025893 Bacteria 1438
1223 Ga0207682_10118542 3300025893 Bacteria 1172
1224 Ga0207682_10307391 3300025893 Bacteria 744
1225 Ga0207642_10073914 3300025899 Bacteria 1632
1226 Ga0207642_10138506 3300025899 Bacteria 1280
1227 Ga0207642_10145099 3300025899 Bacteria 1256
1228 Ga0207642_10237490 3300025899 Bacteria 1027
1229 Ga0207642_10255923 3300025899 Unclassified 996
1230 Ga0207642_10430994 3300025899 Bacteria 795
1231 Ga0207642_10498589 3300025899 Bacteria 745
1232 Ga0207642_10914506 3300025899 Bacteria 562
1233 Ga0207710_10003072 3300025900 Bacteria 7494
1234 Ga0207710_10095348 3300025900 Bacteria 1398
1235 Ga0207710_10129893 3300025900 Bacteria 1209
1236 Ga0207688_10000138 3300025901 Bacteria 30845
1237 Ga0207688_10022145 3300025901 Unclassified 3476
1238 Ga0207688_10085188 3300025901 Bacteria 1810
1239 Ga0207688_10088352 3300025901 Bacteria 1777
1240 Ga0207688_10470832 3300025901 Bacteria 785
1241 Ga0207688_10977919 3300025901 Bacteria 535
1242 Ga0207680_10030593 3300025903 Bacteria 3038
1243 Ga0207680_10035103 3300025903 Bacteria 2875
1244 Ga0207680_10062044 3300025903 Bacteria 2282
1245 Ga0207680_10094028 3300025903 Bacteria 1913
1246 Ga0207680_10099123 3300025903 Bacteria 1869
1247 Ga0207680_10106106 3300025903 Bacteria 1813
1248 Ga0207680_10816205 3300025903 Bacteria 669
1249 Ga0207680_10997002 3300025903 Bacteria 600
1250 Ga0207647_10033238 3300025904 Unclassified 3304
1251 Ga0207647_10347698 3300025904 Bacteria 840
1252 Ga0207647_10700986 3300025904 Bacteria 552
1253 Ga0207685_10153284 3300025905 Bacteria 1045
1254 Ga0207685_10288607 3300025905 Bacteria 808
1255 Ga0207685_10293698 3300025905 Unclassified 802
1256 Ga0207685_10320980 3300025905 Bacteria 772
1257 Ga0207685_10605475 3300025905 Unclassified 588
1258 Ga0207699_10089374 3300025906 Bacteria 1930
1259 Ga0207699_10146666 3300025906 Bacteria 1557
1260 Ga0207699_10590096 3300025906 Bacteria 808
1261 Ga0207699_10639111 3300025906 Bacteria 777
1262 Ga0207645_10003300 3300025907 Bacteria 12310
1263 Ga0207645_10007441 3300025907 Bacteria 7733
1264 Ga0207645_10056725 3300025907 Bacteria 2500
1265 Ga0207645_10076430 3300025907 Bacteria 2145
1266 Ga0207645_10081928 3300025907 Bacteria 2068
1267 Ga0207645_10100278 3300025907 Bacteria 1868
1268 Ga0207645_10205645 3300025907 Bacteria 1296
1269 Ga0207645_10222233 3300025907 Bacteria 1245
1270 Ga0207645_10269401 3300025907 Bacteria 1129
1271 Ga0207645_10414452 3300025907 Bacteria 907
1272 Ga0207645_11171025 3300025907 Bacteria 517
1273 Ga0207643_10001065 3300025908 Bacteria 16221
1274 Ga0207643_10013253 3300025908 Bacteria 4463
1275 Ga0207643_10018749 3300025908 Bacteria 3790
1276 Ga0207643_10019547 3300025908 Unclassified 3713
1277 Ga0207643_10049257 3300025908 Bacteria 2387
1278 Ga0207643_10076123 3300025908 Bacteria 1938
1279 Ga0207643_10281452 3300025908 Bacteria 1031
1280 Ga0207643_10546201 3300025908 Unclassified 743
1281 Ga0207643_10687684 3300025908 Bacteria 661
1282 Ga0207643_11045347 3300025908 Bacteria 528
1283 Ga0207684_10103122 3300025910 Bacteria 2439
1284 Ga0207684_10323689 3300025910 Bacteria 1329
1285 Ga0207684_10333968 3300025910 Bacteria 1306
1286 Ga0207684_10383542 3300025910 Bacteria 1209
1287 Ga0207684_10945882 3300025910 Bacteria 723
1288 Ga0207684_11524171 3300025910 Bacteria 543
1289 Ga0207654_10665156 3300025911 Bacteria 747
1290 Ga0207707_10209114 3300025912 Unclassified 1700
1291 Ga0207707_10333195 3300025912 Bacteria 1309
1292 Ga0207707_10333301 3300025912 Unclassified 1309
1293 Ga0207707_10336137 3300025912 Unclassified 1303
1294 Ga0207707_10829370 3300025912 Bacteria 769
1295 Ga0207707_11539035 3300025912 Bacteria 526
1296 Ga0207695_10163026 3300025913 Unclassified 2159
1297 Ga0207671_10756877 3300025914 Unclassified 771
1298 Ga0207693_11245594 3300025915 Bacteria 559
1299 Ga0207663_10134805 3300025916 Bacteria 1712
1300 Ga0207663_10644152 3300025916 Bacteria 836
1301 Ga0207663_11644426 3300025916 Unclassified 517
1302 Ga0207660_10385855 3300025917 Bacteria 1126
1303 Ga0207660_10548516 3300025917 Bacteria 940
1304 Ga0207662_10005102 3300025918 Bacteria 6966
1305 Ga0207662_10007755 3300025918 Bacteria 5848
1306 Ga0207662_10038839 3300025918 Unclassified 2790
1307 Ga0207662_10099683 3300025918 Unclassified 1799
1308 Ga0207662_10159667 3300025918 Bacteria 1439
1309 Ga0207662_10275010 3300025918 Unclassified 1112
1310 Ga0207662_10381153 3300025918 Unclassified 953
1311 Ga0207662_10419290 3300025918 Bacteria 911
1312 Ga0207657_10385960 3300025919 Bacteria 1102
1313 Ga0207649_10095844 3300025920 Bacteria 1953
1314 Ga0207649_10097718 3300025920 Bacteria 1937
1315 Ga0207649_10123245 3300025920 Bacteria 1750
1316 Ga0207649_10174316 3300025920 Bacteria 1501
1317 Ga0207649_10192368 3300025920 Bacteria 1436
1318 Ga0207649_10269776 3300025920 Bacteria 1233
1319 Ga0207649_10713769 3300025920 Unclassified 778
1320 Ga0207649_11304461 3300025920 Unclassified 574
1321 Ga0207649_11404144 3300025920 Unclassified 552
1322 Ga0207652_10296057 3300025921 Unclassified 1460
1323 Ga0207652_10760477 3300025921 Bacteria 862
1324 Ga0207652_11205393 3300025921 Unclassified 659
1325 Ga0207646_10033194 3300025922 Bacteria 4670
1326 Ga0207646_10065518 3300025922 Bacteria 3244
1327 Ga0207646_10099463 3300025922 Bacteria 2606
1328 Ga0207646_10246298 3300025922 Unclassified 1614
1329 Ga0207646_10443266 3300025922 Bacteria 1172
1330 Ga0207646_10537205 3300025922 Bacteria 1052
1331 Ga0207646_10583901 3300025922 Bacteria 1004
1332 Ga0207646_11231025 3300025922 Bacteria 655
1333 Ga0207646_11651277 3300025922 Bacteria 552
1334 Ga0207681_10004036 3300025923 Bacteria 9105
1335 Ga0207681_10006880 3300025923 Bacteria 6978
1336 Ga0207681_10020465 3300025923 Bacteria 4193
1337 Ga0207681_10030036 3300025923 Bacteria 3539
1338 Ga0207681_10053433 3300025923 Unclassified 2742
1339 Ga0207681_10053942 3300025923 Unclassified 2731
1340 Ga0207681_10122808 3300025923 Bacteria 1907
1341 Ga0207681_10217227 3300025923 Bacteria 1477
1342 Ga0207681_10228419 3300025923 Bacteria 1443
1343 Ga0207681_10394227 3300025923 Bacteria 1117
1344 Ga0207681_10531861 3300025923 Bacteria 966
1345 Ga0207681_10719588 3300025923 Bacteria 831
1346 Ga0207681_10810290 3300025923 Bacteria 782
1347 Ga0207681_11005697 3300025923 Bacteria 699
1348 Ga0207681_11475921 3300025923 Bacteria 570
1349 Ga0207681_11803993 3300025923 Unclassified 510
1350 Ga0207694_10325114 3300025924 Bacteria 1270
1351 Ga0207694_10986457 3300025924 Bacteria 713
1352 Ga0207694_11013191 3300025924 Bacteria 703
1353 Ga0207650_10006789 3300025925 Bacteria 7806
1354 Ga0207650_10015336 3300025925 Bacteria 5335
1355 Ga0207650_10021331 3300025925 Bacteria 4577
1356 Ga0207650_10071813 3300025925 Bacteria 2605
1357 Ga0207650_10132328 3300025925 Bacteria 1953
1358 Ga0207650_10254798 3300025925 Bacteria 1422
1359 Ga0207650_10358597 3300025925 Bacteria 1201
1360 Ga0207650_11111867 3300025925 Bacteria 673
1361 Ga0207650_11759335 3300025925 Unclassified 525
1362 Ga0207650_11853003 3300025925 Bacteria 510
1363 Ga0207659_10000672 3300025926 Bacteria 20255
1364 Ga0207659_10008654 3300025926 Bacteria 6331
1365 Ga0207659_10010072 3300025926 Bacteria 5923
1366 Ga0207659_10015560 3300025926 Bacteria 4932
1367 Ga0207659_10017439 3300025926 Bacteria 4691
1368 Ga0207659_10054978 3300025926 Bacteria 2845
1369 Ga0207659_10072338 3300025926 Bacteria 2520
1370 Ga0207659_10103444 3300025926 Bacteria 2152
1371 Ga0207659_10167391 3300025926 Bacteria 1731
1372 Ga0207659_10167769 3300025926 Bacteria 1729
1373 Ga0207659_10219285 3300025926 Bacteria 1528
1374 Ga0207659_10264111 3300025926 Bacteria 1402
1375 Ga0207659_10453843 3300025926 Bacteria 1080
1376 Ga0207659_10463913 3300025926 Bacteria 1068
1377 Ga0207659_10644819 3300025926 Bacteria 905
1378 Ga0207659_10651802 3300025926 Bacteria 900
1379 Ga0207659_10686407 3300025926 Bacteria 876
1380 Ga0207659_11386650 3300025926 Bacteria 603
1381 Ga0207659_11557642 3300025926 Bacteria 565
1382 Ga0207687_10006511 3300025927 Bacteria 7714
1383 Ga0207687_10009381 3300025927 Bacteria 6400
1384 Ga0207687_10184806 3300025927 Bacteria 1617
1385 Ga0207687_10301438 3300025927 Bacteria 1291
1386 Ga0207687_10457319 3300025927 Bacteria 1059
1387 Ga0207687_11279774 3300025927 Bacteria 630
1388 Ga0207687_11938657 3300025927 Unclassified 503
1389 Ga0207700_10020337 3300025928 Bacteria 4506
1390 Ga0207700_10062152 3300025928 Bacteria 2836
1391 Ga0207700_10366714 3300025928 Unclassified 1257
1392 Ga0207700_10600523 3300025928 Unclassified 979
1393 Ga0207664_10085341 3300025929 Bacteria 2576
1394 Ga0207644_10021145 3300025931 Bacteria 4429
1395 Ga0207644_10043339 3300025931 Bacteria 3193
1396 Ga0207644_10113896 3300025931 Bacteria 2049
1397 Ga0207644_10164275 3300025931 Unclassified 1728
1398 Ga0207644_10164678 3300025931 Bacteria 1726
1399 Ga0207644_10165731 3300025931 Unclassified 1721
1400 Ga0207644_10349082 3300025931 Bacteria 1201
1401 Ga0207644_10500380 3300025931 Bacteria 1002
1402 Ga0207644_10540586 3300025931 Bacteria 964
1403 Ga0207644_10838566 3300025931 Bacteria 769
1404 Ga0207644_10965457 3300025931 Bacteria 715
1405 Ga0207644_11414446 3300025931 Bacteria 584
1406 Ga0207690_10016531 3300025932 Bacteria 4491
1407 Ga0207690_10212124 3300025932 Bacteria 1477
1408 Ga0207690_11162905 3300025932 Unclassified 644
1409 Ga0207706_10042039 3300025933 Bacteria 4050
1410 Ga0207706_10050955 3300025933 Bacteria 3657
1411 Ga0207706_10060055 3300025933 Bacteria 3348
1412 Ga0207706_10091400 3300025933 Bacteria 2676
1413 Ga0207706_10259045 3300025933 Bacteria 1519
1414 Ga0207706_10274350 3300025933 Bacteria 1471
1415 Ga0207706_10304118 3300025933 Bacteria 1389
1416 Ga0207706_10328216 3300025933 Unclassified 1331
1417 Ga0207706_10432479 3300025933 Unclassified 1140
1418 Ga0207706_10525004 3300025933 Unclassified 1021
1419 Ga0207706_10535898 3300025933 Bacteria 1009
1420 Ga0207706_10600299 3300025933 Bacteria 945
1421 Ga0207706_10644987 3300025933 Bacteria 907
1422 Ga0207706_11058489 3300025933 Unclassified 679
1423 Ga0207706_11472716 3300025933 Bacteria 556
1424 Ga0207706_11490082 3300025933 Bacteria 552
1425 Ga0207686_10018666 3300025934 Bacteria 3929
1426 Ga0207686_10053530 3300025934 Bacteria 2523
1427 Ga0207686_10065868 3300025934 Bacteria 2312
1428 Ga0207686_10109154 3300025934 Bacteria 1863
1429 Ga0207686_10208191 3300025934 Bacteria 1405
1430 Ga0207686_10321130 3300025934 Bacteria 1157
1431 Ga0207686_10358057 3300025934 Unclassified 1100
1432 Ga0207686_10376195 3300025934 Bacteria 1076
1433 Ga0207686_10472911 3300025934 Bacteria 968
1434 Ga0207686_10697933 3300025934 Bacteria 806
1435 Ga0207686_11043457 3300025934 Bacteria 665
1436 Ga0207686_11072455 3300025934 Bacteria 656
1437 Ga0207709_10069120 3300025935 Bacteria 2235
1438 Ga0207709_10431503 3300025935 Bacteria 1014
1439 Ga0207709_10524697 3300025935 Unclassified 928
1440 Ga0207709_10857114 3300025935 Unclassified 736
1441 Ga0207709_11206299 3300025935 Bacteria 624
1442 Ga0207670_10033694 3300025936 Unclassified 3303
1443 Ga0207670_10037527 3300025936 Bacteria 3158
1444 Ga0207670_10106275 3300025936 Bacteria 2013
1445 Ga0207670_10148138 3300025936 Bacteria 1738
1446 Ga0207670_10183068 3300025936 Unclassified 1579
1447 Ga0207670_10222550 3300025936 Bacteria 1445
1448 Ga0207670_10320101 3300025936 Bacteria 1220
1449 Ga0207670_11015506 3300025936 Bacteria 698
1450 Ga0207670_11774043 3300025936 Bacteria 525
1451 Ga0207669_10016305 3300025937 Bacteria 3771
1452 Ga0207669_10028238 3300025937 Bacteria 3084
1453 Ga0207669_10085976 3300025937 Unclassified 2032
1454 Ga0207669_10139534 3300025937 Bacteria 1680
1455 Ga0207669_10206774 3300025937 Bacteria 1429
1456 Ga0207669_10645182 3300025937 Unclassified 865
1457 Ga0207669_10843816 3300025937 Bacteria 762
1458 Ga0207669_10855969 3300025937 Bacteria 757
1459 Ga0207669_10912435 3300025937 Bacteria 734
1460 Ga0207669_10942726 3300025937 Unclassified 723
1461 Ga0207669_11189810 3300025937 Unclassified 645
1462 Ga0207669_11367815 3300025937 Bacteria 602
1463 Ga0207669_11381538 3300025937 Unclassified 599
1464 Ga0207669_11550686 3300025937 Bacteria 565
1465 Ga0207669_11627250 3300025937 Unclassified 551
1466 Ga0207704_10010227 3300025938 Bacteria 4566
1467 Ga0207704_10018686 3300025938 Bacteria 3625
1468 Ga0207704_10023158 3300025938 Bacteria 3342
1469 Ga0207704_10202896 3300025938 Bacteria 1453
1470 Ga0207704_10273011 3300025938 Unclassified 1281
1471 Ga0207704_10384581 3300025938 Unclassified 1102
1472 Ga0207704_10430039 3300025938 Bacteria 1049
1473 Ga0207704_10794668 3300025938 Bacteria 790
1474 Ga0207665_10249914 3300025939 Bacteria 1310
1475 Ga0207665_10325536 3300025939 Unclassified 1154
1476 Ga0207665_10494538 3300025939 Unclassified 944
1477 Ga0207691_10002430 3300025940 Bacteria 18233
1478 Ga0207691_10015439 3300025940 Bacteria 7263
1479 Ga0207691_10022904 3300025940 Bacteria 5887
1480 Ga0207691_10045686 3300025940 Bacteria 4025
1481 Ga0207691_10049327 3300025940 Bacteria 3857
1482 Ga0207691_10049665 3300025940 Bacteria 3844
1483 Ga0207691_10067339 3300025940 Bacteria 3238
1484 Ga0207691_10077940 3300025940 Bacteria 2984
1485 Ga0207691_10096948 3300025940 Unclassified 2636
1486 Ga0207691_10133173 3300025940 Bacteria 2194
1487 Ga0207691_10143538 3300025940 Bacteria 2102
1488 Ga0207691_10160333 3300025940 Bacteria 1974
1489 Ga0207691_10172093 3300025940 Bacteria 1896
1490 Ga0207691_10206339 3300025940 Bacteria 1709
1491 Ga0207691_10307619 3300025940 Bacteria 1361
1492 Ga0207691_10492705 3300025940 Bacteria 1041
1493 Ga0207691_11144227 3300025940 Bacteria 646
1494 Ga0207691_11241134 3300025940 Bacteria 617
1495 Ga0207711_10003652 3300025941 Bacteria 13302
1496 Ga0207711_10017668 3300025941 Bacteria 5925
1497 Ga0207711_10035423 3300025941 Bacteria 4230
1498 Ga0207711_10058711 3300025941 Unclassified 3312
1499 Ga0207711_10137829 3300025941 Bacteria 2193
1500 Ga0207711_10146665 3300025941 Bacteria 2126
1501 Ga0207711_10153463 3300025941 Bacteria 2080
1502 Ga0207711_10177045 3300025941 Bacteria 1938
1503 Ga0207711_10306585 3300025941 Archaea 1465
1504 Ga0207711_10316594 3300025941 Bacteria 1441
1505 Ga0207711_10337125 3300025941 Bacteria 1395
1506 Ga0207711_10410826 3300025941 Bacteria 1258
1507 Ga0207711_10443133 3300025941 Unclassified 1209
1508 Ga0207711_10579202 3300025941 Unclassified 1047
1509 Ga0207711_11010000 3300025941 Unclassified 771
1510 Ga0207711_11123835 3300025941 Unclassified 727
1511 Ga0207711_11185624 3300025941 Bacteria 705
1512 Ga0207689_10001000 3300025942 Bacteria 27148
1513 Ga0207689_10028090 3300025942 Bacteria 4706
1514 Ga0207689_10032206 3300025942 Bacteria 4361
1515 Ga0207689_10068729 3300025942 Bacteria 2911
1516 Ga0207689_10069921 3300025942 Bacteria 2884
1517 Ga0207689_10118743 3300025942 Unclassified 2175
1518 Ga0207689_10151265 3300025942 Bacteria 1913
1519 Ga0207689_10263808 3300025942 Bacteria 1425
1520 Ga0207689_10351134 3300025942 Bacteria 1226
1521 Ga0207689_10380565 3300025942 Bacteria 1175
1522 Ga0207689_10626298 3300025942 Unclassified 906
1523 Ga0207689_11233095 3300025942 Unclassified 629
1524 Ga0207689_11292475 3300025942 Bacteria 613
1525 Ga0207689_11389403 3300025942 Unclassified 589
1526 Ga0207689_11502209 3300025942 Bacteria 563
1527 Ga0207661_10009993 3300025944 Bacteria 6819
1528 Ga0207661_10023250 3300025944 Bacteria 4682
1529 Ga0207661_10046602 3300025944 Bacteria 3438
1530 Ga0207661_10349138 3300025944 Unclassified 1334
1531 Ga0207661_10438972 3300025944 Bacteria 1188
1532 Ga0207679_10006536 3300025945 Bacteria 7367
1533 Ga0207679_10054236 3300025945 Bacteria 2950
1534 Ga0207679_10118006 3300025945 Bacteria 2106
1535 Ga0207679_10126652 3300025945 Bacteria 2042
1536 Ga0207679_10159218 3300025945 Unclassified 1847
1537 Ga0207679_10252783 3300025945 Bacteria 1499
1538 Ga0207679_10583326 3300025945 Bacteria 1006
1539 Ga0207679_10681929 3300025945 Bacteria 931
1540 Ga0207679_10690130 3300025945 Bacteria 926
1541 Ga0207679_10739279 3300025945 Bacteria 894
1542 Ga0207679_10818092 3300025945 Bacteria 850
1543 Ga0207679_10847664 3300025945 Unclassified 835
1544 Ga0207679_11192485 3300025945 Bacteria 699
1545 Ga0207651_10011075 3300025960 Bacteria 5030
1546 Ga0207651_10039513 3300025960 Unclassified 3112
1547 Ga0207651_10078681 3300025960 Bacteria 2366
1548 Ga0207651_10140852 3300025960 Bacteria 1862
1549 Ga0207651_10142985 3300025960 Bacteria 1851
1550 Ga0207651_10150586 3300025960 Bacteria 1810
1551 Ga0207651_10315301 3300025960 Bacteria 1305
1552 Ga0207651_10481926 3300025960 Bacteria 1069
1553 Ga0207651_10502655 3300025960 Bacteria 1048
1554 Ga0207651_10525405 3300025960 Unclassified 1026
1555 Ga0207651_10529595 3300025960 Unclassified 1022
1556 Ga0207651_10648648 3300025960 Bacteria 927
1557 Ga0207651_10927179 3300025960 Bacteria 776
1558 Ga0207651_10953364 3300025960 Bacteria 765
1559 Ga0207651_11768869 3300025960 Bacteria 556
1560 Ga0207651_11822847 3300025960 Bacteria 547
1561 Ga0207712_10037308 3300025961 Bacteria 3315
1562 Ga0207712_10040684 3300025961 Bacteria 3192
1563 Ga0207712_10306760 3300025961 Bacteria 1305
1564 Ga0207712_10374776 3300025961 Bacteria 1189
1565 Ga0207712_10539496 3300025961 Bacteria 1002
1566 Ga0207712_11093036 3300025961 Bacteria 710
1567 Ga0207712_11207684 3300025961 Unclassified 675
1568 Ga0207712_11438514 3300025961 Archaea 617
1569 Ga0207668_10022797 3300025972 Bacteria 4013
1570 Ga0207668_10038106 3300025972 Bacteria 3223
1571 Ga0207668_10492228 3300025972 Unclassified 1053
1572 Ga0207668_10548055 3300025972 Bacteria 1001
1573 Ga0207668_10633182 3300025972 Bacteria 934
1574 Ga0207668_10689759 3300025972 Bacteria 897
1575 Ga0207668_10718906 3300025972 Bacteria 879
1576 Ga0207668_10736437 3300025972 Unclassified 869
1577 Ga0207668_11039742 3300025972 Unclassified 733
1578 Ga0207668_11376203 3300025972 Bacteria 636
1579 Ga0207668_11887601 3300025972 Unclassified 539
1580 Ga0207640_10027866 3300025981 Bacteria 3446
1581 Ga0207640_10075286 3300025981 Bacteria 2287
1582 Ga0207640_10098175 3300025981 Bacteria 2047
1583 Ga0207640_10243564 3300025981 Bacteria 1391
1584 Ga0207640_10390288 3300025981 Bacteria 1131
1585 Ga0207640_10574245 3300025981 Bacteria 951
1586 Ga0207640_10587309 3300025981 Bacteria 941
1587 Ga0207640_11055036 3300025981 Bacteria 717
1588 Ga0207658_10017346 3300025986 Bacteria 4960
1589 Ga0207658_10074841 3300025986 Bacteria 2574
1590 Ga0207658_10209960 3300025986 Unclassified 1631
1591 Ga0207658_10230252 3300025986 Bacteria 1564
1592 Ga0207658_10257965 3300025986 Bacteria 1485
1593 Ga0207658_11288645 3300025986 Unclassified 668
1594 Ga0207677_10048110 3300026023 Bacteria 2869
1595 Ga0207677_10123145 3300026023 Bacteria 1955
1596 Ga0207677_10306432 3300026023 Unclassified 1314
1597 Ga0207677_10326873 3300026023 Unclassified 1277
1598 Ga0207677_10386697 3300026023 Bacteria 1182
1599 Ga0207677_10515191 3300026023 Unclassified 1037
1600 Ga0207677_10600600 3300026023 Bacteria 966
1601 Ga0207677_11227454 3300026023 Bacteria 687
1602 Ga0207677_11505298 3300026023 Bacteria 622
1603 Ga0207677_11514961 3300026023 Unclassified 620
1604 Ga0207703_10005589 3300026035 Bacteria 10093
1605 Ga0207703_10016696 3300026035 Bacteria 5726
1606 Ga0207703_10100105 3300026035 Bacteria 2455
1607 Ga0207703_10113572 3300026035 Bacteria 2315
1608 Ga0207703_10147228 3300026035 Bacteria 2050
1609 Ga0207703_10173421 3300026035 Unclassified 1899
1610 Ga0207703_10276641 3300026035 Unclassified 1523
1611 Ga0207703_10434473 3300026035 Unclassified 1224
1612 Ga0207703_10470293 3300026035 Bacteria 1177
1613 Ga0207703_10598333 3300026035 Unclassified 1043
1614 Ga0207703_10685251 3300026035 Bacteria 974
1615 Ga0207703_10763630 3300026035 Bacteria 922
1616 Ga0207703_10798883 3300026035 Bacteria 901
1617 Ga0207703_10918443 3300026035 Bacteria 838
1618 Ga0207703_11007670 3300026035 Bacteria 799
1619 Ga0207703_11159674 3300026035 Bacteria 743
1620 Ga0207703_11422016 3300026035 Unclassified 667
1621 Ga0207639_10575364 3300026041 Bacteria 1036
1622 Ga0207639_12129813 3300026041 Unclassified 522
1623 Ga0207678_10085429 3300026067 Bacteria 2697
1624 Ga0207678_10104793 3300026067 Bacteria 2413
1625 Ga0207678_10839561 3300026067 Bacteria 811
1626 Ga0207708_10002731 3300026075 Bacteria 12963
1627 Ga0207708_10005707 3300026075 Bacteria 9201
1628 Ga0207708_10007575 3300026075 Bacteria 8030
1629 Ga0207708_10013366 3300026075 Bacteria 6134
1630 Ga0207708_10035110 3300026075 Bacteria 3815
1631 Ga0207708_10054645 3300026075 Bacteria 3045
1632 Ga0207708_10109917 3300026075 Bacteria 2139
1633 Ga0207708_10120429 3300026075 Bacteria 2044
1634 Ga0207708_10127761 3300026075 Bacteria 1985
1635 Ga0207708_10137445 3300026075 Bacteria 1915
1636 Ga0207708_10153019 3300026075 Bacteria 1817
1637 Ga0207708_10210968 3300026075 Bacteria 1552
1638 Ga0207708_10321015 3300026075 Bacteria 1264
1639 Ga0207708_10431706 3300026075 Bacteria 1094
1640 Ga0207708_10556027 3300026075 Bacteria 968
1641 Ga0207708_10592636 3300026075 Bacteria 938
1642 Ga0207708_10805529 3300026075 Bacteria 809
1643 Ga0207708_10889935 3300026075 Bacteria 770
1644 Ga0207708_10915256 3300026075 Bacteria 759
1645 Ga0207641_10008046 3300026088 Bacteria 8737
1646 Ga0207641_10008049 3300026088 Bacteria 8736
1647 Ga0207641_10087545 3300026088 Bacteria 2718
1648 Ga0207641_10304766 3300026088 Bacteria 1506
1649 Ga0207641_10595367 3300026088 Bacteria 1082
1650 Ga0207641_10761492 3300026088 Bacteria 956
1651 Ga0207641_11888600 3300026088 Bacteria 599
1652 Ga0207648_10001325 3300026089 Bacteria 27526
1653 Ga0207648_10006823 3300026089 Bacteria 11313
1654 Ga0207648_10018936 3300026089 Bacteria 6219
1655 Ga0207648_10030419 3300026089 Bacteria 4782
1656 Ga0207648_10047057 3300026089 Bacteria 3781
1657 Ga0207648_10048298 3300026089 Bacteria 3727
1658 Ga0207648_10109680 3300026089 Bacteria 2422
1659 Ga0207648_10115701 3300026089 Bacteria 2357
1660 Ga0207648_10138127 3300026089 Bacteria 2147
1661 Ga0207648_10246557 3300026089 Bacteria 1592
1662 Ga0207648_10493009 3300026089 Bacteria 1120
1663 Ga0207648_10541641 3300026089 Bacteria 1068
1664 Ga0207648_10565675 3300026089 Bacteria 1045
1665 Ga0207648_11161057 3300026089 Bacteria 725
1666 Ga0207648_11538807 3300026089 Bacteria 625
1667 Ga0207648_11584263 3300026089 Unclassified 616
1668 Ga0207648_12042267 3300026089 Bacteria 534
1669 Ga0207676_10001537 3300026095 Bacteria 17026
1670 Ga0207676_10023862 3300026095 Bacteria 4520
1671 Ga0207676_10046642 3300026095 Unclassified 3354
1672 Ga0207676_10092743 3300026095 Bacteria 2484
1673 Ga0207676_10133256 3300026095 Bacteria 2116
1674 Ga0207676_10461946 3300026095 Bacteria 1199
1675 Ga0207676_10464106 3300026095 Unclassified 1196
1676 Ga0207676_10674318 3300026095 Unclassified 999
1677 Ga0207676_10819143 3300026095 Bacteria 909
1678 Ga0207676_11212175 3300026095 Bacteria 748
1679 Ga0207676_11665964 3300026095 Bacteria 636
1680 Ga0207676_11671255 3300026095 Unclassified 635
1681 Ga0207676_11718994 3300026095 Bacteria 626
1682 Ga0207674_10118190 3300026116 Bacteria 2621
1683 Ga0207674_10172028 3300026116 Bacteria 2119
1684 Ga0207674_10193818 3300026116 Bacteria 1982
1685 Ga0207674_10307778 3300026116 Unclassified 1533
1686 Ga0207674_10438068 3300026116 Bacteria 1263
1687 Ga0207674_10513188 3300026116 Bacteria 1158
1688 Ga0207674_10707408 3300026116 Bacteria 973
1689 Ga0207675_100004079 3300026118 Bacteria 14140
1690 Ga0207675_100012575 3300026118 Bacteria 7905
1691 Ga0207675_100014601 3300026118 Bacteria 7320
1692 Ga0207675_100030677 3300026118 Bacteria 5007
1693 Ga0207675_100081005 3300026118 Unclassified 3044
1694 Ga0207675_100109920 3300026118 Bacteria 2601
1695 Ga0207675_100213260 3300026118 Bacteria 1858
1696 Ga0207675_100224020 3300026118 Bacteria 1813
1697 Ga0207675_100283219 3300026118 Bacteria 1611
1698 Ga0207675_100286799 3300026118 Bacteria 1601
1699 Ga0207675_100470460 3300026118 Bacteria 1248
1700 Ga0207675_100479652 3300026118 Bacteria 1236
1701 Ga0207675_100483409 3300026118 Bacteria 1231
1702 Ga0207675_100567556 3300026118 Bacteria 1135
1703 Ga0207675_100770175 3300026118 Bacteria 974
1704 Ga0207675_101238383 3300026118 Bacteria 767
1705 Ga0207675_101663206 3300026118 Bacteria 658
1706 Ga0207675_101757296 3300026118 Unclassified 640
1707 Ga0207675_102334870 3300026118 Bacteria 548
1708 Ga0207683_10012729 3300026121 Bacteria 7179
1709 Ga0207683_10029222 3300026121 Bacteria 4772
1710 Ga0207683_10031846 3300026121 Bacteria 4579
1711 Ga0207683_10093176 3300026121 Bacteria 2684
1712 Ga0207683_10159271 3300026121 Archaea 2040
1713 Ga0207683_10179696 3300026121 Bacteria 1918
1714 Ga0207683_10205737 3300026121 Bacteria 1790
1715 Ga0207683_10212113 3300026121 Bacteria 1763
1716 Ga0207683_10218940 3300026121 Bacteria 1734
1717 Ga0207683_10258646 3300026121 Bacteria 1589
1718 Ga0207683_10305059 3300026121 Bacteria 1457
1719 Ga0207683_10490854 3300026121 Unclassified 1134
1720 Ga0207683_10625158 3300026121 Unclassified 997
1721 Ga0207683_11283663 3300026121 Bacteria 678
1722 Ga0207698_10425606 3300026142 Bacteria 1275
1723 Ga0207698_10506212 3300026142 Unclassified 1176
1724 Ga0207698_11730492 3300026142 Bacteria 640
1725 Ga0209996_1029540 3300027395 Bacteria 794
1726 Ga0210000_1067597 3300027462 Bacteria 581
1727 Ga0209995_1028618 3300027471 Unclassified 931
1728 Ga0209999_1075118 3300027543 Bacteria 650
1729 Ga0209982_1055281 3300027552 Unclassified 643
1730 Ga0209970_1120198 3300027614 Bacteria 508
1731 Ga0209983_1034620 3300027665 Unclassified 1082
1732 Ga0209971_1016674 3300027682 Bacteria 1742
1733 Ga0209966_1116233 3300027695 Unclassified 612
1734 Ga0209998_10007303 3300027717 Bacteria 2292
1735 Ga0209998_10158681 3300027717 Bacteria 583
1736 Ga0209813_10004311 3300027866 Bacteria 3389
1737 Ga0209813_10494613 3300027866 Unclassified 507
1738 Ga0209974_10076524 3300027876 Bacteria 1146
1739 Ga0209974_10163228 3300027876 Unclassified 809
1740 Ga0209974_10268258 3300027876 Bacteria 646
1741 Ga0207428_10000021 3300027907 Bacteria 276436
1742 Ga0207428_10000570 3300027907 Bacteria 43701
1743 Ga0207428_10002263 3300027907 Bacteria 19336
1744 Ga0207428_10007451 3300027907 Bacteria 9977
1745 Ga0207428_10008429 3300027907 Bacteria 9307
1746 Ga0207428_10016510 3300027907 Bacteria 6348
1747 Ga0207428_10016885 3300027907 Bacteria 6272
1748 Ga0207428_10019436 3300027907 Bacteria 5792
1749 Ga0207428_10087851 3300027907 Bacteria 2418
1750 Ga0207428_10349987 3300027907 Bacteria 1087
1751 Ga0207428_10358488 3300027907 Bacteria 1072
1752 Ga0207428_10435356 3300027907 Unclassified 957
1753 Ga0207428_10495763 3300027907 Bacteria 887
1754 Ga0207428_10777708 3300027907 Bacteria 681
1755 Ga0207428_10917062 3300027907 Bacteria 618
1756 Ga0207428_11169181 3300027907 Unclassified 536
1757 Ga0268266_10011773 3300028379 Bacteria 7585
1758 Ga0268266_10040785 3300028379 Bacteria 3958
1759 Ga0268266_10804402 3300028379 Unclassified 908
1760 Ga0268266_10878377 3300028379 Bacteria 867
1761 Ga0268266_11403540 3300028379 Bacteria 674
1762 Ga0268266_12028874 3300028379 Unclassified 548
1763 Ga0268265_10000772 3300028380 Bacteria 30842
1764 Ga0268265_10018529 3300028380 Unclassified 4826
1765 Ga0268265_10033837 3300028380 Bacteria 3719
1766 Ga0268265_10123477 3300028380 Bacteria 2138
1767 Ga0268265_10130989 3300028380 Bacteria 2084
1768 Ga0268265_10188052 3300028380 Bacteria 1781
1769 Ga0268265_10322738 3300028380 Bacteria 1399
1770 Ga0268265_10329180 3300028380 Bacteria 1387
1771 Ga0268265_10352155 3300028380 Bacteria 1345
1772 Ga0268265_10652778 3300028380 Unclassified 1011
1773 Ga0268265_10804695 3300028380 Bacteria 916
1774 Ga0268265_10847077 3300028380 Bacteria 894
1775 Ga0268265_10868268 3300028380 Bacteria 884
1776 Ga0268265_10959005 3300028380 Bacteria 843
1777 Ga0268265_11285477 3300028380 Bacteria 731
1778 Ga0268265_11376551 3300028380 Bacteria 707
1779 Ga0268265_11690639 3300028380 Unclassified 639
1780 Ga0268265_11983264 3300028380 Bacteria 589
1781 Ga0268264_10019123 3300028381 Bacteria 5599
1782 Ga0268264_10064145 3300028381 Bacteria 3091
1783 Ga0268264_10158419 3300028381 Bacteria 2037
1784 Ga0268264_10205224 3300028381 Bacteria 1806
1785 Ga0268264_10205815 3300028381 Bacteria 1803
1786 Ga0268264_10217007 3300028381 Bacteria 1759
1787 Ga0268264_10340537 3300028381 Bacteria 1424
1788 Ga0268264_10406879 3300028381 Bacteria 1309
1789 Ga0268264_10445480 3300028381 Bacteria 1253
1790 Ga0268264_10480293 3300028381 Bacteria 1209
1791 Ga0268264_10710632 3300028381 Bacteria 999
1792 Ga0268264_11159878 3300028381 Bacteria 782
1793 Ga0268264_11689620 3300028381 Unclassified 644
1794 Ga0265337_1034006 3300028556 Bacteria 1502
1795 Ga0265326_10000028 3300028558 Bacteria 107913
1796 Ga0265319_1000746 3300028563 Bacteria 21215
1797 Ga0265334_10000040 3300028573 Bacteria 100264
1798 Ga0265336_10003949 3300028666 Bacteria 5678
1799 Ga0265338_10000661 3300028800 Bacteria 59507
1800 Ga0265324_10006868 3300029957 Bacteria 4689
1801 Ga0316177_1137045 3300030731 Bacteria 684
1802 Ga0265332_10078791 3300031238 Bacteria 1399
1803 Ga0265332_10147374 3300031238 Bacteria 985
1804 Ga0265320_10357648 3300031240 Bacteria 645
1805 Ga0265327_10016019 3300031251 Bacteria 4795
1806 Ga0307408_100014431 3300031548 Bacteria 5248
1807 Ga0307408_100020494 3300031548 Bacteria 4465
1808 Ga0307408_100062075 3300031548 Bacteria 2730
1809 Ga0307408_100137514 3300031548 Bacteria 1913
1810 Ga0307408_100327910 3300031548 Bacteria 1292
1811 Ga0307408_100339708 3300031548 Unclassified 1270
1812 Ga0307408_100466204 3300031548 Bacteria 1099
1813 Ga0307408_100603019 3300031548 Bacteria 976
1814 Ga0307408_100853082 3300031548 Bacteria 830
1815 Ga0265314_10029252 3300031711 Bacteria 4097
1816 Ga0265314_10537246 3300031711 Bacteria 610
1817 Ga0307405_10000803 3300031731 Bacteria 12343
1818 Ga0307405_10060325 3300031731 Bacteria 2393
1819 Ga0307405_10951617 3300031731 Bacteria 730
1820 Ga0307405_10965234 3300031731 Bacteria 725
1821 Ga0307405_11364608 3300031731 Bacteria 619
1822 Ga0307405_11969757 3300031731 Bacteria 522
1823 Ga0307413_10215764 3300031824 Bacteria 1397
1824 Ga0307413_10758069 3300031824 Bacteria 812
1825 Ga0307413_10764832 3300031824 Bacteria 809
1826 Ga0307410_10004314 3300031852 Bacteria 7330
1827 Ga0307410_10267810 3300031852 Bacteria 1335
1828 Ga0307410_11081766 3300031852 Bacteria 694
1829 Ga0307406_10078819 3300031901 Bacteria 2183
1830 Ga0307406_10171833 3300031901 Bacteria 1569
1831 Ga0307406_11116729 3300031901 Bacteria 681
1832 Ga0307407_10044651 3300031903 Bacteria 2499
1833 Ga0307407_10257974 3300031903 Bacteria 1198
1834 Ga0307412_10001225 3300031911 Bacteria 14566
1835 Ga0307412_10074987 3300031911 Bacteria 2319
1836 Ga0307412_10105275 3300031911 Bacteria 2004
1837 Ga0307412_10132924 3300031911 Bacteria 1810
1838 Ga0307412_10335921 3300031911 Unclassified 1207
1839 Ga0307412_10726732 3300031911 Bacteria 855
1840 Ga0307412_10895248 3300031911 Bacteria 777
1841 Ga0307412_11093811 3300031911 Bacteria 709
1842 Ga0307412_12045292 3300031911 Unclassified 531
1843 Ga0307409_100008674 3300031995 Bacteria 6187
1844 Ga0307409_100036598 3300031995 Bacteria 3610
1845 Ga0307409_100080632 3300031995 Bacteria 2627
1846 Ga0307409_100539846 3300031995 Unclassified 1143
1847 Ga0307409_100576721 3300031995 Bacteria 1108
1848 Ga0307409_100660716 3300031995 Unclassified 1040
1849 Ga0307409_100889896 3300031995 Bacteria 903
1850 Ga0307409_102884186 3300031995 Bacteria 508
1851 Ga0307416_100000919 3300032002 Bacteria 15561
1852 Ga0307416_100002964 3300032002 Bacteria 9893
1853 Ga0307416_100006245 3300032002 Bacteria 7440
1854 Ga0307416_100022703 3300032002 Bacteria 4535
1855 Ga0307416_100025464 3300032002 Unclassified 4337
1856 Ga0307416_100105363 3300032002 Bacteria 2468
1857 Ga0307416_100118856 3300032002 Bacteria 2350
1858 Ga0307416_100173710 3300032002 Bacteria 2010
1859 Ga0307416_100927198 3300032002 Bacteria 972
1860 Ga0307416_102515037 3300032002 Bacteria 613
1861 Ga0307416_103572395 3300032002 Bacteria 520
1862 Ga0307414_10173577 3300032004 Bacteria 1726
1863 Ga0307414_10321544 3300032004 Bacteria 1317
1864 Ga0307414_10650436 3300032004 Bacteria 950
1865 Ga0307414_11243203 3300032004 Bacteria 690
1866 Ga0307414_11459936 3300032004 Unclassified 636
1867 Ga0307414_11947080 3300032004 Unclassified 549
1868 Ga0307411_10006469 3300032005 Bacteria 5868
1869 Ga0307411_10009191 3300032005 Bacteria 5178
1870 Ga0307411_10014918 3300032005 Bacteria 4342
1871 Ga0307411_10023178 3300032005 Bacteria 3672
1872 Ga0307411_10119110 3300032005 Bacteria 1906
1873 Ga0307411_10334776 3300032005 Bacteria 1228
1874 Ga0307411_10337440 3300032005 Bacteria 1223
1875 Ga0307411_10466817 3300032005 Bacteria 1060
1876 Ga0307411_10610904 3300032005 Unclassified 939
1877 Ga0307411_12021575 3300032005 Unclassified 538
1878 Ga0307415_100006180 3300032126 Bacteria 6431
1879 Ga0307415_100055869 3300032126 Bacteria 2704
1880 Ga0307415_100856750 3300032126 Bacteria 834
1881 Ga0373948_0023401 3300034817 Bacteria 1198
1882 Ga0373950_0029714 3300034818 Bacteria 1006
1883 Ga0373958_0001904 3300034819 Bacteria 2865
1884 Ga0373959_0000856 3300034820 Bacteria 5157
1885 Ga0373938_0000270 3300034957 Bacteria 8216
1886 Ga0373934_0230471 3300035086 Unclassified 765
1887 Ga0373934_0407305 3300035086 Bacteria 569
1888 Ga0373940_0019908 3300035088 Bacteria 1700
1889 Ga0373940_0022988 3300035088 Bacteria 1606
1890 Ga0373940_0048984 3300035088 Bacteria 1182
1891 Ga0373944_0044793 3300035089 Bacteria 1379
1892 Ga0373944_0146027 3300035089 Bacteria 831
1893 Ga0373949_0004159 3300035090 Bacteria 3343
1894 Ga0373949_0018737 3300035090 Bacteria 1571
1895 Ga0373949_0136530 3300035090 Bacteria 700
1896 Ga0373951_0000705 3300035091 Bacteria 9181
1897 Ga0373951_0047441 3300035091 Bacteria 1050
1898 Ga0373952_0001064 3300035092 Bacteria 5017
1899 Ga0373952_0097357 3300035092 Bacteria 772
1900 Ga0373923_0052689 3300035111 Bacteria 1710
1901 Ga0373923_0323984 3300035111 Bacteria 732
1902 Ga0373932_0006011 3300035112 Bacteria 2863
1903 Ga0373932_0097400 3300035112 Unclassified 953
1904 Ga0373939_0000661 3300035114 Bacteria 8564
1905 Ga0373939_0036301 3300035114 Bacteria 1457
1906 Ga0373939_0184345 3300035114 Bacteria 780
1907 Ga0373941_0020023 3300035115 Bacteria 1871
1908 Ga0373941_0114268 3300035115 Bacteria 955
1909 Ga0373945_0181381 3300035116 Unclassified 867
1910 Ga0373953_0161933 3300035117 Unclassified 962
1911 Ga0373954_0031135 3300035118 Bacteria 2462
1912 Ga0373954_0450666 3300035118 Unclassified 637
1913 Ga0373954_0618249 3300035118 Bacteria 537
1914 Ga0373957_0144635 3300035120 Bacteria 974
1915 Ga0373957_0278127 3300035120 Bacteria 707
1916 Ga0373957_0468043 3300035120 Unclassified 547
1917 Ga0373960_0000054 3300035121 Bacteria 15902
1918 Ga0373960_0080966 3300035121 Bacteria 1022
1919 Ga0373960_0081951 3300035121 Unclassified 1017
1920 Ga0373960_0220995 3300035121 Bacteria 678
1921 Ga0373960_0323604 3300035121 Unclassified 579
1922 Ga0373943_0000751 3300035170 Bacteria 14122
1923 Ga0373943_0165126 3300035170 Bacteria 1208
1924 Ga0373943_0478673 3300035170 Bacteria 726
1925 Ga0373943_0581069 3300035170 Bacteria 659
1926 Ga0373943_0807040 3300035170 Bacteria 559
1927 Ga0373946_0005914 3300035171 Bacteria 4433
1928 Ga0373946_0072757 3300035171 Bacteria 1489
1929 Ga0373955_0006664 3300035172 Bacteria 5269
1930 Ga0373955_0081966 3300035172 Bacteria 1825
1931 Ga0373955_0083243 3300035172 Bacteria 1812
1932 Ga0373955_0388909 3300035172 Unclassified 847
1933 Ga0373955_0595114 3300035172 Bacteria 677
1934 Ga0373961_0000488 3300035241 Bacteria 15485
1935 Ga0373962_0004765 3300035242 Bacteria 3274
1936 Ga0373962_0087955 3300035242 Unclassified 953
1937 Ga0373962_0126547 3300035242 Bacteria 819
1938 Ga0373962_0239607 3300035242 Unclassified 626
1939 Ga0373962_0245360 3300035242 Unclassified 620
1940 Ga0373924_0005158 3300035410 Bacteria 4612
1941 Ga0373924_0192621 3300035410 Bacteria 898
1942 Ga0373924_0590334 3300035410 Unclassified 501
1943 Ga0373931_0000668 3300035691 Bacteria 14188
1944 Ga0373931_0034126 3300035691 Bacteria 2640
1945 Ga0373931_0057882 3300035691 Bacteria 2080
1946 Ga0373931_0515849 3300035691 Bacteria 773
1947 Ga0373931_0761353 3300035691 Unclassified 643
1948 Ga0373935_0213435 3300035692 Bacteria 1338
1949 Ga0373935_0259403 3300035692 Unclassified 1219
1950 Ga0373935_0446138 3300035692 Bacteria 934
1951 Ga0373935_0763068 3300035692 Bacteria 713
1952 Ga0373935_1296175 3300035692 Bacteria 544
1953 Ga0373927_0538799 3300035695 Bacteria 772
1954 Ga0373933_0041252 3300035724 Bacteria 2724
1955 Ga0373933_0426713 3300035724 Bacteria 866
1956 Ga0373933_0743378 3300035724 Unclassified 645
1957 Ga0373933_0916064 3300035724 Bacteria 577
1958 Ga0373947_0266336 3300035725 Bacteria 1136
1959 Ga0373947_0309340 3300035725 Bacteria 1055
1960 Ga0373947_0578678 3300035725 Bacteria 765
1961 Ga0373947_0987376 3300035725 Unclassified 574
1962 Ga0373937_0006676 3300036401 Bacteria 9964
1963 Ga0373937_0013739 3300036401 Bacteria 7134
1964 Ga0373937_0041357 3300036401 Bacteria 4204
1965 Ga0373937_0209941 3300036401 Bacteria 1832
1966 Ga0373937_1531527 3300036401 Unclassified 614
1967 Ga0373937_1981210 3300036401 Bacteria 528
1968 Ga0373937_1988862 3300036401 Unclassified 527
1969 Ga0373925_0006947 3300037068 Bacteria 8279
1970 Ga0373925_0013472 3300037068 Bacteria 5918
1971 Ga0373925_0069270 3300037068 Bacteria 2665
1972 Ga0373925_0098923 3300037068 Bacteria 2240
1973 Ga0373925_0445265 3300037068 Bacteria 1060
1974 Ga0373925_0477981 3300037068 Bacteria 1022
1975 Ga0373925_0913899 3300037068 Bacteria 723
1976 Ga0395905_0700986 3300037471 Bacteria 915
1977 Ga0242420_070702 3300038996 Unclassified 709
1978 Ga0436365_0499271 3300039437 Bacteria 2444
1979 Ga0436365_1017954 3300039437 Bacteria 695
1980 Ga0436365_1174797 3300039437 Bacteria 881
1981 Ga0436365_1696168 3300039437 Bacteria 3421
1982 Ga0439453_0006334 3300041408 Bacteria 1839
1983 Ga0439453_0041454 3300041408 Bacteria 904
1984 Ga0439453_0145113 3300041408 Bacteria 560
1985 Ga0439461_0082133 3300041410 Bacteria 762
1986 Ga0439461_0196797 3300041410 Unclassified 540
1987 Ga0451787_290358 3300041441 Bacteria 625
1988 Ga0451791_0128859 3300041451 Bacteria 629
1989 Ga0451793_1779034 3300041452 Bacteria 696
1990 Ga0451800_0189637 3300041459 Bacteria 793
1991 Ga0451802_0167054 3300041460 Bacteria 597
1992 Ga0451804_0849585 3300041463 Bacteria 716
1993 Ga0451851_1374125 3300041507 Bacteria 652
1994 Ga0451853_0622843 3300041512 Unclassified 583
1995 Ga0451853_0708216 3300041512 Bacteria 715
1996 Ga0451853_1516782 3300041512 Bacteria 1431
1997 Ga0451853_2606140 3300041512 Bacteria 692
1998 Ga0451853_3132910 3300041512 Bacteria 541
1999 Ga0439441_033213 3300042001 Bacteria 1009
2000 Ga0439443_011355 3300042003 Bacteria 1304
2001 Ga0439445_0090707 3300042004 Bacteria 860
2002 Ga0439450_003267 3300042008 Bacteria 2660
2003 Ga0439450_048025 3300042008 Bacteria 1007
2004 Ga0439451_052533 3300042009 Bacteria 816
2005 Ga0439455_0177556 3300042012 Bacteria 613
2006 Ga0439457_111164 3300042014 Unclassified 643
2007 Ga0439462_0056990 3300042015 Bacteria 1055
2008 Ga0439462_0192520 3300042015 Bacteria 580
2009 Ga0450890_085205 3300042127 Bacteria 519
2010 Ga0450896_021212 3300042133 Bacteria 954
2011 Ga0439446_0048404 3300042156 Bacteria 1266
2012 Ga0439446_0157179 3300042156 Bacteria 750
2013 Ga0439446_0181987 3300042156 Unclassified 703
2014 Ga0439435_0038565 3300042436 Bacteria 1328
2015 Ga0439435_0089022 3300042436 Bacteria 935
2016 Ga0439435_0118490 3300042436 Bacteria 827
2017 Ga0439444_0083482 3300042437 Bacteria 703
2018 Ga0439459_0107466 3300042438 Bacteria 690
2019 Ga0439464_0000501 3300042439 Bacteria 7978
2020 Ga0439464_0070641 3300042439 Bacteria 1033
2021 Ga0439464_0104743 3300042439 Bacteria 862
2022 Ga0439464_0119202 3300042439 Bacteria 812
2023 Ga0439464_0212745 3300042439 Unclassified 619
2024 Ga0439464_0242667 3300042439 Bacteria 581
2025 Ga0439460_0051717 3300042461 Bacteria 1233
2026 Ga0439460_0066950 3300042461 Unclassified 1106
2027 Ga0439460_0175085 3300042461 Bacteria 724
2028 Ga0439460_0251812 3300042461 Bacteria 610
2029 Ga0439460_0252503 3300042461 Unclassified 610
2030 Ga0450916_086684 3300042530 Bacteria 541
2031 Ga0450893_0095625 3300042532 Bacteria 601
2032 Ga0450893_0129696 3300042532 Bacteria 532
2033 Ga0451577_0734245 3300042876 Unclassified 894
2034 Ga0439440_0029623 3300042993 Bacteria 1285
2035 Ga0439440_0076260 3300042993 Bacteria 880
2036 Ga0439440_0083429 3300042993 Bacteria 848
2037 Ga0439440_0119709 3300042993 Bacteria 732
2038 Ga0453683_0933121 3300044673 Bacteria 575
2039 Ga0466966_0787118 3300044684 Bacteria 573
2040 Ga0466960_0582000 3300044901 Unclassified 663
2041 Ga0466959_0418768 3300045049 Bacteria 909
2042 Ga0451576_0002764 3300045051 Bacteria 25371
2043 Ga0451576_0008567 3300045051 Bacteria 11995
2044 Ga0451576_0026133 3300045051 Bacteria 6280
2045 Ga0451576_0205304 3300045051 Bacteria 2057
2046 Ga0451576_0213190 3300045051 Bacteria 2017
2047 Ga0451576_0348088 3300045051 Bacteria 1551
2048 Ga0451576_0454491 3300045051 Bacteria 1345
2049 Ga0466967_1739665 3300045976 Bacteria 621
2050 Ga0495592_0419846 3300046454 Bacteria 844
2051 Ga0495603_0035445 3300046455 Bacteria 2997
2052 Ga0495603_0069824 3300046455 Bacteria 2066
2053 Ga0495603_0142734 3300046455 Bacteria 1393
2054 Ga0495603_0376659 3300046455 Bacteria 814
2055 Ga0495590_0318104 3300046457 Unclassified 588
2056 Ga0495590_0319212 3300046457 Bacteria 587
2057 Ga0495629_0080403 3300046459 Bacteria 2276
2058 Ga0495629_0460021 3300046459 Bacteria 861
2059 Ga0495580_0070724 3300046472 Bacteria 2438
2060 Ga0495580_0421106 3300046472 Bacteria 898
2061 Ga0495582_0096328 3300046473 Bacteria 1654
2062 Ga0495582_0219881 3300046473 Bacteria 1086
2063 Ga0495582_0251163 3300046473 Bacteria 1014
2064 Ga0495582_0787471 3300046473 Bacteria 550
2065 Ga0495639_0078014 3300046475 Bacteria 1539
2066 Ga0495639_0156778 3300046475 Bacteria 1100
2067 Ga0495639_0249892 3300046475 Bacteria 877
2068 Ga0495585_0032001 3300046492 Bacteria 2983
2069 Ga0495594_0095743 3300046499 Bacteria 1667
2070 Ga0495594_0114950 3300046499 Bacteria 1519
2071 Ga0495594_0175647 3300046499 Bacteria 1219
2072 Ga0495608_0041215 3300046511 Bacteria 3091
2073 Ga0495608_0580857 3300046511 Bacteria 674
2074 Ga0495618_0457688 3300046514 Bacteria 774
2075 Ga0495618_0668754 3300046514 Unclassified 613
2076 Ga0495620_0235087 3300046515 Bacteria 700
2077 Ga0495628_0061096 3300046516 Bacteria 2955
2078 Ga0495628_0131053 3300046516 Bacteria 1918
2079 Ga0495630_0010405 3300046517 Bacteria 6717
2080 Ga0495630_1196449 3300046517 Unclassified 575
2081 Ga0495637_0069931 3300046520 Bacteria 1419
2082 Ga0495643_0021226 3300046522 Bacteria 3729
2083 Ga0495663_0006839 3300046525 Bacteria 3146
2084 Ga0495663_0046692 3300046525 Bacteria 1331
2085 Ga0495663_0050992 3300046525 Unclassified 1281
2086 Ga0495663_0316575 3300046525 Unclassified 564
2087 Ga0495666_0448962 3300046526 Bacteria 578
2088 Ga0495642_0003038 3300046528 Bacteria 6683
2089 Ga0495642_0164566 3300046528 Bacteria 962
2090 Ga0495652_0961907 3300046529 Unclassified 560
2091 Ga0495665_0583293 3300046531 Bacteria 560
2092 Ga0495640_0067995 3300046533 Bacteria 2399
2093 Ga0495640_0209736 3300046533 Bacteria 1232
2094 Ga0495640_0277619 3300046533 Unclassified 1044
2095 Ga0495640_0360213 3300046533 Bacteria 897
2096 Ga0495640_0920854 3300046533 Bacteria 517
2097 Ga0495598_0005013 3300046537 Bacteria 2907
2098 Ga0495598_0025930 3300046537 Unclassified 1603
2099 Ga0495598_0032705 3300046537 Bacteria 1471
2100 Ga0495598_0292375 3300046537 Unclassified 614
2101 Ga0495609_0014640 3300046538 Bacteria 3684
2102 Ga0495621_0000555 3300046539 Bacteria 9291
2103 Ga0495621_0006303 3300046539 Unclassified 3455
2104 Ga0495621_0011543 3300046539 Bacteria 2737
2105 Ga0495621_0030639 3300046539 Bacteria 1840
2106 Ga0495621_0085787 3300046539 Bacteria 1180
2107 Ga0495621_0216521 3300046539 Bacteria 774
2108 Ga0495621_0517898 3300046539 Bacteria 516
2109 Ga0495597_0197535 3300046542 Bacteria 807
2110 Ga0495597_0387189 3300046542 Bacteria 533
2111 Ga0495645_0171096 3300046543 Bacteria 1495
2112 Ga0495645_0544181 3300046543 Bacteria 720
2113 Ga0495633_0004066 3300046558 Bacteria 9443
2114 Ga0495667_0181985 3300046559 Bacteria 1348
2115 Ga0495667_0198685 3300046559 Bacteria 1284
2116 Ga0495667_0533786 3300046559 Unclassified 734
2117 Ga0495656_0003551 3300046615 Viruses 5281
2118 Ga0495656_0067661 3300046615 Bacteria 1577
2119 Ga0495656_0299122 3300046615 Bacteria 824
2120 Ga0495656_0477808 3300046615 Bacteria 659
2121 Ga0495656_0653390 3300046615 Bacteria 564
2122 Ga0495668_0543035 3300046616 Bacteria 641
2123 Ga0495668_0806823 3300046616 Bacteria 520
2124 Ga0495634_0222999 3300046642 Bacteria 1163
2125 Ga0495634_0672076 3300046642 Bacteria 597
2126 Ga0495635_0438619 3300046663 Bacteria 864
2127 Ga0495635_0571795 3300046663 Bacteria 740
2128 Ga0495659_0001873 3300046664 Bacteria 6943
2129 Ga0495659_0018971 3300046664 Bacteria 2297
2130 Ga0495659_0028277 3300046664 Unclassified 1940
2131 Ga0495659_0084531 3300046664 Bacteria 1209
2132 Ga0495659_0160208 3300046664 Bacteria 908
2133 Ga0495659_0164863 3300046664 Bacteria 896
2134 Ga0495659_0235102 3300046664 Bacteria 760
2135 Ga0495661_0583225 3300046665 Unclassified 527
2136 Ga0495588_0006275 3300046674 Bacteria 5348
2137 Ga0495588_0657634 3300046674 Unclassified 548
2138 Ga0495657_0168432 3300046675 Bacteria 1351
2139 Ga0495657_0507789 3300046675 Bacteria 703
2140 Ga0495623_0168828 3300046679 Bacteria 1280
2141 Ga0495647_0065623 3300046681 Bacteria 1442
2142 Ga0495647_0566169 3300046681 Bacteria 532
2143 Ga0495647_0587810 3300046681 Unclassified 522
2144 Ga0495647_0616088 3300046681 Unclassified 510
2145 Ga0495658_0041345 3300046683 Bacteria 2568
2146 Ga0495658_0044093 3300046683 Bacteria 2498
2147 Ga0495658_0061713 3300046683 Bacteria 2153
2148 Ga0495658_0068362 3300046683 Bacteria 2057
2149 Ga0495658_0150052 3300046683 Bacteria 1431
2150 Ga0495658_0351132 3300046683 Bacteria 937
2151 Ga0495669_0004530 3300046684 Bacteria 5748
2152 Ga0495669_0095986 3300046684 Bacteria 1373
2153 Ga0495669_0145343 3300046684 Bacteria 1121
2154 Ga0495613_0004058 3300046689 Bacteria 10955
2155 Ga0495670_0049911 3300046691 Bacteria 2094
2156 Ga0495670_0157390 3300046691 Bacteria 1193
2157 Ga0495670_0226684 3300046691 Bacteria 993
2158 Ga0495670_0700124 3300046691 Bacteria 553
2159 Ga0495671_0476794 3300046692 Bacteria 596
2160 Ga0495589_0534644 3300046794 Unclassified 535
2161 Ga0495600_0093642 3300046809 Bacteria 1959
2162 Ga0495600_0871425 3300046809 Bacteria 533
2163 Ga0495581_0102584 3300047315 Bacteria 1662
2164 Ga0495581_0480343 3300047315 Unclassified 723
2165 Ga0495604_0049008 3300047317 Bacteria 3284
2166 Ga0495636_0021335 3300047318 Bacteria 2615
2167 Ga0495674_0033229 3300047319 Bacteria 4674
2168 Ga0495674_0705808 3300047319 Bacteria 791
2169 Ga0495672_0101037 3300047320 Bacteria 1564
2170 Ga0495680_0031953 3300047322 Bacteria 4279
2171 Ga0495675_0178139 3300047444 Bacteria 1303
2172 Ga0495677_0084304 3300047445 Bacteria 1193
2173 Ga0495685_009919 3300047447 Bacteria 3189
2174 Ga0495684_0001164 3300047471 Bacteria 21155
2175 Ga0495684_0273660 3300047471 Bacteria 1221
2176 Ga0495684_0422463 3300047471 Bacteria 932
2177 Ga0495684_0801730 3300047471 Bacteria 615
2178 Ga0495602_0154005 3300048088 Unclassified 1803
2179 Ga0496100_0003686 3300048903 Bacteria 8019
2180 Ga0496100_0102699 3300048903 Bacteria 1973
2181 Ga0496100_0826070 3300048903 Bacteria 726
2182 Ga0496100_1225913 3300048903 Bacteria 592
2183 Ga0496100_1583278 3300048903 Bacteria 518
2184 Ga0496101_0001362 3300048904 Bacteria 14635
2185 Ga0496101_0002308 3300048904 Bacteria 11669
2186 Ga0496102_0092641 3300048905 Bacteria 2799
2187 Ga0496102_0805157 3300048905 Bacteria 862
2188 Ga0496102_0852176 3300048905 Bacteria 833
2189 Ga0496103_0938875 3300048906 Bacteria 541
2190 Ga0496104_0011626 3300048907 Bacteria 7890
2191 Ga0496104_0016660 3300048907 Bacteria 6679
2192 Ga0496104_0033356 3300048907 Bacteria 4795
2193 Ga0496104_0142420 3300048907 Bacteria 2303
2194 Ga0496104_0172673 3300048907 Unclassified 2072
2195 Ga0496104_0451856 3300048907 Bacteria 1197
2196 Ga0496104_0708884 3300048907 Bacteria 914
2197 Ga0496104_0760922 3300048907 Unclassified 875
2198 Ga0496104_0870710 3300048907 Unclassified 806
2199 Ga0496105_0033301 3300048908 Unclassified 4230
2200 Ga0496105_0103401 3300048908 Bacteria 2352
2201 Ga0496105_0882718 3300048908 Bacteria 675
2202 Ga0496105_1036711 3300048908 Bacteria 612
2203 Ga0496106_0082789 3300048909 Bacteria 2467
2204 Ga0496106_0133640 3300048909 Unclassified 1947
2205 Ga0496106_0136165 3300048909 Bacteria 1929
2206 Ga0496106_0248477 3300048909 Bacteria 1422
2207 Ga0496106_0281622 3300048909 Bacteria 1332
2208 Ga0496107_0024689 3300048910 Bacteria 4253
2209 Ga0496107_0170039 3300048910 Bacteria 1617
2210 Ga0496107_0687660 3300048910 Bacteria 753
2211 Ga0496107_0726140 3300048910 Bacteria 730
2212 Ga0496108_0008524 3300048911 Bacteria 8315
2213 Ga0496108_1257625 3300048911 Bacteria 624
2214 Ga0496109_0234194 3300048912 Bacteria 1728
2215 Ga0496109_0379850 3300048912 Bacteria 1335
2216 Ga0496109_0550524 3300048912 Bacteria 1088
2217 Ga0496109_1328589 3300048912 Bacteria 655
2218 Ga0496109_1901726 3300048912 Bacteria 527
2219 Ga0496110_0880488 3300048913 Unclassified 801
2220 Ga0496111_0931386 3300048914 Unclassified 625
2221 Ga0496111_1311404 3300048914 Unclassified 510
2222 Ga0496112_0000350 3300048915 Bacteria 30081
2223 Ga0496112_0557811 3300048915 Bacteria 1079
2224 Ga0496112_0914284 3300048915 Bacteria 799
2225 Ga0496112_0920911 3300048915 Unclassified 796
2226 Ga0496112_1081565 3300048915 Bacteria 720
2227 Ga0496113_0015351 3300048916 Bacteria 5261
2228 Ga0496113_0309179 3300048916 Bacteria 1266
2229 Ga0496113_0422096 3300048916 Bacteria 1071
2230 Ga0496114_0000376 3300048917 Bacteria 32945
2231 Ga0496114_0000743 3300048917 Bacteria 24334
2232 Ga0496114_0233463 3300048917 Bacteria 1616
2233 Ga0496114_0278028 3300048917 Bacteria 1476
2234 Ga0496114_0428586 3300048917 Bacteria 1172
2235 Ga0496114_0617754 3300048917 Bacteria 955
2236 Ga0496114_0804382 3300048917 Bacteria 819
2237 Ga0496115_0316972 3300048918 Bacteria 1276
2238 Ga0496115_1026720 3300048918 Bacteria 629
2239 Ga0496115_1032700 3300048918 Unclassified 627
2240 Ga0501294_015730 3300049517 Bacteria 783
2241 Ga0501295_122921 3300049518 Bacteria 624
2242 Ga0501296_048296 3300049519 Bacteria 617
2243 Ga0501298_006410 3300049521 Bacteria 1924
2244 Ga0501298_060304 3300049521 Bacteria 803
2245 Ga0501298_098553 3300049521 Bacteria 664
2246 Ga0501299_009585 3300049522 Bacteria 1600
2247 Ga0501299_042497 3300049522 Bacteria 917
2248 Ga0501300_035172 3300049523 Bacteria 745
2249 Ga0501031_0022156 3300049568 Bacteria 4139
2250 Ga0501031_0270690 3300049568 Bacteria 1103
2251 Ga0501031_0553555 3300049568 Unclassified 741
2252 Ga0501032_0006589 3300049569 Bacteria 8526
2253 Ga0501032_0401009 3300049569 Bacteria 881
2254 Ga0501032_0491969 3300049569 Bacteria 784
2255 Ga0501032_1019488 3300049569 Bacteria 520
2256 Ga0501033_0000802 3300049570 Bacteria 28770
2257 Ga0501033_0620244 3300049570 Bacteria 740
2258 Ga0501034_0007961 3300049571 Bacteria 11257
2259 Ga0501034_0061855 3300049571 Bacteria 3759
2260 Ga0501034_0604594 3300049571 Bacteria 1002
2261 Ga0501036_0001038 3300049572 Bacteria 20959
2262 Ga0501036_0137981 3300049572 Bacteria 2058
2263 Ga0501036_0229783 3300049572 Unclassified 1557
2264 Ga0501036_0804211 3300049572 Bacteria 774
2265 Ga0501037_0007964 3300049573 Bacteria 7766
2266 Ga0501038_0002085 3300049574 Bacteria 18536
2267 Ga0501038_0063914 3300049574 Unclassified 3140
2268 Ga0501038_0070553 3300049574 Bacteria 2966
2269 Ga0501038_0134455 3300049574 Bacteria 2027
2270 Ga0501039_0035250 3300049575 Bacteria 3861
2271 Ga0501039_0079870 3300049575 Bacteria 2545
2272 Ga0501039_0097161 3300049575 Bacteria 2297
2273 Ga0501039_0823994 3300049575 Bacteria 724
2274 Ga0501040_0004120 3300049576 Bacteria 9457
2275 Ga0501040_0009388 3300049576 Bacteria 6374
2276 Ga0501040_0235900 3300049576 Bacteria 1303
2277 Ga0501040_0435656 3300049576 Bacteria 943
2278 Ga0501041_0002267 3300049577 Bacteria 10877
2279 Ga0501041_0025316 3300049577 Bacteria 3566
2280 Ga0501041_0030740 3300049577 Bacteria 3242
2281 Ga0501041_0106125 3300049577 Unclassified 1741
2282 Ga0501041_0309291 3300049577 Bacteria 996
2283 Ga0501042_0026471 3300049578 Bacteria 4075
2284 Ga0501042_0052000 3300049578 Bacteria 2922
2285 Ga0501042_0136359 3300049578 Bacteria 1769
2286 Ga0501042_0150442 3300049578 Bacteria 1678
2287 Ga0501042_0193951 3300049578 Bacteria 1465
2288 Ga0501043_0008493 3300049579 Bacteria 8082
2289 Ga0501043_0069357 3300049579 Bacteria 2769
2290 Ga0501043_0074908 3300049579 Bacteria 2659
2291 Ga0501043_0141733 3300049579 Bacteria 1882
2292 Ga0501043_1059325 3300049579 Bacteria 575
2293 Ga0501046_0004140 3300049580 Bacteria 13215
2294 Ga0501046_0026545 3300049580 Bacteria 4730
2295 Ga0501046_0074986 3300049580 Bacteria 2624
2296 Ga0501046_0088257 3300049580 Unclassified 2388
2297 Ga0501047_0006398 3300049581 Bacteria 11078
2298 Ga0501048_0003752 3300049582 Bacteria 11592
2299 Ga0501048_0015163 3300049582 Bacteria 5695
2300 Ga0501048_0024903 3300049582 Bacteria 4366
2301 Ga0501067_0025800 3300049583 Bacteria 3257
2302 Ga0501068_0003166 3300049584 Bacteria 8808
2303 Ga0501068_0062493 3300049584 Bacteria 2265
2304 Ga0501069_0005034 3300049585 Bacteria 6851
2305 Ga0501069_0179471 3300049585 Unclassified 1224
2306 Ga0501070_0002294 3300049586 Bacteria 16800
2307 Ga0501070_0404783 3300049586 Bacteria 1103
2308 Ga0501070_0985862 3300049586 Unclassified 654
2309 Ga0501071_0027676 3300049587 Bacteria 3991
2310 Ga0501071_0055478 3300049587 Bacteria 2860
2311 Ga0501071_0464889 3300049587 Bacteria 969
2312 Ga0501071_0607286 3300049587 Unclassified 841
2313 Ga0501071_0610052 3300049587 Bacteria 839
2314 Ga0501072_0012349 3300049588 Bacteria 6528
2315 Ga0501072_0148143 3300049588 Unclassified 1871
2316 Ga0501072_0351458 3300049588 Bacteria 1170
2317 Ga0501072_0674836 3300049588 Bacteria 813
2318 Ga0501073_0002819 3300049589 Bacteria 13014
2319 Ga0501073_0878987 3300049589 Bacteria 617
2320 Ga0501074_0048687 3300049590 Bacteria 3062
2321 Ga0501074_0079466 3300049590 Bacteria 2353
2322 Ga0501074_0454250 3300049590 Bacteria 908
2323 Ga0501074_0632510 3300049590 Unclassified 756
2324 Ga0501075_0029245 3300049591 Bacteria 4073
2325 Ga0501075_0033782 3300049591 Bacteria 3806
2326 Ga0501075_0068028 3300049591 Bacteria 2690
2327 Ga0501075_0123538 3300049591 Bacteria 1970
2328 Ga0501075_1088631 3300049591 Unclassified 607
2329 Ga0501075_1142775 3300049591 Unclassified 591
2330 Ga0501075_1375406 3300049591 Bacteria 535
2331 Ga0501076_0000493 3300049592 Bacteria 24909
2332 Ga0501076_0018244 3300049592 Bacteria 5346
2333 Ga0501076_0034055 3300049592 Bacteria 3979
2334 Ga0501076_0191927 3300049592 Bacteria 1667
2335 Ga0501076_0746321 3300049592 Bacteria 808
2336 Ga0501076_0878551 3300049592 Bacteria 739
2337 Ga0501076_1369137 3300049592 Bacteria 581
2338 Ga0501077_0008502 3300049593 Bacteria 6362
2339 Ga0501077_0064473 3300049593 Bacteria 2324
2340 Ga0501077_0077760 3300049593 Bacteria 2102
2341 Ga0501202_027623 3300049652 Bacteria 1167
2342 Ga0501217_007594 3300049661 Bacteria 2328
2343 Ga0501230_169971 3300049667 Unclassified 500
2344 Ga0501235_186940 3300049669 Unclassified 555
2345 Ga0501235_239476 3300049669 Bacteria 504
2346 Ga0501247_036380 3300049677 Bacteria 690
2347 Ga0501248_061256 3300049678 Bacteria 502
2348 Ga0501249_096994 3300049679 Bacteria 703
2349 Ga0501249_174100 3300049679 Bacteria 553
2350 Ga0501253_125808 3300049683 Bacteria 625
2351 Ga0501256_048461 3300049685 Bacteria 519
2352 Ga0501259_136001 3300049688 Bacteria 597
2353 Ga0501225_0046156 3300049705 Bacteria 1207
2354 Ga0501234_055758 3300049707 Bacteria 664
2355 Ga0501245_132744 3300049708 Bacteria 535
2356 Ga0501079_0001320 3300049741 Bacteria 17436
2357 Ga0501079_0055787 3300049741 Bacteria 3048
2358 Ga0501079_0148052 3300049741 Bacteria 1830
2359 Ga0501079_0269800 3300049741 Bacteria 1330
2360 Ga0501079_0843882 3300049741 Bacteria 721
2361 Ga0501079_1279896 3300049741 Bacteria 577
2362 Ga0501080_0001598 3300049742 Bacteria 19227
2363 Ga0501080_0156057 3300049742 Unclassified 2108
2364 Ga0501080_0484605 3300049742 Bacteria 1106
2365 Ga0501081_0002590 3300049743 Bacteria 11428
2366 Ga0501081_0017136 3300049743 Bacteria 4792
2367 Ga0501081_0033945 3300049743 Bacteria 3470
2368 Ga0501081_0130592 3300049743 Unclassified 1794
2369 Ga0501081_0515372 3300049743 Bacteria 892
2370 Ga0501081_1120041 3300049743 Unclassified 596
2371 Ga0501081_1405057 3300049743 Bacteria 530
2372 Ga0501083_0006060 3300049744 Bacteria 8565
2373 Ga0501268_006552 3300049765 Unclassified 1714
2374 Ga0501271_028894 3300049768 Bacteria 677
2375 Ga0501271_066076 3300049768 Unclassified 515
2376 Ga0501273_015205 3300049770 Bacteria 997
2377 Ga0501279_015216 3300049775 Bacteria 1064
2378 Ga0501283_057921 3300049779 Bacteria 696
2379 Ga0501283_084731 3300049779 Unclassified 600
2380 Ga0501035_0006651 3300049822 Bacteria 10811
2381 Ga0501035_0661742 3300049822 Bacteria 846
2382 Ga0501035_1277481 3300049822 Unclassified 567
2383 Ga0501044_0023195 3300049823 Bacteria 6603
2384 Ga0501044_0956189 3300049823 Bacteria 730
2385 Ga0501045_0000838 3300049824 Bacteria 19920
2386 Ga0501045_0010775 3300049824 Bacteria 6407
2387 Ga0501045_0057390 3300049824 Bacteria 2849
2388 Ga0501045_0089985 3300049824 Bacteria 2267
2389 Ga0501045_0454641 3300049824 Bacteria 952
2390 nmdc:mga03683_9150_c1 3300050489 Bacteria 3511
2391 nmdc:mga03n38_427625_c1 3300050490 Bacteria 733
2392 nmdc:mga00v17_162147_c1 3300050491 Bacteria 1440
2393 nmdc:mga00v17_16776_c1 3300050491 Bacteria 4132
2394 nmdc:mga00v17_19858_c1 3300050491 Bacteria 3842
2395 nmdc:mga00v17_266992_c1 3300050491 Bacteria 1110
2396 nmdc:mga0yw44_422286_c1 3300050492 Unclassified 903
2397 nmdc:mga0k408_163490_c1 3300050493 Unclassified 1326
2398 nmdc:mga0k408_319758_c1 3300050493 Bacteria 926
2399 nmdc:mga0k408_3476_c1 3300050493 Bacteria 8340
2400 nmdc:mga0k408_4351_c1 3300050493 Bacteria 7520
2401 nmdc:mga06z11_33122_c1 3300050494 Bacteria 2525
2402 nmdc:mga06z11_416539_c1 3300050494 Unclassified 810
2403 nmdc:mga06z11_469824_c1 3300050494 Bacteria 761
2404 nmdc:mga06z11_486849_c1 3300050494 Bacteria 747
2405 nmdc:mga04h51_15198_c1 3300050495 Bacteria 2214
2406 nmdc:mga04h51_23724_c1 3300050495 Bacteria 1871
2407 nmdc:mga07m45_10008_c1 3300050496 Bacteria 4937
2408 nmdc:mga07m45_456377_c1 3300050496 Bacteria 741
2409 nmdc:mga05p37_138725_c1 3300050507 Bacteria 2980
2410 nmdc:mga05p37_1423837_c1 3300050507 Bacteria 696
2411 nmdc:mga05p37_1570052_c1 3300050507 Unclassified 650
2412 nmdc:mga05p37_1585653_c1 3300050507 Bacteria 646
2413 nmdc:mga05p37_1586392_c1 3300050507 Unclassified 646
2414 nmdc:mga05p37_19535_c1 3300050507 Bacteria 8196
2415 nmdc:mga05p37_200946_c1 3300050507 Bacteria 2414
2416 nmdc:mga05p37_204194_c1 3300050507 Bacteria 2391
2417 nmdc:mga05p37_208332_c1 3300050507 Bacteria 2364
2418 nmdc:mga05p37_2097507_c1 3300050507 Unclassified 530
2419 nmdc:mga05p37_2242885_c1 3300050507 Archaea 505
2420 nmdc:mga05p37_2269157_c1 3300050507 Bacteria 501
2421 nmdc:mga05p37_257923_c1 3300050507 Bacteria 2088
2422 nmdc:mga05p37_312284_c1 3300050507 Bacteria 1863
2423 nmdc:mga05p37_324316_c1 3300050507 Bacteria 1822
2424 nmdc:mga05p37_348950_c1 3300050507 Bacteria 1743
2425 nmdc:mga05p37_398084_c1 3300050507 Bacteria 1608
2426 nmdc:mga05p37_417181_c1 3300050507 Bacteria 1563
2427 nmdc:mga05p37_4344_c1 3300050507 Bacteria 16546
2428 nmdc:mga05p37_52776_c1 3300050507 Bacteria 4999
2429 nmdc:mga05p37_650323_c1 3300050507 Bacteria 1181
2430 nmdc:mga05p37_66851_c1 3300050507 Bacteria 4421
2431 nmdc:mga05p37_77505_c1 3300050507 Bacteria 4092
2432 nmdc:mga05p37_78145_c1 3300050507 Bacteria 4075
2433 nmdc:mga05p37_8727_c1 3300050507 Bacteria 11971
2434 nmdc:mga05p37_9255_c1 3300050507 Bacteria 11642
2435 nmdc:mga05p37_973053_c1 3300050507 Bacteria 905
2436 nmdc:mga09592_1148594_c1 3300050508 Bacteria 644
2437 nmdc:mga09592_1195442_c1 3300050508 Bacteria 629
2438 nmdc:mga09592_123163_c1 3300050508 Bacteria 2228
2439 nmdc:mga09592_1334367_c1 3300050508 Bacteria 588
2440 nmdc:mga09592_14861_c1 3300050508 Bacteria 6357
2441 nmdc:mga09592_1705_c1 3300050508 Bacteria 17709
2442 nmdc:mga09592_366636_c1 3300050508 Bacteria 1246
2443 nmdc:mga09592_37667_c1 3300050508 Bacteria 4057
2444 nmdc:mga09592_446367_c1 3300050508 Bacteria 1116
2445 nmdc:mga09592_456736_c1 3300050508 Bacteria 1102
2446 nmdc:mga09592_4599_c1 3300050508 Bacteria 5578
2447 nmdc:mga09592_48621_c1 3300050508 Bacteria 3576
2448 nmdc:mga09592_5442_c1 3300050508 Bacteria 10353
2449 nmdc:mga09592_610037_c1 3300050508 Bacteria 934
2450 nmdc:mga09592_772917_c1 3300050508 Unclassified 814
2451 nmdc:mga09592_822086_c1 3300050508 Unclassified 785
2452 nmdc:mga09592_90639_c1 3300050508 Bacteria 2612
2453 nmdc:mga0qj67_110252_c1 3300050509 Bacteria 2221
2454 nmdc:mga0qj67_110759_c1 3300050509 Bacteria 2216
2455 nmdc:mga0qj67_14964_c1 3300050509 Bacteria 5870
2456 nmdc:mga0qj67_15370_c1 3300050509 Bacteria 5796
2457 nmdc:mga0qj67_1707_c1 3300050509 Bacteria 15485
2458 nmdc:mga0qj67_192504_c1 3300050509 Bacteria 1657
2459 nmdc:mga0qj67_206936_c1 3300050509 Bacteria 1594
2460 nmdc:mga0qj67_215063_c1 3300050509 Bacteria 1561
2461 nmdc:mga0qj67_254175_c1 3300050509 Bacteria 1426
2462 nmdc:mga0qj67_47063_c1 3300050509 Bacteria 3407
2463 nmdc:mga0qj67_901546_c1 3300050509 Unclassified 697
2464 nmdc:mga06r32_1294905_c1 3300050510 Unclassified 673
2465 nmdc:mga06r32_145316_c1 3300050510 Bacteria 2349
2466 nmdc:mga06r32_300681_c1 3300050510 Bacteria 1591
2467 nmdc:mga06r32_3088_c1 3300050510 Bacteria 14903
2468 nmdc:mga06r32_326778_c1 3300050510 Bacteria 1519
2469 nmdc:mga06r32_376982_c1 3300050510 Bacteria 1402
2470 nmdc:mga06r32_465149_c1 3300050510 Bacteria 1244
2471 nmdc:mga06r32_67915_c1 3300050510 Bacteria 3442
2472 nmdc:mga06r32_7112_c1 3300050510 Bacteria 10081
2473 nmdc:mga06r32_8866_c1 3300050510 Bacteria 9065
2474 nmdc:mga06r32_962622_c1 3300050510 Bacteria 808
2475 nmdc:mga08y16_1003061_c1 3300050511 Bacteria 815
2476 nmdc:mga08y16_109_c1 3300050511 Bacteria 69745
2477 nmdc:mga08y16_1187473_c1 3300050511 Bacteria 734
2478 nmdc:mga08y16_130580_c1 3300050511 Bacteria 2613
2479 nmdc:mga08y16_142950_c1 3300050511 Bacteria 2487
2480 nmdc:mga08y16_143_c2 3300050511 Bacteria 54311
2481 nmdc:mga08y16_15585_c1 3300050511 Bacteria 7993
2482 nmdc:mga08y16_155_c1 3300050511 Bacteria 31746
2483 nmdc:mga08y16_1975190_c1 3300050511 Bacteria 533
2484 nmdc:mga08y16_2023008_c1 3300050511 Bacteria 525
2485 nmdc:mga08y16_2034_c1 3300050511 Bacteria 20719
2486 nmdc:mga08y16_2151888_c1 3300050511 Unclassified 505
2487 nmdc:mga08y16_224915_c1 3300050511 Bacteria 1942
2488 nmdc:mga08y16_31145_c1 3300050511 Bacteria 5613
2489 nmdc:mga08y16_4050_c1 3300050511 Bacteria 15294
2490 nmdc:mga08y16_418880_c1 3300050511 Bacteria 1369
2491 nmdc:mga08y16_433296_c1 3300050511 Unclassified 1343
2492 nmdc:mga08y16_44610_c1 3300050511 Bacteria 4645
2493 nmdc:mga08y16_479407_c1 3300050511 Unclassified 1266
2494 nmdc:mga08y16_480609_c1 3300050511 Bacteria 1264
2495 nmdc:mga08y16_597730_c1 3300050511 Bacteria 1112
2496 nmdc:mga08y16_729099_c1 3300050511 Bacteria 989
2497 nmdc:mga08y16_740118_c1 3300050511 Bacteria 980
2498 nmdc:mga08y16_855459_c1 3300050511 Bacteria 898
2499 nmdc:mga08y16_87907_c1 3300050511 Bacteria 3238
2500 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
2501 nmdc:mga08y16_920_c1 3300050511 Bacteria 28551
2502 nmdc:mga08y16_92356_c1 3300050511 Bacteria 3154
2503 nmdc:mga0n895_101876_c1 3300050512 Bacteria 2882
2504 nmdc:mga0n895_1036_c1 3300050512 Bacteria 20226
2505 nmdc:mga0n895_109795_c1 3300050512 Bacteria 829
2506 nmdc:mga0n895_1271911_c1 3300050512 Bacteria 707
2507 nmdc:mga0n895_1377323_c1 3300050512 Bacteria 674
2508 nmdc:mga0n895_148694_c1 3300050512 Bacteria 2372
2509 nmdc:mga0n895_15184_c1 3300050512 Bacteria 7018
2510 nmdc:mga0n895_1737421_c1 3300050512 Bacteria 586
2511 nmdc:mga0n895_1738539_c1 3300050512 Archaea 585
2512 nmdc:mga0n895_187108_c1 3300050512 Bacteria 2102
2513 nmdc:mga0n895_1898733_c1 3300050512 Unclassified 555
2514 nmdc:mga0n895_26397_c1 3300050512 Bacteria 5500
2515 nmdc:mga0n895_3447_c1 3300050512 Bacteria 12768
2516 nmdc:mga0n895_426783_c1 3300050512 Bacteria 1340
2517 nmdc:mga0n895_58600_c1 3300050512 Bacteria 3797
2518 nmdc:mga0n895_66607_c1 3300050512 Bacteria 3566
2519 nmdc:mga0n895_686489_c1 3300050512 Bacteria 1021
2520 nmdc:mga0n895_735164_c1 3300050512 Bacteria 981
2521 nmdc:mga0n895_8433_c1 3300050512 Bacteria 8922
2522 nmdc:mga0n895_889507_c1 3300050512 Unclassified 876
2523 nmdc:mga0rr50_1137_c2 3300050513 Bacteria 12993
2524 nmdc:mga0rr50_161849_c1 3300050513 Bacteria 1817
2525 nmdc:mga0rr50_223652_c1 3300050513 Bacteria 1555
2526 nmdc:mga0rr50_23467_c1 3300050513 Bacteria 4254
2527 nmdc:mga0rr50_26163_c1 3300050513 Unclassified 4066
2528 nmdc:mga0rr50_44277_c1 3300050513 Bacteria 3263
2529 nmdc:mga0rr50_457787_c1 3300050513 Bacteria 1082
2530 nmdc:mga0rr50_6472_c1 3300050513 Bacteria 7133
2531 nmdc:mga0rr50_72784_c1 3300050513 Bacteria 2626
2532 nmdc:mga08x19_1108514_c1 3300050514 Unclassified 562
2533 nmdc:mga08x19_221628_c1 3300050514 Bacteria 1300
2534 nmdc:mga08x19_29827_c1 3300050514 Bacteria 3423
2535 nmdc:mga08x19_525248_c1 3300050514 Bacteria 837
2536 nmdc:mga08x19_64303_c1 3300050514 Bacteria 2382
2537 nmdc:mga0a205_119797_c1 3300050515 Unclassified 2531
2538 nmdc:mga0a205_123144_c1 3300050515 Bacteria 2493
2539 nmdc:mga0a205_128247_c1 3300050515 Bacteria 2437
2540 nmdc:mga0a205_1288_c1 3300050515 Bacteria 21111
2541 nmdc:mga0a205_1383640_c1 3300050515 Unclassified 551
2542 nmdc:mga0a205_2131_c1 3300050515 Bacteria 17373
2543 nmdc:mga0a205_23887_c1 3300050515 Bacteria 5802
2544 nmdc:mga0a205_25144_c1 3300050515 Bacteria 1828
2545 nmdc:mga0a205_255663_c1 3300050515 Bacteria 1630
2546 nmdc:mga0a205_330526_c1 3300050515 Bacteria 1394
2547 nmdc:mga0a205_34802_c1 3300050515 Bacteria 4833
2548 nmdc:mga0a205_463659_c1 3300050515 Bacteria 1126
2549 nmdc:mga0a205_495418_c1 3300050515 Unclassified 1079
2550 nmdc:mga0a205_55369_c1 3300050515 Bacteria 3831
2551 nmdc:mga0a205_617923_c1 3300050515 Bacteria 936
2552 nmdc:mga0a205_658392_c1 3300050515 Bacteria 898
2553 nmdc:mga0a205_849795_c1 3300050515 Bacteria 760
2554 Ga0495601_0006402 3300053077 Bacteria 6886
2555 Ga0495601_0024751 3300053077 Bacteria 3697
2556 Ga0495601_0148695 3300053077 Bacteria 1529
2557 Ga0495601_0345043 3300053077 Bacteria 968
2558 Ga0495595_0233959 3300053084 Bacteria 918
2559 Ga0495619_0009733 3300053085 Bacteria 6059
2560 Ga0495619_0113384 3300053085 Bacteria 1854
2561 Ga0495619_0226349 3300053085 Bacteria 1296
2562 Ga0495619_0493149 3300053085 Unclassified 843
2563 Ga0495619_0585239 3300053085 Bacteria 764
2564 Ga0495619_0635129 3300053085 Unclassified 729
2565 Ga0495619_0805831 3300053085 Unclassified 635
2566 Ga0500628_120392 3300053129 Unclassified 712
2567 Ga0501084_0023198 3300054114 Bacteria 5180
2568 Ga0501084_0365658 3300054114 Bacteria 1219
2569 Ga0501084_0459203 3300054114 Bacteria 1077
2570 Ga0501084_0480139 3300054114 Unclassified 1051
2571 Ga0501084_0762796 3300054114 Unclassified 815
2572 Ga0590071_027534 3300059421 Bacteria 1350
2573 Ga0501082_0006809 3300060353 Bacteria 9878
2574 Ga0501082_0043983 3300060353 Bacteria 3852
2575 Ga0501082_0205551 3300060353 Bacteria 1713
2576 Ga0501082_0644256 3300060353 Unclassified 927
2577 Ga0530510_0001782 3300061734 Bacteria 14686
2578 Ga0530510_0006476 3300061734 Bacteria 8154

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0787118 Ga0466966_0787118_163_516 74
2 3300045049 Ga0466959_0418768 Ga0466959_0418768_440_793 74
3 3300005435 Ga0070714_100009036 Ga0070714_1000090362 88
4 3300009553 Ga0105249_10508561 Ga0105249_105085612 88
5 3300025929 Ga0207664_10085341 Ga0207664_100853412 88
6 3300028556 Ga0265337_1034006 Ga0265337_10340062 88
7 3300028558 Ga0265326_10000028 Ga0265326_1000002873 88
8 3300028563 Ga0265319_1000746 Ga0265319_100074616 88
9 3300028573 Ga0265334_10000040 Ga0265334_1000004062 88
10 3300028666 Ga0265336_10003949 Ga0265336_100039492 88
11 3300028800 Ga0265338_10000661 Ga0265338_1000066147 88
12 3300029957 Ga0265324_10006868 Ga0265324_100068687 88
13 3300031240 Ga0265320_10357648 Ga0265320_103576482 88
14 3300031251 Ga0265327_10016019 Ga0265327_100160194 88
15 3300007076 Ga0075435_100283680 Ga0075435_1002836802 89
16 3300050513 nmdc:mga0rr50_223652_c1 nmdc:mga0rr50_223652_c1_585_938 89
17 3300010375 Ga0105239_10032758 Ga0105239_100327581 92
18 3300048915 Ga0496112_0914284 Ga0496112_0914284_108_461 92
19 3300048916 Ga0496113_0422096 Ga0496113_0422096_698_1051 92
20 3300009148 Ga0105243_12484706 Ga0105243_124847062 97
21 3300009176 Ga0105242_11733222 Ga0105242_117332222 97
22 3300035692 Ga0373935_1296175 Ga0373935_1296175_229_525 97
23 3300041410 Ga0439461_0082133 Ga0439461_0082133_434_730 97
24 3300042532 Ga0450893_0095625 Ga0450893_0095625_29_325 97
25 3300047444 Ga0495675_0178139 Ga0495675_0178139_396_692 97
26 3300049570 Ga0501033_0620244 Ga0501033_0620244_12_308 97
27 3300049677 Ga0501247_036380 Ga0501247_036380_378_674 97
28 3300005841 Ga0068863_100351308 Ga0068863_1003513082 98
29 3300049592 Ga0501076_0878551 Ga0501076_0878551_190_519 99
30 3300039437 Ga0436365_1017954 Ga0436365_1017954_47_385 100
31 3300042014 Ga0439457_111164 Ga0439457_111164_289_618 100
32 3300005444 Ga0070694_100932338 Ga0070694_1009323381 101
33 3300005471 Ga0070698_101139025 Ga0070698_1011390251 101
34 3300005518 Ga0070699_101389000 Ga0070699_1013890002 101
35 3300005356 Ga0070674_100875338 Ga0070674_1008753382 102
36 3300005578 Ga0068854_100010562 Ga0068854_1000105624 102
37 3300025908 Ga0207643_10546201 Ga0207643_105462012 102
38 3300025981 Ga0207640_10390288 Ga0207640_103902882 102
39 3300050507 nmdc:mga05p37_2242885_c1 nmdc:mga05p37_2242885_c1_15_326 102
40 3300005844 Ga0068862_102300737 Ga0068862_1023007372 104
41 3300013308 Ga0157375_11121992 Ga0157375_111219921 104
42 3300049586 Ga0501070_0404783 Ga0501070_0404783_234_554 105
43 3300049822 Ga0501035_1277481 Ga0501035_1277481_125_442 105
44 3300005289 Ga0065704_10655043 Ga0065704_106550431 107
45 3300005340 Ga0070689_101011754 Ga0070689_1010117542 107
46 3300005353 Ga0070669_101391786 Ga0070669_1013917862 107
47 3300042156 Ga0439446_0048404 Ga0439446_0048404_59_382 107
48 3300046539 Ga0495621_0216521 Ga0495621_0216521_291_614 107
49 3300049576 Ga0501040_0435656 Ga0501040_0435656_539_862 107
50 3300049679 Ga0501249_174100 Ga0501249_174100_88_414 107
51 3300049743 Ga0501081_0515372 Ga0501081_0515372_546_869 107
52 3300050511 nmdc:mga08y16_2034_c1 nmdc:mga08y16_2034_c1_15819_16142 107
53 3300005467 Ga0070706_100983878 Ga0070706_1009838781 108
54 3300005471 Ga0070698_100765102 Ga0070698_1007651022 108
55 3300005564 Ga0070664_101076178 Ga0070664_1010761782 108
56 3300006237 Ga0097621_100255643 Ga0097621_1002556431 108
57 3300006358 Ga0068871_100144872 Ga0068871_1001448722 108
58 3300007265 Ga0099794_10434603 Ga0099794_104346031 108
59 3300013297 Ga0157378_11056683 Ga0157378_110566832 108
60 3300013306 Ga0163162_12698906 Ga0163162_126989062 108
61 3300025905 Ga0207685_10293698 Ga0207685_102936981 108
62 3300025910 Ga0207684_10333968 Ga0207684_103339682 108
63 3300025919 Ga0207657_10385960 Ga0207657_103859602 108
64 3300025933 Ga0207706_11058489 Ga0207706_110584892 108
65 3300025945 Ga0207679_10847664 Ga0207679_108476642 108
66 3300035086 Ga0373934_0230471 Ga0373934_0230471_155_487 108
67 3300035117 Ga0373953_0161933 Ga0373953_0161933_139_471 108
68 3300035172 Ga0373955_0083243 Ga0373955_0083243_166_498 108
69 3300036401 Ga0373937_1988862 Ga0373937_1988862_166_498 108
70 3300037068 Ga0373925_0477981 Ga0373925_0477981_347_679 108
71 3300046455 Ga0495603_0376659 Ga0495603_0376659_244_588 108
72 3300046475 Ga0495639_0156778 Ga0495639_0156778_685_1017 108
73 3300046681 Ga0495647_0065623 Ga0495647_0065623_964_1308 108
74 3300046683 Ga0495658_0041345 Ga0495658_0041345_1886_2230 108
75 3300048903 Ga0496100_0102699 Ga0496100_0102699_1504_1848 108
76 3300048904 Ga0496101_0001362 Ga0496101_0001362_7185_7529 108
77 3300048905 Ga0496102_0852176 Ga0496102_0852176_382_726 108
78 3300048907 Ga0496104_0142420 Ga0496104_0142420_646_990 108
79 3300048909 Ga0496106_0082789 Ga0496106_0082789_644_988 108
80 3300048910 Ga0496107_0170039 Ga0496107_0170039_758_1102 108
81 3300048917 Ga0496114_0000743 Ga0496114_0000743_13429_13773 108
82 3300053085 Ga0495619_0493149 Ga0495619_0493149_257_589 108
83 3300000044 ARSoilOldRDRAFT_c015219 ARSoilOldRDRAFT_0152192 109
84 3300001977 JGI24746J21847_1001104 JGI24746J21847_10011043 109
85 3300001991 JGI24743J22301_10152721 JGI24743J22301_101527212 109
86 3300002073 JGI24745J21846_1035581 JGI24745J21846_10355811 109
87 3300002126 JGI24035J26624_1018769 JGI24035J26624_10187691 109
88 3300002155 JGI24033J26618_1014535 JGI24033J26618_10145352 109
89 3300002459 JGI24751J29686_10039997 JGI24751J29686_100399972 109
90 3300002459 JGI24751J29686_10092875 JGI24751J29686_100928752 109
91 3300003203 JGI25406J46586_10001848 JGI25406J46586_100018489 109
92 3300003203 JGI25406J46586_10015761 JGI25406J46586_100157612 109
93 3300003575 Ga0007409J51694_1094330 Ga0007409J51694_10943302 109
94 3300003579 Ga0007429J51699_1091030 Ga0007429J51699_10910302 109
95 3300004798 Ga0058859_11801951 Ga0058859_118019511 109
96 3300004801 Ga0058860_11976869 Ga0058860_119768692 109
97 3300004801 Ga0058860_11990331 Ga0058860_119903312 109
98 3300005288 Ga0065714_10076628 Ga0065714_100766281 109
99 3300005288 Ga0065714_10083759 Ga0065714_100837592 109
100 3300005288 Ga0065714_10127161 Ga0065714_101271612 109
101 3300005288 Ga0065714_10314071 Ga0065714_103140712 109
102 3300005289 Ga0065704_10073095 Ga0065704_100730956 109
103 3300005289 Ga0065704_10414867 Ga0065704_104148671 109
104 3300005289 Ga0065704_10580918 Ga0065704_105809182 109
105 3300005289 Ga0065704_10585035 Ga0065704_105850351 109
106 3300005290 Ga0065712_10000606 Ga0065712_100006064 109
107 3300005290 Ga0065712_10001610 Ga0065712_100016105 109
108 3300005290 Ga0065712_10003904 Ga0065712_100039043 109
109 3300005290 Ga0065712_10031832 Ga0065712_100318322 109
110 3300005290 Ga0065712_10068769 Ga0065712_100687695 109
111 3300005290 Ga0065712_10091814 Ga0065712_100918142 109
112 3300005290 Ga0065712_10094945 Ga0065712_100949451 109
113 3300005290 Ga0065712_10141090 Ga0065712_101410902 109
114 3300005290 Ga0065712_10158009 Ga0065712_101580092 109
115 3300005290 Ga0065712_10159214 Ga0065712_101592142 109
116 3300005290 Ga0065712_10338388 Ga0065712_103383882 109
117 3300005290 Ga0065712_10605506 Ga0065712_106055061 109
118 3300005290 Ga0065712_10668066 Ga0065712_106680662 109
119 3300005293 Ga0065715_10000608 Ga0065715_100006086 109
120 3300005293 Ga0065715_10103698 Ga0065715_101036982 109
121 3300005293 Ga0065715_10134926 Ga0065715_101349262 109
122 3300005293 Ga0065715_10171014 Ga0065715_101710142 109
123 3300005293 Ga0065715_10371651 Ga0065715_103716512 109
124 3300005293 Ga0065715_10484167 Ga0065715_104841671 109
125 3300005293 Ga0065715_10502292 Ga0065715_105022922 109
126 3300005293 Ga0065715_10588216 Ga0065715_105882162 109
127 3300005293 Ga0065715_10634163 Ga0065715_106341632 109
128 3300005293 Ga0065715_10719491 Ga0065715_107194912 109
129 3300005293 Ga0065715_10764053 Ga0065715_107640531 109
130 3300005293 Ga0065715_10874796 Ga0065715_108747962 109
131 3300005293 Ga0065715_10959652 Ga0065715_109596522 109
132 3300005293 Ga0065715_10995081 Ga0065715_109950811 109
133 3300005295 Ga0065707_10001625 Ga0065707_100016254 109
134 3300005295 Ga0065707_10025113 Ga0065707_100251132 109
135 3300005295 Ga0065707_10052146 Ga0065707_100521462 109
136 3300005295 Ga0065707_10113954 Ga0065707_101139543 109
137 3300005295 Ga0065707_10115210 Ga0065707_101152102 109
138 3300005295 Ga0065707_10117763 Ga0065707_101177632 109
139 3300005295 Ga0065707_10121036 Ga0065707_101210363 109
140 3300005295 Ga0065707_10143401 Ga0065707_101434012 109
141 3300005295 Ga0065707_10427017 Ga0065707_104270171 109
142 3300005295 Ga0065707_10437955 Ga0065707_104379551 109
143 3300005295 Ga0065707_10500829 Ga0065707_105008291 109
144 3300005295 Ga0065707_10774695 Ga0065707_107746952 109
145 3300005295 Ga0065707_10913582 Ga0065707_109135822 109
146 3300005327 Ga0070658_10024349 Ga0070658_100243494 109
147 3300005328 Ga0070676_10017097 Ga0070676_100170972 109
148 3300005328 Ga0070676_10044432 Ga0070676_100444323 109
149 3300005328 Ga0070676_10053805 Ga0070676_100538052 109
150 3300005328 Ga0070676_10105547 Ga0070676_101055472 109
151 3300005328 Ga0070676_10127756 Ga0070676_101277561 109
152 3300005328 Ga0070676_10310803 Ga0070676_103108031 109
153 3300005328 Ga0070676_10478139 Ga0070676_104781392 109
154 3300005328 Ga0070676_10498232 Ga0070676_104982321 109
155 3300005328 Ga0070676_11177469 Ga0070676_111774692 109
156 3300005329 Ga0070683_100028120 Ga0070683_1000281202 109
157 3300005329 Ga0070683_100032991 Ga0070683_1000329913 109
158 3300005329 Ga0070683_100413841 Ga0070683_1004138412 109
159 3300005329 Ga0070683_101239933 Ga0070683_1012399331 109
160 3300005329 Ga0070683_101310690 Ga0070683_1013106901 109
161 3300005330 Ga0070690_100029489 Ga0070690_1000294892 109
162 3300005330 Ga0070690_100029519 Ga0070690_1000295193 109
163 3300005330 Ga0070690_100031442 Ga0070690_1000314422 109
164 3300005330 Ga0070690_100072866 Ga0070690_1000728662 109
165 3300005330 Ga0070690_100204853 Ga0070690_1002048532 109
166 3300005330 Ga0070690_100242064 Ga0070690_1002420642 109
167 3300005331 Ga0070670_100005242 Ga0070670_1000052422 109
168 3300005331 Ga0070670_100016095 Ga0070670_1000160955 109
169 3300005331 Ga0070670_100026591 Ga0070670_1000265911 109
170 3300005331 Ga0070670_100080922 Ga0070670_1000809222 109
171 3300005331 Ga0070670_100128918 Ga0070670_1001289182 109
172 3300005331 Ga0070670_100134769 Ga0070670_1001347693 109
173 3300005331 Ga0070670_100268650 Ga0070670_1002686502 109
174 3300005331 Ga0070670_100433912 Ga0070670_1004339122 109
175 3300005331 Ga0070670_100492261 Ga0070670_1004922612 109
176 3300005331 Ga0070670_100532565 Ga0070670_1005325652 109
177 3300005331 Ga0070670_100723340 Ga0070670_1007233402 109
178 3300005331 Ga0070670_101025573 Ga0070670_1010255731 109
179 3300005331 Ga0070670_101787004 Ga0070670_1017870042 109
180 3300005333 Ga0070677_10016037 Ga0070677_100160373 109
181 3300005333 Ga0070677_10026731 Ga0070677_100267311 109
182 3300005333 Ga0070677_10520465 Ga0070677_105204651 109
183 3300005333 Ga0070677_10528286 Ga0070677_105282861 109
184 3300005333 Ga0070677_10898464 Ga0070677_108984642 109
185 3300005334 Ga0068869_100061574 Ga0068869_1000615742 109
186 3300005334 Ga0068869_100070719 Ga0068869_1000707191 109
187 3300005334 Ga0068869_100115629 Ga0068869_1001156292 109
188 3300005334 Ga0068869_100285361 Ga0068869_1002853612 109
189 3300005334 Ga0068869_100304936 Ga0068869_1003049362 109
190 3300005334 Ga0068869_100405883 Ga0068869_1004058831 109
191 3300005334 Ga0068869_100587127 Ga0068869_1005871272 109
192 3300005334 Ga0068869_100619234 Ga0068869_1006192342 109
193 3300005334 Ga0068869_101161982 Ga0068869_1011619822 109
194 3300005334 Ga0068869_101245466 Ga0068869_1012454661 109
195 3300005334 Ga0068869_101275269 Ga0068869_1012752691 109
196 3300005334 Ga0068869_101649782 Ga0068869_1016497822 109
197 3300005335 Ga0070666_10015435 Ga0070666_100154353 109
198 3300005335 Ga0070666_10025573 Ga0070666_100255734 109
199 3300005335 Ga0070666_10063003 Ga0070666_100630032 109
200 3300005335 Ga0070666_10141298 Ga0070666_101412982 109
201 3300005335 Ga0070666_10249856 Ga0070666_102498562 109
202 3300005335 Ga0070666_10363174 Ga0070666_103631741 109
203 3300005335 Ga0070666_10462801 Ga0070666_104628012 109
204 3300005335 Ga0070666_10509488 Ga0070666_105094881 109
205 3300005335 Ga0070666_11107230 Ga0070666_111072302 109
206 3300005336 Ga0070680_100081806 Ga0070680_1000818062 109
207 3300005336 Ga0070680_100274873 Ga0070680_1002748732 109
208 3300005337 Ga0070682_100177524 Ga0070682_1001775242 109
209 3300005337 Ga0070682_100393341 Ga0070682_1003933412 109
210 3300005337 Ga0070682_100408628 Ga0070682_1004086281 109
211 3300005338 Ga0068868_100002613 Ga0068868_1000026136 109
212 3300005338 Ga0068868_100125325 Ga0068868_1001253252 109
213 3300005338 Ga0068868_100168029 Ga0068868_1001680292 109
214 3300005338 Ga0068868_100181016 Ga0068868_1001810162 109
215 3300005338 Ga0068868_100406504 Ga0068868_1004065042 109
216 3300005338 Ga0068868_100474576 Ga0068868_1004745762 109
217 3300005338 Ga0068868_100753819 Ga0068868_1007538192 109
218 3300005338 Ga0068868_100896550 Ga0068868_1008965502 109
219 3300005338 Ga0068868_101754862 Ga0068868_1017548622 109
220 3300005339 Ga0070660_100790408 Ga0070660_1007904082 109
221 3300005340 Ga0070689_100004747 Ga0070689_1000047473 109
222 3300005340 Ga0070689_100008229 Ga0070689_1000082294 109
223 3300005340 Ga0070689_100014545 Ga0070689_1000145452 109
224 3300005340 Ga0070689_100017434 Ga0070689_1000174342 109
225 3300005340 Ga0070689_100020726 Ga0070689_1000207264 109
226 3300005340 Ga0070689_100046423 Ga0070689_1000464232 109
227 3300005340 Ga0070689_100633346 Ga0070689_1006333461 109
228 3300005341 Ga0070691_10034977 Ga0070691_100349772 109
229 3300005341 Ga0070691_10133947 Ga0070691_101339472 109
230 3300005341 Ga0070691_10247625 Ga0070691_102476251 109
231 3300005341 Ga0070691_10440904 Ga0070691_104409042 109
232 3300005341 Ga0070691_10521898 Ga0070691_105218981 109
233 3300005341 Ga0070691_10650128 Ga0070691_106501282 109
234 3300005343 Ga0070687_100002751 Ga0070687_1000027516 109
235 3300005343 Ga0070687_100071459 Ga0070687_1000714591 109
236 3300005343 Ga0070687_100091341 Ga0070687_1000913412 109
237 3300005343 Ga0070687_100141709 Ga0070687_1001417092 109
238 3300005343 Ga0070687_100403390 Ga0070687_1004033902 109
239 3300005343 Ga0070687_100426936 Ga0070687_1004269361 109
240 3300005343 Ga0070687_100581574 Ga0070687_1005815741 109
241 3300005343 Ga0070687_100619469 Ga0070687_1006194692 109
242 3300005343 Ga0070687_100876420 Ga0070687_1008764201 109
243 3300005344 Ga0070661_100073736 Ga0070661_1000737363 109
244 3300005344 Ga0070661_100154837 Ga0070661_1001548372 109
245 3300005344 Ga0070661_100158947 Ga0070661_1001589472 109
246 3300005344 Ga0070661_100360176 Ga0070661_1003601762 109
247 3300005344 Ga0070661_100425917 Ga0070661_1004259172 109
248 3300005344 Ga0070661_100527358 Ga0070661_1005273582 109
249 3300005344 Ga0070661_101075215 Ga0070661_1010752151 109
250 3300005344 Ga0070661_101303844 Ga0070661_1013038441 109
251 3300005344 Ga0070661_101891011 Ga0070661_1018910111 109
252 3300005345 Ga0070692_10026150 Ga0070692_100261502 109
253 3300005345 Ga0070692_10053127 Ga0070692_100531272 109
254 3300005345 Ga0070692_10107616 Ga0070692_101076162 109
255 3300005345 Ga0070692_10112288 Ga0070692_101122881 109
256 3300005345 Ga0070692_10163313 Ga0070692_101633132 109
257 3300005345 Ga0070692_10348102 Ga0070692_103481022 109
258 3300005347 Ga0070668_100011207 Ga0070668_1000112072 109
259 3300005347 Ga0070668_100034459 Ga0070668_1000344593 109
260 3300005347 Ga0070668_100236894 Ga0070668_1002368941 109
261 3300005347 Ga0070668_100308244 Ga0070668_1003082441 109
262 3300005347 Ga0070668_100793733 Ga0070668_1007937332 109
263 3300005347 Ga0070668_100825367 Ga0070668_1008253672 109
264 3300005347 Ga0070668_101633597 Ga0070668_1016335971 109
265 3300005347 Ga0070668_101740917 Ga0070668_1017409172 109
266 3300005347 Ga0070668_102005199 Ga0070668_1020051991 109
267 3300005353 Ga0070669_100003660 Ga0070669_1000036607 109
268 3300005353 Ga0070669_100023915 Ga0070669_1000239154 109
269 3300005353 Ga0070669_100027137 Ga0070669_1000271374 109
270 3300005353 Ga0070669_100068139 Ga0070669_1000681391 109
271 3300005353 Ga0070669_100139991 Ga0070669_1001399912 109
272 3300005353 Ga0070669_100167787 Ga0070669_1001677872 109
273 3300005353 Ga0070669_100190989 Ga0070669_1001909892 109
274 3300005353 Ga0070669_100306614 Ga0070669_1003066142 109
275 3300005353 Ga0070669_100328516 Ga0070669_1003285162 109
276 3300005353 Ga0070669_100482997 Ga0070669_1004829972 109
277 3300005353 Ga0070669_100572812 Ga0070669_1005728121 109
278 3300005353 Ga0070669_100803504 Ga0070669_1008035042 109
279 3300005353 Ga0070669_100974136 Ga0070669_1009741361 109
280 3300005353 Ga0070669_101036047 Ga0070669_1010360472 109
281 3300005354 Ga0070675_100012940 Ga0070675_1000129404 109
282 3300005354 Ga0070675_100016195 Ga0070675_1000161956 109
283 3300005354 Ga0070675_100023187 Ga0070675_1000231874 109
284 3300005354 Ga0070675_100028016 Ga0070675_1000280163 109
285 3300005354 Ga0070675_100032799 Ga0070675_1000327993 109
286 3300005354 Ga0070675_100043086 Ga0070675_1000430862 109
287 3300005354 Ga0070675_100043190 Ga0070675_1000431904 109
288 3300005354 Ga0070675_100054777 Ga0070675_1000547772 109
289 3300005354 Ga0070675_100092883 Ga0070675_1000928832 109
290 3300005354 Ga0070675_100094360 Ga0070675_1000943602 109
291 3300005354 Ga0070675_100106368 Ga0070675_1001063683 109
292 3300005354 Ga0070675_100124332 Ga0070675_1001243322 109
293 3300005354 Ga0070675_100140257 Ga0070675_1001402572 109
294 3300005354 Ga0070675_100140848 Ga0070675_1001408482 109
295 3300005354 Ga0070675_100161639 Ga0070675_1001616392 109
296 3300005354 Ga0070675_100252931 Ga0070675_1002529312 109
297 3300005354 Ga0070675_100348204 Ga0070675_1003482042 109
298 3300005354 Ga0070675_100898481 Ga0070675_1008984811 109
299 3300005354 Ga0070675_100953523 Ga0070675_1009535231 109
300 3300005354 Ga0070675_101025816 Ga0070675_1010258161 109
301 3300005354 Ga0070675_101082920 Ga0070675_1010829202 109
302 3300005354 Ga0070675_101148262 Ga0070675_1011482621 109
303 3300005355 Ga0070671_100018697 Ga0070671_1000186974 109
304 3300005355 Ga0070671_100027473 Ga0070671_1000274735 109
305 3300005355 Ga0070671_100037768 Ga0070671_1000377683 109
306 3300005355 Ga0070671_100226603 Ga0070671_1002266032 109
307 3300005355 Ga0070671_100239244 Ga0070671_1002392442 109
308 3300005355 Ga0070671_100268189 Ga0070671_1002681892 109
309 3300005355 Ga0070671_100511295 Ga0070671_1005112951 109
310 3300005355 Ga0070671_101088131 Ga0070671_1010881312 109
311 3300005355 Ga0070671_101218468 Ga0070671_1012184681 109
312 3300005356 Ga0070674_100023482 Ga0070674_1000234823 109
313 3300005356 Ga0070674_100030097 Ga0070674_1000300972 109
314 3300005356 Ga0070674_100108249 Ga0070674_1001082493 109
315 3300005356 Ga0070674_100145197 Ga0070674_1001451973 109
316 3300005356 Ga0070674_100164633 Ga0070674_1001646332 109
317 3300005356 Ga0070674_100189381 Ga0070674_1001893812 109
318 3300005356 Ga0070674_100299300 Ga0070674_1002993002 109
319 3300005356 Ga0070674_100350905 Ga0070674_1003509052 109
320 3300005356 Ga0070674_100375091 Ga0070674_1003750912 109
321 3300005356 Ga0070674_100410449 Ga0070674_1004104492 109
322 3300005356 Ga0070674_100428067 Ga0070674_1004280672 109
323 3300005356 Ga0070674_100645872 Ga0070674_1006458721 109
324 3300005356 Ga0070674_100694804 Ga0070674_1006948041 109
325 3300005356 Ga0070674_100705686 Ga0070674_1007056862 109
326 3300005356 Ga0070674_100747991 Ga0070674_1007479912 109
327 3300005356 Ga0070674_101028974 Ga0070674_1010289742 109
328 3300005356 Ga0070674_101177315 Ga0070674_1011773152 109
329 3300005356 Ga0070674_101328677 Ga0070674_1013286772 109
330 3300005356 Ga0070674_101491724 Ga0070674_1014917242 109
331 3300005356 Ga0070674_101505806 Ga0070674_1015058061 109
332 3300005356 Ga0070674_102092931 Ga0070674_1020929312 109
333 3300005364 Ga0070673_100002420 Ga0070673_10000242010 109
334 3300005364 Ga0070673_100088599 Ga0070673_1000885992 109
335 3300005364 Ga0070673_100116081 Ga0070673_1001160812 109
336 3300005364 Ga0070673_100156089 Ga0070673_1001560891 109
337 3300005364 Ga0070673_100158464 Ga0070673_1001584642 109
338 3300005364 Ga0070673_100207926 Ga0070673_1002079262 109
339 3300005364 Ga0070673_100242943 Ga0070673_1002429431 109
340 3300005364 Ga0070673_100251410 Ga0070673_1002514102 109
341 3300005364 Ga0070673_100272696 Ga0070673_1002726962 109
342 3300005364 Ga0070673_100373103 Ga0070673_1003731032 109
343 3300005364 Ga0070673_100588565 Ga0070673_1005885652 109
344 3300005364 Ga0070673_100879958 Ga0070673_1008799582 109
345 3300005364 Ga0070673_101084985 Ga0070673_1010849851 109
346 3300005364 Ga0070673_101089057 Ga0070673_1010890572 109
347 3300005365 Ga0070688_100001753 Ga0070688_10000175310 109
348 3300005365 Ga0070688_100021218 Ga0070688_1000212183 109
349 3300005365 Ga0070688_100028061 Ga0070688_1000280612 109
350 3300005365 Ga0070688_100029021 Ga0070688_1000290212 109
351 3300005365 Ga0070688_100100222 Ga0070688_1001002222 109
352 3300005365 Ga0070688_100122052 Ga0070688_1001220522 109
353 3300005365 Ga0070688_100176393 Ga0070688_1001763932 109
354 3300005365 Ga0070688_100180496 Ga0070688_1001804963 109
355 3300005365 Ga0070688_100288123 Ga0070688_1002881232 109
356 3300005365 Ga0070688_100565502 Ga0070688_1005655022 109
357 3300005365 Ga0070688_101139966 Ga0070688_1011399661 109
358 3300005366 Ga0070659_100236015 Ga0070659_1002360152 109
359 3300005366 Ga0070659_100623034 Ga0070659_1006230341 109
360 3300005366 Ga0070659_101214932 Ga0070659_1012149321 109
361 3300005367 Ga0070667_100013896 Ga0070667_1000138962 109
362 3300005367 Ga0070667_100066891 Ga0070667_1000668912 109
363 3300005367 Ga0070667_100234216 Ga0070667_1002342162 109
364 3300005367 Ga0070667_100301068 Ga0070667_1003010682 109
365 3300005367 Ga0070667_100344106 Ga0070667_1003441062 109
366 3300005367 Ga0070667_100562263 Ga0070667_1005622631 109
367 3300005367 Ga0070667_100917851 Ga0070667_1009178511 109
368 3300005367 Ga0070667_101392029 Ga0070667_1013920292 109
369 3300005367 Ga0070667_102300926 Ga0070667_1023009261 109
370 3300005406 Ga0070703_10009612 Ga0070703_100096122 109
371 3300005406 Ga0070703_10291958 Ga0070703_102919581 109
372 3300005406 Ga0070703_10298510 Ga0070703_102985101 109
373 3300005406 Ga0070703_10300647 Ga0070703_103006472 109
374 3300005406 Ga0070703_10314820 Ga0070703_103148202 109
375 3300005406 Ga0070703_10336997 Ga0070703_103369971 109
376 3300005406 Ga0070703_10526263 Ga0070703_105262631 109
377 3300005434 Ga0070709_10005339 Ga0070709_100053396 109
378 3300005434 Ga0070709_10050658 Ga0070709_100506582 109
379 3300005434 Ga0070709_10210736 Ga0070709_102107363 109
380 3300005434 Ga0070709_10714089 Ga0070709_107140891 109
381 3300005436 Ga0070713_100023853 Ga0070713_1000238532 109
382 3300005436 Ga0070713_100027285 Ga0070713_1000272852 109
383 3300005436 Ga0070713_100080898 Ga0070713_1000808982 109
384 3300005436 Ga0070713_100406747 Ga0070713_1004067472 109
385 3300005436 Ga0070713_100463062 Ga0070713_1004630622 109
386 3300005437 Ga0070710_10769953 Ga0070710_107699532 109
387 3300005438 Ga0070701_10012529 Ga0070701_100125292 109
388 3300005438 Ga0070701_10016470 Ga0070701_100164705 109
389 3300005438 Ga0070701_10125174 Ga0070701_101251742 109
390 3300005438 Ga0070701_10169327 Ga0070701_101693272 109
391 3300005438 Ga0070701_10194546 Ga0070701_101945463 109
392 3300005438 Ga0070701_10248957 Ga0070701_102489572 109
393 3300005438 Ga0070701_10289216 Ga0070701_102892161 109
394 3300005438 Ga0070701_10758140 Ga0070701_107581402 109
395 3300005438 Ga0070701_11208803 Ga0070701_112088031 109
396 3300005439 Ga0070711_100295535 Ga0070711_1002955352 109
397 3300005439 Ga0070711_100457063 Ga0070711_1004570631 109
398 3300005439 Ga0070711_101395811 Ga0070711_1013958112 109
399 3300005440 Ga0070705_100000897 Ga0070705_1000008977 109
400 3300005440 Ga0070705_100006850 Ga0070705_1000068504 109
401 3300005440 Ga0070705_100124191 Ga0070705_1001241912 109
402 3300005440 Ga0070705_100205457 Ga0070705_1002054572 109
403 3300005440 Ga0070705_100242684 Ga0070705_1002426842 109
404 3300005440 Ga0070705_100246944 Ga0070705_1002469441 109
405 3300005440 Ga0070705_100367941 Ga0070705_1003679411 109
406 3300005440 Ga0070705_100571827 Ga0070705_1005718271 109
407 3300005440 Ga0070705_100662030 Ga0070705_1006620301 109
408 3300005440 Ga0070705_100666645 Ga0070705_1006666452 109
409 3300005440 Ga0070705_100739537 Ga0070705_1007395372 109
410 3300005440 Ga0070705_100813033 Ga0070705_1008130331 109
411 3300005440 Ga0070705_100894032 Ga0070705_1008940322 109
412 3300005441 Ga0070700_100007200 Ga0070700_1000072004 109
413 3300005441 Ga0070700_100022411 Ga0070700_1000224113 109
414 3300005441 Ga0070700_100037500 Ga0070700_1000375002 109
415 3300005441 Ga0070700_100053729 Ga0070700_1000537292 109
416 3300005441 Ga0070700_100088454 Ga0070700_1000884542 109
417 3300005441 Ga0070700_100104342 Ga0070700_1001043422 109
418 3300005441 Ga0070700_100270299 Ga0070700_1002702992 109
419 3300005441 Ga0070700_100312355 Ga0070700_1003123552 109
420 3300005441 Ga0070700_100400437 Ga0070700_1004004372 109
421 3300005441 Ga0070700_100559901 Ga0070700_1005599012 109
422 3300005441 Ga0070700_101053215 Ga0070700_1010532152 109
423 3300005441 Ga0070700_101325125 Ga0070700_1013251251 109
424 3300005441 Ga0070700_101525443 Ga0070700_1015254431 109
425 3300005441 Ga0070700_101982619 Ga0070700_1019826191 109
426 3300005444 Ga0070694_100001253 Ga0070694_1000012535 109
427 3300005444 Ga0070694_100001998 Ga0070694_1000019987 109
428 3300005444 Ga0070694_100115736 Ga0070694_1001157362 109
429 3300005444 Ga0070694_100128153 Ga0070694_1001281532 109
430 3300005444 Ga0070694_100131235 Ga0070694_1001312352 109
431 3300005444 Ga0070694_100167894 Ga0070694_1001678941 109
432 3300005444 Ga0070694_100177663 Ga0070694_1001776631 109
433 3300005444 Ga0070694_100237418 Ga0070694_1002374182 109
434 3300005444 Ga0070694_100328764 Ga0070694_1003287641 109
435 3300005444 Ga0070694_100376892 Ga0070694_1003768921 109
436 3300005444 Ga0070694_100395988 Ga0070694_1003959882 109
437 3300005445 Ga0070708_100370669 Ga0070708_1003706692 109
438 3300005445 Ga0070708_100469016 Ga0070708_1004690162 109
439 3300005445 Ga0070708_100860041 Ga0070708_1008600411 109
440 3300005445 Ga0070708_100960275 Ga0070708_1009602752 109
441 3300005455 Ga0070663_100074691 Ga0070663_1000746912 109
442 3300005455 Ga0070663_101513983 Ga0070663_1015139831 109
443 3300005456 Ga0070678_100038726 Ga0070678_1000387262 109
444 3300005456 Ga0070678_100041676 Ga0070678_1000416763 109
445 3300005456 Ga0070678_100069671 Ga0070678_1000696712 109
446 3300005456 Ga0070678_100091538 Ga0070678_1000915381 109
447 3300005456 Ga0070678_100139864 Ga0070678_1001398641 109
448 3300005456 Ga0070678_100169062 Ga0070678_1001690622 109
449 3300005456 Ga0070678_100179023 Ga0070678_1001790232 109
450 3300005456 Ga0070678_100295380 Ga0070678_1002953802 109
451 3300005456 Ga0070678_100418905 Ga0070678_1004189052 109
452 3300005456 Ga0070678_100554615 Ga0070678_1005546152 109
453 3300005456 Ga0070678_100657645 Ga0070678_1006576451 109
454 3300005456 Ga0070678_100742766 Ga0070678_1007427662 109
455 3300005456 Ga0070678_100835535 Ga0070678_1008355352 109
456 3300005456 Ga0070678_100845601 Ga0070678_1008456012 109
457 3300005456 Ga0070678_100862061 Ga0070678_1008620611 109
458 3300005456 Ga0070678_101094782 Ga0070678_1010947821 109
459 3300005456 Ga0070678_101521889 Ga0070678_1015218891 109
460 3300005457 Ga0070662_100043913 Ga0070662_1000439132 109
461 3300005457 Ga0070662_100083192 Ga0070662_1000831922 109
462 3300005457 Ga0070662_100160289 Ga0070662_1001602892 109
463 3300005457 Ga0070662_100189813 Ga0070662_1001898132 109
464 3300005457 Ga0070662_100354017 Ga0070662_1003540171 109
465 3300005457 Ga0070662_100473685 Ga0070662_1004736852 109
466 3300005457 Ga0070662_100501443 Ga0070662_1005014431 109
467 3300005457 Ga0070662_100655831 Ga0070662_1006558311 109
468 3300005457 Ga0070662_100739496 Ga0070662_1007394961 109
469 3300005457 Ga0070662_100958487 Ga0070662_1009584872 109
470 3300005457 Ga0070662_101139730 Ga0070662_1011397301 109
471 3300005457 Ga0070662_101201037 Ga0070662_1012010371 109
472 3300005457 Ga0070662_101341898 Ga0070662_1013418981 109
473 3300005458 Ga0070681_10036359 Ga0070681_100363595 109
474 3300005458 Ga0070681_10234728 Ga0070681_102347282 109
475 3300005458 Ga0070681_10245415 Ga0070681_102454152 109
476 3300005458 Ga0070681_10315070 Ga0070681_103150702 109
477 3300005458 Ga0070681_10353760 Ga0070681_103537601 109
478 3300005458 Ga0070681_10544930 Ga0070681_105449302 109
479 3300005458 Ga0070681_11123333 Ga0070681_111233332 109
480 3300005459 Ga0068867_100007393 Ga0068867_1000073938 109
481 3300005459 Ga0068867_100008654 Ga0068867_1000086544 109
482 3300005459 Ga0068867_100012752 Ga0068867_1000127527 109
483 3300005459 Ga0068867_100016089 Ga0068867_1000160891 109
484 3300005459 Ga0068867_100145700 Ga0068867_1001457002 109
485 3300005459 Ga0068867_100286851 Ga0068867_1002868511 109
486 3300005459 Ga0068867_100311441 Ga0068867_1003114412 109
487 3300005459 Ga0068867_100521265 Ga0068867_1005212652 109
488 3300005459 Ga0068867_101345790 Ga0068867_1013457901 109
489 3300005459 Ga0068867_101365680 Ga0068867_1013656802 109
490 3300005459 Ga0068867_101520011 Ga0068867_1015200111 109
491 3300005459 Ga0068867_101754969 Ga0068867_1017549691 109
492 3300005459 Ga0068867_101761317 Ga0068867_1017613172 109
493 3300005459 Ga0068867_102056289 Ga0068867_1020562891 109
494 3300005466 Ga0070685_10000947 Ga0070685_100009472 109
495 3300005466 Ga0070685_10202006 Ga0070685_102020062 109
496 3300005466 Ga0070685_10214530 Ga0070685_102145301 109
497 3300005466 Ga0070685_10309048 Ga0070685_103090482 109
498 3300005466 Ga0070685_10360382 Ga0070685_103603822 109
499 3300005466 Ga0070685_10374420 Ga0070685_103744202 109
500 3300005466 Ga0070685_10425666 Ga0070685_104256661 109
501 3300005466 Ga0070685_10561825 Ga0070685_105618252 109
502 3300005466 Ga0070685_11007625 Ga0070685_110076251 109
503 3300005466 Ga0070685_11579551 Ga0070685_115795511 109
504 3300005467 Ga0070706_100313699 Ga0070706_1003136991 109
505 3300005467 Ga0070706_100433779 Ga0070706_1004337792 109
506 3300005467 Ga0070706_100501160 Ga0070706_1005011602 109
507 3300005467 Ga0070706_100581790 Ga0070706_1005817901 109
508 3300005467 Ga0070706_101123123 Ga0070706_1011231231 109
509 3300005467 Ga0070706_101271203 Ga0070706_1012712032 109
510 3300005467 Ga0070706_101283085 Ga0070706_1012830852 109
511 3300005468 Ga0070707_100106563 Ga0070707_1001065632 109
512 3300005468 Ga0070707_100116361 Ga0070707_1001163612 109
513 3300005468 Ga0070707_100118656 Ga0070707_1001186562 109
514 3300005468 Ga0070707_100176549 Ga0070707_1001765492 109
515 3300005468 Ga0070707_100676427 Ga0070707_1006764272 109
516 3300005468 Ga0070707_100737860 Ga0070707_1007378602 109
517 3300005468 Ga0070707_101767055 Ga0070707_1017670551 109
518 3300005468 Ga0070707_102271565 Ga0070707_1022715651 109
519 3300005471 Ga0070698_100036634 Ga0070698_1000366344 109
520 3300005471 Ga0070698_100077203 Ga0070698_1000772032 109
521 3300005471 Ga0070698_100084104 Ga0070698_1000841042 109
522 3300005471 Ga0070698_100141206 Ga0070698_1001412062 109
523 3300005471 Ga0070698_100292134 Ga0070698_1002921342 109
524 3300005471 Ga0070698_100392553 Ga0070698_1003925532 109
525 3300005471 Ga0070698_100572122 Ga0070698_1005721222 109
526 3300005471 Ga0070698_100623826 Ga0070698_1006238261 109
527 3300005471 Ga0070698_100627389 Ga0070698_1006273891 109
528 3300005471 Ga0070698_100919765 Ga0070698_1009197652 109
529 3300005471 Ga0070698_100927033 Ga0070698_1009270331 109
530 3300005471 Ga0070698_102055084 Ga0070698_1020550841 109
531 3300005518 Ga0070699_100000410 Ga0070699_10000041014 109
532 3300005518 Ga0070699_100000753 Ga0070699_10000075318 109
533 3300005518 Ga0070699_100017510 Ga0070699_1000175104 109
534 3300005518 Ga0070699_100032358 Ga0070699_1000323584 109
535 3300005518 Ga0070699_100072950 Ga0070699_1000729502 109
536 3300005518 Ga0070699_100091280 Ga0070699_1000912802 109
537 3300005518 Ga0070699_100135537 Ga0070699_1001355371 109
538 3300005518 Ga0070699_100245741 Ga0070699_1002457412 109
539 3300005518 Ga0070699_100390198 Ga0070699_1003901982 109
540 3300005518 Ga0070699_100489514 Ga0070699_1004895142 109
541 3300005518 Ga0070699_100847762 Ga0070699_1008477621 109
542 3300005518 Ga0070699_101095718 Ga0070699_1010957181 109
543 3300005518 Ga0070699_101172278 Ga0070699_1011722781 109
544 3300005518 Ga0070699_101479520 Ga0070699_1014795201 109
545 3300005530 Ga0070679_100059093 Ga0070679_1000590932 109
546 3300005530 Ga0070679_100179646 Ga0070679_1001796462 109
547 3300005530 Ga0070679_101106211 Ga0070679_1011062111 109
548 3300005530 Ga0070679_101360741 Ga0070679_1013607412 109
549 3300005535 Ga0070684_100098813 Ga0070684_1000988132 109
550 3300005535 Ga0070684_100646836 Ga0070684_1006468361 109
551 3300005535 Ga0070684_100763403 Ga0070684_1007634032 109
552 3300005535 Ga0070684_101290966 Ga0070684_1012909662 109
553 3300005535 Ga0070684_101347554 Ga0070684_1013475542 109
554 3300005535 Ga0070684_101497389 Ga0070684_1014973891 109
555 3300005536 Ga0070697_100033368 Ga0070697_1000333684 109
556 3300005536 Ga0070697_100240185 Ga0070697_1002401852 109
557 3300005536 Ga0070697_100349499 Ga0070697_1003494992 109
558 3300005536 Ga0070697_100590548 Ga0070697_1005905482 109
559 3300005536 Ga0070697_100691193 Ga0070697_1006911932 109
560 3300005536 Ga0070697_100835451 Ga0070697_1008354512 109
561 3300005536 Ga0070697_102022129 Ga0070697_1020221291 109
562 3300005539 Ga0068853_100300755 Ga0068853_1003007552 109
563 3300005539 Ga0068853_100491875 Ga0068853_1004918751 109
564 3300005543 Ga0070672_100005033 Ga0070672_1000050332 109
565 3300005543 Ga0070672_100018161 Ga0070672_1000181613 109
566 3300005543 Ga0070672_100018273 Ga0070672_1000182733 109
567 3300005543 Ga0070672_100028636 Ga0070672_1000286362 109
568 3300005543 Ga0070672_100057910 Ga0070672_1000579102 109
569 3300005543 Ga0070672_100091670 Ga0070672_1000916702 109
570 3300005543 Ga0070672_100132620 Ga0070672_1001326203 109
571 3300005543 Ga0070672_100137378 Ga0070672_1001373782 109
572 3300005543 Ga0070672_100138059 Ga0070672_1001380592 109
573 3300005543 Ga0070672_100154028 Ga0070672_1001540282 109
574 3300005543 Ga0070672_100218002 Ga0070672_1002180022 109
575 3300005543 Ga0070672_100400931 Ga0070672_1004009312 109
576 3300005543 Ga0070672_100428513 Ga0070672_1004285132 109
577 3300005543 Ga0070672_100522166 Ga0070672_1005221662 109
578 3300005543 Ga0070672_100590641 Ga0070672_1005906412 109
579 3300005543 Ga0070672_101133921 Ga0070672_1011339212 109
580 3300005543 Ga0070672_101149525 Ga0070672_1011495252 109
581 3300005543 Ga0070672_101465441 Ga0070672_1014654411 109
582 3300005544 Ga0070686_100001410 Ga0070686_1000014102 109
583 3300005544 Ga0070686_100018367 Ga0070686_1000183672 109
584 3300005544 Ga0070686_100066401 Ga0070686_1000664012 109
585 3300005544 Ga0070686_100073995 Ga0070686_1000739952 109
586 3300005544 Ga0070686_100096363 Ga0070686_1000963633 109
587 3300005544 Ga0070686_100182542 Ga0070686_1001825422 109
588 3300005544 Ga0070686_100322083 Ga0070686_1003220832 109
589 3300005544 Ga0070686_100455187 Ga0070686_1004551872 109
590 3300005544 Ga0070686_100473925 Ga0070686_1004739252 109
591 3300005544 Ga0070686_100473950 Ga0070686_1004739502 109
592 3300005544 Ga0070686_100548966 Ga0070686_1005489662 109
593 3300005544 Ga0070686_101240827 Ga0070686_1012408271 109
594 3300005544 Ga0070686_101788966 Ga0070686_1017889661 109
595 3300005544 Ga0070686_101918884 Ga0070686_1019188841 109
596 3300005544 Ga0070686_101952522 Ga0070686_1019525221 109
597 3300005545 Ga0070695_100000939 Ga0070695_10000093914 109
598 3300005545 Ga0070695_100041621 Ga0070695_1000416213 109
599 3300005545 Ga0070695_100058755 Ga0070695_1000587552 109
600 3300005545 Ga0070695_100088445 Ga0070695_1000884452 109
601 3300005545 Ga0070695_100141576 Ga0070695_1001415761 109
602 3300005545 Ga0070695_100191216 Ga0070695_1001912162 109
603 3300005545 Ga0070695_100723857 Ga0070695_1007238571 109
604 3300005545 Ga0070695_101281754 Ga0070695_1012817541 109
605 3300005546 Ga0070696_100001074 Ga0070696_1000010749 109
606 3300005546 Ga0070696_100008820 Ga0070696_1000088203 109
607 3300005546 Ga0070696_100038629 Ga0070696_1000386292 109
608 3300005546 Ga0070696_100103211 Ga0070696_1001032112 109
609 3300005546 Ga0070696_100107749 Ga0070696_1001077492 109
610 3300005546 Ga0070696_100251895 Ga0070696_1002518952 109
611 3300005546 Ga0070696_100456033 Ga0070696_1004560332 109
612 3300005546 Ga0070696_100681800 Ga0070696_1006818002 109
613 3300005547 Ga0070693_100261677 Ga0070693_1002616771 109
614 3300005547 Ga0070693_100897588 Ga0070693_1008975882 109
615 3300005548 Ga0070665_100012666 Ga0070665_1000126664 109
616 3300005548 Ga0070665_100029781 Ga0070665_1000297815 109
617 3300005548 Ga0070665_100034631 Ga0070665_1000346312 109
618 3300005548 Ga0070665_101007899 Ga0070665_1010078992 109
619 3300005549 Ga0070704_100001249 Ga0070704_1000012492 109
620 3300005549 Ga0070704_100004940 Ga0070704_1000049405 109
621 3300005549 Ga0070704_100025590 Ga0070704_1000255904 109
622 3300005549 Ga0070704_100102200 Ga0070704_1001022002 109
623 3300005549 Ga0070704_100111026 Ga0070704_1001110261 109
624 3300005549 Ga0070704_100122788 Ga0070704_1001227882 109
625 3300005549 Ga0070704_100184666 Ga0070704_1001846662 109
626 3300005549 Ga0070704_100251466 Ga0070704_1002514661 109
627 3300005549 Ga0070704_100525243 Ga0070704_1005252431 109
628 3300005549 Ga0070704_100627521 Ga0070704_1006275211 109
629 3300005549 Ga0070704_100685322 Ga0070704_1006853222 109
630 3300005549 Ga0070704_100994962 Ga0070704_1009949622 109
631 3300005549 Ga0070704_101019325 Ga0070704_1010193251 109
632 3300005549 Ga0070704_101100846 Ga0070704_1011008462 109
633 3300005549 Ga0070704_101386655 Ga0070704_1013866552 109
634 3300005549 Ga0070704_101397212 Ga0070704_1013972122 109
635 3300005549 Ga0070704_101598784 Ga0070704_1015987842 109
636 3300005564 Ga0070664_100006618 Ga0070664_1000066187 109
637 3300005564 Ga0070664_100023419 Ga0070664_1000234193 109
638 3300005564 Ga0070664_100041208 Ga0070664_1000412082 109
639 3300005564 Ga0070664_100101236 Ga0070664_1001012362 109
640 3300005564 Ga0070664_100149280 Ga0070664_1001492802 109
641 3300005564 Ga0070664_100432279 Ga0070664_1004322792 109
642 3300005564 Ga0070664_100451037 Ga0070664_1004510372 109
643 3300005564 Ga0070664_100658297 Ga0070664_1006582972 109
644 3300005564 Ga0070664_100722954 Ga0070664_1007229542 109
645 3300005564 Ga0070664_100733423 Ga0070664_1007334232 109
646 3300005564 Ga0070664_101357864 Ga0070664_1013578642 109
647 3300005564 Ga0070664_101380279 Ga0070664_1013802792 109
648 3300005577 Ga0068857_100079371 Ga0068857_1000793714 109
649 3300005577 Ga0068857_100150832 Ga0068857_1001508322 109
650 3300005577 Ga0068857_100174209 Ga0068857_1001742092 109
651 3300005577 Ga0068857_100452499 Ga0068857_1004524991 109
652 3300005577 Ga0068857_100535693 Ga0068857_1005356932 109
653 3300005577 Ga0068857_101610488 Ga0068857_1016104882 109
654 3300005577 Ga0068857_101959580 Ga0068857_1019595801 109
655 3300005578 Ga0068854_100076351 Ga0068854_1000763513 109
656 3300005578 Ga0068854_100077452 Ga0068854_1000774522 109
657 3300005578 Ga0068854_100450182 Ga0068854_1004501822 109
658 3300005578 Ga0068854_100749467 Ga0068854_1007494672 109
659 3300005578 Ga0068854_101176832 Ga0068854_1011768321 109
660 3300005615 Ga0070702_100015349 Ga0070702_1000153493 109
661 3300005615 Ga0070702_100031935 Ga0070702_1000319352 109
662 3300005615 Ga0070702_100201913 Ga0070702_1002019132 109
663 3300005615 Ga0070702_100273570 Ga0070702_1002735701 109
664 3300005615 Ga0070702_100436024 Ga0070702_1004360242 109
665 3300005615 Ga0070702_100555985 Ga0070702_1005559851 109
666 3300005615 Ga0070702_100825978 Ga0070702_1008259782 109
667 3300005616 Ga0068852_100075870 Ga0068852_1000758701 109
668 3300005616 Ga0068852_101016662 Ga0068852_1010166621 109
669 3300005617 Ga0068859_100023275 Ga0068859_1000232753 109
670 3300005617 Ga0068859_100033707 Ga0068859_1000337073 109
671 3300005617 Ga0068859_100048146 Ga0068859_1000481462 109
672 3300005617 Ga0068859_100055252 Ga0068859_1000552522 109
673 3300005617 Ga0068859_100061540 Ga0068859_1000615402 109
674 3300005617 Ga0068859_100066190 Ga0068859_1000661904 109
675 3300005617 Ga0068859_100111753 Ga0068859_1001117532 109
676 3300005617 Ga0068859_100113988 Ga0068859_1001139882 109
677 3300005617 Ga0068859_100140184 Ga0068859_1001401842 109
678 3300005617 Ga0068859_100187875 Ga0068859_1001878752 109
679 3300005617 Ga0068859_100235859 Ga0068859_1002358593 109
680 3300005617 Ga0068859_100256618 Ga0068859_1002566181 109
681 3300005617 Ga0068859_100521796 Ga0068859_1005217962 109
682 3300005617 Ga0068859_100880755 Ga0068859_1008807551 109
683 3300005617 Ga0068859_101321780 Ga0068859_1013217802 109
684 3300005617 Ga0068859_101337837 Ga0068859_1013378372 109
685 3300005617 Ga0068859_101920698 Ga0068859_1019206982 109
686 3300005617 Ga0068859_102254685 Ga0068859_1022546852 109
687 3300005618 Ga0068864_100001449 Ga0068864_1000014495 109
688 3300005618 Ga0068864_100033085 Ga0068864_1000330852 109
689 3300005618 Ga0068864_100116552 Ga0068864_1001165522 109
690 3300005618 Ga0068864_100119189 Ga0068864_1001191894 109
691 3300005618 Ga0068864_100171845 Ga0068864_1001718452 109
692 3300005618 Ga0068864_100653142 Ga0068864_1006531422 109
693 3300005618 Ga0068864_100784206 Ga0068864_1007842061 109
694 3300005618 Ga0068864_100938612 Ga0068864_1009386122 109
695 3300005618 Ga0068864_100980107 Ga0068864_1009801072 109
696 3300005618 Ga0068864_101330219 Ga0068864_1013302191 109
697 3300005618 Ga0068864_101429478 Ga0068864_1014294782 109
698 3300005618 Ga0068864_101907656 Ga0068864_1019076562 109
699 3300005618 Ga0068864_102055217 Ga0068864_1020552172 109
700 3300005718 Ga0068866_10031836 Ga0068866_100318362 109
701 3300005718 Ga0068866_10094288 Ga0068866_100942882 109
702 3300005718 Ga0068866_10368368 Ga0068866_103683681 109
703 3300005718 Ga0068866_10409648 Ga0068866_104096482 109
704 3300005718 Ga0068866_10537328 Ga0068866_105373282 109
705 3300005718 Ga0068866_10785301 Ga0068866_107853011 109
706 3300005718 Ga0068866_11140695 Ga0068866_111406952 109
707 3300005719 Ga0068861_100016299 Ga0068861_1000162991 109
708 3300005719 Ga0068861_100016649 Ga0068861_1000166492 109
709 3300005719 Ga0068861_100016863 Ga0068861_1000168632 109
710 3300005719 Ga0068861_100053065 Ga0068861_1000530654 109
711 3300005719 Ga0068861_100062481 Ga0068861_1000624812 109
712 3300005719 Ga0068861_100071472 Ga0068861_1000714722 109
713 3300005719 Ga0068861_100084971 Ga0068861_1000849712 109
714 3300005719 Ga0068861_100135619 Ga0068861_1001356192 109
715 3300005719 Ga0068861_100209677 Ga0068861_1002096772 109
716 3300005719 Ga0068861_100331464 Ga0068861_1003314642 109
717 3300005719 Ga0068861_100388542 Ga0068861_1003885422 109
718 3300005719 Ga0068861_100450132 Ga0068861_1004501322 109
719 3300005719 Ga0068861_100506764 Ga0068861_1005067642 109
720 3300005719 Ga0068861_100547697 Ga0068861_1005476972 109
721 3300005719 Ga0068861_102233858 Ga0068861_1022338581 109
722 3300005719 Ga0068861_102532428 Ga0068861_1025324281 109
723 3300005834 Ga0068851_10101840 Ga0068851_101018402 109
724 3300005840 Ga0068870_10007356 Ga0068870_100073563 109
725 3300005840 Ga0068870_10012486 Ga0068870_100124863 109
726 3300005840 Ga0068870_10052341 Ga0068870_100523411 109
727 3300005840 Ga0068870_10055842 Ga0068870_100558423 109
728 3300005840 Ga0068870_10099479 Ga0068870_100994792 109
729 3300005840 Ga0068870_10112032 Ga0068870_101120322 109
730 3300005840 Ga0068870_10396432 Ga0068870_103964322 109
731 3300005840 Ga0068870_10539540 Ga0068870_105395402 109
732 3300005840 Ga0068870_10673927 Ga0068870_106739272 109
733 3300005840 Ga0068870_11317444 Ga0068870_113174442 109
734 3300005841 Ga0068863_100001998 Ga0068863_1000019984 109
735 3300005841 Ga0068863_100003338 Ga0068863_10000333815 109
736 3300005841 Ga0068863_100010691 Ga0068863_1000106912 109
737 3300005841 Ga0068863_100296914 Ga0068863_1002969142 109
738 3300005841 Ga0068863_100394671 Ga0068863_1003946712 109
739 3300005841 Ga0068863_100553528 Ga0068863_1005535282 109
740 3300005841 Ga0068863_100731439 Ga0068863_1007314392 109
741 3300005841 Ga0068863_101208102 Ga0068863_1012081022 109
742 3300005841 Ga0068863_101499439 Ga0068863_1014994392 109
743 3300005841 Ga0068863_101657212 Ga0068863_1016572121 109
744 3300005842 Ga0068858_100017315 Ga0068858_1000173154 109
745 3300005842 Ga0068858_100018057 Ga0068858_1000180577 109
746 3300005842 Ga0068858_100041117 Ga0068858_1000411173 109
747 3300005842 Ga0068858_100052285 Ga0068858_1000522853 109
748 3300005842 Ga0068858_100055021 Ga0068858_1000550212 109
749 3300005842 Ga0068858_100078536 Ga0068858_1000785363 109
750 3300005842 Ga0068858_100085768 Ga0068858_1000857682 109
751 3300005842 Ga0068858_100150435 Ga0068858_1001504352 109
752 3300005842 Ga0068858_100155455 Ga0068858_1001554552 109
753 3300005842 Ga0068858_100226785 Ga0068858_1002267852 109
754 3300005842 Ga0068858_100248451 Ga0068858_1002484512 109
755 3300005842 Ga0068858_100297298 Ga0068858_1002972982 109
756 3300005842 Ga0068858_100618020 Ga0068858_1006180202 109
757 3300005842 Ga0068858_100637000 Ga0068858_1006370003 109
758 3300005842 Ga0068858_100830798 Ga0068858_1008307981 109
759 3300005842 Ga0068858_101200908 Ga0068858_1012009082 109
760 3300005842 Ga0068858_101300602 Ga0068858_1013006021 109
761 3300005842 Ga0068858_101399910 Ga0068858_1013999102 109
762 3300005842 Ga0068858_101578364 Ga0068858_1015783642 109
763 3300005842 Ga0068858_101836407 Ga0068858_1018364071 109
764 3300005842 Ga0068858_101873047 Ga0068858_1018730472 109
765 3300005843 Ga0068860_100038835 Ga0068860_1000388355 109
766 3300005843 Ga0068860_100076543 Ga0068860_1000765432 109
767 3300005843 Ga0068860_100087884 Ga0068860_1000878843 109
768 3300005843 Ga0068860_100132440 Ga0068860_1001324402 109
769 3300005843 Ga0068860_100193257 Ga0068860_1001932572 109
770 3300005843 Ga0068860_100391717 Ga0068860_1003917172 109
771 3300005843 Ga0068860_100502177 Ga0068860_1005021772 109
772 3300005843 Ga0068860_100566985 Ga0068860_1005669852 109
773 3300005843 Ga0068860_100623495 Ga0068860_1006234952 109
774 3300005843 Ga0068860_100629188 Ga0068860_1006291882 109
775 3300005843 Ga0068860_100733962 Ga0068860_1007339622 109
776 3300005843 Ga0068860_101417381 Ga0068860_1014173812 109
777 3300005843 Ga0068860_102266689 Ga0068860_1022666891 109
778 3300005844 Ga0068862_100002296 Ga0068862_10000229615 109
779 3300005844 Ga0068862_100006007 Ga0068862_1000060072 109
780 3300005844 Ga0068862_100021571 Ga0068862_1000215713 109
781 3300005844 Ga0068862_100066542 Ga0068862_1000665422 109
782 3300005844 Ga0068862_100344154 Ga0068862_1003441542 109
783 3300005844 Ga0068862_100441079 Ga0068862_1004410792 109
784 3300005844 Ga0068862_100689126 Ga0068862_1006891261 109
785 3300005844 Ga0068862_100826185 Ga0068862_1008261852 109
786 3300005844 Ga0068862_100894987 Ga0068862_1008949872 109
787 3300005844 Ga0068862_101399557 Ga0068862_1013995572 109
788 3300005844 Ga0068862_102081918 Ga0068862_1020819182 109
789 3300005844 Ga0068862_102300860 Ga0068862_1023008601 109
790 3300005937 Ga0081455_10140765 Ga0081455_101407652 109
791 3300005937 Ga0081455_10589558 Ga0081455_105895582 109
792 3300005981 Ga0081538_10206388 Ga0081538_102063882 109
793 3300005985 Ga0081539_10000142 Ga0081539_1000014274 109
794 3300005985 Ga0081539_10000215 Ga0081539_10000215116 109
795 3300005985 Ga0081539_10003297 Ga0081539_1000329718 109
796 3300005985 Ga0081539_10059468 Ga0081539_100594683 109
797 3300005985 Ga0081539_10260238 Ga0081539_102602381 109
798 3300006028 Ga0070717_10403199 Ga0070717_104031991 109
799 3300006028 Ga0070717_11255778 Ga0070717_112557782 109
800 3300006038 Ga0075365_10032125 Ga0075365_100321252 109
801 3300006038 Ga0075365_11343602 Ga0075365_113436021 109
802 3300006042 Ga0075368_10018816 Ga0075368_100188162 109
803 3300006042 Ga0075368_10034977 Ga0075368_100349772 109
804 3300006051 Ga0075364_10005699 Ga0075364_100056992 109
805 3300006051 Ga0075364_10071778 Ga0075364_100717782 109
806 3300006058 Ga0075432_10144842 Ga0075432_101448422 109
807 3300006058 Ga0075432_10323013 Ga0075432_103230132 109
808 3300006058 Ga0075432_10403306 Ga0075432_104033062 109
809 3300006163 Ga0070715_10009391 Ga0070715_100093912 109
810 3300006163 Ga0070715_10564482 Ga0070715_105644822 109
811 3300006173 Ga0070716_100613314 Ga0070716_1006133142 109
812 3300006173 Ga0070716_100741513 Ga0070716_1007415132 109
813 3300006175 Ga0070712_100253943 Ga0070712_1002539432 109
814 3300006177 Ga0075362_10070036 Ga0075362_100700362 109
815 3300006178 Ga0075367_10024774 Ga0075367_100247742 109
816 3300006178 Ga0075367_10145935 Ga0075367_101459352 109
817 3300006178 Ga0075367_10271666 Ga0075367_102716662 109
818 3300006195 Ga0075366_10005878 Ga0075366_100058782 109
819 3300006195 Ga0075366_10009758 Ga0075366_100097582 109
820 3300006195 Ga0075366_10130555 Ga0075366_101305552 109
821 3300006195 Ga0075366_10168442 Ga0075366_101684422 109
822 3300006237 Ga0097621_100000865 Ga0097621_10000086510 109
823 3300006237 Ga0097621_100007424 Ga0097621_1000074242 109
824 3300006237 Ga0097621_100017573 Ga0097621_1000175732 109
825 3300006237 Ga0097621_100028797 Ga0097621_1000287973 109
826 3300006237 Ga0097621_100033597 Ga0097621_1000335974 109
827 3300006237 Ga0097621_100052497 Ga0097621_1000524972 109
828 3300006237 Ga0097621_100057308 Ga0097621_1000573083 109
829 3300006237 Ga0097621_100068357 Ga0097621_1000683572 109
830 3300006237 Ga0097621_100070983 Ga0097621_1000709832 109
831 3300006237 Ga0097621_100116424 Ga0097621_1001164242 109
832 3300006237 Ga0097621_100187025 Ga0097621_1001870254 109
833 3300006237 Ga0097621_100246149 Ga0097621_1002461493 109
834 3300006237 Ga0097621_100419571 Ga0097621_1004195712 109
835 3300006237 Ga0097621_100504670 Ga0097621_1005046702 109
836 3300006237 Ga0097621_100522573 Ga0097621_1005225731 109
837 3300006237 Ga0097621_100571254 Ga0097621_1005712542 109
838 3300006237 Ga0097621_100866837 Ga0097621_1008668372 109
839 3300006237 Ga0097621_101266095 Ga0097621_1012660952 109
840 3300006353 Ga0075370_10008938 Ga0075370_100089383 109
841 3300006353 Ga0075370_10490814 Ga0075370_104908142 109
842 3300006358 Ga0068871_100000059 Ga0068871_10000005955 109
843 3300006358 Ga0068871_100002585 Ga0068871_10000258510 109
844 3300006358 Ga0068871_100002961 Ga0068871_1000029614 109
845 3300006358 Ga0068871_100016611 Ga0068871_1000166112 109
846 3300006358 Ga0068871_100052496 Ga0068871_1000524962 109
847 3300006358 Ga0068871_100081776 Ga0068871_1000817763 109
848 3300006358 Ga0068871_100133827 Ga0068871_1001338272 109
849 3300006358 Ga0068871_100166908 Ga0068871_1001669082 109
850 3300006358 Ga0068871_100390354 Ga0068871_1003903541 109
851 3300006358 Ga0068871_100395821 Ga0068871_1003958212 109
852 3300006358 Ga0068871_100609372 Ga0068871_1006093722 109
853 3300006358 Ga0068871_100757814 Ga0068871_1007578142 109
854 3300006358 Ga0068871_100857766 Ga0068871_1008577662 109
855 3300006358 Ga0068871_101221149 Ga0068871_1012211492 109
856 3300006358 Ga0068871_101275118 Ga0068871_1012751182 109
857 3300006358 Ga0068871_101543558 Ga0068871_1015435581 109
858 3300006844 Ga0075428_100000008 Ga0075428_1000000088 109
859 3300006844 Ga0075428_100000566 Ga0075428_10000056637 109
860 3300006844 Ga0075428_100007672 Ga0075428_1000076723 109
861 3300006844 Ga0075428_100009392 Ga0075428_1000093927 109
862 3300006844 Ga0075428_100020179 Ga0075428_1000201798 109
863 3300006844 Ga0075428_100020584 Ga0075428_1000205846 109
864 3300006844 Ga0075428_100032218 Ga0075428_1000322186 109
865 3300006844 Ga0075428_100035640 Ga0075428_1000356403 109
866 3300006844 Ga0075428_100048480 Ga0075428_1000484803 109
867 3300006844 Ga0075428_100048480 Ga0075428_1000484805 109
868 3300006844 Ga0075428_100075003 Ga0075428_1000750033 109
869 3300006844 Ga0075428_100298362 Ga0075428_1002983622 109
870 3300006844 Ga0075428_100666966 Ga0075428_1006669662 109
871 3300006844 Ga0075428_101236637 Ga0075428_1012366372 109
872 3300006846 Ga0075430_100002270 Ga0075430_10000227010 109
873 3300006846 Ga0075430_100005144 Ga0075430_1000051446 109
874 3300006846 Ga0075430_100008641 Ga0075430_1000086411 109
875 3300006846 Ga0075430_100013718 Ga0075430_1000137186 109
876 3300006846 Ga0075430_100031566 Ga0075430_1000315663 109
877 3300006846 Ga0075430_100073946 Ga0075430_1000739462 109
878 3300006846 Ga0075430_100200512 Ga0075430_1002005122 109
879 3300006846 Ga0075430_100204815 Ga0075430_1002048152 109
880 3300006846 Ga0075430_100231480 Ga0075430_1002314801 109
881 3300006846 Ga0075430_100232505 Ga0075430_1002325052 109
882 3300006846 Ga0075430_100298359 Ga0075430_1002983592 109
883 3300006846 Ga0075430_101119123 Ga0075430_1011191231 109
884 3300006846 Ga0075430_101284695 Ga0075430_1012846951 109
885 3300006847 Ga0075431_100002134 Ga0075431_10000213411 109
886 3300006847 Ga0075431_100010616 Ga0075431_1000106167 109
887 3300006847 Ga0075431_100052863 Ga0075431_1000528633 109
888 3300006847 Ga0075431_100070686 Ga0075431_1000706862 109
889 3300006847 Ga0075431_100155262 Ga0075431_1001552622 109
890 3300006847 Ga0075431_100216098 Ga0075431_1002160983 109
891 3300006847 Ga0075431_100382412 Ga0075431_1003824122 109
892 3300006847 Ga0075431_100382706 Ga0075431_1003827062 109
893 3300006847 Ga0075431_100389377 Ga0075431_1003893772 109
894 3300006847 Ga0075431_101123518 Ga0075431_1011235182 109
895 3300006847 Ga0075431_101251114 Ga0075431_1012511142 109
896 3300006852 Ga0075433_10000724 Ga0075433_100007246 109
897 3300006852 Ga0075433_10010506 Ga0075433_100105064 109
898 3300006852 Ga0075433_10018386 Ga0075433_100183866 109
899 3300006852 Ga0075433_10037380 Ga0075433_100373804 109
900 3300006852 Ga0075433_10047241 Ga0075433_100472412 109
901 3300006852 Ga0075433_10062491 Ga0075433_100624911 109
902 3300006852 Ga0075433_10195949 Ga0075433_101959492 109
903 3300006852 Ga0075433_10207482 Ga0075433_102074822 109
904 3300006852 Ga0075433_10302351 Ga0075433_103023512 109
905 3300006852 Ga0075433_10362658 Ga0075433_103626582 109
906 3300006852 Ga0075433_10425523 Ga0075433_104255232 109
907 3300006852 Ga0075433_10535697 Ga0075433_105356972 109
908 3300006852 Ga0075433_10650558 Ga0075433_106505582 109
909 3300006852 Ga0075433_10656242 Ga0075433_106562422 109
910 3300006852 Ga0075433_10919154 Ga0075433_109191543 109
911 3300006852 Ga0075433_11257987 Ga0075433_112579872 109
912 3300006871 Ga0075434_100000793 Ga0075434_1000007932 109
913 3300006871 Ga0075434_100002391 Ga0075434_10000239110 109
914 3300006871 Ga0075434_100002842 Ga0075434_1000028426 109
915 3300006871 Ga0075434_100019631 Ga0075434_1000196312 109
916 3300006871 Ga0075434_100044204 Ga0075434_1000442042 109
917 3300006871 Ga0075434_100048758 Ga0075434_1000487583 109
918 3300006871 Ga0075434_100057737 Ga0075434_1000577374 109
919 3300006871 Ga0075434_100069185 Ga0075434_1000691852 109
920 3300006871 Ga0075434_100075740 Ga0075434_1000757402 109
921 3300006871 Ga0075434_100214320 Ga0075434_1002143202 109
922 3300006871 Ga0075434_100404055 Ga0075434_1004040552 109
923 3300006871 Ga0075434_100472009 Ga0075434_1004720091 109
924 3300006871 Ga0075434_100501634 Ga0075434_1005016342 109
925 3300006871 Ga0075434_100683762 Ga0075434_1006837622 109
926 3300006871 Ga0075434_100905748 Ga0075434_1009057482 109
927 3300006871 Ga0075434_101215138 Ga0075434_1012151382 109
928 3300006871 Ga0075434_101279279 Ga0075434_1012792791 109
929 3300006880 Ga0075429_100002891 Ga0075429_1000028915 109
930 3300006880 Ga0075429_100006250 Ga0075429_1000062508 109
931 3300006880 Ga0075429_100032448 Ga0075429_1000324485 109
932 3300006880 Ga0075429_100060972 Ga0075429_1000609722 109
933 3300006880 Ga0075429_100061831 Ga0075429_1000618313 109
934 3300006880 Ga0075429_100162057 Ga0075429_1001620572 109
935 3300006880 Ga0075429_100191132 Ga0075429_1001911322 109
936 3300006880 Ga0075429_100250088 Ga0075429_1002500882 109
937 3300006880 Ga0075429_100363290 Ga0075429_1003632902 109
938 3300006880 Ga0075429_100492723 Ga0075429_1004927232 109
939 3300006880 Ga0075429_100519075 Ga0075429_1005190752 109
940 3300006880 Ga0075429_100864569 Ga0075429_1008645692 109
941 3300006880 Ga0075429_101226394 Ga0075429_1012263941 109
942 3300006880 Ga0075429_101454530 Ga0075429_1014545302 109
943 3300006881 Ga0068865_100002965 Ga0068865_1000029655 109
944 3300006881 Ga0068865_100008261 Ga0068865_1000082616 109
945 3300006881 Ga0068865_100008264 Ga0068865_1000082647 109
946 3300006881 Ga0068865_100069535 Ga0068865_1000695353 109
947 3300006881 Ga0068865_100095345 Ga0068865_1000953452 109
948 3300006881 Ga0068865_100238053 Ga0068865_1002380532 109
949 3300006881 Ga0068865_100261227 Ga0068865_1002612271 109
950 3300006881 Ga0068865_100426217 Ga0068865_1004262172 109
951 3300006881 Ga0068865_100457464 Ga0068865_1004574641 109
952 3300006881 Ga0068865_100550692 Ga0068865_1005506922 109
953 3300006881 Ga0068865_100784408 Ga0068865_1007844082 109
954 3300006881 Ga0068865_100940680 Ga0068865_1009406802 109
955 3300006881 Ga0068865_101138237 Ga0068865_1011382371 109
956 3300006881 Ga0068865_101233901 Ga0068865_1012339012 109
957 3300006881 Ga0068865_101287967 Ga0068865_1012879671 109
958 3300006881 Ga0068865_101556149 Ga0068865_1015561492 109
959 3300006914 Ga0075436_100004571 Ga0075436_1000045712 109
960 3300006914 Ga0075436_100026299 Ga0075436_1000262992 109
961 3300006914 Ga0075436_100113306 Ga0075436_1001133062 109
962 3300006914 Ga0075436_100960028 Ga0075436_1009600282 109
963 3300006931 Ga0097620_100023274 Ga0097620_1000232742 109
964 3300006931 Ga0097620_100033707 Ga0097620_1000337073 109
965 3300006931 Ga0097620_100048149 Ga0097620_1000481492 109
966 3300006931 Ga0097620_100055251 Ga0097620_1000552512 109
967 3300006931 Ga0097620_100061552 Ga0097620_1000615522 109
968 3300006931 Ga0097620_100066188 Ga0097620_1000661884 109
969 3300006931 Ga0097620_100111746 Ga0097620_1001117462 109
970 3300006931 Ga0097620_100113990 Ga0097620_1001139902 109
971 3300006931 Ga0097620_100140172 Ga0097620_1001401722 109
972 3300006931 Ga0097620_100187872 Ga0097620_1001878722 109
973 3300006931 Ga0097620_100235869 Ga0097620_1002358691 109
974 3300006931 Ga0097620_100256622 Ga0097620_1002566221 109
975 3300006931 Ga0097620_100521712 Ga0097620_1005217122 109
976 3300006931 Ga0097620_100880742 Ga0097620_1008807421 109
977 3300006931 Ga0097620_101321761 Ga0097620_1013217612 109
978 3300006931 Ga0097620_101337752 Ga0097620_1013377522 109
979 3300006931 Ga0097620_101920535 Ga0097620_1019205352 109
980 3300006931 Ga0097620_102254837 Ga0097620_1022548372 109
981 3300007076 Ga0075435_100010153 Ga0075435_1000101532 109
982 3300007076 Ga0075435_100015456 Ga0075435_1000154564 109
983 3300007076 Ga0075435_100031693 Ga0075435_1000316932 109
984 3300007076 Ga0075435_100035634 Ga0075435_1000356342 109
985 3300007076 Ga0075435_100049414 Ga0075435_1000494142 109
986 3300007076 Ga0075435_100054740 Ga0075435_1000547402 109
987 3300007076 Ga0075435_100073632 Ga0075435_1000736322 109
988 3300007076 Ga0075435_100086353 Ga0075435_1000863532 109
989 3300007076 Ga0075435_100174587 Ga0075435_1001745872 109
990 3300007076 Ga0075435_100405717 Ga0075435_1004057172 109
991 3300007076 Ga0075435_100893542 Ga0075435_1008935421 109
992 3300007076 Ga0075435_101891585 Ga0075435_1018915852 109
993 3300007788 Ga0099795_10190345 Ga0099795_101903452 109
994 3300009011 Ga0105251_10129608 Ga0105251_101296082 109
995 3300009092 Ga0105250_10346198 Ga0105250_103461982 109
996 3300009092 Ga0105250_10523649 Ga0105250_105236491 109
997 3300009093 Ga0105240_10288130 Ga0105240_102881301 109
998 3300009093 Ga0105240_12214746 Ga0105240_122147461 109
999 3300009094 Ga0111539_10000015 Ga0111539_10000015206 109
1000 3300009094 Ga0111539_10000614 Ga0111539_1000061430 109
1001 3300009094 Ga0111539_10001499 Ga0111539_100014994 109
1002 3300009094 Ga0111539_10008113 Ga0111539_100081135 109
1003 3300009094 Ga0111539_10026203 Ga0111539_100262032 109
1004 3300009094 Ga0111539_10032217 Ga0111539_100322172 109
1005 3300009094 Ga0111539_10046019 Ga0111539_100460192 109
1006 3300009094 Ga0111539_10055675 Ga0111539_100556752 109
1007 3300009094 Ga0111539_10060965 Ga0111539_100609652 109
1008 3300009094 Ga0111539_10258932 Ga0111539_102589322 109
1009 3300009094 Ga0111539_10281546 Ga0111539_102815462 109
1010 3300009094 Ga0111539_10294241 Ga0111539_102942412 109
1011 3300009094 Ga0111539_10682624 Ga0111539_106826242 109
1012 3300009094 Ga0111539_10742142 Ga0111539_107421422 109
1013 3300009094 Ga0111539_10779300 Ga0111539_107793002 109
1014 3300009094 Ga0111539_10883858 Ga0111539_108838582 109
1015 3300009094 Ga0111539_10990243 Ga0111539_109902432 109
1016 3300009094 Ga0111539_10999903 Ga0111539_109999032 109
1017 3300009094 Ga0111539_11095186 Ga0111539_110951862 109
1018 3300009094 Ga0111539_11114285 Ga0111539_111142852 109
1019 3300009094 Ga0111539_11348489 Ga0111539_113484892 109
1020 3300009094 Ga0111539_11388806 Ga0111539_113888062 109
1021 3300009094 Ga0111539_11648623 Ga0111539_116486232 109
1022 3300009094 Ga0111539_11744952 Ga0111539_117449521 109
1023 3300009094 Ga0111539_12481063 Ga0111539_124810632 109
1024 3300009094 Ga0111539_12737730 Ga0111539_127377302 109
1025 3300009094 Ga0111539_12847257 Ga0111539_128472571 109
1026 3300009098 Ga0105245_10055993 Ga0105245_100559934 109
1027 3300009098 Ga0105245_10065038 Ga0105245_100650383 109
1028 3300009098 Ga0105245_10083644 Ga0105245_100836443 109
1029 3300009098 Ga0105245_10148512 Ga0105245_101485122 109
1030 3300009098 Ga0105245_11402745 Ga0105245_114027452 109
1031 3300009098 Ga0105245_12335310 Ga0105245_123353101 109
1032 3300009098 Ga0105245_12421108 Ga0105245_124211082 109
1033 3300009098 Ga0105245_13265724 Ga0105245_132657242 109
1034 3300009101 Ga0105247_10001718 Ga0105247_100017185 109
1035 3300009101 Ga0105247_10023026 Ga0105247_100230262 109
1036 3300009101 Ga0105247_10085979 Ga0105247_100859792 109
1037 3300009101 Ga0105247_10160572 Ga0105247_101605722 109
1038 3300009101 Ga0105247_10837386 Ga0105247_108373862 109
1039 3300009147 Ga0114129_10005721 Ga0114129_100057212 109
1040 3300009147 Ga0114129_10019565 Ga0114129_100195656 109
1041 3300009147 Ga0114129_10031894 Ga0114129_100318943 109
1042 3300009147 Ga0114129_10035574 Ga0114129_100355744 109
1043 3300009147 Ga0114129_10040259 Ga0114129_100402593 109
1044 3300009147 Ga0114129_10051572 Ga0114129_100515725 109
1045 3300009147 Ga0114129_10087222 Ga0114129_100872221 109
1046 3300009147 Ga0114129_10102117 Ga0114129_101021173 109
1047 3300009147 Ga0114129_10130531 Ga0114129_101305312 109
1048 3300009147 Ga0114129_10147174 Ga0114129_101471742 109
1049 3300009147 Ga0114129_10191711 Ga0114129_101917112 109
1050 3300009147 Ga0114129_10216144 Ga0114129_102161442 109
1051 3300009147 Ga0114129_10217395 Ga0114129_102173952 109
1052 3300009147 Ga0114129_10250077 Ga0114129_102500772 109
1053 3300009147 Ga0114129_10290917 Ga0114129_102909172 109
1054 3300009147 Ga0114129_10671763 Ga0114129_106717632 109
1055 3300009147 Ga0114129_10913818 Ga0114129_109138182 109
1056 3300009147 Ga0114129_11418320 Ga0114129_114183202 109
1057 3300009147 Ga0114129_11504330 Ga0114129_115043302 109
1058 3300009147 Ga0114129_11669653 Ga0114129_116696532 109
1059 3300009147 Ga0114129_11873210 Ga0114129_118732101 109
1060 3300009147 Ga0114129_12147865 Ga0114129_121478652 109
1061 3300009147 Ga0114129_12304585 Ga0114129_123045851 109
1062 3300009147 Ga0114129_13390892 Ga0114129_133908921 109
1063 3300009148 Ga0105243_10049256 Ga0105243_100492563 109
1064 3300009148 Ga0105243_10065794 Ga0105243_100657942 109
1065 3300009148 Ga0105243_10068538 Ga0105243_100685382 109
1066 3300009148 Ga0105243_10070835 Ga0105243_100708352 109
1067 3300009148 Ga0105243_10436594 Ga0105243_104365942 109
1068 3300009148 Ga0105243_10688698 Ga0105243_106886982 109
1069 3300009148 Ga0105243_10905728 Ga0105243_109057281 109
1070 3300009148 Ga0105243_10906855 Ga0105243_109068552 109
1071 3300009148 Ga0105243_11930934 Ga0105243_119309341 109
1072 3300009148 Ga0105243_11975873 Ga0105243_119758731 109
1073 3300009148 Ga0105243_12085271 Ga0105243_120852711 109
1074 3300009174 Ga0105241_10113334 Ga0105241_101133341 109
1075 3300009174 Ga0105241_10968288 Ga0105241_109682882 109
1076 3300009174 Ga0105241_10974497 Ga0105241_109744971 109
1077 3300009176 Ga0105242_10012357 Ga0105242_100123575 109
1078 3300009176 Ga0105242_10016561 Ga0105242_100165612 109
1079 3300009176 Ga0105242_10017161 Ga0105242_100171614 109
1080 3300009176 Ga0105242_10017753 Ga0105242_100177536 109
1081 3300009176 Ga0105242_10018186 Ga0105242_100181862 109
1082 3300009176 Ga0105242_10076151 Ga0105242_100761512 109
1083 3300009176 Ga0105242_10098074 Ga0105242_100980742 109
1084 3300009176 Ga0105242_10276600 Ga0105242_102766003 109
1085 3300009176 Ga0105242_10365403 Ga0105242_103654032 109
1086 3300009176 Ga0105242_10576818 Ga0105242_105768182 109
1087 3300009176 Ga0105242_10748397 Ga0105242_107483971 109
1088 3300009176 Ga0105242_10760264 Ga0105242_107602642 109
1089 3300009176 Ga0105242_10952459 Ga0105242_109524592 109
1090 3300009176 Ga0105242_11322920 Ga0105242_113229202 109
1091 3300009176 Ga0105242_12805022 Ga0105242_128050222 109
1092 3300009176 Ga0105242_13075752 Ga0105242_130757522 109
1093 3300009177 Ga0105248_10001370 Ga0105248_1000137015 109
1094 3300009177 Ga0105248_10031364 Ga0105248_100313642 109
1095 3300009177 Ga0105248_10050366 Ga0105248_100503664 109
1096 3300009177 Ga0105248_10100829 Ga0105248_101008292 109
1097 3300009177 Ga0105248_10111207 Ga0105248_101112073 109
1098 3300009177 Ga0105248_10115869 Ga0105248_101158693 109
1099 3300009177 Ga0105248_10133137 Ga0105248_101331372 109
1100 3300009177 Ga0105248_10236464 Ga0105248_102364642 109
1101 3300009177 Ga0105248_10509054 Ga0105248_105090542 109
1102 3300009177 Ga0105248_10587885 Ga0105248_105878852 109
1103 3300009177 Ga0105248_10615351 Ga0105248_106153512 109
1104 3300009177 Ga0105248_10689302 Ga0105248_106893022 109
1105 3300009177 Ga0105248_10762898 Ga0105248_107628982 109
1106 3300009177 Ga0105248_10765905 Ga0105248_107659052 109
1107 3300009177 Ga0105248_10777537 Ga0105248_107775372 109
1108 3300009177 Ga0105248_10852570 Ga0105248_108525701 109
1109 3300009177 Ga0105248_10906759 Ga0105248_109067592 109
1110 3300009177 Ga0105248_11245928 Ga0105248_112459282 109
1111 3300009177 Ga0105248_11425742 Ga0105248_114257422 109
1112 3300009177 Ga0105248_11917719 Ga0105248_119177192 109
1113 3300009177 Ga0105248_12782256 Ga0105248_127822561 109
1114 3300009177 Ga0105248_13416828 Ga0105248_134168282 109
1115 3300009177 Ga0105248_13438476 Ga0105248_134384761 109
1116 3300009545 Ga0105237_11385511 Ga0105237_113855111 109
1117 3300009551 Ga0105238_10005196 Ga0105238_1000519611 109
1118 3300009551 Ga0105238_10238192 Ga0105238_102381922 109
1119 3300009551 Ga0105238_10494359 Ga0105238_104943592 109
1120 3300009551 Ga0105238_12564432 Ga0105238_125644321 109
1121 3300009553 Ga0105249_10000649 Ga0105249_100006498 109
1122 3300009553 Ga0105249_10009366 Ga0105249_100093664 109
1123 3300009553 Ga0105249_10029742 Ga0105249_100297423 109
1124 3300009553 Ga0105249_10284787 Ga0105249_102847872 109
1125 3300009553 Ga0105249_10449552 Ga0105249_104495522 109
1126 3300009553 Ga0105249_10697434 Ga0105249_106974342 109
1127 3300009553 Ga0105249_10723204 Ga0105249_107232042 109
1128 3300009553 Ga0105249_11014393 Ga0105249_110143932 109
1129 3300009553 Ga0105249_11267996 Ga0105249_112679961 109
1130 3300009553 Ga0105249_11628161 Ga0105249_116281612 109
1131 3300010159 Ga0099796_10574844 Ga0099796_105748441 109
1132 3300010375 Ga0105239_10928638 Ga0105239_109286382 109
1133 3300010375 Ga0105239_11221616 Ga0105239_112216162 109
1134 3300010375 Ga0105239_13188317 Ga0105239_131883172 109
1135 3300010375 Ga0105239_13456811 Ga0105239_134568111 109
1136 3300011119 Ga0105246_10192154 Ga0105246_101921542 109
1137 3300011119 Ga0105246_11120484 Ga0105246_111204841 109
1138 3300011119 Ga0105246_11219835 Ga0105246_112198351 109
1139 3300011119 Ga0105246_11297646 Ga0105246_112976461 109
1140 3300012478 Ga0157328_1022269 Ga0157328_10222692 109
1141 3300012478 Ga0157328_1023021 Ga0157328_10230211 109
1142 3300012485 Ga0157325_1038831 Ga0157325_10388312 109
1143 3300012495 Ga0157323_1034993 Ga0157323_10349932 109
1144 3300012505 Ga0157339_1072190 Ga0157339_10721901 109
1145 3300013100 Ga0157373_10959965 Ga0157373_109599652 109
1146 3300013102 Ga0157371_10188614 Ga0157371_101886141 109
1147 3300013102 Ga0157371_10482124 Ga0157371_104821242 109
1148 3300013102 Ga0157371_10890394 Ga0157371_108903941 109
1149 3300013104 Ga0157370_10620678 Ga0157370_106206781 109
1150 3300013104 Ga0157370_11235337 Ga0157370_112353372 109
1151 3300013105 Ga0157369_12220078 Ga0157369_122200782 109
1152 3300013105 Ga0157369_12522979 Ga0157369_125229792 109
1153 3300013296 Ga0157374_10197987 Ga0157374_101979871 109
1154 3300013296 Ga0157374_10209676 Ga0157374_102096762 109
1155 3300013296 Ga0157374_10681886 Ga0157374_106818861 109
1156 3300013296 Ga0157374_10819470 Ga0157374_108194702 109
1157 3300013296 Ga0157374_10908549 Ga0157374_109085491 109
1158 3300013297 Ga0157378_10001288 Ga0157378_1000128814 109
1159 3300013297 Ga0157378_10013431 Ga0157378_100134317 109
1160 3300013297 Ga0157378_10022222 Ga0157378_100222222 109
1161 3300013297 Ga0157378_10190523 Ga0157378_101905232 109
1162 3300013297 Ga0157378_10290680 Ga0157378_102906802 109
1163 3300013297 Ga0157378_10340369 Ga0157378_103403692 109
1164 3300013297 Ga0157378_10691402 Ga0157378_106914022 109
1165 3300013297 Ga0157378_10788647 Ga0157378_107886472 109
1166 3300013297 Ga0157378_10969956 Ga0157378_109699562 109
1167 3300013297 Ga0157378_11374119 Ga0157378_113741192 109
1168 3300013297 Ga0157378_11404491 Ga0157378_114044912 109
1169 3300013297 Ga0157378_11898156 Ga0157378_118981561 109
1170 3300013297 Ga0157378_12523049 Ga0157378_125230491 109
1171 3300013306 Ga0163162_10020439 Ga0163162_100204393 109
1172 3300013306 Ga0163162_10106674 Ga0163162_101066742 109
1173 3300013306 Ga0163162_10276266 Ga0163162_102762662 109
1174 3300013306 Ga0163162_10333100 Ga0163162_103331002 109
1175 3300013306 Ga0163162_10372383 Ga0163162_103723832 109
1176 3300013306 Ga0163162_11285172 Ga0163162_112851722 109
1177 3300013306 Ga0163162_11535983 Ga0163162_115359832 109
1178 3300013306 Ga0163162_11690372 Ga0163162_116903721 109
1179 3300013306 Ga0163162_12065647 Ga0163162_120656471 109
1180 3300013306 Ga0163162_12107423 Ga0163162_121074232 109
1181 3300013307 Ga0157372_10131584 Ga0157372_101315842 109
1182 3300013307 Ga0157372_12564209 Ga0157372_125642091 109
1183 3300013308 Ga0157375_10022924 Ga0157375_100229244 109
1184 3300013308 Ga0157375_10024718 Ga0157375_100247184 109
1185 3300013308 Ga0157375_10169053 Ga0157375_101690532 109
1186 3300013308 Ga0157375_10232019 Ga0157375_102320192 109
1187 3300013308 Ga0157375_10241579 Ga0157375_102415791 109
1188 3300013308 Ga0157375_10251020 Ga0157375_102510202 109
1189 3300013308 Ga0157375_10637308 Ga0157375_106373082 109
1190 3300013308 Ga0157375_10786672 Ga0157375_107866722 109
1191 3300013308 Ga0157375_10888477 Ga0157375_108884772 109
1192 3300013308 Ga0157375_10904311 Ga0157375_109043112 109
1193 3300013308 Ga0157375_11131371 Ga0157375_111313712 109
1194 3300013308 Ga0157375_11370078 Ga0157375_113700782 109
1195 3300013308 Ga0157375_11454239 Ga0157375_114542392 109
1196 3300013308 Ga0157375_11860980 Ga0157375_118609802 109
1197 3300013308 Ga0157375_12372732 Ga0157375_123727321 109
1198 3300013308 Ga0157375_13014863 Ga0157375_130148632 109
1199 3300014325 Ga0163163_10000717 Ga0163163_100007179 109
1200 3300014325 Ga0163163_10009403 Ga0163163_100094035 109
1201 3300014325 Ga0163163_10074861 Ga0163163_100748612 109
1202 3300014325 Ga0163163_10250007 Ga0163163_102500072 109
1203 3300014325 Ga0163163_10553369 Ga0163163_105533692 109
1204 3300014325 Ga0163163_10704694 Ga0163163_107046942 109
1205 3300014325 Ga0163163_10778547 Ga0163163_107785472 109
1206 3300014325 Ga0163163_11256238 Ga0163163_112562382 109
1207 3300014326 Ga0157380_10006726 Ga0157380_100067263 109
1208 3300014326 Ga0157380_10007218 Ga0157380_100072184 109
1209 3300014326 Ga0157380_10023279 Ga0157380_100232794 109
1210 3300014326 Ga0157380_10046654 Ga0157380_100466543 109
1211 3300014326 Ga0157380_10085336 Ga0157380_100853362 109
1212 3300014326 Ga0157380_10279374 Ga0157380_102793743 109
1213 3300014326 Ga0157380_10301850 Ga0157380_103018502 109
1214 3300014326 Ga0157380_10328315 Ga0157380_103283152 109
1215 3300014326 Ga0157380_10470602 Ga0157380_104706022 109
1216 3300014326 Ga0157380_10611936 Ga0157380_106119362 109
1217 3300014326 Ga0157380_10779636 Ga0157380_107796362 109
1218 3300014326 Ga0157380_10979954 Ga0157380_109799542 109
1219 3300014326 Ga0157380_11813429 Ga0157380_118134291 109
1220 3300014326 Ga0157380_12258795 Ga0157380_122587952 109
1221 3300014326 Ga0157380_12264878 Ga0157380_122648782 109
1222 3300014326 Ga0157380_12919959 Ga0157380_129199591 109
1223 3300014497 Ga0182008_10814496 Ga0182008_108144962 109
1224 3300014745 Ga0157377_10025400 Ga0157377_100254002 109
1225 3300014745 Ga0157377_10166001 Ga0157377_101660012 109
1226 3300014745 Ga0157377_10301950 Ga0157377_103019502 109
1227 3300014745 Ga0157377_10339280 Ga0157377_103392801 109
1228 3300014745 Ga0157377_10399472 Ga0157377_103994722 109
1229 3300014745 Ga0157377_10669131 Ga0157377_106691311 109
1230 3300014745 Ga0157377_11029621 Ga0157377_110296212 109
1231 3300014968 Ga0157379_10003113 Ga0157379_100031139 109
1232 3300014968 Ga0157379_10054418 Ga0157379_100544182 109
1233 3300014968 Ga0157379_10059336 Ga0157379_100593363 109
1234 3300014968 Ga0157379_10087318 Ga0157379_100873182 109
1235 3300014968 Ga0157379_10323502 Ga0157379_103235022 109
1236 3300014968 Ga0157379_10382130 Ga0157379_103821302 109
1237 3300014968 Ga0157379_10957081 Ga0157379_109570812 109
1238 3300014969 Ga0157376_10016289 Ga0157376_100162892 109
1239 3300014969 Ga0157376_10030353 Ga0157376_100303533 109
1240 3300014969 Ga0157376_10040405 Ga0157376_100404053 109
1241 3300014969 Ga0157376_10049730 Ga0157376_100497302 109
1242 3300014969 Ga0157376_10060290 Ga0157376_100602903 109
1243 3300014969 Ga0157376_10076563 Ga0157376_100765632 109
1244 3300014969 Ga0157376_10088434 Ga0157376_100884342 109
1245 3300014969 Ga0157376_10216296 Ga0157376_102162962 109
1246 3300014969 Ga0157376_10277547 Ga0157376_102775472 109
1247 3300014969 Ga0157376_10540816 Ga0157376_105408162 109
1248 3300014969 Ga0157376_10568706 Ga0157376_105687062 109
1249 3300014969 Ga0157376_10616443 Ga0157376_106164432 109
1250 3300014969 Ga0157376_10667238 Ga0157376_106672382 109
1251 3300014969 Ga0157376_10734995 Ga0157376_107349952 109
1252 3300014969 Ga0157376_10832661 Ga0157376_108326611 109
1253 3300014969 Ga0157376_10885766 Ga0157376_108857662 109
1254 3300014969 Ga0157376_12023276 Ga0157376_120232762 109
1255 3300015262 Ga0182007_10401862 Ga0182007_104018622 109
1256 3300017792 Ga0163161_10091292 Ga0163161_100912922 109
1257 3300017792 Ga0163161_10185396 Ga0163161_101853962 109
1258 3300017792 Ga0163161_10451381 Ga0163161_104513812 109
1259 3300017792 Ga0163161_10576695 Ga0163161_105766952 109
1260 3300017792 Ga0163161_11963672 Ga0163161_119636721 109
1261 3300021384 Ga0213876_10032805 Ga0213876_100328052 109
1262 3300021384 Ga0213876_10244367 Ga0213876_102443672 109
1263 3300021384 Ga0213876_10333909 Ga0213876_103339091 109
1264 3300025271 Ga0207666_1051100 Ga0207666_10511001 109
1265 3300025315 Ga0207697_10003624 Ga0207697_100036247 109
1266 3300025315 Ga0207697_10015956 Ga0207697_100159562 109
1267 3300025315 Ga0207697_10103317 Ga0207697_101033172 109
1268 3300025315 Ga0207697_10141949 Ga0207697_101419492 109
1269 3300025315 Ga0207697_10150675 Ga0207697_101506751 109
1270 3300025315 Ga0207697_10159818 Ga0207697_101598182 109
1271 3300025315 Ga0207697_10468761 Ga0207697_104687612 109
1272 3300025315 Ga0207697_10503975 Ga0207697_105039751 109
1273 3300025735 Ga0207713_1246112 Ga0207713_12461122 109
1274 3300025885 Ga0207653_10012866 Ga0207653_100128662 109
1275 3300025885 Ga0207653_10149889 Ga0207653_101498892 109
1276 3300025885 Ga0207653_10277309 Ga0207653_102773091 109
1277 3300025885 Ga0207653_10416724 Ga0207653_104167242 109
1278 3300025893 Ga0207682_10003849 Ga0207682_100038493 109
1279 3300025893 Ga0207682_10005690 Ga0207682_100056902 109
1280 3300025893 Ga0207682_10075178 Ga0207682_100751782 109
1281 3300025893 Ga0207682_10118542 Ga0207682_101185423 109
1282 3300025893 Ga0207682_10307391 Ga0207682_103073912 109
1283 3300025899 Ga0207642_10073914 Ga0207642_100739142 109
1284 3300025899 Ga0207642_10138506 Ga0207642_101385062 109
1285 3300025899 Ga0207642_10145099 Ga0207642_101450992 109
1286 3300025899 Ga0207642_10237490 Ga0207642_102374902 109
1287 3300025899 Ga0207642_10255923 Ga0207642_102559232 109
1288 3300025899 Ga0207642_10430994 Ga0207642_104309942 109
1289 3300025899 Ga0207642_10498589 Ga0207642_104985891 109
1290 3300025899 Ga0207642_10914506 Ga0207642_109145061 109
1291 3300025900 Ga0207710_10003072 Ga0207710_100030724 109
1292 3300025900 Ga0207710_10095348 Ga0207710_100953482 109
1293 3300025900 Ga0207710_10129893 Ga0207710_101298932 109
1294 3300025901 Ga0207688_10000138 Ga0207688_1000013824 109
1295 3300025901 Ga0207688_10022145 Ga0207688_100221452 109
1296 3300025901 Ga0207688_10085188 Ga0207688_100851881 109
1297 3300025901 Ga0207688_10088352 Ga0207688_100883522 109
1298 3300025901 Ga0207688_10470832 Ga0207688_104708322 109
1299 3300025901 Ga0207688_10977919 Ga0207688_109779192 109
1300 3300025903 Ga0207680_10030593 Ga0207680_100305934 109
1301 3300025903 Ga0207680_10035103 Ga0207680_100351032 109
1302 3300025903 Ga0207680_10062044 Ga0207680_100620442 109
1303 3300025903 Ga0207680_10094028 Ga0207680_100940282 109
1304 3300025903 Ga0207680_10099123 Ga0207680_100991233 109
1305 3300025903 Ga0207680_10106106 Ga0207680_101061062 109
1306 3300025903 Ga0207680_10816205 Ga0207680_108162051 109
1307 3300025903 Ga0207680_10997002 Ga0207680_109970022 109
1308 3300025904 Ga0207647_10033238 Ga0207647_100332382 109
1309 3300025904 Ga0207647_10347698 Ga0207647_103476982 109
1310 3300025904 Ga0207647_10700986 Ga0207647_107009861 109
1311 3300025905 Ga0207685_10153284 Ga0207685_101532842 109
1312 3300025905 Ga0207685_10288607 Ga0207685_102886072 109
1313 3300025905 Ga0207685_10320980 Ga0207685_103209802 109
1314 3300025905 Ga0207685_10605475 Ga0207685_106054752 109
1315 3300025906 Ga0207699_10089374 Ga0207699_100893742 109
1316 3300025906 Ga0207699_10146666 Ga0207699_101466662 109
1317 3300025906 Ga0207699_10590096 Ga0207699_105900962 109
1318 3300025906 Ga0207699_10639111 Ga0207699_106391112 109
1319 3300025907 Ga0207645_10003300 Ga0207645_100033005 109
1320 3300025907 Ga0207645_10007441 Ga0207645_100074413 109
1321 3300025907 Ga0207645_10056725 Ga0207645_100567252 109
1322 3300025907 Ga0207645_10076430 Ga0207645_100764303 109
1323 3300025907 Ga0207645_10081928 Ga0207645_100819282 109
1324 3300025907 Ga0207645_10100278 Ga0207645_101002782 109
1325 3300025907 Ga0207645_10205645 Ga0207645_102056452 109
1326 3300025907 Ga0207645_10222233 Ga0207645_102222332 109
1327 3300025907 Ga0207645_10269401 Ga0207645_102694012 109
1328 3300025907 Ga0207645_10414452 Ga0207645_104144523 109
1329 3300025907 Ga0207645_11171025 Ga0207645_111710252 109
1330 3300025908 Ga0207643_10001065 Ga0207643_100010655 109
1331 3300025908 Ga0207643_10013253 Ga0207643_100132532 109
1332 3300025908 Ga0207643_10018749 Ga0207643_100187493 109
1333 3300025908 Ga0207643_10019547 Ga0207643_100195472 109
1334 3300025908 Ga0207643_10049257 Ga0207643_100492572 109
1335 3300025908 Ga0207643_10076123 Ga0207643_100761232 109
1336 3300025908 Ga0207643_10281452 Ga0207643_102814522 109
1337 3300025908 Ga0207643_10687684 Ga0207643_106876841 109
1338 3300025908 Ga0207643_11045347 Ga0207643_110453471 109
1339 3300025910 Ga0207684_10103122 Ga0207684_101031222 109
1340 3300025910 Ga0207684_10323689 Ga0207684_103236892 109
1341 3300025910 Ga0207684_10383542 Ga0207684_103835422 109
1342 3300025910 Ga0207684_10945882 Ga0207684_109458821 109
1343 3300025910 Ga0207684_11524171 Ga0207684_115241712 109
1344 3300025911 Ga0207654_10665156 Ga0207654_106651562 109
1345 3300025912 Ga0207707_10209114 Ga0207707_102091142 109
1346 3300025912 Ga0207707_10333195 Ga0207707_103331952 109
1347 3300025912 Ga0207707_10333301 Ga0207707_103333012 109
1348 3300025912 Ga0207707_10336137 Ga0207707_103361372 109
1349 3300025912 Ga0207707_10829370 Ga0207707_108293702 109
1350 3300025912 Ga0207707_11539035 Ga0207707_115390351 109
1351 3300025913 Ga0207695_10163026 Ga0207695_101630262 109
1352 3300025914 Ga0207671_10756877 Ga0207671_107568772 109
1353 3300025915 Ga0207693_11245594 Ga0207693_112455942 109
1354 3300025916 Ga0207663_10134805 Ga0207663_101348052 109
1355 3300025916 Ga0207663_10644152 Ga0207663_106441521 109
1356 3300025916 Ga0207663_11644426 Ga0207663_116444261 109
1357 3300025917 Ga0207660_10385855 Ga0207660_103858552 109
1358 3300025917 Ga0207660_10548516 Ga0207660_105485162 109
1359 3300025918 Ga0207662_10005102 Ga0207662_100051023 109
1360 3300025918 Ga0207662_10007755 Ga0207662_100077555 109
1361 3300025918 Ga0207662_10038839 Ga0207662_100388392 109
1362 3300025918 Ga0207662_10099683 Ga0207662_100996833 109
1363 3300025918 Ga0207662_10159667 Ga0207662_101596672 109
1364 3300025918 Ga0207662_10275010 Ga0207662_102750102 109
1365 3300025918 Ga0207662_10381153 Ga0207662_103811532 109
1366 3300025918 Ga0207662_10419290 Ga0207662_104192901 109
1367 3300025920 Ga0207649_10095844 Ga0207649_100958443 109
1368 3300025920 Ga0207649_10097718 Ga0207649_100977182 109
1369 3300025920 Ga0207649_10123245 Ga0207649_101232453 109
1370 3300025920 Ga0207649_10174316 Ga0207649_101743162 109
1371 3300025920 Ga0207649_10192368 Ga0207649_101923682 109
1372 3300025920 Ga0207649_10269776 Ga0207649_102697763 109
1373 3300025920 Ga0207649_10713769 Ga0207649_107137692 109
1374 3300025920 Ga0207649_11304461 Ga0207649_113044612 109
1375 3300025920 Ga0207649_11404144 Ga0207649_114041442 109
1376 3300025921 Ga0207652_10296057 Ga0207652_102960572 109
1377 3300025921 Ga0207652_10760477 Ga0207652_107604772 109
1378 3300025921 Ga0207652_11205393 Ga0207652_112053932 109
1379 3300025922 Ga0207646_10033194 Ga0207646_100331942 109
1380 3300025922 Ga0207646_10065518 Ga0207646_100655182 109
1381 3300025922 Ga0207646_10099463 Ga0207646_100994632 109
1382 3300025922 Ga0207646_10246298 Ga0207646_102462982 109
1383 3300025922 Ga0207646_10443266 Ga0207646_104432662 109
1384 3300025922 Ga0207646_10537205 Ga0207646_105372052 109
1385 3300025922 Ga0207646_10583901 Ga0207646_105839012 109
1386 3300025922 Ga0207646_11231025 Ga0207646_112310252 109
1387 3300025922 Ga0207646_11651277 Ga0207646_116512772 109
1388 3300025923 Ga0207681_10004036 Ga0207681_100040362 109
1389 3300025923 Ga0207681_10006880 Ga0207681_100068802 109
1390 3300025923 Ga0207681_10020465 Ga0207681_100204652 109
1391 3300025923 Ga0207681_10030036 Ga0207681_100300363 109
1392 3300025923 Ga0207681_10053433 Ga0207681_100534334 109
1393 3300025923 Ga0207681_10053942 Ga0207681_100539421 109
1394 3300025923 Ga0207681_10122808 Ga0207681_101228083 109
1395 3300025923 Ga0207681_10217227 Ga0207681_102172272 109
1396 3300025923 Ga0207681_10228419 Ga0207681_102284192 109
1397 3300025923 Ga0207681_10394227 Ga0207681_103942272 109
1398 3300025923 Ga0207681_10531861 Ga0207681_105318612 109
1399 3300025923 Ga0207681_10719588 Ga0207681_107195882 109
1400 3300025923 Ga0207681_10810290 Ga0207681_108102902 109
1401 3300025923 Ga0207681_11005697 Ga0207681_110056972 109
1402 3300025923 Ga0207681_11475921 Ga0207681_114759211 109
1403 3300025923 Ga0207681_11803993 Ga0207681_118039932 109
1404 3300025924 Ga0207694_10325114 Ga0207694_103251142 109
1405 3300025924 Ga0207694_10986457 Ga0207694_109864572 109
1406 3300025924 Ga0207694_11013191 Ga0207694_110131911 109
1407 3300025925 Ga0207650_10006789 Ga0207650_100067895 109
1408 3300025925 Ga0207650_10015336 Ga0207650_100153362 109
1409 3300025925 Ga0207650_10021331 Ga0207650_100213312 109
1410 3300025925 Ga0207650_10071813 Ga0207650_100718132 109
1411 3300025925 Ga0207650_10132328 Ga0207650_101323281 109
1412 3300025925 Ga0207650_10254798 Ga0207650_102547982 109
1413 3300025925 Ga0207650_10358597 Ga0207650_103585972 109
1414 3300025925 Ga0207650_11111867 Ga0207650_111118671 109
1415 3300025925 Ga0207650_11759335 Ga0207650_117593352 109
1416 3300025925 Ga0207650_11853003 Ga0207650_118530032 109
1417 3300025926 Ga0207659_10000672 Ga0207659_1000067220 109
1418 3300025926 Ga0207659_10008654 Ga0207659_100086545 109
1419 3300025926 Ga0207659_10010072 Ga0207659_100100722 109
1420 3300025926 Ga0207659_10015560 Ga0207659_100155603 109
1421 3300025926 Ga0207659_10017439 Ga0207659_100174392 109
1422 3300025926 Ga0207659_10054978 Ga0207659_100549782 109
1423 3300025926 Ga0207659_10072338 Ga0207659_100723382 109
1424 3300025926 Ga0207659_10103444 Ga0207659_101034442 109
1425 3300025926 Ga0207659_10167391 Ga0207659_101673912 109
1426 3300025926 Ga0207659_10167769 Ga0207659_101677692 109
1427 3300025926 Ga0207659_10219285 Ga0207659_102192851 109
1428 3300025926 Ga0207659_10264111 Ga0207659_102641112 109
1429 3300025926 Ga0207659_10453843 Ga0207659_104538432 109
1430 3300025926 Ga0207659_10463913 Ga0207659_104639132 109
1431 3300025926 Ga0207659_10644819 Ga0207659_106448191 109
1432 3300025926 Ga0207659_10651802 Ga0207659_106518022 109
1433 3300025926 Ga0207659_10686407 Ga0207659_106864072 109
1434 3300025926 Ga0207659_11386650 Ga0207659_113866502 109
1435 3300025926 Ga0207659_11557642 Ga0207659_115576421 109
1436 3300025927 Ga0207687_10006511 Ga0207687_100065119 109
1437 3300025927 Ga0207687_10009381 Ga0207687_100093812 109
1438 3300025927 Ga0207687_10184806 Ga0207687_101848062 109
1439 3300025927 Ga0207687_10301438 Ga0207687_103014382 109
1440 3300025927 Ga0207687_10457319 Ga0207687_104573192 109
1441 3300025927 Ga0207687_11279774 Ga0207687_112797741 109
1442 3300025927 Ga0207687_11938657 Ga0207687_119386572 109
1443 3300025928 Ga0207700_10020337 Ga0207700_100203372 109
1444 3300025928 Ga0207700_10062152 Ga0207700_100621522 109
1445 3300025928 Ga0207700_10366714 Ga0207700_103667142 109
1446 3300025928 Ga0207700_10600523 Ga0207700_106005232 109
1447 3300025931 Ga0207644_10021145 Ga0207644_100211452 109
1448 3300025931 Ga0207644_10043339 Ga0207644_100433392 109
1449 3300025931 Ga0207644_10113896 Ga0207644_101138964 109
1450 3300025931 Ga0207644_10164275 Ga0207644_101642752 109
1451 3300025931 Ga0207644_10164678 Ga0207644_101646782 109
1452 3300025931 Ga0207644_10165731 Ga0207644_101657312 109
1453 3300025931 Ga0207644_10349082 Ga0207644_103490822 109
1454 3300025931 Ga0207644_10500380 Ga0207644_105003802 109
1455 3300025931 Ga0207644_10540586 Ga0207644_105405862 109
1456 3300025931 Ga0207644_10838566 Ga0207644_108385662 109
1457 3300025931 Ga0207644_10965457 Ga0207644_109654571 109
1458 3300025931 Ga0207644_11414446 Ga0207644_114144462 109
1459 3300025932 Ga0207690_10016531 Ga0207690_100165312 109
1460 3300025932 Ga0207690_10212124 Ga0207690_102121242 109
1461 3300025932 Ga0207690_11162905 Ga0207690_111629052 109
1462 3300025933 Ga0207706_10042039 Ga0207706_100420392 109
1463 3300025933 Ga0207706_10050955 Ga0207706_100509553 109
1464 3300025933 Ga0207706_10060055 Ga0207706_100600552 109
1465 3300025933 Ga0207706_10091400 Ga0207706_100914002 109
1466 3300025933 Ga0207706_10259045 Ga0207706_102590452 109
1467 3300025933 Ga0207706_10274350 Ga0207706_102743502 109
1468 3300025933 Ga0207706_10304118 Ga0207706_103041182 109
1469 3300025933 Ga0207706_10328216 Ga0207706_103282162 109
1470 3300025933 Ga0207706_10432479 Ga0207706_104324792 109
1471 3300025933 Ga0207706_10525004 Ga0207706_105250041 109
1472 3300025933 Ga0207706_10535898 Ga0207706_105358982 109
1473 3300025933 Ga0207706_10600299 Ga0207706_106002992 109
1474 3300025933 Ga0207706_10644987 Ga0207706_106449871 109
1475 3300025933 Ga0207706_11472716 Ga0207706_114727162 109
1476 3300025933 Ga0207706_11490082 Ga0207706_114900821 109
1477 3300025934 Ga0207686_10018666 Ga0207686_100186662 109
1478 3300025934 Ga0207686_10053530 Ga0207686_100535302 109
1479 3300025934 Ga0207686_10065868 Ga0207686_100658682 109
1480 3300025934 Ga0207686_10109154 Ga0207686_101091541 109
1481 3300025934 Ga0207686_10208191 Ga0207686_102081912 109
1482 3300025934 Ga0207686_10321130 Ga0207686_103211301 109
1483 3300025934 Ga0207686_10358057 Ga0207686_103580572 109
1484 3300025934 Ga0207686_10376195 Ga0207686_103761952 109
1485 3300025934 Ga0207686_10472911 Ga0207686_104729111 109
1486 3300025934 Ga0207686_10697933 Ga0207686_106979332 109
1487 3300025934 Ga0207686_11043457 Ga0207686_110434571 109
1488 3300025934 Ga0207686_11072455 Ga0207686_110724551 109
1489 3300025935 Ga0207709_10069120 Ga0207709_100691202 109
1490 3300025935 Ga0207709_10431503 Ga0207709_104315032 109
1491 3300025935 Ga0207709_10524697 Ga0207709_105246972 109
1492 3300025935 Ga0207709_10857114 Ga0207709_108571142 109
1493 3300025935 Ga0207709_11206299 Ga0207709_112062991 109
1494 3300025936 Ga0207670_10033694 Ga0207670_100336942 109
1495 3300025936 Ga0207670_10037527 Ga0207670_100375272 109
1496 3300025936 Ga0207670_10106275 Ga0207670_101062752 109
1497 3300025936 Ga0207670_10148138 Ga0207670_101481382 109
1498 3300025936 Ga0207670_10183068 Ga0207670_101830682 109
1499 3300025936 Ga0207670_10222550 Ga0207670_102225502 109
1500 3300025936 Ga0207670_10320101 Ga0207670_103201013 109
1501 3300025936 Ga0207670_11015506 Ga0207670_110155061 109
1502 3300025936 Ga0207670_11774043 Ga0207670_117740432 109
1503 3300025937 Ga0207669_10016305 Ga0207669_100163052 109
1504 3300025937 Ga0207669_10028238 Ga0207669_100282382 109
1505 3300025937 Ga0207669_10085976 Ga0207669_100859762 109
1506 3300025937 Ga0207669_10139534 Ga0207669_101395342 109
1507 3300025937 Ga0207669_10206774 Ga0207669_102067742 109
1508 3300025937 Ga0207669_10645182 Ga0207669_106451822 109
1509 3300025937 Ga0207669_10843816 Ga0207669_108438161 109
1510 3300025937 Ga0207669_10855969 Ga0207669_108559692 109
1511 3300025937 Ga0207669_10912435 Ga0207669_109124352 109
1512 3300025937 Ga0207669_10942726 Ga0207669_109427261 109
1513 3300025937 Ga0207669_11189810 Ga0207669_111898102 109
1514 3300025937 Ga0207669_11367815 Ga0207669_113678151 109
1515 3300025937 Ga0207669_11381538 Ga0207669_113815381 109
1516 3300025937 Ga0207669_11550686 Ga0207669_115506862 109
1517 3300025937 Ga0207669_11627250 Ga0207669_116272501 109
1518 3300025938 Ga0207704_10010227 Ga0207704_100102272 109
1519 3300025938 Ga0207704_10018686 Ga0207704_100186863 109
1520 3300025938 Ga0207704_10023158 Ga0207704_100231583 109
1521 3300025938 Ga0207704_10202896 Ga0207704_102028962 109
1522 3300025938 Ga0207704_10273011 Ga0207704_102730112 109
1523 3300025938 Ga0207704_10384581 Ga0207704_103845812 109
1524 3300025938 Ga0207704_10430039 Ga0207704_104300392 109
1525 3300025938 Ga0207704_10794668 Ga0207704_107946682 109
1526 3300025939 Ga0207665_10249914 Ga0207665_102499143 109
1527 3300025939 Ga0207665_10325536 Ga0207665_103255362 109
1528 3300025939 Ga0207665_10494538 Ga0207665_104945382 109
1529 3300025940 Ga0207691_10002430 Ga0207691_1000243016 109
1530 3300025940 Ga0207691_10015439 Ga0207691_100154392 109
1531 3300025940 Ga0207691_10022904 Ga0207691_100229045 109
1532 3300025940 Ga0207691_10045686 Ga0207691_100456863 109
1533 3300025940 Ga0207691_10049327 Ga0207691_100493272 109
1534 3300025940 Ga0207691_10049665 Ga0207691_100496652 109
1535 3300025940 Ga0207691_10067339 Ga0207691_100673392 109
1536 3300025940 Ga0207691_10077940 Ga0207691_100779403 109
1537 3300025940 Ga0207691_10096948 Ga0207691_100969482 109
1538 3300025940 Ga0207691_10133173 Ga0207691_101331732 109
1539 3300025940 Ga0207691_10143538 Ga0207691_101435382 109
1540 3300025940 Ga0207691_10160333 Ga0207691_101603332 109
1541 3300025940 Ga0207691_10172093 Ga0207691_101720933 109
1542 3300025940 Ga0207691_10206339 Ga0207691_102063392 109
1543 3300025940 Ga0207691_10307619 Ga0207691_103076192 109
1544 3300025940 Ga0207691_10492705 Ga0207691_104927051 109
1545 3300025940 Ga0207691_11144227 Ga0207691_111442272 109
1546 3300025940 Ga0207691_11241134 Ga0207691_112411341 109
1547 3300025941 Ga0207711_10003652 Ga0207711_100036527 109
1548 3300025941 Ga0207711_10017668 Ga0207711_100176682 109
1549 3300025941 Ga0207711_10035423 Ga0207711_100354233 109
1550 3300025941 Ga0207711_10058711 Ga0207711_100587113 109
1551 3300025941 Ga0207711_10137829 Ga0207711_101378292 109
1552 3300025941 Ga0207711_10146665 Ga0207711_101466651 109
1553 3300025941 Ga0207711_10153463 Ga0207711_101534632 109
1554 3300025941 Ga0207711_10177045 Ga0207711_101770451 109
1555 3300025941 Ga0207711_10306585 Ga0207711_103065852 109
1556 3300025941 Ga0207711_10316594 Ga0207711_103165942 109
1557 3300025941 Ga0207711_10337125 Ga0207711_103371252 109
1558 3300025941 Ga0207711_10410826 Ga0207711_104108262 109
1559 3300025941 Ga0207711_10443133 Ga0207711_104431332 109
1560 3300025941 Ga0207711_10579202 Ga0207711_105792022 109
1561 3300025941 Ga0207711_11010000 Ga0207711_110100002 109
1562 3300025941 Ga0207711_11123835 Ga0207711_111238351 109
1563 3300025941 Ga0207711_11185624 Ga0207711_111856242 109
1564 3300025942 Ga0207689_10001000 Ga0207689_1000100013 109
1565 3300025942 Ga0207689_10028090 Ga0207689_100280902 109
1566 3300025942 Ga0207689_10032206 Ga0207689_100322064 109
1567 3300025942 Ga0207689_10068729 Ga0207689_100687293 109
1568 3300025942 Ga0207689_10069921 Ga0207689_100699213 109
1569 3300025942 Ga0207689_10118743 Ga0207689_101187432 109
1570 3300025942 Ga0207689_10151265 Ga0207689_101512653 109
1571 3300025942 Ga0207689_10263808 Ga0207689_102638083 109
1572 3300025942 Ga0207689_10351134 Ga0207689_103511342 109
1573 3300025942 Ga0207689_10380565 Ga0207689_103805651 109
1574 3300025942 Ga0207689_10626298 Ga0207689_106262981 109
1575 3300025942 Ga0207689_11233095 Ga0207689_112330951 109
1576 3300025942 Ga0207689_11292475 Ga0207689_112924752 109
1577 3300025942 Ga0207689_11389403 Ga0207689_113894032 109
1578 3300025942 Ga0207689_11502209 Ga0207689_115022092 109
1579 3300025944 Ga0207661_10009993 Ga0207661_100099933 109
1580 3300025944 Ga0207661_10023250 Ga0207661_100232503 109
1581 3300025944 Ga0207661_10046602 Ga0207661_100466022 109
1582 3300025944 Ga0207661_10349138 Ga0207661_103491382 109
1583 3300025944 Ga0207661_10438972 Ga0207661_104389721 109
1584 3300025945 Ga0207679_10006536 Ga0207679_100065365 109
1585 3300025945 Ga0207679_10054236 Ga0207679_100542362 109
1586 3300025945 Ga0207679_10118006 Ga0207679_101180062 109
1587 3300025945 Ga0207679_10126652 Ga0207679_101266522 109
1588 3300025945 Ga0207679_10159218 Ga0207679_101592182 109
1589 3300025945 Ga0207679_10252783 Ga0207679_102527832 109
1590 3300025945 Ga0207679_10583326 Ga0207679_105833262 109
1591 3300025945 Ga0207679_10681929 Ga0207679_106819292 109
1592 3300025945 Ga0207679_10690130 Ga0207679_106901302 109
1593 3300025945 Ga0207679_10739279 Ga0207679_107392792 109
1594 3300025945 Ga0207679_10818092 Ga0207679_108180921 109
1595 3300025945 Ga0207679_11192485 Ga0207679_111924852 109
1596 3300025960 Ga0207651_10011075 Ga0207651_100110752 109
1597 3300025960 Ga0207651_10039513 Ga0207651_100395132 109
1598 3300025960 Ga0207651_10078681 Ga0207651_100786812 109
1599 3300025960 Ga0207651_10140852 Ga0207651_101408522 109
1600 3300025960 Ga0207651_10142985 Ga0207651_101429853 109
1601 3300025960 Ga0207651_10150586 Ga0207651_101505862 109
1602 3300025960 Ga0207651_10315301 Ga0207651_103153012 109
1603 3300025960 Ga0207651_10481926 Ga0207651_104819262 109
1604 3300025960 Ga0207651_10502655 Ga0207651_105026552 109
1605 3300025960 Ga0207651_10525405 Ga0207651_105254052 109
1606 3300025960 Ga0207651_10529595 Ga0207651_105295952 109
1607 3300025960 Ga0207651_10648648 Ga0207651_106486481 109
1608 3300025960 Ga0207651_10927179 Ga0207651_109271792 109
1609 3300025960 Ga0207651_10953364 Ga0207651_109533642 109
1610 3300025960 Ga0207651_11768869 Ga0207651_117688692 109
1611 3300025960 Ga0207651_11822847 Ga0207651_118228472 109
1612 3300025961 Ga0207712_10037308 Ga0207712_100373082 109
1613 3300025961 Ga0207712_10040684 Ga0207712_100406842 109
1614 3300025961 Ga0207712_10306760 Ga0207712_103067602 109
1615 3300025961 Ga0207712_10374776 Ga0207712_103747761 109
1616 3300025961 Ga0207712_10539496 Ga0207712_105394963 109
1617 3300025961 Ga0207712_11093036 Ga0207712_110930362 109
1618 3300025961 Ga0207712_11207684 Ga0207712_112076841 109
1619 3300025961 Ga0207712_11438514 Ga0207712_114385142 109
1620 3300025972 Ga0207668_10022797 Ga0207668_100227973 109
1621 3300025972 Ga0207668_10038106 Ga0207668_100381062 109
1622 3300025972 Ga0207668_10492228 Ga0207668_104922281 109
1623 3300025972 Ga0207668_10548055 Ga0207668_105480552 109
1624 3300025972 Ga0207668_10633182 Ga0207668_106331822 109
1625 3300025972 Ga0207668_10689759 Ga0207668_106897592 109
1626 3300025972 Ga0207668_10718906 Ga0207668_107189062 109
1627 3300025972 Ga0207668_10736437 Ga0207668_107364372 109
1628 3300025972 Ga0207668_11039742 Ga0207668_110397421 109
1629 3300025972 Ga0207668_11376203 Ga0207668_113762032 109
1630 3300025972 Ga0207668_11887601 Ga0207668_118876012 109
1631 3300025981 Ga0207640_10027866 Ga0207640_100278662 109
1632 3300025981 Ga0207640_10075286 Ga0207640_100752862 109
1633 3300025981 Ga0207640_10098175 Ga0207640_100981752 109
1634 3300025981 Ga0207640_10243564 Ga0207640_102435641 109
1635 3300025981 Ga0207640_10574245 Ga0207640_105742452 109
1636 3300025981 Ga0207640_10587309 Ga0207640_105873092 109
1637 3300025981 Ga0207640_11055036 Ga0207640_110550361 109
1638 3300025986 Ga0207658_10017346 Ga0207658_100173462 109
1639 3300025986 Ga0207658_10074841 Ga0207658_100748412 109
1640 3300025986 Ga0207658_10209960 Ga0207658_102099602 109
1641 3300025986 Ga0207658_10230252 Ga0207658_102302522 109
1642 3300025986 Ga0207658_10257965 Ga0207658_102579652 109
1643 3300025986 Ga0207658_11288645 Ga0207658_112886452 109
1644 3300026023 Ga0207677_10048110 Ga0207677_100481103 109
1645 3300026023 Ga0207677_10123145 Ga0207677_101231452 109
1646 3300026023 Ga0207677_10306432 Ga0207677_103064321 109
1647 3300026023 Ga0207677_10326873 Ga0207677_103268732 109
1648 3300026023 Ga0207677_10386697 Ga0207677_103866972 109
1649 3300026023 Ga0207677_10515191 Ga0207677_105151912 109
1650 3300026023 Ga0207677_10600600 Ga0207677_106006002 109
1651 3300026023 Ga0207677_11227454 Ga0207677_112274541 109
1652 3300026023 Ga0207677_11505298 Ga0207677_115052982 109
1653 3300026023 Ga0207677_11514961 Ga0207677_115149611 109
1654 3300026035 Ga0207703_10005589 Ga0207703_100055899 109
1655 3300026035 Ga0207703_10016696 Ga0207703_100166962 109
1656 3300026035 Ga0207703_10100105 Ga0207703_101001052 109
1657 3300026035 Ga0207703_10113572 Ga0207703_101135722 109
1658 3300026035 Ga0207703_10147228 Ga0207703_101472282 109
1659 3300026035 Ga0207703_10173421 Ga0207703_101734212 109
1660 3300026035 Ga0207703_10276641 Ga0207703_102766412 109
1661 3300026035 Ga0207703_10434473 Ga0207703_104344731 109
1662 3300026035 Ga0207703_10470293 Ga0207703_104702932 109
1663 3300026035 Ga0207703_10598333 Ga0207703_105983332 109
1664 3300026035 Ga0207703_10685251 Ga0207703_106852512 109
1665 3300026035 Ga0207703_10763630 Ga0207703_107636301 109
1666 3300026035 Ga0207703_10798883 Ga0207703_107988832 109
1667 3300026035 Ga0207703_10918443 Ga0207703_109184432 109
1668 3300026035 Ga0207703_11007670 Ga0207703_110076701 109
1669 3300026035 Ga0207703_11159674 Ga0207703_111596742 109
1670 3300026035 Ga0207703_11422016 Ga0207703_114220162 109
1671 3300026041 Ga0207639_10575364 Ga0207639_105753642 109
1672 3300026041 Ga0207639_12129813 Ga0207639_121298131 109
1673 3300026067 Ga0207678_10085429 Ga0207678_100854291 109
1674 3300026067 Ga0207678_10104793 Ga0207678_101047932 109
1675 3300026067 Ga0207678_10839561 Ga0207678_108395612 109
1676 3300026075 Ga0207708_10002731 Ga0207708_1000273111 109
1677 3300026075 Ga0207708_10005707 Ga0207708_100057073 109
1678 3300026075 Ga0207708_10007575 Ga0207708_100075752 109
1679 3300026075 Ga0207708_10013366 Ga0207708_100133664 109
1680 3300026075 Ga0207708_10035110 Ga0207708_100351103 109
1681 3300026075 Ga0207708_10054645 Ga0207708_100546454 109
1682 3300026075 Ga0207708_10109917 Ga0207708_101099172 109
1683 3300026075 Ga0207708_10120429 Ga0207708_101204292 109
1684 3300026075 Ga0207708_10127761 Ga0207708_101277612 109
1685 3300026075 Ga0207708_10137445 Ga0207708_101374452 109
1686 3300026075 Ga0207708_10153019 Ga0207708_101530191 109
1687 3300026075 Ga0207708_10210968 Ga0207708_102109682 109
1688 3300026075 Ga0207708_10321015 Ga0207708_103210152 109
1689 3300026075 Ga0207708_10431706 Ga0207708_104317062 109
1690 3300026075 Ga0207708_10556027 Ga0207708_105560272 109
1691 3300026075 Ga0207708_10592636 Ga0207708_105926362 109
1692 3300026075 Ga0207708_10805529 Ga0207708_108055292 109
1693 3300026075 Ga0207708_10889935 Ga0207708_108899351 109
1694 3300026075 Ga0207708_10915256 Ga0207708_109152562 109
1695 3300026088 Ga0207641_10008046 Ga0207641_100080464 109
1696 3300026088 Ga0207641_10008049 Ga0207641_100080495 109
1697 3300026088 Ga0207641_10087545 Ga0207641_100875452 109
1698 3300026088 Ga0207641_10304766 Ga0207641_103047662 109
1699 3300026088 Ga0207641_10595367 Ga0207641_105953672 109
1700 3300026088 Ga0207641_10761492 Ga0207641_107614922 109
1701 3300026088 Ga0207641_11888600 Ga0207641_118886002 109
1702 3300026089 Ga0207648_10001325 Ga0207648_100013258 109
1703 3300026089 Ga0207648_10006823 Ga0207648_100068234 109
1704 3300026089 Ga0207648_10018936 Ga0207648_100189364 109
1705 3300026089 Ga0207648_10030419 Ga0207648_100304192 109
1706 3300026089 Ga0207648_10047057 Ga0207648_100470572 109
1707 3300026089 Ga0207648_10048298 Ga0207648_100482981 109
1708 3300026089 Ga0207648_10109680 Ga0207648_101096804 109
1709 3300026089 Ga0207648_10115701 Ga0207648_101157012 109
1710 3300026089 Ga0207648_10138127 Ga0207648_101381272 109
1711 3300026089 Ga0207648_10246557 Ga0207648_102465572 109
1712 3300026089 Ga0207648_10493009 Ga0207648_104930092 109
1713 3300026089 Ga0207648_10541641 Ga0207648_105416412 109
1714 3300026089 Ga0207648_10565675 Ga0207648_105656752 109
1715 3300026089 Ga0207648_11161057 Ga0207648_111610572 109
1716 3300026089 Ga0207648_11538807 Ga0207648_115388072 109
1717 3300026089 Ga0207648_11584263 Ga0207648_115842631 109
1718 3300026089 Ga0207648_12042267 Ga0207648_120422671 109
1719 3300026095 Ga0207676_10001537 Ga0207676_100015377 109
1720 3300026095 Ga0207676_10023862 Ga0207676_100238624 109
1721 3300026095 Ga0207676_10046642 Ga0207676_100466422 109
1722 3300026095 Ga0207676_10092743 Ga0207676_100927432 109
1723 3300026095 Ga0207676_10133256 Ga0207676_101332561 109
1724 3300026095 Ga0207676_10461946 Ga0207676_104619462 109
1725 3300026095 Ga0207676_10464106 Ga0207676_104641062 109
1726 3300026095 Ga0207676_10674318 Ga0207676_106743182 109
1727 3300026095 Ga0207676_10819143 Ga0207676_108191432 109
1728 3300026095 Ga0207676_11212175 Ga0207676_112121751 109
1729 3300026095 Ga0207676_11665964 Ga0207676_116659642 109
1730 3300026095 Ga0207676_11671255 Ga0207676_116712552 109
1731 3300026095 Ga0207676_11718994 Ga0207676_117189941 109
1732 3300026116 Ga0207674_10118190 Ga0207674_101181902 109
1733 3300026116 Ga0207674_10172028 Ga0207674_101720283 109
1734 3300026116 Ga0207674_10193818 Ga0207674_101938182 109
1735 3300026116 Ga0207674_10307778 Ga0207674_103077782 109
1736 3300026116 Ga0207674_10438068 Ga0207674_104380682 109
1737 3300026116 Ga0207674_10513188 Ga0207674_105131882 109
1738 3300026116 Ga0207674_10707408 Ga0207674_107074082 109
1739 3300026118 Ga0207675_100004079 Ga0207675_1000040794 109
1740 3300026118 Ga0207675_100012575 Ga0207675_1000125752 109
1741 3300026118 Ga0207675_100014601 Ga0207675_1000146016 109
1742 3300026118 Ga0207675_100030677 Ga0207675_1000306776 109
1743 3300026118 Ga0207675_100081005 Ga0207675_1000810052 109
1744 3300026118 Ga0207675_100109920 Ga0207675_1001099202 109
1745 3300026118 Ga0207675_100213260 Ga0207675_1002132602 109
1746 3300026118 Ga0207675_100224020 Ga0207675_1002240202 109
1747 3300026118 Ga0207675_100283219 Ga0207675_1002832192 109
1748 3300026118 Ga0207675_100286799 Ga0207675_1002867991 109
1749 3300026118 Ga0207675_100470460 Ga0207675_1004704602 109
1750 3300026118 Ga0207675_100479652 Ga0207675_1004796522 109
1751 3300026118 Ga0207675_100483409 Ga0207675_1004834092 109
1752 3300026118 Ga0207675_100567556 Ga0207675_1005675561 109
1753 3300026118 Ga0207675_100770175 Ga0207675_1007701751 109
1754 3300026118 Ga0207675_101238383 Ga0207675_1012383832 109
1755 3300026118 Ga0207675_101663206 Ga0207675_1016632062 109
1756 3300026118 Ga0207675_101757296 Ga0207675_1017572961 109
1757 3300026118 Ga0207675_102334870 Ga0207675_1023348701 109
1758 3300026121 Ga0207683_10012729 Ga0207683_100127292 109
1759 3300026121 Ga0207683_10029222 Ga0207683_100292222 109
1760 3300026121 Ga0207683_10031846 Ga0207683_100318464 109
1761 3300026121 Ga0207683_10093176 Ga0207683_100931763 109
1762 3300026121 Ga0207683_10159271 Ga0207683_101592713 109
1763 3300026121 Ga0207683_10179696 Ga0207683_101796961 109
1764 3300026121 Ga0207683_10205737 Ga0207683_102057373 109
1765 3300026121 Ga0207683_10212113 Ga0207683_102121132 109
1766 3300026121 Ga0207683_10218940 Ga0207683_102189402 109
1767 3300026121 Ga0207683_10258646 Ga0207683_102586461 109
1768 3300026121 Ga0207683_10305059 Ga0207683_103050592 109
1769 3300026121 Ga0207683_10490854 Ga0207683_104908542 109
1770 3300026121 Ga0207683_10625158 Ga0207683_106251582 109
1771 3300026121 Ga0207683_11283663 Ga0207683_112836632 109
1772 3300026142 Ga0207698_10425606 Ga0207698_104256062 109
1773 3300026142 Ga0207698_10506212 Ga0207698_105062121 109
1774 3300026142 Ga0207698_11730492 Ga0207698_117304922 109
1775 3300027395 Ga0209996_1029540 Ga0209996_10295402 109
1776 3300027462 Ga0210000_1067597 Ga0210000_10675971 109
1777 3300027471 Ga0209995_1028618 Ga0209995_10286182 109
1778 3300027543 Ga0209999_1075118 Ga0209999_10751182 109
1779 3300027552 Ga0209982_1055281 Ga0209982_10552811 109
1780 3300027614 Ga0209970_1120198 Ga0209970_11201981 109
1781 3300027665 Ga0209983_1034620 Ga0209983_10346202 109
1782 3300027682 Ga0209971_1016674 Ga0209971_10166742 109
1783 3300027695 Ga0209966_1116233 Ga0209966_11162331 109
1784 3300027717 Ga0209998_10007303 Ga0209998_100073033 109
1785 3300027717 Ga0209998_10158681 Ga0209998_101586811 109
1786 3300027866 Ga0209813_10004311 Ga0209813_100043113 109
1787 3300027866 Ga0209813_10494613 Ga0209813_104946131 109
1788 3300027876 Ga0209974_10076524 Ga0209974_100765242 109
1789 3300027876 Ga0209974_10163228 Ga0209974_101632281 109
1790 3300027876 Ga0209974_10268258 Ga0209974_102682582 109
1791 3300027907 Ga0207428_10000021 Ga0207428_10000021198 109
1792 3300027907 Ga0207428_10000570 Ga0207428_1000057036 109
1793 3300027907 Ga0207428_10002263 Ga0207428_100022637 109
1794 3300027907 Ga0207428_10007451 Ga0207428_100074512 109
1795 3300027907 Ga0207428_10008429 Ga0207428_100084295 109
1796 3300027907 Ga0207428_10016510 Ga0207428_100165102 109
1797 3300027907 Ga0207428_10016885 Ga0207428_100168855 109
1798 3300027907 Ga0207428_10019436 Ga0207428_100194362 109
1799 3300027907 Ga0207428_10087851 Ga0207428_100878512 109
1800 3300027907 Ga0207428_10349987 Ga0207428_103499871 109
1801 3300027907 Ga0207428_10358488 Ga0207428_103584882 109
1802 3300027907 Ga0207428_10435356 Ga0207428_104353562 109
1803 3300027907 Ga0207428_10495763 Ga0207428_104957631 109
1804 3300027907 Ga0207428_10777708 Ga0207428_107777081 109
1805 3300027907 Ga0207428_10917062 Ga0207428_109170621 109
1806 3300027907 Ga0207428_11169181 Ga0207428_111691811 109
1807 3300028379 Ga0268266_10011773 Ga0268266_100117734 109
1808 3300028379 Ga0268266_10040785 Ga0268266_100407852 109
1809 3300028379 Ga0268266_10804402 Ga0268266_108044022 109
1810 3300028379 Ga0268266_10878377 Ga0268266_108783772 109
1811 3300028379 Ga0268266_11403540 Ga0268266_114035402 109
1812 3300028379 Ga0268266_12028874 Ga0268266_120288742 109
1813 3300028380 Ga0268265_10000772 Ga0268265_1000077224 109
1814 3300028380 Ga0268265_10018529 Ga0268265_100185292 109
1815 3300028380 Ga0268265_10033837 Ga0268265_100338373 109
1816 3300028380 Ga0268265_10123477 Ga0268265_101234772 109
1817 3300028380 Ga0268265_10130989 Ga0268265_101309892 109
1818 3300028380 Ga0268265_10188052 Ga0268265_101880522 109
1819 3300028380 Ga0268265_10322738 Ga0268265_103227382 109
1820 3300028380 Ga0268265_10329180 Ga0268265_103291803 109
1821 3300028380 Ga0268265_10352155 Ga0268265_103521552 109
1822 3300028380 Ga0268265_10652778 Ga0268265_106527781 109
1823 3300028380 Ga0268265_10804695 Ga0268265_108046951 109
1824 3300028380 Ga0268265_10847077 Ga0268265_108470772 109
1825 3300028380 Ga0268265_10868268 Ga0268265_108682681 109
1826 3300028380 Ga0268265_10959005 Ga0268265_109590052 109
1827 3300028380 Ga0268265_11285477 Ga0268265_112854772 109
1828 3300028380 Ga0268265_11376551 Ga0268265_113765511 109
1829 3300028380 Ga0268265_11690639 Ga0268265_116906392 109
1830 3300028380 Ga0268265_11983264 Ga0268265_119832642 109
1831 3300028381 Ga0268264_10019123 Ga0268264_100191232 109
1832 3300028381 Ga0268264_10064145 Ga0268264_100641455 109
1833 3300028381 Ga0268264_10158419 Ga0268264_101584192 109
1834 3300028381 Ga0268264_10205224 Ga0268264_102052242 109
1835 3300028381 Ga0268264_10205815 Ga0268264_102058152 109
1836 3300028381 Ga0268264_10217007 Ga0268264_102170072 109
1837 3300028381 Ga0268264_10340537 Ga0268264_103405372 109
1838 3300028381 Ga0268264_10406879 Ga0268264_104068792 109
1839 3300028381 Ga0268264_10445480 Ga0268264_104454802 109
1840 3300028381 Ga0268264_10480293 Ga0268264_104802932 109
1841 3300028381 Ga0268264_10710632 Ga0268264_107106322 109
1842 3300028381 Ga0268264_11159878 Ga0268264_111598782 109
1843 3300028381 Ga0268264_11689620 Ga0268264_116896202 109
1844 3300030731 Ga0316177_1137045 Ga0316177_11370452 109
1845 3300031238 Ga0265332_10078791 Ga0265332_100787912 109
1846 3300031238 Ga0265332_10147374 Ga0265332_101473741 109
1847 3300031548 Ga0307408_100014431 Ga0307408_1000144313 109
1848 3300031548 Ga0307408_100020494 Ga0307408_1000204941 109
1849 3300031548 Ga0307408_100062075 Ga0307408_1000620751 109
1850 3300031548 Ga0307408_100137514 Ga0307408_1001375142 109
1851 3300031548 Ga0307408_100327910 Ga0307408_1003279102 109
1852 3300031548 Ga0307408_100339708 Ga0307408_1003397082 109
1853 3300031548 Ga0307408_100466204 Ga0307408_1004662042 109
1854 3300031548 Ga0307408_100603019 Ga0307408_1006030191 109
1855 3300031548 Ga0307408_100853082 Ga0307408_1008530822 109
1856 3300031711 Ga0265314_10029252 Ga0265314_100292521 109
1857 3300031711 Ga0265314_10537246 Ga0265314_105372461 109
1858 3300031731 Ga0307405_10000803 Ga0307405_100008039 109
1859 3300031731 Ga0307405_10060325 Ga0307405_100603252 109
1860 3300031731 Ga0307405_10951617 Ga0307405_109516172 109
1861 3300031731 Ga0307405_10965234 Ga0307405_109652342 109
1862 3300031731 Ga0307405_11364608 Ga0307405_113646082 109
1863 3300031731 Ga0307405_11969757 Ga0307405_119697571 109
1864 3300031824 Ga0307413_10215764 Ga0307413_102157642 109
1865 3300031824 Ga0307413_10758069 Ga0307413_107580692 109
1866 3300031824 Ga0307413_10764832 Ga0307413_107648322 109
1867 3300031852 Ga0307410_10004314 Ga0307410_100043144 109
1868 3300031852 Ga0307410_10267810 Ga0307410_102678102 109
1869 3300031852 Ga0307410_11081766 Ga0307410_110817662 109
1870 3300031901 Ga0307406_10078819 Ga0307406_100788193 109
1871 3300031901 Ga0307406_10171833 Ga0307406_101718332 109
1872 3300031901 Ga0307406_11116729 Ga0307406_111167291 109
1873 3300031903 Ga0307407_10044651 Ga0307407_100446512 109
1874 3300031903 Ga0307407_10257974 Ga0307407_102579742 109
1875 3300031911 Ga0307412_10001225 Ga0307412_100012255 109
1876 3300031911 Ga0307412_10074987 Ga0307412_100749872 109
1877 3300031911 Ga0307412_10105275 Ga0307412_101052752 109
1878 3300031911 Ga0307412_10132924 Ga0307412_101329241 109
1879 3300031911 Ga0307412_10335921 Ga0307412_103359212 109
1880 3300031911 Ga0307412_10726732 Ga0307412_107267322 109
1881 3300031911 Ga0307412_10895248 Ga0307412_108952482 109
1882 3300031911 Ga0307412_11093811 Ga0307412_110938112 109
1883 3300031911 Ga0307412_12045292 Ga0307412_120452921 109
1884 3300031995 Ga0307409_100008674 Ga0307409_1000086742 109
1885 3300031995 Ga0307409_100036598 Ga0307409_1000365982 109
1886 3300031995 Ga0307409_100080632 Ga0307409_1000806322 109
1887 3300031995 Ga0307409_100539846 Ga0307409_1005398462 109
1888 3300031995 Ga0307409_100576721 Ga0307409_1005767211 109
1889 3300031995 Ga0307409_100660716 Ga0307409_1006607162 109
1890 3300031995 Ga0307409_100889896 Ga0307409_1008898962 109
1891 3300031995 Ga0307409_102884186 Ga0307409_1028841862 109
1892 3300032002 Ga0307416_100000919 Ga0307416_1000009199 109
1893 3300032002 Ga0307416_100002964 Ga0307416_1000029642 109
1894 3300032002 Ga0307416_100006245 Ga0307416_1000062452 109
1895 3300032002 Ga0307416_100022703 Ga0307416_1000227032 109
1896 3300032002 Ga0307416_100025464 Ga0307416_1000254642 109
1897 3300032002 Ga0307416_100105363 Ga0307416_1001053632 109
1898 3300032002 Ga0307416_100118856 Ga0307416_1001188562 109
1899 3300032002 Ga0307416_100173710 Ga0307416_1001737102 109
1900 3300032002 Ga0307416_100927198 Ga0307416_1009271982 109
1901 3300032002 Ga0307416_102515037 Ga0307416_1025150371 109
1902 3300032002 Ga0307416_103572395 Ga0307416_1035723951 109
1903 3300032004 Ga0307414_10173577 Ga0307414_101735772 109
1904 3300032004 Ga0307414_10321544 Ga0307414_103215442 109
1905 3300032004 Ga0307414_10650436 Ga0307414_106504362 109
1906 3300032004 Ga0307414_11243203 Ga0307414_112432032 109
1907 3300032004 Ga0307414_11459936 Ga0307414_114599362 109
1908 3300032004 Ga0307414_11947080 Ga0307414_119470801 109
1909 3300032005 Ga0307411_10006469 Ga0307411_100064695 109
1910 3300032005 Ga0307411_10009191 Ga0307411_100091912 109
1911 3300032005 Ga0307411_10014918 Ga0307411_100149182 109
1912 3300032005 Ga0307411_10023178 Ga0307411_100231782 109
1913 3300032005 Ga0307411_10119110 Ga0307411_101191102 109
1914 3300032005 Ga0307411_10334776 Ga0307411_103347762 109
1915 3300032005 Ga0307411_10337440 Ga0307411_103374402 109
1916 3300032005 Ga0307411_10466817 Ga0307411_104668172 109
1917 3300032005 Ga0307411_10610904 Ga0307411_106109042 109
1918 3300032005 Ga0307411_12021575 Ga0307411_120215751 109
1919 3300032126 Ga0307415_100006180 Ga0307415_1000061802 109
1920 3300032126 Ga0307415_100055869 Ga0307415_1000558692 109
1921 3300032126 Ga0307415_100856750 Ga0307415_1008567501 109
1922 3300034817 Ga0373948_0023401 Ga0373948_0023401_270_602 109
1923 3300034818 Ga0373950_0029714 Ga0373950_0029714_594_926 109
1924 3300034819 Ga0373958_0001904 Ga0373958_0001904_580_912 109
1925 3300034820 Ga0373959_0000856 Ga0373959_0000856_3162_3494 109
1926 3300034957 Ga0373938_0000270 Ga0373938_0000270_7068_7400 109
1927 3300035086 Ga0373934_0407305 Ga0373934_0407305_33_365 109
1928 3300035088 Ga0373940_0019908 Ga0373940_0019908_145_474 109
1929 3300035088 Ga0373940_0022988 Ga0373940_0022988_1140_1472 109
1930 3300035088 Ga0373940_0048984 Ga0373940_0048984_329_658 109
1931 3300035089 Ga0373944_0044793 Ga0373944_0044793_1018_1350 109
1932 3300035089 Ga0373944_0146027 Ga0373944_0146027_67_399 109
1933 3300035090 Ga0373949_0004159 Ga0373949_0004159_2501_2833 109
1934 3300035090 Ga0373949_0018737 Ga0373949_0018737_1152_1481 109
1935 3300035090 Ga0373949_0136530 Ga0373949_0136530_31_363 109
1936 3300035091 Ga0373951_0000705 Ga0373951_0000705_8568_8900 109
1937 3300035091 Ga0373951_0047441 Ga0373951_0047441_58_390 109
1938 3300035092 Ga0373952_0001064 Ga0373952_0001064_1359_1691 109
1939 3300035092 Ga0373952_0097357 Ga0373952_0097357_272_604 109
1940 3300035111 Ga0373923_0052689 Ga0373923_0052689_1164_1496 109
1941 3300035111 Ga0373923_0323984 Ga0373923_0323984_256_585 109
1942 3300035112 Ga0373932_0006011 Ga0373932_0006011_1366_1698 109
1943 3300035112 Ga0373932_0097400 Ga0373932_0097400_579_908 109
1944 3300035114 Ga0373939_0000661 Ga0373939_0000661_3916_4248 109
1945 3300035114 Ga0373939_0036301 Ga0373939_0036301_250_579 109
1946 3300035114 Ga0373939_0184345 Ga0373939_0184345_20_352 109
1947 3300035115 Ga0373941_0020023 Ga0373941_0020023_517_846 109
1948 3300035115 Ga0373941_0114268 Ga0373941_0114268_309_641 109
1949 3300035116 Ga0373945_0181381 Ga0373945_0181381_433_765 109
1950 3300035118 Ga0373954_0031135 Ga0373954_0031135_167_499 109
1951 3300035118 Ga0373954_0450666 Ga0373954_0450666_189_521 109
1952 3300035118 Ga0373954_0618249 Ga0373954_0618249_131_463 109
1953 3300035120 Ga0373957_0144635 Ga0373957_0144635_108_440 109
1954 3300035120 Ga0373957_0278127 Ga0373957_0278127_328_657 109
1955 3300035120 Ga0373957_0468043 Ga0373957_0468043_20_352 109
1956 3300035121 Ga0373960_0000054 Ga0373960_0000054_4750_5082 109
1957 3300035121 Ga0373960_0080966 Ga0373960_0080966_154_486 109
1958 3300035121 Ga0373960_0081951 Ga0373960_0081951_346_675 109
1959 3300035121 Ga0373960_0220995 Ga0373960_0220995_72_404 109
1960 3300035121 Ga0373960_0323604 Ga0373960_0323604_131_460 109
1961 3300035170 Ga0373943_0000751 Ga0373943_0000751_10741_11073 109
1962 3300035170 Ga0373943_0165126 Ga0373943_0165126_489_821 109
1963 3300035170 Ga0373943_0478673 Ga0373943_0478673_315_644 109
1964 3300035170 Ga0373943_0581069 Ga0373943_0581069_106_438 109
1965 3300035170 Ga0373943_0807040 Ga0373943_0807040_84_416 109
1966 3300035171 Ga0373946_0005914 Ga0373946_0005914_1716_2048 109
1967 3300035171 Ga0373946_0072757 Ga0373946_0072757_1059_1391 109
1968 3300035172 Ga0373955_0006664 Ga0373955_0006664_3868_4200 109
1969 3300035172 Ga0373955_0081966 Ga0373955_0081966_1371_1700 109
1970 3300035172 Ga0373955_0388909 Ga0373955_0388909_158_490 109
1971 3300035172 Ga0373955_0595114 Ga0373955_0595114_241_573 109
1972 3300035241 Ga0373961_0000488 Ga0373961_0000488_13833_14165 109
1973 3300035242 Ga0373962_0004765 Ga0373962_0004765_23_355 109
1974 3300035242 Ga0373962_0087955 Ga0373962_0087955_246_578 109
1975 3300035242 Ga0373962_0126547 Ga0373962_0126547_163_492 109
1976 3300035242 Ga0373962_0239607 Ga0373962_0239607_238_567 109
1977 3300035242 Ga0373962_0245360 Ga0373962_0245360_29_358 109
1978 3300035410 Ga0373924_0005158 Ga0373924_0005158_52_384 109
1979 3300035410 Ga0373924_0192621 Ga0373924_0192621_383_712 109
1980 3300035410 Ga0373924_0590334 Ga0373924_0590334_108_440 109
1981 3300035691 Ga0373931_0000668 Ga0373931_0000668_3796_4128 109
1982 3300035691 Ga0373931_0034126 Ga0373931_0034126_1081_1410 109
1983 3300035691 Ga0373931_0057882 Ga0373931_0057882_27_356 109
1984 3300035691 Ga0373931_0515849 Ga0373931_0515849_300_629 109
1985 3300035691 Ga0373931_0761353 Ga0373931_0761353_92_424 109
1986 3300035692 Ga0373935_0213435 Ga0373935_0213435_674_1006 109
1987 3300035692 Ga0373935_0259403 Ga0373935_0259403_873_1205 109
1988 3300035692 Ga0373935_0446138 Ga0373935_0446138_469_801 109
1989 3300035692 Ga0373935_0763068 Ga0373935_0763068_40_369 109
1990 3300035695 Ga0373927_0538799 Ga0373927_0538799_309_641 109
1991 3300035724 Ga0373933_0041252 Ga0373933_0041252_341_670 109
1992 3300035724 Ga0373933_0426713 Ga0373933_0426713_320_649 109
1993 3300035724 Ga0373933_0743378 Ga0373933_0743378_202_534 109
1994 3300035724 Ga0373933_0916064 Ga0373933_0916064_231_563 109
1995 3300035725 Ga0373947_0266336 Ga0373947_0266336_95_427 109
1996 3300035725 Ga0373947_0309340 Ga0373947_0309340_208_540 109
1997 3300035725 Ga0373947_0578678 Ga0373947_0578678_312_656 109
1998 3300035725 Ga0373947_0987376 Ga0373947_0987376_82_414 109
1999 3300036401 Ga0373937_0006676 Ga0373937_0006676_2147_2476 109
2000 3300036401 Ga0373937_0013739 Ga0373937_0013739_1266_1595 109
2001 3300036401 Ga0373937_0041357 Ga0373937_0041357_707_1039 109
2002 3300036401 Ga0373937_0209941 Ga0373937_0209941_522_854 109
2003 3300036401 Ga0373937_1531527 Ga0373937_1531527_86_418 109
2004 3300036401 Ga0373937_1981210 Ga0373937_1981210_120_449 109
2005 3300037068 Ga0373925_0006947 Ga0373925_0006947_1842_2174 109
2006 3300037068 Ga0373925_0013472 Ga0373925_0013472_5476_5805 109
2007 3300037068 Ga0373925_0069270 Ga0373925_0069270_1613_1942 109
2008 3300037068 Ga0373925_0098923 Ga0373925_0098923_649_981 109
2009 3300037068 Ga0373925_0445265 Ga0373925_0445265_354_686 109
2010 3300037068 Ga0373925_0913899 Ga0373925_0913899_203_547 109
2011 3300037471 Ga0395905_0700986 Ga0395905_0700986_448_777 109
2012 3300038996 Ga0242420_070702 Ga0242420_070702_230_559 109
2013 3300039437 Ga0436365_0499271 Ga0436365_0499271_478_810 109
2014 3300039437 Ga0436365_1174797 Ga0436365_1174797_481_813 109
2015 3300039437 Ga0436365_1696168 Ga0436365_1696168_1344_1676 109
2016 3300041408 Ga0439453_0006334 Ga0439453_0006334_1213_1545 109
2017 3300041408 Ga0439453_0041454 Ga0439453_0041454_30_359 109
2018 3300041408 Ga0439453_0145113 Ga0439453_0145113_25_357 109
2019 3300041410 Ga0439461_0196797 Ga0439461_0196797_199_528 109
2020 3300041441 Ga0451787_290358 Ga0451787_290358_127_456 109
2021 3300041451 Ga0451791_0128859 Ga0451791_0128859_29_358 109
2022 3300041452 Ga0451793_1779034 Ga0451793_1779034_44_373 109
2023 3300041459 Ga0451800_0189637 Ga0451800_0189637_398_727 109
2024 3300041460 Ga0451802_0167054 Ga0451802_0167054_221_550 109
2025 3300041463 Ga0451804_0849585 Ga0451804_0849585_135_464 109
2026 3300041507 Ga0451851_1374125 Ga0451851_1374125_290_619 109
2027 3300041512 Ga0451853_0622843 Ga0451853_0622843_35_364 109
2028 3300041512 Ga0451853_0708216 Ga0451853_0708216_346_675 109
2029 3300041512 Ga0451853_1516782 Ga0451853_1516782_10_339 109
2030 3300041512 Ga0451853_2606140 Ga0451853_2606140_18_347 109
2031 3300041512 Ga0451853_3132910 Ga0451853_3132910_119_448 109
2032 3300042001 Ga0439441_033213 Ga0439441_033213_121_450 109
2033 3300042003 Ga0439443_011355 Ga0439443_011355_766_1098 109
2034 3300042004 Ga0439445_0090707 Ga0439445_0090707_19_348 109
2035 3300042008 Ga0439450_003267 Ga0439450_003267_1997_2329 109
2036 3300042008 Ga0439450_048025 Ga0439450_048025_122_451 109
2037 3300042009 Ga0439451_052533 Ga0439451_052533_410_742 109
2038 3300042012 Ga0439455_0177556 Ga0439455_0177556_64_393 109
2039 3300042015 Ga0439462_0056990 Ga0439462_0056990_349_678 109
2040 3300042015 Ga0439462_0192520 Ga0439462_0192520_89_418 109
2041 3300042127 Ga0450890_085205 Ga0450890_085205_135_467 109
2042 3300042133 Ga0450896_021212 Ga0450896_021212_17_346 109
2043 3300042156 Ga0439446_0157179 Ga0439446_0157179_110_439 109
2044 3300042156 Ga0439446_0181987 Ga0439446_0181987_249_578 109
2045 3300042436 Ga0439435_0038565 Ga0439435_0038565_975_1307 109
2046 3300042436 Ga0439435_0089022 Ga0439435_0089022_444_776 109
2047 3300042436 Ga0439435_0118490 Ga0439435_0118490_300_632 109
2048 3300042437 Ga0439444_0083482 Ga0439444_0083482_293_625 109
2049 3300042438 Ga0439459_0107466 Ga0439459_0107466_230_562 109
2050 3300042439 Ga0439464_0000501 Ga0439464_0000501_2370_2702 109
2051 3300042439 Ga0439464_0070641 Ga0439464_0070641_209_538 109
2052 3300042439 Ga0439464_0104743 Ga0439464_0104743_445_777 109
2053 3300042439 Ga0439464_0119202 Ga0439464_0119202_379_708 109
2054 3300042439 Ga0439464_0212745 Ga0439464_0212745_133_462 109
2055 3300042439 Ga0439464_0242667 Ga0439464_0242667_28_357 109
2056 3300042461 Ga0439460_0051717 Ga0439460_0051717_511_843 109
2057 3300042461 Ga0439460_0066950 Ga0439460_0066950_448_777 109
2058 3300042461 Ga0439460_0175085 Ga0439460_0175085_100_429 109
2059 3300042461 Ga0439460_0251812 Ga0439460_0251812_61_393 109
2060 3300042461 Ga0439460_0252503 Ga0439460_0252503_25_354 109
2061 3300042530 Ga0450916_086684 Ga0450916_086684_162_491 109
2062 3300042532 Ga0450893_0129696 Ga0450893_0129696_32_361 109
2063 3300042876 Ga0451577_0734245 Ga0451577_0734245_121_450 109
2064 3300042993 Ga0439440_0029623 Ga0439440_0029623_849_1181 109
2065 3300042993 Ga0439440_0076260 Ga0439440_0076260_156_485 109
2066 3300042993 Ga0439440_0083429 Ga0439440_0083429_158_487 109
2067 3300042993 Ga0439440_0119709 Ga0439440_0119709_326_655 109
2068 3300044673 Ga0453683_0933121 Ga0453683_0933121_28_360 109
2069 3300044901 Ga0466960_0582000 Ga0466960_0582000_89_418 109
2070 3300045051 Ga0451576_0002764 Ga0451576_0002764_2669_2998 109
2071 3300045051 Ga0451576_0008567 Ga0451576_0008567_10444_10776 109
2072 3300045051 Ga0451576_0026133 Ga0451576_0026133_3765_4094 109
2073 3300045051 Ga0451576_0205304 Ga0451576_0205304_582_911 109
2074 3300045051 Ga0451576_0213190 Ga0451576_0213190_1048_1380 109
2075 3300045051 Ga0451576_0348088 Ga0451576_0348088_267_596 109
2076 3300045051 Ga0451576_0454491 Ga0451576_0454491_421_750 109
2077 3300045976 Ga0466967_1739665 Ga0466967_1739665_85_414 109
2078 3300046454 Ga0495592_0419846 Ga0495592_0419846_495_827 109
2079 3300046455 Ga0495603_0035445 Ga0495603_0035445_30_359 109
2080 3300046455 Ga0495603_0069824 Ga0495603_0069824_484_816 109
2081 3300046455 Ga0495603_0142734 Ga0495603_0142734_951_1283 109
2082 3300046457 Ga0495590_0318104 Ga0495590_0318104_63_395 109
2083 3300046457 Ga0495590_0319212 Ga0495590_0319212_228_557 109
2084 3300046459 Ga0495629_0080403 Ga0495629_0080403_297_629 109
2085 3300046459 Ga0495629_0460021 Ga0495629_0460021_312_644 109
2086 3300046472 Ga0495580_0070724 Ga0495580_0070724_768_1100 109
2087 3300046472 Ga0495580_0421106 Ga0495580_0421106_280_609 109
2088 3300046473 Ga0495582_0096328 Ga0495582_0096328_833_1162 109
2089 3300046473 Ga0495582_0219881 Ga0495582_0219881_254_586 109
2090 3300046473 Ga0495582_0251163 Ga0495582_0251163_303_635 109
2091 3300046473 Ga0495582_0787471 Ga0495582_0787471_21_350 109
2092 3300046475 Ga0495639_0078014 Ga0495639_0078014_747_1079 109
2093 3300046475 Ga0495639_0249892 Ga0495639_0249892_225_554 109
2094 3300046492 Ga0495585_0032001 Ga0495585_0032001_766_1095 109
2095 3300046499 Ga0495594_0095743 Ga0495594_0095743_60_389 109
2096 3300046499 Ga0495594_0114950 Ga0495594_0114950_908_1237 109
2097 3300046499 Ga0495594_0175647 Ga0495594_0175647_695_1024 109
2098 3300046511 Ga0495608_0041215 Ga0495608_0041215_2334_2666 109
2099 3300046511 Ga0495608_0580857 Ga0495608_0580857_181_513 109
2100 3300046514 Ga0495618_0457688 Ga0495618_0457688_12_341 109
2101 3300046514 Ga0495618_0668754 Ga0495618_0668754_103_435 109
2102 3300046515 Ga0495620_0235087 Ga0495620_0235087_265_594 109
2103 3300046516 Ga0495628_0061096 Ga0495628_0061096_768_1100 109
2104 3300046516 Ga0495628_0131053 Ga0495628_0131053_1337_1669 109
2105 3300046517 Ga0495630_0010405 Ga0495630_0010405_1800_2132 109
2106 3300046517 Ga0495630_1196449 Ga0495630_1196449_147_479 109
2107 3300046520 Ga0495637_0069931 Ga0495637_0069931_207_536 109
2108 3300046522 Ga0495643_0021226 Ga0495643_0021226_2110_2439 109
2109 3300046525 Ga0495663_0006839 Ga0495663_0006839_1152_1481 109
2110 3300046525 Ga0495663_0046692 Ga0495663_0046692_210_539 109
2111 3300046525 Ga0495663_0050992 Ga0495663_0050992_381_710 109
2112 3300046525 Ga0495663_0316575 Ga0495663_0316575_89_418 109
2113 3300046526 Ga0495666_0448962 Ga0495666_0448962_44_376 109
2114 3300046528 Ga0495642_0003038 Ga0495642_0003038_3582_3911 109
2115 3300046528 Ga0495642_0164566 Ga0495642_0164566_75_404 109
2116 3300046529 Ga0495652_0961907 Ga0495652_0961907_71_400 109
2117 3300046531 Ga0495665_0583293 Ga0495665_0583293_145_474 109
2118 3300046533 Ga0495640_0067995 Ga0495640_0067995_1009_1341 109
2119 3300046533 Ga0495640_0209736 Ga0495640_0209736_697_1029 109
2120 3300046533 Ga0495640_0277619 Ga0495640_0277619_14_346 109
2121 3300046533 Ga0495640_0360213 Ga0495640_0360213_271_600 109
2122 3300046533 Ga0495640_0920854 Ga0495640_0920854_123_452 109
2123 3300046537 Ga0495598_0005013 Ga0495598_0005013_2108_2437 109
2124 3300046537 Ga0495598_0025930 Ga0495598_0025930_165_494 109
2125 3300046537 Ga0495598_0032705 Ga0495598_0032705_739_1068 109
2126 3300046537 Ga0495598_0292375 Ga0495598_0292375_72_401 109
2127 3300046538 Ga0495609_0014640 Ga0495609_0014640_1321_1650 109
2128 3300046539 Ga0495621_0000555 Ga0495621_0000555_4258_4587 109
2129 3300046539 Ga0495621_0006303 Ga0495621_0006303_2968_3297 109
2130 3300046539 Ga0495621_0011543 Ga0495621_0011543_2374_2703 109
2131 3300046539 Ga0495621_0030639 Ga0495621_0030639_825_1154 109
2132 3300046539 Ga0495621_0085787 Ga0495621_0085787_410_739 109
2133 3300046539 Ga0495621_0517898 Ga0495621_0517898_164_493 109
2134 3300046542 Ga0495597_0197535 Ga0495597_0197535_208_537 109
2135 3300046542 Ga0495597_0387189 Ga0495597_0387189_177_506 109
2136 3300046543 Ga0495645_0171096 Ga0495645_0171096_649_981 109
2137 3300046543 Ga0495645_0544181 Ga0495645_0544181_366_698 109
2138 3300046558 Ga0495633_0004066 Ga0495633_0004066_6192_6521 109
2139 3300046559 Ga0495667_0181985 Ga0495667_0181985_389_721 109
2140 3300046559 Ga0495667_0198685 Ga0495667_0198685_800_1132 109
2141 3300046559 Ga0495667_0533786 Ga0495667_0533786_88_420 109
2142 3300046615 Ga0495656_0003551 Ga0495656_0003551_4752_5081 109
2143 3300046615 Ga0495656_0067661 Ga0495656_0067661_356_685 109
2144 3300046615 Ga0495656_0299122 Ga0495656_0299122_72_401 109
2145 3300046615 Ga0495656_0477808 Ga0495656_0477808_100_429 109
2146 3300046615 Ga0495656_0653390 Ga0495656_0653390_118_447 109
2147 3300046616 Ga0495668_0543035 Ga0495668_0543035_197_526 109
2148 3300046616 Ga0495668_0806823 Ga0495668_0806823_169_501 109
2149 3300046642 Ga0495634_0222999 Ga0495634_0222999_594_926 109
2150 3300046642 Ga0495634_0672076 Ga0495634_0672076_204_536 109
2151 3300046663 Ga0495635_0438619 Ga0495635_0438619_279_611 109
2152 3300046663 Ga0495635_0571795 Ga0495635_0571795_333_665 109
2153 3300046664 Ga0495659_0001873 Ga0495659_0001873_4290_4619 109
2154 3300046664 Ga0495659_0018971 Ga0495659_0018971_1333_1662 109
2155 3300046664 Ga0495659_0028277 Ga0495659_0028277_383_715 109
2156 3300046664 Ga0495659_0084531 Ga0495659_0084531_521_850 109
2157 3300046664 Ga0495659_0160208 Ga0495659_0160208_51_380 109
2158 3300046664 Ga0495659_0164863 Ga0495659_0164863_386_715 109
2159 3300046664 Ga0495659_0235102 Ga0495659_0235102_21_353 109
2160 3300046665 Ga0495661_0583225 Ga0495661_0583225_100_432 109
2161 3300046674 Ga0495588_0006275 Ga0495588_0006275_155_484 109
2162 3300046674 Ga0495588_0657634 Ga0495588_0657634_51_380 109
2163 3300046675 Ga0495657_0168432 Ga0495657_0168432_780_1112 109
2164 3300046675 Ga0495657_0507789 Ga0495657_0507789_95_427 109
2165 3300046679 Ga0495623_0168828 Ga0495623_0168828_710_1042 109
2166 3300046681 Ga0495647_0566169 Ga0495647_0566169_180_512 109
2167 3300046681 Ga0495647_0587810 Ga0495647_0587810_39_368 109
2168 3300046681 Ga0495647_0616088 Ga0495647_0616088_72_416 109
2169 3300046683 Ga0495658_0044093 Ga0495658_0044093_567_899 109
2170 3300046683 Ga0495658_0061713 Ga0495658_0061713_899_1228 109
2171 3300046683 Ga0495658_0068362 Ga0495658_0068362_860_1189 109
2172 3300046683 Ga0495658_0150052 Ga0495658_0150052_701_1033 109
2173 3300046683 Ga0495658_0351132 Ga0495658_0351132_439_771 109
2174 3300046684 Ga0495669_0004530 Ga0495669_0004530_3778_4110 109
2175 3300046684 Ga0495669_0095986 Ga0495669_0095986_966_1295 109
2176 3300046684 Ga0495669_0145343 Ga0495669_0145343_543_872 109
2177 3300046689 Ga0495613_0004058 Ga0495613_0004058_2530_2862 109
2178 3300046691 Ga0495670_0049911 Ga0495670_0049911_1574_1903 109
2179 3300046691 Ga0495670_0157390 Ga0495670_0157390_777_1106 109
2180 3300046691 Ga0495670_0226684 Ga0495670_0226684_423_752 109
2181 3300046691 Ga0495670_0700124 Ga0495670_0700124_193_525 109
2182 3300046692 Ga0495671_0476794 Ga0495671_0476794_185_514 109
2183 3300046794 Ga0495589_0534644 Ga0495589_0534644_162_491 109
2184 3300046809 Ga0495600_0093642 Ga0495600_0093642_375_707 109
2185 3300046809 Ga0495600_0871425 Ga0495600_0871425_135_467 109
2186 3300047315 Ga0495581_0102584 Ga0495581_0102584_95_427 109
2187 3300047315 Ga0495581_0480343 Ga0495581_0480343_100_432 109
2188 3300047317 Ga0495604_0049008 Ga0495604_0049008_1761_2093 109
2189 3300047318 Ga0495636_0021335 Ga0495636_0021335_1019_1348 109
2190 3300047319 Ga0495674_0033229 Ga0495674_0033229_3630_3962 109
2191 3300047319 Ga0495674_0705808 Ga0495674_0705808_126_455 109
2192 3300047320 Ga0495672_0101037 Ga0495672_0101037_865_1194 109
2193 3300047322 Ga0495680_0031953 Ga0495680_0031953_1536_1868 109
2194 3300047445 Ga0495677_0084304 Ga0495677_0084304_175_504 109
2195 3300047447 Ga0495685_009919 Ga0495685_009919_2571_2900 109
2196 3300047471 Ga0495684_0001164 Ga0495684_0001164_19802_20134 109
2197 3300047471 Ga0495684_0273660 Ga0495684_0273660_872_1204 109
2198 3300047471 Ga0495684_0422463 Ga0495684_0422463_575_907 109
2199 3300047471 Ga0495684_0801730 Ga0495684_0801730_264_596 109
2200 3300048088 Ga0495602_0154005 Ga0495602_0154005_215_547 109
2201 3300048903 Ga0496100_0003686 Ga0496100_0003686_5483_5815 109
2202 3300048903 Ga0496100_0826070 Ga0496100_0826070_229_561 109
2203 3300048903 Ga0496100_1225913 Ga0496100_1225913_18_347 109
2204 3300048903 Ga0496100_1583278 Ga0496100_1583278_22_354 109
2205 3300048904 Ga0496101_0002308 Ga0496101_0002308_2907_3239 109
2206 3300048905 Ga0496102_0092641 Ga0496102_0092641_1469_1801 109
2207 3300048905 Ga0496102_0805157 Ga0496102_0805157_227_559 109
2208 3300048906 Ga0496103_0938875 Ga0496103_0938875_120_452 109
2209 3300048907 Ga0496104_0011626 Ga0496104_0011626_7037_7369 109
2210 3300048907 Ga0496104_0016660 Ga0496104_0016660_2253_2585 109
2211 3300048907 Ga0496104_0033356 Ga0496104_0033356_4289_4621 109
2212 3300048907 Ga0496104_0172673 Ga0496104_0172673_919_1251 109
2213 3300048907 Ga0496104_0451856 Ga0496104_0451856_47_379 109
2214 3300048907 Ga0496104_0708884 Ga0496104_0708884_294_623 109
2215 3300048907 Ga0496104_0760922 Ga0496104_0760922_491_820 109
2216 3300048907 Ga0496104_0870710 Ga0496104_0870710_221_553 109
2217 3300048908 Ga0496105_0033301 Ga0496105_0033301_840_1172 109
2218 3300048908 Ga0496105_0103401 Ga0496105_0103401_525_857 109
2219 3300048908 Ga0496105_0882718 Ga0496105_0882718_116_448 109
2220 3300048908 Ga0496105_1036711 Ga0496105_1036711_245_577 109
2221 3300048909 Ga0496106_0133640 Ga0496106_0133640_920_1252 109
2222 3300048909 Ga0496106_0136165 Ga0496106_0136165_100_432 109
2223 3300048909 Ga0496106_0248477 Ga0496106_0248477_891_1223 109
2224 3300048909 Ga0496106_0281622 Ga0496106_0281622_876_1208 109
2225 3300048910 Ga0496107_0024689 Ga0496107_0024689_3836_4168 109
2226 3300048910 Ga0496107_0687660 Ga0496107_0687660_130_462 109
2227 3300048910 Ga0496107_0726140 Ga0496107_0726140_278_610 109
2228 3300048911 Ga0496108_0008524 Ga0496108_0008524_2934_3266 109
2229 3300048911 Ga0496108_1257625 Ga0496108_1257625_56_385 109
2230 3300048912 Ga0496109_0234194 Ga0496109_0234194_762_1094 109
2231 3300048912 Ga0496109_0379850 Ga0496109_0379850_695_1027 109
2232 3300048912 Ga0496109_0550524 Ga0496109_0550524_57_386 109
2233 3300048912 Ga0496109_1328589 Ga0496109_1328589_241_573 109
2234 3300048912 Ga0496109_1901726 Ga0496109_1901726_173_505 109
2235 3300048913 Ga0496110_0880488 Ga0496110_0880488_263_592 109
2236 3300048914 Ga0496111_0931386 Ga0496111_0931386_258_587 109
2237 3300048914 Ga0496111_1311404 Ga0496111_1311404_37_369 109
2238 3300048915 Ga0496112_0000350 Ga0496112_0000350_13889_14221 109
2239 3300048915 Ga0496112_0557811 Ga0496112_0557811_614_946 109
2240 3300048915 Ga0496112_0920911 Ga0496112_0920911_154_483 109
2241 3300048915 Ga0496112_1081565 Ga0496112_1081565_278_607 109
2242 3300048916 Ga0496113_0015351 Ga0496113_0015351_3594_3926 109
2243 3300048916 Ga0496113_0309179 Ga0496113_0309179_926_1255 109
2244 3300048917 Ga0496114_0000376 Ga0496114_0000376_2111_2443 109
2245 3300048917 Ga0496114_0233463 Ga0496114_0233463_356_688 109
2246 3300048917 Ga0496114_0278028 Ga0496114_0278028_999_1328 109
2247 3300048917 Ga0496114_0428586 Ga0496114_0428586_130_462 109
2248 3300048917 Ga0496114_0617754 Ga0496114_0617754_141_473 109
2249 3300048917 Ga0496114_0804382 Ga0496114_0804382_390_722 109
2250 3300048918 Ga0496115_0316972 Ga0496115_0316972_294_626 109
2251 3300048918 Ga0496115_1026720 Ga0496115_1026720_90_422 109
2252 3300048918 Ga0496115_1032700 Ga0496115_1032700_74_406 109
2253 3300049517 Ga0501294_015730 Ga0501294_015730_213_545 109
2254 3300049518 Ga0501295_122921 Ga0501295_122921_135_467 109
2255 3300049519 Ga0501296_048296 Ga0501296_048296_145_477 109
2256 3300049521 Ga0501298_006410 Ga0501298_006410_1510_1842 109
2257 3300049521 Ga0501298_060304 Ga0501298_060304_280_609 109
2258 3300049521 Ga0501298_098553 Ga0501298_098553_325_654 109
2259 3300049522 Ga0501299_009585 Ga0501299_009585_278_610 109
2260 3300049522 Ga0501299_042497 Ga0501299_042497_526_858 109
2261 3300049523 Ga0501300_035172 Ga0501300_035172_366_698 109
2262 3300049568 Ga0501031_0022156 Ga0501031_0022156_2724_3065 109
2263 3300049568 Ga0501031_0270690 Ga0501031_0270690_360_689 109
2264 3300049568 Ga0501031_0553555 Ga0501031_0553555_179_511 109
2265 3300049569 Ga0501032_0006589 Ga0501032_0006589_2910_3251 109
2266 3300049569 Ga0501032_0401009 Ga0501032_0401009_472_801 109
2267 3300049569 Ga0501032_0491969 Ga0501032_0491969_325_654 109
2268 3300049569 Ga0501032_1019488 Ga0501032_1019488_107_436 109
2269 3300049570 Ga0501033_0000802 Ga0501033_0000802_15172_15513 109
2270 3300049571 Ga0501034_0007961 Ga0501034_0007961_7346_7687 109
2271 3300049571 Ga0501034_0061855 Ga0501034_0061855_1871_2200 109
2272 3300049571 Ga0501034_0604594 Ga0501034_0604594_470_802 109
2273 3300049572 Ga0501036_0001038 Ga0501036_0001038_12629_12970 109
2274 3300049572 Ga0501036_0137981 Ga0501036_0137981_1414_1743 109
2275 3300049572 Ga0501036_0229783 Ga0501036_0229783_661_990 109
2276 3300049572 Ga0501036_0804211 Ga0501036_0804211_299_631 109
2277 3300049573 Ga0501037_0007964 Ga0501037_0007964_4788_5129 109
2278 3300049574 Ga0501038_0002085 Ga0501038_0002085_7330_7671 109
2279 3300049574 Ga0501038_0063914 Ga0501038_0063914_2684_3016 109
2280 3300049574 Ga0501038_0070553 Ga0501038_0070553_1283_1612 109
2281 3300049574 Ga0501038_0134455 Ga0501038_0134455_1482_1811 109
2282 3300049575 Ga0501039_0035250 Ga0501039_0035250_330_671 109
2283 3300049575 Ga0501039_0079870 Ga0501039_0079870_1557_1889 109
2284 3300049575 Ga0501039_0097161 Ga0501039_0097161_1942_2271 109
2285 3300049575 Ga0501039_0823994 Ga0501039_0823994_221_550 109
2286 3300049576 Ga0501040_0004120 Ga0501040_0004120_7525_7857 109
2287 3300049576 Ga0501040_0009388 Ga0501040_0009388_1645_1974 109
2288 3300049576 Ga0501040_0009388 Ga0501040_0009388_3434_3763 109
2289 3300049576 Ga0501040_0235900 Ga0501040_0235900_306_647 109
2290 3300049577 Ga0501041_0002267 Ga0501041_0002267_6966_7298 109
2291 3300049577 Ga0501041_0025316 Ga0501041_0025316_2817_3146 109
2292 3300049577 Ga0501041_0030740 Ga0501041_0030740_1265_1594 109
2293 3300049577 Ga0501041_0106125 Ga0501041_0106125_23_352 109
2294 3300049577 Ga0501041_0309291 Ga0501041_0309291_355_684 109
2295 3300049578 Ga0501042_0026471 Ga0501042_0026471_1669_1998 109
2296 3300049578 Ga0501042_0026471 Ga0501042_0026471_3458_3787 109
2297 3300049578 Ga0501042_0052000 Ga0501042_0052000_915_1247 109
2298 3300049578 Ga0501042_0136359 Ga0501042_0136359_1429_1758 109
2299 3300049578 Ga0501042_0150442 Ga0501042_0150442_670_1011 109
2300 3300049578 Ga0501042_0193951 Ga0501042_0193951_747_1076 109
2301 3300049579 Ga0501043_0008493 Ga0501043_0008493_6572_6913 109
2302 3300049579 Ga0501043_0069357 Ga0501043_0069357_1115_1444 109
2303 3300049579 Ga0501043_0074908 Ga0501043_0074908_840_1172 109
2304 3300049579 Ga0501043_0141733 Ga0501043_0141733_706_1035 109
2305 3300049579 Ga0501043_1059325 Ga0501043_1059325_235_564 109
2306 3300049580 Ga0501046_0004140 Ga0501046_0004140_5044_5385 109
2307 3300049580 Ga0501046_0026545 Ga0501046_0026545_1942_2274 109
2308 3300049580 Ga0501046_0074986 Ga0501046_0074986_278_607 109
2309 3300049580 Ga0501046_0088257 Ga0501046_0088257_1688_2017 109
2310 3300049581 Ga0501047_0006398 Ga0501047_0006398_5148_5489 109
2311 3300049582 Ga0501048_0003752 Ga0501048_0003752_2636_2977 109
2312 3300049582 Ga0501048_0015163 Ga0501048_0015163_3695_4027 109
2313 3300049582 Ga0501048_0024903 Ga0501048_0024903_2379_2708 109
2314 3300049583 Ga0501067_0025800 Ga0501067_0025800_2775_3116 109
2315 3300049584 Ga0501068_0003166 Ga0501068_0003166_5510_5851 109
2316 3300049584 Ga0501068_0062493 Ga0501068_0062493_574_906 109
2317 3300049585 Ga0501069_0005034 Ga0501069_0005034_5495_5836 109
2318 3300049585 Ga0501069_0179471 Ga0501069_0179471_577_906 109
2319 3300049586 Ga0501070_0002294 Ga0501070_0002294_6047_6388 109
2320 3300049586 Ga0501070_0985862 Ga0501070_0985862_312_641 109
2321 3300049587 Ga0501071_0027676 Ga0501071_0027676_358_687 109
2322 3300049587 Ga0501071_0055478 Ga0501071_0055478_2055_2387 109
2323 3300049587 Ga0501071_0464889 Ga0501071_0464889_200_532 109
2324 3300049587 Ga0501071_0607286 Ga0501071_0607286_196_525 109
2325 3300049587 Ga0501071_0610052 Ga0501071_0610052_111_443 109
2326 3300049588 Ga0501072_0012349 Ga0501072_0012349_1616_1945 109
2327 3300049588 Ga0501072_0012349 Ga0501072_0012349_3405_3734 109
2328 3300049588 Ga0501072_0148143 Ga0501072_0148143_137_469 109
2329 3300049588 Ga0501072_0351458 Ga0501072_0351458_179_508 109
2330 3300049588 Ga0501072_0674836 Ga0501072_0674836_57_386 109
2331 3300049589 Ga0501073_0002819 Ga0501073_0002819_2177_2518 109
2332 3300049589 Ga0501073_0878987 Ga0501073_0878987_221_550 109
2333 3300049590 Ga0501074_0048687 Ga0501074_0048687_2599_2928 109
2334 3300049590 Ga0501074_0048687 Ga0501074_0048687_810_1139 109
2335 3300049590 Ga0501074_0079466 Ga0501074_0079466_943_1284 109
2336 3300049590 Ga0501074_0454250 Ga0501074_0454250_405_734 109
2337 3300049590 Ga0501074_0632510 Ga0501074_0632510_137_469 109
2338 3300049591 Ga0501075_0029245 Ga0501075_0029245_160_492 109
2339 3300049591 Ga0501075_0033782 Ga0501075_0033782_2862_3191 109
2340 3300049591 Ga0501075_0068028 Ga0501075_0068028_1516_1845 109
2341 3300049591 Ga0501075_0123538 Ga0501075_0123538_48_377 109
2342 3300049591 Ga0501075_1088631 Ga0501075_1088631_147_476 109
2343 3300049591 Ga0501075_1142775 Ga0501075_1142775_211_540 109
2344 3300049591 Ga0501075_1375406 Ga0501075_1375406_195_524 109
2345 3300049592 Ga0501076_0000493 Ga0501076_0000493_16816_17148 109
2346 3300049592 Ga0501076_0018244 Ga0501076_0018244_1762_2091 109
2347 3300049592 Ga0501076_0018244 Ga0501076_0018244_3551_3880 109
2348 3300049592 Ga0501076_0034055 Ga0501076_0034055_985_1314 109
2349 3300049592 Ga0501076_0191927 Ga0501076_0191927_1025_1357 109
2350 3300049592 Ga0501076_0746321 Ga0501076_0746321_352_681 109
2351 3300049592 Ga0501076_1369137 Ga0501076_1369137_74_403 109
2352 3300049593 Ga0501077_0008502 Ga0501077_0008502_1453_1785 109
2353 3300049593 Ga0501077_0064473 Ga0501077_0064473_1444_1773 109
2354 3300049593 Ga0501077_0077760 Ga0501077_0077760_1456_1785 109
2355 3300049652 Ga0501202_027623 Ga0501202_027623_582_914 109
2356 3300049661 Ga0501217_007594 Ga0501217_007594_1516_1848 109
2357 3300049667 Ga0501230_169971 Ga0501230_169971_22_354 109
2358 3300049669 Ga0501235_186940 Ga0501235_186940_182_511 109
2359 3300049669 Ga0501235_239476 Ga0501235_239476_36_365 109
2360 3300049678 Ga0501248_061256 Ga0501248_061256_134_466 109
2361 3300049679 Ga0501249_096994 Ga0501249_096994_223_552 109
2362 3300049683 Ga0501253_125808 Ga0501253_125808_213_545 109
2363 3300049685 Ga0501256_048461 Ga0501256_048461_32_364 109
2364 3300049688 Ga0501259_136001 Ga0501259_136001_237_569 109
2365 3300049705 Ga0501225_0046156 Ga0501225_0046156_643_975 109
2366 3300049707 Ga0501234_055758 Ga0501234_055758_222_554 109
2367 3300049708 Ga0501245_132744 Ga0501245_132744_93_422 109
2368 3300049741 Ga0501079_0001320 Ga0501079_0001320_6637_6978 109
2369 3300049741 Ga0501079_0055787 Ga0501079_0055787_1657_1989 109
2370 3300049741 Ga0501079_0148052 Ga0501079_0148052_117_446 109
2371 3300049741 Ga0501079_0269800 Ga0501079_0269800_30_359 109
2372 3300049741 Ga0501079_0843882 Ga0501079_0843882_39_368 109
2373 3300049741 Ga0501079_1279896 Ga0501079_1279896_49_378 109
2374 3300049742 Ga0501080_0001598 Ga0501080_0001598_9092_9433 109
2375 3300049742 Ga0501080_0156057 Ga0501080_0156057_10_342 109
2376 3300049742 Ga0501080_0484605 Ga0501080_0484605_349_678 109
2377 3300049743 Ga0501081_0002590 Ga0501081_0002590_1650_1982 109
2378 3300049743 Ga0501081_0017136 Ga0501081_0017136_4442_4771 109
2379 3300049743 Ga0501081_0033945 Ga0501081_0033945_1687_2016 109
2380 3300049743 Ga0501081_0130592 Ga0501081_0130592_11_340 109
2381 3300049743 Ga0501081_1120041 Ga0501081_1120041_112_441 109
2382 3300049743 Ga0501081_1405057 Ga0501081_1405057_84_413 109
2383 3300049744 Ga0501083_0006060 Ga0501083_0006060_3876_4217 109
2384 3300049765 Ga0501268_006552 Ga0501268_006552_1263_1592 109
2385 3300049768 Ga0501271_028894 Ga0501271_028894_192_524 109
2386 3300049768 Ga0501271_066076 Ga0501271_066076_145_474 109
2387 3300049770 Ga0501273_015205 Ga0501273_015205_105_437 109
2388 3300049775 Ga0501279_015216 Ga0501279_015216_139_471 109
2389 3300049779 Ga0501283_057921 Ga0501283_057921_150_482 109
2390 3300049779 Ga0501283_084731 Ga0501283_084731_223_552 109
2391 3300049822 Ga0501035_0006651 Ga0501035_0006651_1298_1639 109
2392 3300049822 Ga0501035_0661742 Ga0501035_0661742_206_538 109
2393 3300049823 Ga0501044_0023195 Ga0501044_0023195_5148_5489 109
2394 3300049823 Ga0501044_0956189 Ga0501044_0956189_123_452 109
2395 3300049824 Ga0501045_0000838 Ga0501045_0000838_170_502 109
2396 3300049824 Ga0501045_0010775 Ga0501045_0010775_3735_4076 109
2397 3300049824 Ga0501045_0057390 Ga0501045_0057390_2006_2335 109
2398 3300049824 Ga0501045_0057390 Ga0501045_0057390_217_546 109
2399 3300049824 Ga0501045_0089985 Ga0501045_0089985_131_460 109
2400 3300049824 Ga0501045_0454641 Ga0501045_0454641_595_924 109
2401 3300050489 nmdc:mga03683_9150_c1 nmdc:mga03683_9150_c1_2357_2686 109
2402 3300050490 nmdc:mga03n38_427625_c1 nmdc:mga03n38_427625_c1_23_352 109
2403 3300050491 nmdc:mga00v17_162147_c1 nmdc:mga00v17_162147_c1_1039_1371 109
2404 3300050491 nmdc:mga00v17_16776_c1 nmdc:mga00v17_16776_c1_383_712 109
2405 3300050491 nmdc:mga00v17_19858_c1 nmdc:mga00v17_19858_c1_2651_2980 109
2406 3300050491 nmdc:mga00v17_266992_c1 nmdc:mga00v17_266992_c1_596_928 109
2407 3300050492 nmdc:mga0yw44_422286_c1 nmdc:mga0yw44_422286_c1_179_508 109
2408 3300050493 nmdc:mga0k408_163490_c1 nmdc:mga0k408_163490_c1_434_763 109
2409 3300050493 nmdc:mga0k408_319758_c1 nmdc:mga0k408_319758_c1_564_893 109
2410 3300050493 nmdc:mga0k408_3476_c1 nmdc:mga0k408_3476_c1_729_1058 109
2411 3300050493 nmdc:mga0k408_4351_c1 nmdc:mga0k408_4351_c1_3129_3458 109
2412 3300050494 nmdc:mga06z11_33122_c1 nmdc:mga06z11_33122_c1_352_681 109
2413 3300050494 nmdc:mga06z11_416539_c1 nmdc:mga06z11_416539_c1_253_582 109
2414 3300050494 nmdc:mga06z11_469824_c1 nmdc:mga06z11_469824_c1_70_399 109
2415 3300050494 nmdc:mga06z11_486849_c1 nmdc:mga06z11_486849_c1_51_383 109
2416 3300050495 nmdc:mga04h51_15198_c1 nmdc:mga04h51_15198_c1_1121_1450 109
2417 3300050495 nmdc:mga04h51_23724_c1 nmdc:mga04h51_23724_c1_991_1320 109
2418 3300050496 nmdc:mga07m45_10008_c1 nmdc:mga07m45_10008_c1_630_959 109
2419 3300050496 nmdc:mga07m45_456377_c1 nmdc:mga07m45_456377_c1_148_477 109
2420 3300050507 nmdc:mga05p37_138725_c1 nmdc:mga05p37_138725_c1_1173_1502 109
2421 3300050507 nmdc:mga05p37_1423837_c1 nmdc:mga05p37_1423837_c1_126_455 109
2422 3300050507 nmdc:mga05p37_1570052_c1 nmdc:mga05p37_1570052_c1_240_572 109
2423 3300050507 nmdc:mga05p37_1585653_c1 nmdc:mga05p37_1585653_c1_66_395 109
2424 3300050507 nmdc:mga05p37_1586392_c1 nmdc:mga05p37_1586392_c1_301_630 109
2425 3300050507 nmdc:mga05p37_19535_c1 nmdc:mga05p37_19535_c1_3157_3486 109
2426 3300050507 nmdc:mga05p37_200946_c1 nmdc:mga05p37_200946_c1_907_1239 109
2427 3300050507 nmdc:mga05p37_204194_c1 nmdc:mga05p37_204194_c1_232_561 109
2428 3300050507 nmdc:mga05p37_208332_c1 nmdc:mga05p37_208332_c1_708_1037 109
2429 3300050507 nmdc:mga05p37_2097507_c1 nmdc:mga05p37_2097507_c1_116_445 109
2430 3300050507 nmdc:mga05p37_2269157_c1 nmdc:mga05p37_2269157_c1_43_372 109
2431 3300050507 nmdc:mga05p37_257923_c1 nmdc:mga05p37_257923_c1_501_830 109
2432 3300050507 nmdc:mga05p37_312284_c1 nmdc:mga05p37_312284_c1_423_755 109
2433 3300050507 nmdc:mga05p37_324316_c1 nmdc:mga05p37_324316_c1_201_530 109
2434 3300050507 nmdc:mga05p37_348950_c1 nmdc:mga05p37_348950_c1_1400_1729 109
2435 3300050507 nmdc:mga05p37_398084_c1 nmdc:mga05p37_398084_c1_1112_1441 109
2436 3300050507 nmdc:mga05p37_417181_c1 nmdc:mga05p37_417181_c1_1133_1465 109
2437 3300050507 nmdc:mga05p37_4344_c1 nmdc:mga05p37_4344_c1_8315_8644 109
2438 3300050507 nmdc:mga05p37_52776_c1 nmdc:mga05p37_52776_c1_3296_3628 109
2439 3300050507 nmdc:mga05p37_650323_c1 nmdc:mga05p37_650323_c1_482_814 109
2440 3300050507 nmdc:mga05p37_66851_c1 nmdc:mga05p37_66851_c1_1593_1922 109
2441 3300050507 nmdc:mga05p37_77505_c1 nmdc:mga05p37_77505_c1_3529_3858 109
2442 3300050507 nmdc:mga05p37_78145_c1 nmdc:mga05p37_78145_c1_2228_2560 109
2443 3300050507 nmdc:mga05p37_8727_c1 nmdc:mga05p37_8727_c1_1106_1435 109
2444 3300050507 nmdc:mga05p37_9255_c1 nmdc:mga05p37_9255_c1_4148_4480 109
2445 3300050507 nmdc:mga05p37_973053_c1 nmdc:mga05p37_973053_c1_502_834 109
2446 3300050508 nmdc:mga09592_1148594_c1 nmdc:mga09592_1148594_c1_258_590 109
2447 3300050508 nmdc:mga09592_1195442_c1 nmdc:mga09592_1195442_c1_193_522 109
2448 3300050508 nmdc:mga09592_123163_c1 nmdc:mga09592_123163_c1_1512_1841 109
2449 3300050508 nmdc:mga09592_1334367_c1 nmdc:mga09592_1334367_c1_142_471 109
2450 3300050508 nmdc:mga09592_14861_c1 nmdc:mga09592_14861_c1_1069_1401 109
2451 3300050508 nmdc:mga09592_1705_c1 nmdc:mga09592_1705_c1_15444_15773 109
2452 3300050508 nmdc:mga09592_366636_c1 nmdc:mga09592_366636_c1_81_410 109
2453 3300050508 nmdc:mga09592_37667_c1 nmdc:mga09592_37667_c1_158_487 109
2454 3300050508 nmdc:mga09592_446367_c1 nmdc:mga09592_446367_c1_233_565 109
2455 3300050508 nmdc:mga09592_456736_c1 nmdc:mga09592_456736_c1_496_825 109
2456 3300050508 nmdc:mga09592_4599_c1 nmdc:mga09592_4599_c1_292_624 109
2457 3300050508 nmdc:mga09592_48621_c1 nmdc:mga09592_48621_c1_2001_2330 109
2458 3300050508 nmdc:mga09592_5442_c1 nmdc:mga09592_5442_c1_2191_2520 109
2459 3300050508 nmdc:mga09592_610037_c1 nmdc:mga09592_610037_c1_70_402 109
2460 3300050508 nmdc:mga09592_772917_c1 nmdc:mga09592_772917_c1_22_351 109
2461 3300050508 nmdc:mga09592_822086_c1 nmdc:mga09592_822086_c1_270_599 109
2462 3300050508 nmdc:mga09592_90639_c1 nmdc:mga09592_90639_c1_581_910 109
2463 3300050509 nmdc:mga0qj67_110252_c1 nmdc:mga0qj67_110252_c1_942_1271 109
2464 3300050509 nmdc:mga0qj67_110759_c1 nmdc:mga0qj67_110759_c1_645_977 109
2465 3300050509 nmdc:mga0qj67_14964_c1 nmdc:mga0qj67_14964_c1_4914_5243 109
2466 3300050509 nmdc:mga0qj67_15370_c1 nmdc:mga0qj67_15370_c1_1703_2035 109
2467 3300050509 nmdc:mga0qj67_1707_c1 nmdc:mga0qj67_1707_c1_14909_15238 109
2468 3300050509 nmdc:mga0qj67_192504_c1 nmdc:mga0qj67_192504_c1_312_641 109
2469 3300050509 nmdc:mga0qj67_206936_c1 nmdc:mga0qj67_206936_c1_517_846 109
2470 3300050509 nmdc:mga0qj67_215063_c1 nmdc:mga0qj67_215063_c1_179_508 109
2471 3300050509 nmdc:mga0qj67_254175_c1 nmdc:mga0qj67_254175_c1_596_925 109
2472 3300050509 nmdc:mga0qj67_47063_c1 nmdc:mga0qj67_47063_c1_2261_2590 109
2473 3300050509 nmdc:mga0qj67_901546_c1 nmdc:mga0qj67_901546_c1_204_536 109
2474 3300050510 nmdc:mga06r32_1294905_c1 nmdc:mga06r32_1294905_c1_233_565 109
2475 3300050510 nmdc:mga06r32_145316_c1 nmdc:mga06r32_145316_c1_1964_2293 109
2476 3300050510 nmdc:mga06r32_300681_c1 nmdc:mga06r32_300681_c1_1002_1331 109
2477 3300050510 nmdc:mga06r32_3088_c1 nmdc:mga06r32_3088_c1_12844_13173 109
2478 3300050510 nmdc:mga06r32_326778_c1 nmdc:mga06r32_326778_c1_778_1110 109
2479 3300050510 nmdc:mga06r32_376982_c1 nmdc:mga06r32_376982_c1_387_716 109
2480 3300050510 nmdc:mga06r32_465149_c1 nmdc:mga06r32_465149_c1_501_830 109
2481 3300050510 nmdc:mga06r32_67915_c1 nmdc:mga06r32_67915_c1_3006_3338 109
2482 3300050510 nmdc:mga06r32_7112_c1 nmdc:mga06r32_7112_c1_5315_5647 109
2483 3300050510 nmdc:mga06r32_8866_c1 nmdc:mga06r32_8866_c1_1865_2197 109
2484 3300050510 nmdc:mga06r32_962622_c1 nmdc:mga06r32_962622_c1_345_674 109
2485 3300050511 nmdc:mga08y16_1003061_c1 nmdc:mga08y16_1003061_c1_382_714 109
2486 3300050511 nmdc:mga08y16_109_c1 nmdc:mga08y16_109_c1_56429_56761 109
2487 3300050511 nmdc:mga08y16_1187473_c1 nmdc:mga08y16_1187473_c1_83_415 109
2488 3300050511 nmdc:mga08y16_130580_c1 nmdc:mga08y16_130580_c1_734_1063 109
2489 3300050511 nmdc:mga08y16_142950_c1 nmdc:mga08y16_142950_c1_884_1213 109
2490 3300050511 nmdc:mga08y16_143_c2 nmdc:mga08y16_143_c2_5579_5911 109
2491 3300050511 nmdc:mga08y16_15585_c1 nmdc:mga08y16_15585_c1_1463_1792 109
2492 3300050511 nmdc:mga08y16_155_c1 nmdc:mga08y16_155_c1_25751_26080 109
2493 3300050511 nmdc:mga08y16_1975190_c1 nmdc:mga08y16_1975190_c1_137_466 109
2494 3300050511 nmdc:mga08y16_2023008_c1 nmdc:mga08y16_2023008_c1_46_375 109
2495 3300050511 nmdc:mga08y16_2151888_c1 nmdc:mga08y16_2151888_c1_97_426 109
2496 3300050511 nmdc:mga08y16_224915_c1 nmdc:mga08y16_224915_c1_1459_1788 109
2497 3300050511 nmdc:mga08y16_31145_c1 nmdc:mga08y16_31145_c1_1609_1938 109
2498 3300050511 nmdc:mga08y16_4050_c1 nmdc:mga08y16_4050_c1_12290_12622 109
2499 3300050511 nmdc:mga08y16_418880_c1 nmdc:mga08y16_418880_c1_946_1275 109
2500 3300050511 nmdc:mga08y16_433296_c1 nmdc:mga08y16_433296_c1_831_1163 109
2501 3300050511 nmdc:mga08y16_44610_c1 nmdc:mga08y16_44610_c1_2206_2535 109
2502 3300050511 nmdc:mga08y16_479407_c1 nmdc:mga08y16_479407_c1_904_1233 109
2503 3300050511 nmdc:mga08y16_480609_c1 nmdc:mga08y16_480609_c1_386_718 109
2504 3300050511 nmdc:mga08y16_597730_c1 nmdc:mga08y16_597730_c1_656_985 109
2505 3300050511 nmdc:mga08y16_729099_c1 nmdc:mga08y16_729099_c1_376_705 109
2506 3300050511 nmdc:mga08y16_740118_c1 nmdc:mga08y16_740118_c1_577_906 109
2507 3300050511 nmdc:mga08y16_855459_c1 nmdc:mga08y16_855459_c1_113_442 109
2508 3300050511 nmdc:mga08y16_87907_c1 nmdc:mga08y16_87907_c1_2019_2348 109
2509 3300050511 nmdc:mga08y16_8_c1 nmdc:mga08y16_8_c1_314915_315244 109
2510 3300050511 nmdc:mga08y16_920_c1 nmdc:mga08y16_920_c1_10514_10843 109
2511 3300050511 nmdc:mga08y16_92356_c1 nmdc:mga08y16_92356_c1_1522_1851 109
2512 3300050512 nmdc:mga0n895_101876_c1 nmdc:mga0n895_101876_c1_846_1178 109
2513 3300050512 nmdc:mga0n895_1036_c1 nmdc:mga0n895_1036_c1_17802_18131 109
2514 3300050512 nmdc:mga0n895_109795_c1 nmdc:mga0n895_109795_c1_67_396 109
2515 3300050512 nmdc:mga0n895_1271911_c1 nmdc:mga0n895_1271911_c1_192_521 109
2516 3300050512 nmdc:mga0n895_1377323_c1 nmdc:mga0n895_1377323_c1_290_622 109
2517 3300050512 nmdc:mga0n895_148694_c1 nmdc:mga0n895_148694_c1_1497_1826 109
2518 3300050512 nmdc:mga0n895_15184_c1 nmdc:mga0n895_15184_c1_2891_3220 109
2519 3300050512 nmdc:mga0n895_1737421_c1 nmdc:mga0n895_1737421_c1_244_576 109
2520 3300050512 nmdc:mga0n895_1738539_c1 nmdc:mga0n895_1738539_c1_30_362 109
2521 3300050512 nmdc:mga0n895_187108_c1 nmdc:mga0n895_187108_c1_1759_2088 109
2522 3300050512 nmdc:mga0n895_1898733_c1 nmdc:mga0n895_1898733_c1_168_497 109
2523 3300050512 nmdc:mga0n895_26397_c1 nmdc:mga0n895_26397_c1_431_760 109
2524 3300050512 nmdc:mga0n895_3447_c1 nmdc:mga0n895_3447_c1_94_423 109
2525 3300050512 nmdc:mga0n895_426783_c1 nmdc:mga0n895_426783_c1_180_509 109
2526 3300050512 nmdc:mga0n895_58600_c1 nmdc:mga0n895_58600_c1_2971_3300 109
2527 3300050512 nmdc:mga0n895_66607_c1 nmdc:mga0n895_66607_c1_1705_2037 109
2528 3300050512 nmdc:mga0n895_686489_c1 nmdc:mga0n895_686489_c1_676_1008 109
2529 3300050512 nmdc:mga0n895_735164_c1 nmdc:mga0n895_735164_c1_250_582 109
2530 3300050512 nmdc:mga0n895_8433_c1 nmdc:mga0n895_8433_c1_3169_3501 109
2531 3300050512 nmdc:mga0n895_889507_c1 nmdc:mga0n895_889507_c1_451_780 109
2532 3300050513 nmdc:mga0rr50_1137_c2 nmdc:mga0rr50_1137_c2_10254_10586 109
2533 3300050513 nmdc:mga0rr50_161849_c1 nmdc:mga0rr50_161849_c1_1167_1499 109
2534 3300050513 nmdc:mga0rr50_23467_c1 nmdc:mga0rr50_23467_c1_2177_2509 109
2535 3300050513 nmdc:mga0rr50_26163_c1 nmdc:mga0rr50_26163_c1_2064_2393 109
2536 3300050513 nmdc:mga0rr50_44277_c1 nmdc:mga0rr50_44277_c1_1552_1884 109
2537 3300050513 nmdc:mga0rr50_457787_c1 nmdc:mga0rr50_457787_c1_422_751 109
2538 3300050513 nmdc:mga0rr50_6472_c1 nmdc:mga0rr50_6472_c1_6547_6876 109
2539 3300050513 nmdc:mga0rr50_72784_c1 nmdc:mga0rr50_72784_c1_22_351 109
2540 3300050514 nmdc:mga08x19_1108514_c1 nmdc:mga08x19_1108514_c1_114_443 109
2541 3300050514 nmdc:mga08x19_221628_c1 nmdc:mga08x19_221628_c1_270_602 109
2542 3300050514 nmdc:mga08x19_29827_c1 nmdc:mga08x19_29827_c1_1688_2020 109
2543 3300050514 nmdc:mga08x19_525248_c1 nmdc:mga08x19_525248_c1_174_506 109
2544 3300050514 nmdc:mga08x19_64303_c1 nmdc:mga08x19_64303_c1_987_1319 109
2545 3300050515 nmdc:mga0a205_119797_c1 nmdc:mga0a205_119797_c1_214_543 109
2546 3300050515 nmdc:mga0a205_123144_c1 nmdc:mga0a205_123144_c1_2150_2479 109
2547 3300050515 nmdc:mga0a205_128247_c1 nmdc:mga0a205_128247_c1_951_1280 109
2548 3300050515 nmdc:mga0a205_1288_c1 nmdc:mga0a205_1288_c1_6057_6386 109
2549 3300050515 nmdc:mga0a205_1383640_c1 nmdc:mga0a205_1383640_c1_92_424 109
2550 3300050515 nmdc:mga0a205_2131_c1 nmdc:mga0a205_2131_c1_287_616 109
2551 3300050515 nmdc:mga0a205_23887_c1 nmdc:mga0a205_23887_c1_2878_3210 109
2552 3300050515 nmdc:mga0a205_25144_c1 nmdc:mga0a205_25144_c1_250_579 109
2553 3300050515 nmdc:mga0a205_255663_c1 nmdc:mga0a205_255663_c1_1132_1461 109
2554 3300050515 nmdc:mga0a205_330526_c1 nmdc:mga0a205_330526_c1_228_560 109
2555 3300050515 nmdc:mga0a205_34802_c1 nmdc:mga0a205_34802_c1_3693_4022 109
2556 3300050515 nmdc:mga0a205_463659_c1 nmdc:mga0a205_463659_c1_280_609 109
2557 3300050515 nmdc:mga0a205_495418_c1 nmdc:mga0a205_495418_c1_346_678 109
2558 3300050515 nmdc:mga0a205_55369_c1 nmdc:mga0a205_55369_c1_2945_3274 109
2559 3300050515 nmdc:mga0a205_617923_c1 nmdc:mga0a205_617923_c1_499_831 109
2560 3300050515 nmdc:mga0a205_658392_c1 nmdc:mga0a205_658392_c1_232_564 109
2561 3300050515 nmdc:mga0a205_849795_c1 nmdc:mga0a205_849795_c1_102_431 109
2562 3300053077 Ga0495601_0006402 Ga0495601_0006402_2861_3193 109
2563 3300053077 Ga0495601_0024751 Ga0495601_0024751_2056_2385 109
2564 3300053077 Ga0495601_0148695 Ga0495601_0148695_1158_1490 109
2565 3300053077 Ga0495601_0345043 Ga0495601_0345043_251_583 109
2566 3300053084 Ga0495595_0233959 Ga0495595_0233959_401_733 109
2567 3300053085 Ga0495619_0009733 Ga0495619_0009733_5447_5779 109
2568 3300053085 Ga0495619_0113384 Ga0495619_0113384_913_1245 109
2569 3300053085 Ga0495619_0226349 Ga0495619_0226349_818_1150 109
2570 3300053085 Ga0495619_0585239 Ga0495619_0585239_156_488 109
2571 3300053085 Ga0495619_0635129 Ga0495619_0635129_334_666 109
2572 3300053085 Ga0495619_0805831 Ga0495619_0805831_64_396 109
2573 3300053129 Ga0500628_120392 Ga0500628_120392_270_599 109
2574 3300054114 Ga0501084_0023198 Ga0501084_0023198_44_373 109
2575 3300054114 Ga0501084_0365658 Ga0501084_0365658_751_1080 109
2576 3300054114 Ga0501084_0459203 Ga0501084_0459203_219_548 109
2577 3300054114 Ga0501084_0480139 Ga0501084_0480139_13_342 109
2578 3300054114 Ga0501084_0762796 Ga0501084_0762796_75_404 109
2579 3300059421 Ga0590071_027534 Ga0590071_027534_251_583 109
2580 3300060353 Ga0501082_0006809 Ga0501082_0006809_511_843 109
2581 3300060353 Ga0501082_0043983 Ga0501082_0043983_483_824 109
2582 3300060353 Ga0501082_0205551 Ga0501082_0205551_1323_1652 109
2583 3300060353 Ga0501082_0644256 Ga0501082_0644256_106_435 109
2584 3300061734 Ga0530510_0001782 Ga0530510_0001782_4501_4830 109
2585 3300061734 Ga0530510_0001782 Ga0530510_0001782_6290_6619 109
2586 3300061734 Ga0530510_0006476 Ga0530510_0006476_7665_7997 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

1

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9527 1 108
4c3m-assembly1.cif.gz_B structure of wildtype pii from s. elongatus at medium resolution 0.9429 1 106
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9426 1 108
3t9z-assembly1.cif.gz_A a. fulgidus glnk3, ligand-free 0.9406 1 108
1v9o-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9405 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9098 1 109 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9067 2 107 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8985 2 108 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8832 1 109 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8771 2 109 3.30.70.120
ID Description Score Start End GO Terms
AF-F8XWX0-F1-model_v4 deleted 0.909 1 102
AF-A0A0S6WXS2-F1-model_v4 Nitrogen regulatory protein P-II 0.9085 5 102 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2V7CKF6-F1-model_v4 P-II family nitrogen regulator 0.9073 1 108 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7C3Q2H0-F1-model_v4 P-II family nitrogen regulator 0.907 1 108 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A3D3KPN2-F1-model_v4 P-II family nitrogen regulator 0.9042 1 97 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
86.87 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map