F496459

General Info

Members Datasets Scaffolds Average Seq Length
2143 688 2088 88

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_14154_c1|nmdc:mga09592_14154_c1_3867_4157
Length 96
Sequence LKLERRDVDSAQVFTFGQQGLYLLLMVAAPLLLTVLAVGLVVSIFQAATQIHEATLSFVPKIVAAVAVLAVAGPWMLTTLVEYLQRTLQAIPTVVG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221585 Pelomonas sp. Root662 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221660 Methylibium sp. Root1272 Isolate Unclassified
21 2643221683 Variovorax sp. Root473 Isolate Unclassified
22 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
23 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
24 2738541277 Variovorax sp. GV051 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738541337 Pelomonas sp. BT06 Isolate Unclassified
27 2738543013 Variovorax sp. BT01 Isolate Unclassified
28 2738543019 Variovorax sp. GV040 Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842733646 Variovorax sp. R-72446 Isolate Unclassified
34 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
42 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
43 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
44 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
45 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
46 2928037797 Variovorax sp. 1126 Isolate Unclassified
47 2928044640 Variovorax sp. 1128 Isolate Unclassified
48 2928051484 Variovorax sp. 1133 Isolate Unclassified
49 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
50 2928070936 Variovorax gossypii 1167 Isolate Unclassified
51 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
54 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
57 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
60 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
61 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
77 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
78 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
89 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
90 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
91 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
92 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
96 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
97 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
100 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
101 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
102 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
106 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
113 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
119 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
120 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
121 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
122 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
123 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
126 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
127 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
133 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
134 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
135 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
136 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
137 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
141 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
142 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
143 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
146 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
147 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
148 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
158 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
159 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
160 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
161 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
162 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
163 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
164 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
165 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
168 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
169 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
175 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
176 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
177 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
178 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
179 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
180 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
181 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
184 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
185 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
186 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
190 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
202 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
203 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
204 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
205 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
206 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
207 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
208 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
209 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
210 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
211 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
215 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
216 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
217 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
218 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
219 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
220 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
221 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
222 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
223 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
224 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
225 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
226 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
227 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
228 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
229 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
230 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
231 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
232 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
234 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
235 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
239 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
241 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
245 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
246 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
251 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
254 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
320 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
329 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
335 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
336 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
337 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
338 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
339 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
340 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
341 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
342 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
343 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
344 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
345 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
346 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
347 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
348 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
349 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
350 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
351 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
352 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
353 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
354 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
355 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
356 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
357 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
358 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
359 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
360 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
361 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
362 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
363 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
364 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
365 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
366 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
367 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
368 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
369 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
370 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
371 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
372 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
373 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
374 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
375 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
376 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
377 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
378 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
379 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
380 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
381 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
382 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
383 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
384 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
385 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
386 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
387 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
388 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
389 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
390 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
391 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
394 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
395 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
398 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
399 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
400 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
401 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
402 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
403 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
404 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
405 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
406 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
407 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
408 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
409 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
410 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
411 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
412 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
413 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
414 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
415 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
416 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
417 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
418 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
419 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
420 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
421 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
422 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
423 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
424 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
425 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
426 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
427 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
428 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
429 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
430 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
431 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
432 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
433 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
434 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
435 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
436 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
437 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
438 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
439 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
440 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
441 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
442 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
443 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
444 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
445 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
446 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
447 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
448 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
449 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
450 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
451 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
452 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
453 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
454 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
455 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
456 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
457 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
458 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
459 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
460 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
461 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
462 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
463 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
464 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
465 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
466 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
467 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
468 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
469 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
470 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
471 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
472 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
473 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
474 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
475 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
476 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
477 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
478 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
479 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
480 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
481 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
482 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
483 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
484 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
485 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
488 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
489 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
490 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
491 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
492 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
493 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
494 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
495 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
496 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
497 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
498 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
499 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
500 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
501 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
502 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
503 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
504 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
505 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
506 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
507 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
508 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
509 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
510 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
511 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
512 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
513 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
514 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
515 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
516 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
517 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
518 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
519 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
520 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
521 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
522 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
523 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
524 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
525 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
526 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
527 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
528 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
529 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
530 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
531 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
532 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
533 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
534 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
535 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
536 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
537 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
538 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
539 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
540 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
541 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
542 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
543 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
544 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
545 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
546 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
547 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
548 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
549 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
550 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
551 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
552 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
553 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
554 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
555 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
556 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
557 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
558 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
559 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
560 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
561 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
562 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
563 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
564 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
565 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
566 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
567 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
568 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
569 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
570 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
571 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
572 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
573 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
574 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
575 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
576 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
577 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
578 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
579 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
580 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
583 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
584 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
585 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
586 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
596 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
597 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
598 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
599 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
600 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
601 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
602 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
603 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
604 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
605 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
606 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
607 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
608 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
609 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
610 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
611 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
612 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
613 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
614 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
615 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
616 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
619 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
620 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
621 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
622 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
623 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
624 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
625 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
628 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
629 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
630 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
631 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
632 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
633 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
634 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
635 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
636 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
637 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
638 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
639 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
640 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
641 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
642 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
643 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
644 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
645 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
646 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
647 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
648 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
649 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
650 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
651 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
652 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
653 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
654 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
655 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
656 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
657 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
658 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
659 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
660 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
661 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
662 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
663 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
664 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
665 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
666 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
667 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
668 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
669 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
670 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
671 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
672 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
673 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
674 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
675 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
676 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
677 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
678 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
679 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
680 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
681 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
682 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
683 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
684 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
685 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
686 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
687 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
688 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.61
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0.23
Rhizoplane 3.78
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_93844 2162886007 Bacteria 809
2 JGI24746J21847_1025597 3300001977 Bacteria 816
3 JGI24740J21852_10030620 3300001979 Bacteria 1748
4 JGI24740J21852_10061013 3300001979 Bacteria 1040
5 JGI24739J22299_10016035 3300001989 Bacteria 2717
6 JGI24739J22299_10125477 3300001989 Bacteria 765
7 JGI24735J21928_10247644 3300002067 Bacteria 519
8 JGI24750J21931_1076289 3300002070 Bacteria 553
9 JGI25158J39367_1004622 3300002739 Bacteria 2059
10 JGI25158J39367_1015083 3300002739 Bacteria 992
11 JGI25152J39213_1006440 3300002773 Bacteria 3204
12 JGI25150J39212_1000713 3300002774 Bacteria 11919
13 JGI25159J45721_1007232 3300002987 Bacteria 3204
14 JGI25159J45721_1009555 3300002987 Bacteria 2549
15 JGI25151J46595_10016692 3300003187 Bacteria 3204
16 JGI25153J46596_10004412 3300003215 Bacteria 7594
17 JGI25153J46596_10011494 3300003215 Bacteria 3905
18 JGI25153J46596_10012754 3300003215 Bacteria 3601
19 JGI25153J46596_10014829 3300003215 Bacteria 3215
20 JGI25153J46596_10028238 3300003215 Bacteria 1950
21 rootH1_10029168 3300003316 Bacteria 1401
22 rootH1_10056955 3300003316 Bacteria 3500
23 rootH2_10190564 3300003320 Bacteria 1403
24 rootL2_10040047 3300003322 Bacteria 3883
25 rootL2_10046934 3300003322 Bacteria 6020
26 rootL2_10150001 3300003322 Bacteria 2623
27 rootH1_10038325 3300003323 Bacteria 4703
28 rootH1_10042098 3300003323 Bacteria 5137
29 rootH1_10068314 3300003316 Bacteria 3199
30 rootH1_10068314 3300003323 Bacteria 2671
31 JGI26128J50194_1000847 3300003347 Bacteria 1832
32 JGI25160J50197_1011152 3300003354 Bacteria 3204
33 JGI25160J50197_1013627 3300003354 Bacteria 2761
34 JGI26145J50221_1025494 3300003371 Bacteria 588
35 JGI25161J50226_1003238 3300003374 Bacteria 3808
36 JGI25161J50226_1008435 3300003374 Bacteria 1588
37 Ga0006562J51391_1125153 3300003578 Bacteria 3430
38 Ga0006562J51391_1125156 3300003578 Bacteria 970
39 Ga0055532_1025643 3300003758 Bacteria 580
40 Ga0055535_1001434 3300003761 Bacteria 12127
41 Ga0055542_1000127 3300003762 Bacteria 100078
42 Ga0055526_1002532 3300003771 Bacteria 12277
43 Ga0055526_1014660 3300003771 Bacteria 3204
44 Ga0055526_1014781 3300003771 Bacteria 3183
45 Ga0055537_1005895 3300003773 Bacteria 3204
46 Ga0055537_1005952 3300003773 Bacteria 3179
47 Ga0055524_1000207 3300003775 Bacteria 63213
48 Ga0055524_1012781 3300003775 Bacteria 3204
49 Ga0055524_1015362 3300003775 Bacteria 2795
50 Ga0055536_1000530 3300003781 Bacteria 26325
51 Ga0055536_1001748 3300003781 Bacteria 12822
52 Ga0055536_1038022 3300003781 Bacteria 1171
53 Ga0055534_1003750 3300003784 Bacteria 4681
54 Ga0055534_1005868 3300003784 Bacteria 3204
55 Ga0055534_1015344 3300003784 Bacteria 1405
56 Ga0055528_1007039 3300003790 Bacteria 5027
57 Ga0055528_1013037 3300003790 Bacteria 3180
58 Ga0055528_1063074 3300003790 Bacteria 693
59 Ga0055528_1081495 3300003790 Bacteria 567
60 Ga0055530_10000464 3300003791 Bacteria 35595
61 Ga0055530_10020044 3300003791 Bacteria 2009
62 Ga0055530_10057447 3300003791 Bacteria 879
63 Ga0055530_10122084 3300003791 Bacteria 504
64 Ga0055540_1000011 3300003792 Bacteria 282927
65 Ga0055540_1000603 3300003792 Bacteria 25833
66 Ga0055540_1002445 3300003792 Bacteria 9798
67 Ga0055540_1002836 3300003792 Bacteria 8832
68 Ga0055540_1020072 3300003792 Bacteria 1780
69 Ga0055531_10001607 3300003794 Bacteria 16412
70 Ga0055531_10001895 3300003794 Bacteria 14645
71 Ga0055531_10011526 3300003794 Bacteria 4250
72 Ga0055543_1000771 3300004625 Bacteria 15959
73 Ga0055543_1003491 3300004625 Bacteria 4611
74 Ga0065165_1001786 3300005262 Bacteria 21245
75 Ga0065165_1003619 3300005262 Bacteria 10607
76 Ga0065165_1010543 3300005262 Bacteria 3973
77 Ga0065714_10276998 3300005288 Bacteria 729
78 Ga0065714_10299280 3300005288 Bacteria 682
79 Ga0065704_10100495 3300005289 Bacteria 2271
80 Ga0065704_10153191 3300005289 Bacteria 1412
81 Ga0065704_10178466 3300005289 Bacteria 1250
82 Ga0065704_10251990 3300005289 Bacteria 987
83 Ga0065704_10776945 3300005289 Bacteria 526
84 Ga0065712_10045136 3300005290 Bacteria 751
85 Ga0065712_10054430 3300005290 Bacteria 689
86 Ga0065715_10145513 3300005293 Bacteria 1794
87 Ga0065715_10245821 3300005293 Bacteria 1184
88 Ga0070658_10897051 3300005327 Bacteria 771
89 Ga0070676_10001849 3300005328 Bacteria 10793
90 Ga0070676_10019835 3300005328 Bacteria 3745
91 Ga0070676_10083237 3300005328 Bacteria 1946
92 Ga0070676_10099580 3300005328 Bacteria 1793
93 Ga0070676_10380340 3300005328 Bacteria 977
94 Ga0070676_10420234 3300005328 Bacteria 934
95 Ga0070676_10617389 3300005328 Bacteria 784
96 Ga0070676_10841459 3300005328 Bacteria 680
97 Ga0070676_11502463 3300005328 Bacteria 519
98 Ga0070683_100032863 3300005329 Bacteria 4728
99 Ga0070683_100713614 3300005329 Bacteria 960
100 Ga0070683_100935908 3300005329 Bacteria 831
101 Ga0070690_100006214 3300005330 Bacteria 6773
102 Ga0070670_100013010 3300005331 Bacteria 7128
103 Ga0070670_100037154 3300005331 Bacteria 4190
104 Ga0070670_100095571 3300005331 Bacteria 2556
105 Ga0070670_100199248 3300005331 Bacteria 1739
106 Ga0070670_100465496 3300005331 Bacteria 1121
107 Ga0070670_100545083 3300005331 Bacteria 1034
108 Ga0070670_100594711 3300005331 Bacteria 990
109 Ga0070670_100678357 3300005331 Bacteria 926
110 Ga0070670_100738722 3300005331 Bacteria 886
111 Ga0070670_100947184 3300005331 Bacteria 782
112 Ga0070670_101263339 3300005331 Bacteria 675
113 Ga0070670_101497598 3300005331 Bacteria 619
114 Ga0070670_101693075 3300005331 Bacteria 582
115 Ga0070677_10017835 3300005333 Bacteria 2547
116 Ga0070677_10033687 3300005333 Bacteria 1974
117 Ga0070677_10071030 3300005333 Bacteria 1465
118 Ga0070677_10108197 3300005333 Bacteria 1237
119 Ga0070677_10146861 3300005333 Bacteria 1093
120 Ga0070677_10241124 3300005333 Bacteria 892
121 Ga0070677_10241125 3300005333 Bacteria 892
122 Ga0070677_10481215 3300005333 Bacteria 670
123 Ga0068869_100014166 3300005334 Bacteria 5322
124 Ga0068869_100036584 3300005334 Bacteria 3486
125 Ga0068869_100067518 3300005334 Bacteria 2638
126 Ga0068869_100095143 3300005334 Bacteria 2247
127 Ga0068869_100347984 3300005334 Bacteria 1207
128 Ga0068869_100378568 3300005334 Bacteria 1159
129 Ga0068869_100447250 3300005334 Bacteria 1070
130 Ga0068869_100666018 3300005334 Bacteria 885
131 Ga0068869_101160634 3300005334 Bacteria 677
132 Ga0070666_10020373 3300005335 Bacteria 4286
133 Ga0070666_10071419 3300005335 Bacteria 2362
134 Ga0070666_10332138 3300005335 Bacteria 1086
135 Ga0070666_10689634 3300005335 Bacteria 749
136 Ga0070666_10735042 3300005335 Bacteria 725
137 Ga0070666_11311054 3300005335 Bacteria 540
138 Ga0070666_11338559 3300005335 Bacteria 535
139 Ga0070666_11453302 3300005335 Bacteria 512
140 Ga0070680_100012570 3300005336 Bacteria 6581
141 Ga0070680_100121871 3300005336 Bacteria 2177
142 Ga0070680_100130032 3300005336 Bacteria 2106
143 Ga0070680_101068157 3300005336 Bacteria 698
144 Ga0068868_100003711 3300005338 Bacteria 10664
145 Ga0068868_100052781 3300005338 Bacteria 3200
146 Ga0068868_100058644 3300005338 Bacteria 3043
147 Ga0068868_100059788 3300005338 Bacteria 3015
148 Ga0068868_100140028 3300005338 Bacteria 1985
149 Ga0068868_100205867 3300005338 Bacteria 1642
150 Ga0068868_100233241 3300005338 Bacteria 1544
151 Ga0068868_100322318 3300005338 Bacteria 1317
152 Ga0068868_100362665 3300005338 Bacteria 1243
153 Ga0068868_100982060 3300005338 Bacteria 771
154 Ga0068868_101411987 3300005338 Bacteria 649
155 Ga0068868_102317947 3300005338 Bacteria 512
156 Ga0068868_102431744 3300005338 Bacteria 500
157 Ga0070660_100002224 3300005339 Bacteria 13368
158 Ga0070660_101270341 3300005339 Bacteria 625
159 Ga0070660_101583083 3300005339 Bacteria 557
160 Ga0070660_101863067 3300005339 Bacteria 513
161 Ga0070689_100021223 3300005340 Bacteria 4830
162 Ga0070689_101343224 3300005340 Bacteria 645
163 Ga0070691_10522081 3300005341 Bacteria 690
164 Ga0070687_100038494 3300005343 Bacteria 2397
165 Ga0070687_100496478 3300005343 Bacteria 821
166 Ga0070687_100518213 3300005343 Bacteria 806
167 Ga0070687_101353116 3300005343 Bacteria 530
168 Ga0070687_101443009 3300005343 Bacteria 516
169 Ga0070661_100005152 3300005344 Bacteria 9001
170 Ga0070661_100042215 3300005344 Bacteria 3328
171 Ga0070661_100219593 3300005344 Bacteria 1458
172 Ga0070661_100597918 3300005344 Bacteria 892
173 Ga0070661_100783587 3300005344 Bacteria 781
174 Ga0070668_100013101 3300005347 Bacteria 6179
175 Ga0070668_100130926 3300005347 Bacteria 2013
176 Ga0070668_100246169 3300005347 Bacteria 1482
177 Ga0070668_100467784 3300005347 Bacteria 1087
178 Ga0070668_100583008 3300005347 Bacteria 976
179 Ga0070668_100617705 3300005347 Bacteria 950
180 Ga0070669_100015642 3300005353 Bacteria 5410
181 Ga0070669_100071256 3300005353 Bacteria 2571
182 Ga0070669_100097794 3300005353 Bacteria 2210
183 Ga0070669_100160545 3300005353 Bacteria 1746
184 Ga0070669_100426231 3300005353 Bacteria 1089
185 Ga0070669_100704995 3300005353 Bacteria 852
186 Ga0070669_101135656 3300005353 Bacteria 674
187 Ga0070669_101481984 3300005353 Bacteria 590
188 Ga0070669_101570594 3300005353 Bacteria 572
189 Ga0070675_100000250 3300005354 Bacteria 34971
190 Ga0070675_100003213 3300005354 Bacteria 12380
191 Ga0070675_100011215 3300005354 Bacteria 7015
192 Ga0070675_100012571 3300005354 Bacteria 6636
193 Ga0070675_100018746 3300005354 Bacteria 5508
194 Ga0070675_100025359 3300005354 Bacteria 4754
195 Ga0070675_100114393 3300005354 Bacteria 2286
196 Ga0070675_100171767 3300005354 Bacteria 1870
197 Ga0070675_100207755 3300005354 Bacteria 1701
198 Ga0070675_100326159 3300005354 Bacteria 1357
199 Ga0070675_100419443 3300005354 Bacteria 1196
200 Ga0070675_100571434 3300005354 Bacteria 1024
201 Ga0070675_101423761 3300005354 Bacteria 639
202 Ga0070675_101469976 3300005354 Bacteria 628
203 Ga0070675_101820912 3300005354 Bacteria 561
204 Ga0070671_100006682 3300005355 Bacteria 9222
205 Ga0070671_100126528 3300005355 Bacteria 2151
206 Ga0070671_100152385 3300005355 Bacteria 1952
207 Ga0070671_100202994 3300005355 Bacteria 1681
208 Ga0070671_100315170 3300005355 Bacteria 1333
209 Ga0070671_100440500 3300005355 Bacteria 1117
210 Ga0070671_100656227 3300005355 Bacteria 908
211 Ga0070671_101156220 3300005355 Bacteria 680
212 Ga0070671_101169761 3300005355 Bacteria 676
213 Ga0070671_101200285 3300005355 Bacteria 668
214 Ga0070671_101970988 3300005355 Bacteria 520
215 Ga0070671_102000250 3300005355 Bacteria 516
216 Ga0070674_100002846 3300005356 Bacteria 9563
217 Ga0070674_100029632 3300005356 Bacteria 3608
218 Ga0070674_100038484 3300005356 Bacteria 3223
219 Ga0070674_100233224 3300005356 Bacteria 1437
220 Ga0070674_100792281 3300005356 Bacteria 818
221 Ga0070674_101416738 3300005356 Bacteria 623
222 Ga0070674_101536814 3300005356 Bacteria 599
223 Ga0070674_101616631 3300005356 Bacteria 585
224 Ga0070674_101700792 3300005356 Bacteria 570
225 Ga0070673_100027009 3300005364 Bacteria 4249
226 Ga0070673_100073056 3300005364 Bacteria 2760
227 Ga0070673_100102804 3300005364 Bacteria 2356
228 Ga0070673_100164539 3300005364 Bacteria 1889
229 Ga0070673_100260429 3300005364 Bacteria 1515
230 Ga0070673_100274931 3300005364 Bacteria 1475
231 Ga0070673_100329470 3300005364 Bacteria 1350
232 Ga0070673_100490950 3300005364 Bacteria 1109
233 Ga0070673_100768445 3300005364 Bacteria 888
234 Ga0070673_101126854 3300005364 Bacteria 733
235 Ga0070688_100004925 3300005365 Bacteria 6988
236 Ga0070688_100578414 3300005365 Bacteria 857
237 Ga0070688_100648628 3300005365 Bacteria 813
238 Ga0070688_101656546 3300005365 Bacteria 523
239 Ga0070659_100008671 3300005366 Bacteria 7436
240 Ga0070659_100011205 3300005366 Bacteria 6625
241 Ga0070659_100051316 3300005366 Bacteria 3243
242 Ga0070659_100510243 3300005366 Bacteria 1026
243 Ga0070659_100710562 3300005366 Bacteria 869
244 Ga0070659_100882452 3300005366 Bacteria 781
245 Ga0070659_101020976 3300005366 Bacteria 726
246 Ga0070659_101026845 3300005366 Bacteria 724
247 Ga0070659_101090530 3300005366 Bacteria 703
248 Ga0070667_100039183 3300005367 Bacteria 3971
249 Ga0070667_100257230 3300005367 Bacteria 1562
250 Ga0070667_100334063 3300005367 Bacteria 1370
251 Ga0070667_100334570 3300005367 Bacteria 1369
252 Ga0070667_100354680 3300005367 Bacteria 1328
253 Ga0070667_100533371 3300005367 Bacteria 1078
254 Ga0070667_100958035 3300005367 Bacteria 798
255 Ga0070667_100989473 3300005367 Bacteria 784
256 Ga0070667_101176329 3300005367 Bacteria 718
257 Ga0070667_101205557 3300005367 Bacteria 708
258 Ga0070667_101609601 3300005367 Bacteria 610
259 Ga0070667_101677350 3300005367 Bacteria 598
260 Ga0070667_102151080 3300005367 Bacteria 526
261 Ga0070703_10571995 3300005406 Bacteria 518
262 Ga0070709_10084240 3300005434 Bacteria 2082
263 Ga0070714_100003247 3300005435 Bacteria 12099
264 Ga0070713_100255447 3300005436 Bacteria 1600
265 Ga0070713_102202206 3300005436 Bacteria 534
266 Ga0070710_10151357 3300005437 Bacteria 1431
267 Ga0070710_10918525 3300005437 Bacteria 633
268 Ga0070701_10500696 3300005438 Bacteria 789
269 Ga0070701_10595090 3300005438 Bacteria 732
270 Ga0070711_100892482 3300005439 Bacteria 758
271 Ga0070705_100393727 3300005440 Bacteria 1024
272 Ga0070700_101212675 3300005441 Bacteria 630
273 Ga0070708_100063831 3300005445 Bacteria 3298
274 Ga0070708_101003617 3300005445 Bacteria 783
275 Ga0070663_100003281 3300005455 Bacteria 9317
276 Ga0070663_100196930 3300005455 Bacteria 1570
277 Ga0070663_100290568 3300005455 Bacteria 1305
278 Ga0070663_100316389 3300005455 Bacteria 1254
279 Ga0070663_100974126 3300005455 Bacteria 736
280 Ga0070663_101134196 3300005455 Bacteria 685
281 Ga0070663_101300241 3300005455 Bacteria 641
282 Ga0070663_101584809 3300005455 Bacteria 584
283 Ga0070663_101716594 3300005455 Bacteria 562
284 Ga0070678_100053998 3300005456 Bacteria 2925
285 Ga0070678_100060240 3300005456 Bacteria 2793
286 Ga0070678_100074682 3300005456 Bacteria 2549
287 Ga0070678_100080841 3300005456 Bacteria 2462
288 Ga0070678_100086444 3300005456 Bacteria 2392
289 Ga0070678_100093252 3300005456 Bacteria 2315
290 Ga0070678_100097628 3300005456 Bacteria 2269
291 Ga0070678_100226044 3300005456 Bacteria 1558
292 Ga0070678_100417015 3300005456 Bacteria 1169
293 Ga0070678_100435618 3300005456 Bacteria 1145
294 Ga0070678_100736692 3300005456 Bacteria 890
295 Ga0070678_100964237 3300005456 Bacteria 782
296 Ga0070678_100974049 3300005456 Bacteria 778
297 Ga0070678_101332825 3300005456 Bacteria 669
298 Ga0070678_101701187 3300005456 Bacteria 594
299 Ga0070678_101707733 3300005456 Bacteria 592
300 Ga0070678_101961243 3300005456 Bacteria 553
301 Ga0070678_102104866 3300005456 Bacteria 535
302 Ga0070662_100013275 3300005457 Bacteria 5479
303 Ga0070662_100043528 3300005457 Bacteria 3213
304 Ga0070662_100052894 3300005457 Bacteria 2938
305 Ga0070662_100127998 3300005457 Bacteria 1954
306 Ga0070662_100262606 3300005457 Bacteria 1391
307 Ga0070662_100287034 3300005457 Bacteria 1333
308 Ga0070662_100418097 3300005457 Bacteria 1109
309 Ga0070662_100576707 3300005457 Bacteria 945
310 Ga0070662_100596614 3300005457 Bacteria 929
311 Ga0070662_100598633 3300005457 Bacteria 927
312 Ga0070662_100896512 3300005457 Bacteria 756
313 Ga0070662_101444633 3300005457 Bacteria 593
314 Ga0070662_101616173 3300005457 Bacteria 559
315 Ga0070662_101678461 3300005457 Bacteria 548
316 Ga0070681_10170120 3300005458 Bacteria 2101
317 Ga0070681_10265946 3300005458 Bacteria 1626
318 Ga0068867_100000329 3300005459 Bacteria 31296
319 Ga0068867_100001932 3300005459 Bacteria 14439
320 Ga0068867_100020667 3300005459 Bacteria 4691
321 Ga0068867_100056082 3300005459 Bacteria 2914
322 Ga0068867_100102861 3300005459 Bacteria 2184
323 Ga0068867_100115742 3300005459 Bacteria 2065
324 Ga0068867_100178615 3300005459 Bacteria 1686
325 Ga0068867_100248108 3300005459 Bacteria 1447
326 Ga0068867_100422376 3300005459 Bacteria 1129
327 Ga0068867_100548975 3300005459 Bacteria 1001
328 Ga0068867_100623126 3300005459 Bacteria 943
329 Ga0068867_100691947 3300005459 Bacteria 899
330 Ga0068867_100944551 3300005459 Bacteria 778
331 Ga0068867_101049289 3300005459 Bacteria 741
332 Ga0068867_101129962 3300005459 Bacteria 716
333 Ga0070685_10693949 3300005466 Bacteria 742
334 Ga0070685_10833306 3300005466 Bacteria 682
335 Ga0070685_11177346 3300005466 Bacteria 582
336 Ga0070685_11588165 3300005466 Bacteria 506
337 Ga0070706_100004486 3300005467 Bacteria 13456
338 Ga0070706_100096620 3300005467 Bacteria 2743
339 Ga0070707_100355610 3300005468 Bacteria 1422
340 Ga0070698_100138790 3300005471 Bacteria 2384
341 Ga0070699_101436279 3300005518 Bacteria 633
342 Ga0070679_100043614 3300005530 Bacteria 4466
343 Ga0070679_100212093 3300005530 Bacteria 1900
344 Ga0070679_100241396 3300005530 Bacteria 1764
345 Ga0070679_100475313 3300005530 Bacteria 1194
346 Ga0070679_101126452 3300005530 Bacteria 730
347 Ga0070684_100181994 3300005535 Bacteria 1911
348 Ga0070684_100202985 3300005535 Bacteria 1806
349 Ga0070684_100775796 3300005535 Bacteria 895
350 Ga0070684_102145738 3300005535 Bacteria 527
351 Ga0068853_100004811 3300005539 Bacteria 10499
352 Ga0068853_100007795 3300005539 Bacteria 8588
353 Ga0068853_100010420 3300005539 Bacteria 7521
354 Ga0068853_100105575 3300005539 Bacteria 2496
355 Ga0068853_100160997 3300005539 Bacteria 2025
356 Ga0068853_100281317 3300005539 Bacteria 1534
357 Ga0068853_100490057 3300005539 Bacteria 1159
358 Ga0068853_100522230 3300005539 Bacteria 1122
359 Ga0070672_100001451 3300005543 Bacteria 14681
360 Ga0070672_100015547 3300005543 Bacteria 5423
361 Ga0070672_100021276 3300005543 Bacteria 4744
362 Ga0070672_100027777 3300005543 Bacteria 4224
363 Ga0070672_100030773 3300005543 Bacteria 4036
364 Ga0070672_100033709 3300005543 Bacteria 3880
365 Ga0070672_100042276 3300005543 Bacteria 3508
366 Ga0070672_100135479 3300005543 Bacteria 2028
367 Ga0070672_100318781 3300005543 Bacteria 1321
368 Ga0070672_100332166 3300005543 Bacteria 1293
369 Ga0070672_100412143 3300005543 Bacteria 1159
370 Ga0070672_100572100 3300005543 Bacteria 982
371 Ga0070672_101391110 3300005543 Bacteria 627
372 Ga0070695_100085874 3300005545 Bacteria 2090
373 Ga0070693_100026317 3300005547 Bacteria 3140
374 Ga0070693_100629876 3300005547 Bacteria 778
375 Ga0070665_100543803 3300005548 Bacteria 1173
376 Ga0070665_100790261 3300005548 Bacteria 962
377 Ga0070665_100853711 3300005548 Bacteria 923
378 Ga0070665_101205973 3300005548 Bacteria 767
379 Ga0070665_102467209 3300005548 Bacteria 522
380 Ga0068855_100015899 3300005563 Bacteria 9053
381 Ga0068855_100019544 3300005563 Bacteria 8138
382 Ga0068855_100399137 3300005563 Bacteria 1507
383 Ga0068855_100409839 3300005563 Bacteria 1484
384 Ga0068855_100546779 3300005563 Bacteria 1254
385 Ga0070664_100001831 3300005564 Bacteria 17028
386 Ga0070664_100040136 3300005564 Bacteria 3945
387 Ga0070664_100148636 3300005564 Bacteria 2067
388 Ga0070664_100230636 3300005564 Bacteria 1659
389 Ga0070664_100262430 3300005564 Bacteria 1554
390 Ga0070664_100285705 3300005564 Bacteria 1488
391 Ga0070664_100512445 3300005564 Bacteria 1106
392 Ga0070664_100832791 3300005564 Bacteria 863
393 Ga0070664_101046865 3300005564 Bacteria 768
394 Ga0070664_101047334 3300005564 Bacteria 767
395 Ga0070664_101638866 3300005564 Bacteria 609
396 Ga0070664_102223047 3300005564 Bacteria 520
397 Ga0068857_100001323 3300005577 Bacteria 19468
398 Ga0068857_100188666 3300005577 Bacteria 1877
399 Ga0068857_100220281 3300005577 Bacteria 1733
400 Ga0068857_100804946 3300005577 Bacteria 897
401 Ga0068857_100923447 3300005577 Bacteria 838
402 Ga0068857_101427885 3300005577 Bacteria 673
403 Ga0068857_102188780 3300005577 Bacteria 543
404 Ga0068854_100014719 3300005578 Bacteria 5162
405 Ga0068854_100499034 3300005578 Bacteria 1025
406 Ga0068854_100691507 3300005578 Bacteria 879
407 Ga0068854_100801982 3300005578 Bacteria 821
408 Ga0068856_100012520 3300005614 Bacteria 8213
409 Ga0068856_100234744 3300005614 Bacteria 1849
410 Ga0068856_100588995 3300005614 Bacteria 1133
411 Ga0070702_100330559 3300005615 Bacteria 1066
412 Ga0070702_100390308 3300005615 Bacteria 992
413 Ga0070702_100970483 3300005615 Bacteria 670
414 Ga0070702_101678808 3300005615 Bacteria 527
415 Ga0068852_100003059 3300005616 Bacteria 11640
416 Ga0068852_100003215 3300005616 Bacteria 11409
417 Ga0068852_100005883 3300005616 Bacteria 8816
418 Ga0068852_100060508 3300005616 Bacteria 3287
419 Ga0068852_100063413 3300005616 Bacteria 3218
420 Ga0068852_100081438 3300005616 Bacteria 2873
421 Ga0068852_100085851 3300005616 Bacteria 2804
422 Ga0068852_100281484 3300005616 Bacteria 1603
423 Ga0068852_100289797 3300005616 Bacteria 1581
424 Ga0068852_100338183 3300005616 Bacteria 1466
425 Ga0068852_100429912 3300005616 Bacteria 1304
426 Ga0068852_100496905 3300005616 Bacteria 1214
427 Ga0068852_100623488 3300005616 Bacteria 1084
428 Ga0068852_100877640 3300005616 Bacteria 913
429 Ga0068852_100944013 3300005616 Bacteria 880
430 Ga0068852_101778848 3300005616 Bacteria 639
431 Ga0068852_101993761 3300005616 Bacteria 603
432 Ga0068852_102203231 3300005616 Bacteria 572
433 Ga0068852_102555406 3300005616 Bacteria 530
434 Ga0068859_100024423 3300005617 Bacteria 6063
435 Ga0068859_100030871 3300005617 Bacteria 5377
436 Ga0068859_100205505 3300005617 Bacteria 2054
437 Ga0068859_100420551 3300005617 Bacteria 1433
438 Ga0068864_100003978 3300005618 Bacteria 12169
439 Ga0068864_100026806 3300005618 Bacteria 4860
440 Ga0068864_100070862 3300005618 Bacteria 3034
441 Ga0068864_100074432 3300005618 Bacteria 2963
442 Ga0068864_100186642 3300005618 Bacteria 1898
443 Ga0068864_100507830 3300005618 Bacteria 1161
444 Ga0068864_100959443 3300005618 Bacteria 846
445 Ga0068864_102179872 3300005618 Bacteria 560
446 Ga0068864_102491605 3300005618 Bacteria 523
447 Ga0068866_10010148 3300005718 Bacteria 4027
448 Ga0068866_10092812 3300005718 Bacteria 1648
449 Ga0068866_10246875 3300005718 Bacteria 1090
450 Ga0068866_10624189 3300005718 Bacteria 731
451 Ga0068861_100007969 3300005719 Bacteria 7292
452 Ga0068861_100050459 3300005719 Bacteria 3155
453 Ga0068861_100252792 3300005719 Bacteria 1505
454 Ga0068861_100566595 3300005719 Bacteria 1037
455 Ga0068861_100754860 3300005719 Bacteria 909
456 Ga0068861_101024062 3300005719 Bacteria 789
457 Ga0068861_101437731 3300005719 Bacteria 675
458 Ga0068861_102366491 3300005719 Bacteria 534
459 Ga0068851_10010993 3300005834 Bacteria 4236
460 Ga0068851_10013080 3300005834 Bacteria 3924
461 Ga0068851_10049026 3300005834 Bacteria 2141
462 Ga0068851_10061522 3300005834 Bacteria 1924
463 Ga0068851_10110219 3300005834 Bacteria 1468
464 Ga0068851_10232097 3300005834 Bacteria 1041
465 Ga0068851_10365005 3300005834 Bacteria 843
466 Ga0068851_10403524 3300005834 Bacteria 804
467 Ga0068851_10871972 3300005834 Bacteria 562
468 Ga0068870_10184872 3300005840 Bacteria 1254
469 Ga0068870_10286484 3300005840 Bacteria 1035
470 Ga0068870_10433751 3300005840 Bacteria 862
471 Ga0068863_100019694 3300005841 Bacteria 6454
472 Ga0068863_100076202 3300005841 Bacteria 3173
473 Ga0068863_100160408 3300005841 Bacteria 2154
474 Ga0068863_100294731 3300005841 Bacteria 1573
475 Ga0068863_100352912 3300005841 Bacteria 1432
476 Ga0068863_100587577 3300005841 Bacteria 1101
477 Ga0068863_102685320 3300005841 Bacteria 507
478 Ga0068858_100001515 3300005842 Bacteria 23851
479 Ga0068858_100001818 3300005842 Bacteria 21717
480 Ga0068858_100003704 3300005842 Bacteria 15140
481 Ga0068860_100001009 3300005843 Bacteria 31175
482 Ga0068860_100003030 3300005843 Bacteria 17343
483 Ga0068860_100057253 3300005843 Bacteria 3705
484 Ga0068860_100249680 3300005843 Bacteria 1727
485 Ga0068860_100730483 3300005843 Bacteria 1001
486 Ga0068860_102665865 3300005843 Bacteria 519
487 Ga0068862_100036617 3300005844 Bacteria 4159
488 Ga0068862_100243673 3300005844 Bacteria 1636
489 Ga0068862_101222035 3300005844 Bacteria 751
490 Ga0070717_10994756 3300006028 Bacteria 764
491 Ga0075365_10270767 3300006038 Bacteria 1194
492 Ga0075368_10069600 3300006042 Bacteria 1419
493 Ga0075363_100009238 3300006048 Bacteria 4630
494 Ga0075363_100131110 3300006048 Bacteria 1406
495 Ga0075363_100157455 3300006048 Bacteria 1285
496 Ga0075363_100301776 3300006048 Bacteria 929
497 Ga0075364_10002974 3300006051 Bacteria 9569
498 Ga0075364_10121068 3300006051 Bacteria 1751
499 Ga0075364_10187923 3300006051 Bacteria 1399
500 Ga0070715_10214039 3300006163 Bacteria 987
501 Ga0070716_100205061 3300006173 Bacteria 1313
502 Ga0070716_100776094 3300006173 Bacteria 740
503 Ga0070712_101297678 3300006175 Bacteria 634
504 Ga0075362_10010715 3300006177 Bacteria 3588
505 Ga0075362_10021615 3300006177 Bacteria 2703
506 Ga0075362_10064250 3300006177 Bacteria 1665
507 Ga0075362_10162263 3300006177 Bacteria 1077
508 Ga0075362_10173547 3300006177 Bacteria 1042
509 Ga0075362_10190963 3300006177 Bacteria 995
510 Ga0075362_10409447 3300006177 Bacteria 685
511 Ga0075362_10434037 3300006177 Bacteria 666
512 Ga0075362_10500658 3300006177 Bacteria 621
513 Ga0075362_10516424 3300006177 Bacteria 612
514 Ga0075362_10672741 3300006177 Bacteria 539
515 Ga0075367_10015588 3300006178 Bacteria 4137
516 Ga0075367_10033387 3300006178 Bacteria 2965
517 Ga0075367_10056015 3300006178 Bacteria 2341
518 Ga0075367_10078408 3300006178 Bacteria 1995
519 Ga0075367_10389942 3300006178 Bacteria 880
520 Ga0075369_10007815 3300006186 Bacteria 4091
521 Ga0075369_10013367 3300006186 Bacteria 3258
522 Ga0075369_10104184 3300006186 Bacteria 1275
523 Ga0075369_10408093 3300006186 Bacteria 641
524 Ga0075366_10025896 3300006195 Bacteria 3431
525 Ga0075366_10046947 3300006195 Bacteria 2559
526 Ga0075366_10058370 3300006195 Bacteria 2292
527 Ga0075366_10083646 3300006195 Bacteria 1907
528 Ga0075366_10124788 3300006195 Bacteria 1552
529 Ga0075366_10179318 3300006195 Bacteria 1286
530 Ga0075366_10251270 3300006195 Bacteria 1078
531 Ga0075366_10317687 3300006195 Bacteria 954
532 Ga0075366_10371893 3300006195 Bacteria 878
533 Ga0075366_10479410 3300006195 Bacteria 768
534 Ga0075366_10485219 3300006195 Bacteria 764
535 Ga0075366_10577374 3300006195 Bacteria 696
536 Ga0075366_10638500 3300006195 Bacteria 660
537 Ga0075366_10859577 3300006195 Bacteria 565
538 Ga0075366_10944258 3300006195 Bacteria 538
539 Ga0097621_100016134 3300006237 Bacteria 5640
540 Ga0097621_100056447 3300006237 Bacteria 3208
541 Ga0097621_100096593 3300006237 Bacteria 2479
542 Ga0097621_100104372 3300006237 Bacteria 2388
543 Ga0097621_100406286 3300006237 Bacteria 1220
544 Ga0097621_100566255 3300006237 Bacteria 1035
545 Ga0097621_101293660 3300006237 Bacteria 688
546 Ga0097621_101392461 3300006237 Bacteria 664
547 Ga0075370_10000524 3300006353 Bacteria 14643
548 Ga0075370_10002753 3300006353 Bacteria 8237
549 Ga0075370_10010292 3300006353 Bacteria 4886
550 Ga0075370_10014590 3300006353 Bacteria 4194
551 Ga0075370_10024961 3300006353 Bacteria 3304
552 Ga0075370_10054018 3300006353 Bacteria 2280
553 Ga0075370_10104776 3300006353 Bacteria 1639
554 Ga0075370_10130104 3300006353 Bacteria 1468
555 Ga0075370_10137636 3300006353 Bacteria 1427
556 Ga0075370_10182783 3300006353 Bacteria 1234
557 Ga0075370_10194837 3300006353 Bacteria 1195
558 Ga0075370_10198370 3300006353 Bacteria 1183
559 Ga0075370_10321799 3300006353 Bacteria 921
560 Ga0075370_10440707 3300006353 Bacteria 783
561 Ga0075370_10479758 3300006353 Bacteria 749
562 Ga0075370_10505437 3300006353 Bacteria 729
563 Ga0075370_10511414 3300006353 Bacteria 725
564 Ga0075370_10656904 3300006353 Bacteria 636
565 Ga0075370_10795353 3300006353 Bacteria 576
566 Ga0068871_100083637 3300006358 Bacteria 2647
567 Ga0068871_100163910 3300006358 Bacteria 1902
568 Ga0068871_100183476 3300006358 Bacteria 1799
569 Ga0068871_100321654 3300006358 Bacteria 1362
570 Ga0068871_100518079 3300006358 Bacteria 1076
571 Ga0068871_100886165 3300006358 Bacteria 826
572 Ga0068871_100890569 3300006358 Bacteria 824
573 Ga0068871_101112981 3300006358 Bacteria 739
574 Ga0068871_101214269 3300006358 Bacteria 707
575 Ga0068871_101446739 3300006358 Bacteria 648
576 Ga0068871_101757230 3300006358 Bacteria 589
577 Ga0075428_100529609 3300006844 Bacteria 1260
578 Ga0075428_101653622 3300006844 Bacteria 669
579 Ga0075430_100023009 3300006846 Bacteria 5300
580 Ga0075434_100130115 3300006871 Bacteria 2535
581 Ga0075429_100008966 3300006880 Bacteria 8689
582 Ga0068865_100091831 3300006881 Bacteria 2204
583 Ga0068865_100097410 3300006881 Bacteria 2147
584 Ga0068865_100112935 3300006881 Bacteria 2007
585 Ga0068865_100367678 3300006881 Bacteria 1169
586 Ga0068865_100546026 3300006881 Bacteria 972
587 Ga0097620_100024424 3300006931 Bacteria 6063
588 Ga0097620_100030873 3300006931 Bacteria 5377
589 Ga0097620_100205485 3300006931 Bacteria 2054
590 Ga0097620_100420551 3300006931 Bacteria 1433
591 Ga0079104_1000040 3300006946 Bacteria 187962
592 Ga0079104_1044093 3300006946 Bacteria 1024
593 Ga0099826_10238378 3300006948 Bacteria 967
594 Ga0105251_10343262 3300009011 Bacteria 681
595 Ga0105244_10026422 3300009036 Bacteria 3142
596 Ga0105244_10480951 3300009036 Bacteria 571
597 Ga0105240_10002903 3300009093 Bacteria 27043
598 Ga0105240_10030212 3300009093 Bacteria 7045
599 Ga0105240_10039246 3300009093 Bacteria 6065
600 Ga0105240_10183372 3300009093 Bacteria 2468
601 Ga0105240_10221428 3300009093 Bacteria 2204
602 Ga0105240_10721263 3300009093 Bacteria 1086
603 Ga0111539_10492911 3300009094 Bacteria 1427
604 Ga0111539_10542458 3300009094 Bacteria 1355
605 Ga0111539_10867708 3300009094 Bacteria 1050
606 Ga0105245_10008631 3300009098 Bacteria 8888
607 Ga0105245_10049840 3300009098 Bacteria 3751
608 Ga0105245_10061364 3300009098 Bacteria 3388
609 Ga0105245_10293445 3300009098 Bacteria 1593
610 Ga0105245_11520681 3300009098 Bacteria 720
611 Ga0105245_12155683 3300009098 Bacteria 611
612 Ga0105247_10237932 3300009101 Bacteria 1239
613 Ga0105247_10253737 3300009101 Bacteria 1203
614 Ga0105247_10947597 3300009101 Bacteria 668
615 Ga0114129_10023973 3300009147 Bacteria 8647
616 Ga0114129_10267738 3300009147 Bacteria 2287
617 Ga0105243_10000197 3300009148 Bacteria 70941
618 Ga0105243_10008438 3300009148 Bacteria 7910
619 Ga0105243_10013128 3300009148 Bacteria 6260
620 Ga0105243_10083870 3300009148 Bacteria 2608
621 Ga0105243_10312678 3300009148 Bacteria 1428
622 Ga0105243_10475551 3300009148 Bacteria 1178
623 Ga0105243_11079602 3300009148 Bacteria 810
624 Ga0105243_11459518 3300009148 Bacteria 706
625 Ga0105243_12658700 3300009148 Bacteria 540
626 Ga0105241_10086637 3300009174 Bacteria 2463
627 Ga0105241_10191455 3300009174 Bacteria 1703
628 Ga0105241_10669885 3300009174 Bacteria 944
629 Ga0105241_11599311 3300009174 Bacteria 630
630 Ga0105241_11902796 3300009174 Bacteria 583
631 Ga0105242_10058974 3300009176 Bacteria 3148
632 Ga0105242_10282573 3300009176 Bacteria 1508
633 Ga0105242_10339727 3300009176 Bacteria 1383
634 Ga0105242_11759390 3300009176 Bacteria 657
635 Ga0105242_12123191 3300009176 Bacteria 606
636 Ga0105248_10013699 3300009177 Bacteria 8926
637 Ga0105248_10031936 3300009177 Bacteria 5884
638 Ga0105248_10285735 3300009177 Bacteria 1857
639 Ga0105248_10446577 3300009177 Bacteria 1457
640 Ga0105248_10459956 3300009177 Bacteria 1434
641 Ga0105248_10754462 3300009177 Bacteria 1098
642 Ga0105248_10989899 3300009177 Bacteria 950
643 Ga0105248_11718831 3300009177 Bacteria 711
644 Ga0105248_11948689 3300009177 Bacteria 667
645 Ga0105237_10000605 3300009545 Bacteria 50037
646 Ga0105237_10014977 3300009545 Bacteria 8082
647 Ga0105237_10021204 3300009545 Bacteria 6682
648 Ga0105237_10024647 3300009545 Bacteria 6153
649 Ga0105237_10035003 3300009545 Bacteria 5082
650 Ga0105237_10073055 3300009545 Bacteria 3423
651 Ga0105237_10452160 3300009545 Bacteria 1290
652 Ga0105238_10001575 3300009551 Bacteria 22864
653 Ga0105238_10028942 3300009551 Bacteria 5642
654 Ga0105238_10307061 3300009551 Bacteria 1571
655 Ga0105238_10378039 3300009551 Bacteria 1407
656 Ga0105238_10393781 3300009551 Bacteria 1378
657 Ga0105238_10483868 3300009551 Bacteria 1237
658 Ga0105238_10898267 3300009551 Bacteria 904
659 Ga0105249_10138150 3300009553 Bacteria 2334
660 Ga0105249_10394623 3300009553 Bacteria 1413
661 Ga0105249_10755732 3300009553 Bacteria 1034
662 Ga0105249_10957132 3300009553 Bacteria 924
663 Ga0105249_10978956 3300009553 Bacteria 914
664 Ga0105249_12241215 3300009553 Bacteria 619
665 Ga0105239_10000328 3300010375 Bacteria 70165
666 Ga0105239_10026320 3300010375 Bacteria 6401
667 Ga0105239_10031452 3300010375 Bacteria 5836
668 Ga0105239_10114097 3300010375 Bacteria 2997
669 Ga0105239_11237406 3300010375 Bacteria 861
670 Ga0105246_10153471 3300011119 Bacteria 1746
671 Ga0105246_10439382 3300011119 Bacteria 1094
672 Ga0105246_10458010 3300011119 Bacteria 1073
673 Ga0105246_10616419 3300011119 Bacteria 940
674 Ga0105246_11820562 3300011119 Bacteria 582
675 Ga0105246_12419946 3300011119 Bacteria 515
676 Ga0157317_1005765 3300012475 Bacteria 846
677 Ga0157328_1027883 3300012478 Bacteria 518
678 Ga0157337_1031094 3300012483 Bacteria 547
679 Ga0157325_1015900 3300012485 Bacteria 620
680 Ga0157329_1014777 3300012491 Bacteria 667
681 Ga0157323_1004876 3300012495 Bacteria 877
682 Ga0157314_1005685 3300012500 Bacteria 954
683 Ga0157315_1034929 3300012508 Bacteria 610
684 Ga0157316_1005909 3300012510 Bacteria 985
685 Ga0157327_1046621 3300012512 Bacteria 602
686 Ga0157338_1059789 3300012515 Bacteria 569
687 Ga0157373_10009706 3300013100 Bacteria 7104
688 Ga0157373_10020413 3300013100 Bacteria 4815
689 Ga0157373_10213609 3300013100 Bacteria 1360
690 Ga0157373_10329462 3300013100 Bacteria 1087
691 Ga0157373_10371991 3300013100 Bacteria 1021
692 Ga0157373_11023067 3300013100 Bacteria 617
693 Ga0157373_11092864 3300013100 Bacteria 598
694 Ga0157371_10034557 3300013102 Bacteria 3626
695 Ga0157371_10094994 3300013102 Bacteria 2113
696 Ga0157371_10095280 3300013102 Bacteria 2109
697 Ga0157371_10907224 3300013102 Bacteria 668
698 Ga0157371_11150079 3300013102 Bacteria 597
699 Ga0157371_11595439 3300013102 Bacteria 511
700 Ga0157370_10026238 3300013104 Bacteria 5756
701 Ga0157370_10233816 3300013104 Bacteria 1701
702 Ga0157370_10653068 3300013104 Bacteria 961
703 Ga0157370_11467787 3300013104 Bacteria 613
704 Ga0157370_11660903 3300013104 Bacteria 574
705 Ga0157370_11811047 3300013104 Bacteria 548
706 Ga0157370_12092579 3300013104 Bacteria 507
707 Ga0157369_10014064 3300013105 Bacteria 9040
708 Ga0157369_10014312 3300013105 Bacteria 8961
709 Ga0157369_10298892 3300013105 Bacteria 1675
710 Ga0157369_10957638 3300013105 Bacteria 877
711 Ga0157374_10007375 3300013296 Bacteria 9379
712 Ga0157374_10047442 3300013296 Bacteria 3983
713 Ga0157374_10074924 3300013296 Bacteria 3197
714 Ga0157374_10202503 3300013296 Bacteria 1944
715 Ga0157374_10765796 3300013296 Bacteria 980
716 Ga0157374_10994380 3300013296 Bacteria 858
717 Ga0157374_11476736 3300013296 Bacteria 703
718 Ga0157374_12492433 3300013296 Bacteria 545
719 Ga0157378_10113037 3300013297 Bacteria 2492
720 Ga0157378_10138443 3300013297 Bacteria 2259
721 Ga0157378_10754387 3300013297 Bacteria 996
722 Ga0157378_11027931 3300013297 Bacteria 859
723 Ga0157378_11150283 3300013297 Bacteria 814
724 Ga0157378_11505132 3300013297 Bacteria 718
725 Ga0163162_10023275 3300013306 Bacteria 6113
726 Ga0163162_10060967 3300013306 Bacteria 3810
727 Ga0163162_10080866 3300013306 Bacteria 3319
728 Ga0163162_10128822 3300013306 Bacteria 2638
729 Ga0163162_10218886 3300013306 Bacteria 2034
730 Ga0163162_10696994 3300013306 Bacteria 1137
731 Ga0163162_10816582 3300013306 Bacteria 1049
732 Ga0163162_11052362 3300013306 Bacteria 921
733 Ga0163162_11054926 3300013306 Bacteria 920
734 Ga0163162_11324107 3300013306 Bacteria 819
735 Ga0163162_11989478 3300013306 Bacteria 666
736 Ga0163162_12242593 3300013306 Bacteria 627
737 Ga0163162_12253968 3300013306 Bacteria 625
738 Ga0163162_12395248 3300013306 Bacteria 607
739 Ga0157372_10005958 3300013307 Bacteria 12960
740 Ga0157372_10010263 3300013307 Bacteria 9948
741 Ga0157372_10059208 3300013307 Bacteria 4283
742 Ga0157372_10502453 3300013307 Bacteria 1414
743 Ga0157372_10507343 3300013307 Bacteria 1406
744 Ga0157372_11772534 3300013307 Bacteria 710
745 Ga0157372_11943755 3300013307 Bacteria 676
746 Ga0157375_10024076 3300013308 Bacteria 5629
747 Ga0157375_10044133 3300013308 Bacteria 4328
748 Ga0157375_10165940 3300013308 Bacteria 2353
749 Ga0157375_10220885 3300013308 Bacteria 2053
750 Ga0157375_10543308 3300013308 Bacteria 1324
751 Ga0157375_11008528 3300013308 Bacteria 972
752 Ga0157375_11096261 3300013308 Bacteria 932
753 Ga0157375_11410600 3300013308 Bacteria 821
754 Ga0157375_11918122 3300013308 Bacteria 703
755 Ga0157375_12704414 3300013308 Bacteria 593
756 Ga0157375_12882360 3300013308 Bacteria 575
757 Ga0157375_13344920 3300013308 Bacteria 534
758 Ga0163163_10220374 3300014325 Bacteria 1946
759 Ga0163163_10251732 3300014325 Bacteria 1817
760 Ga0163163_10394057 3300014325 Bacteria 1443
761 Ga0163163_10527368 3300014325 Bacteria 1243
762 Ga0163163_10767023 3300014325 Bacteria 1028
763 Ga0163163_10998768 3300014325 Bacteria 900
764 Ga0163163_11021015 3300014325 Bacteria 890
765 Ga0163163_11230600 3300014325 Bacteria 811
766 Ga0163163_11713957 3300014325 Bacteria 689
767 Ga0163163_12521296 3300014325 Bacteria 572
768 Ga0157380_10360353 3300014326 Bacteria 1364
769 Ga0157380_10607993 3300014326 Bacteria 1083
770 Ga0157380_10854464 3300014326 Bacteria 932
771 Ga0157380_11008816 3300014326 Bacteria 866
772 Ga0157380_11107608 3300014326 Bacteria 831
773 Ga0157380_11265346 3300014326 Bacteria 784
774 Ga0157380_11730149 3300014326 Bacteria 683
775 Ga0157380_12519827 3300014326 Bacteria 580
776 Ga0157380_12697823 3300014326 Bacteria 563
777 Ga0157380_13486133 3300014326 Bacteria 504
778 Ga0182008_10020420 3300014497 Bacteria 3411
779 Ga0182008_10096215 3300014497 Bacteria 1461
780 Ga0182008_10136468 3300014497 Bacteria 1225
781 Ga0182008_10383655 3300014497 Bacteria 751
782 Ga0157377_10000170 3300014745 Bacteria 38897
783 Ga0157377_10043830 3300014745 Bacteria 2492
784 Ga0157377_10165085 3300014745 Bacteria 1380
785 Ga0157377_10461045 3300014745 Bacteria 880
786 Ga0157379_10006124 3300014968 Bacteria 10355
787 Ga0157379_10018100 3300014968 Bacteria 6208
788 Ga0157379_10039682 3300014968 Bacteria 4201
789 Ga0157379_10082445 3300014968 Bacteria 2882
790 Ga0157379_10724686 3300014968 Bacteria 935
791 Ga0157379_11528669 3300014968 Bacteria 650
792 Ga0157376_10029275 3300014969 Bacteria 4387
793 Ga0157376_10128576 3300014969 Bacteria 2257
794 Ga0157376_10328604 3300014969 Bacteria 1456
795 Ga0157376_10334767 3300014969 Bacteria 1443
796 Ga0157376_10537979 3300014969 Bacteria 1154
797 Ga0157376_10998736 3300014969 Bacteria 859
798 Ga0157376_11986897 3300014969 Bacteria 619
799 Ga0157376_12879482 3300014969 Bacteria 521
800 Ga0157376_12881165 3300014969 Bacteria 521
801 Ga0182006_1051132 3300015261 Bacteria 1590
802 Ga0182006_1121441 3300015261 Bacteria 907
803 Ga0182006_1179085 3300015261 Bacteria 707
804 Ga0182006_1273992 3300015261 Bacteria 553
805 Ga0182007_10002567 3300015262 Bacteria 8943
806 Ga0182005_1017803 3300015265 Bacteria 1966
807 Ga0182005_1033460 3300015265 Bacteria 1398
808 Ga0182005_1120196 3300015265 Bacteria 747
809 Ga0183362_10001 3300015683 Bacteria 2046624
810 Ga0163161_10017494 3300017792 Bacteria 5016
811 Ga0163161_10144969 3300017792 Bacteria 1800
812 Ga0163161_10255007 3300017792 Bacteria 1368
813 Ga0163161_10325350 3300017792 Bacteria 1216
814 Ga0163161_10401696 3300017792 Bacteria 1099
815 Ga0163161_10443080 3300017792 Bacteria 1048
816 Ga0163161_10999557 3300017792 Bacteria 714
817 Ga0163161_11013310 3300017792 Bacteria 709
818 Ga0163161_11119543 3300017792 Bacteria 677
819 Ga0163161_11681147 3300017792 Bacteria 562
820 Ga0163161_11761836 3300017792 Bacteria 550
821 Ga0206353_11880330 3300020082 Bacteria 609
822 Ga0213876_10076899 3300021384 Bacteria 1763
823 Ga0213876_10358837 3300021384 Bacteria 775
824 Ga0209436_102722 3300025208 Bacteria 5093
825 Ga0209436_113640 3300025208 Bacteria 1320
826 Ga0209672_102060 3300025228 Bacteria 5470
827 Ga0209147_101677 3300025229 Bacteria 7269
828 Ga0209258_100078 3300025242 Bacteria 263996
829 Ga0207425_1000726 3300025245 Bacteria 17525
830 Ga0207425_1000881 3300025245 Bacteria 14608
831 Ga0207425_1002203 3300025245 Bacteria 7090
832 Ga0209148_1000086 3300025254 Bacteria 263996
833 Ga0209129_1000027 3300025258 Bacteria 409587
834 Ga0209129_1000054 3300025258 Bacteria 261997
835 Ga0209565_1000317 3300025263 Bacteria 44071
836 Ga0209565_1001263 3300025263 Bacteria 11754
837 Ga0209565_1015434 3300025263 Bacteria 1723
838 Ga0207666_1004468 3300025271 Bacteria 1758
839 Ga0209673_1000168 3300025273 Bacteria 135126
840 Ga0209673_1000355 3300025273 Bacteria 83197
841 Ga0209673_1005247 3300025273 Bacteria 6592
842 Ga0209673_1038095 3300025273 Bacteria 1404
843 Ga0209130_1000206 3300025284 Bacteria 79198
844 Ga0209130_1001172 3300025284 Bacteria 18829
845 Ga0209130_1035061 3300025284 Bacteria 1005
846 Ga0207673_1007194 3300025290 Bacteria 1391
847 Ga0207673_1042741 3300025290 Bacteria 637
848 Ga0209675_1000388 3300025291 Bacteria 36674
849 Ga0209675_1002561 3300025291 Bacteria 9228
850 Ga0209675_1004338 3300025291 Bacteria 6351
851 Ga0209675_1013516 3300025291 Bacteria 2545
852 Ga0209676_1000103 3300025292 Bacteria 226908
853 Ga0209676_1000290 3300025292 Bacteria 103000
854 Ga0209676_1005377 3300025292 Bacteria 6722
855 Ga0209025_1000201 3300025294 Bacteria 145890
856 Ga0209025_1019038 3300025294 Bacteria 3842
857 Ga0209564_1000014 3300025295 Bacteria 621501
858 Ga0209564_1000289 3300025295 Bacteria 101976
859 Ga0209564_1000408 3300025295 Bacteria 76528
860 Ga0209758_1000034 3300025297 Bacteria 467637
861 Ga0209758_1000193 3300025297 Bacteria 134744
862 Ga0209758_1000208 3300025297 Bacteria 128596
863 Ga0209758_1005547 3300025297 Bacteria 9627
864 Ga0209050_1000012 3300025298 Bacteria 813717
865 Ga0209050_1000416 3300025298 Bacteria 78976
866 Ga0209050_1001233 3300025298 Bacteria 29602
867 Ga0209050_1005046 3300025298 Bacteria 8546
868 Ga0209050_1008921 3300025298 Bacteria 5239
869 Ga0209050_1052859 3300025298 Bacteria 1014
870 Ga0209256_1000066 3300025299 Bacteria 247534
871 Ga0209256_1000092 3300025299 Bacteria 210547
872 Ga0209256_1001887 3300025299 Bacteria 19263
873 Ga0209256_1022736 3300025299 Bacteria 1891
874 Ga0209256_1036914 3300025299 Bacteria 1278
875 Ga0207426_1000067 3300025302 Bacteria 342108
876 Ga0207426_1000266 3300025302 Bacteria 109895
877 Ga0209051_1000019 3300025303 Bacteria 511268
878 Ga0209051_1000020 3300025303 Bacteria 508628
879 Ga0209051_1000141 3300025303 Bacteria 135837
880 Ga0209051_1000235 3300025303 Bacteria 92799
881 Ga0209051_1007019 3300025303 Bacteria 6238
882 Ga0209051_1054597 3300025303 Bacteria 1302
883 Ga0209257_1000024 3300025304 Bacteria 726068
884 Ga0209257_1000085 3300025304 Bacteria 291117
885 Ga0209257_1002015 3300025304 Bacteria 21717
886 Ga0209257_1014801 3300025304 Bacteria 3312
887 Ga0209257_1028057 3300025304 Bacteria 1860
888 Ga0209257_1110720 3300025304 Bacteria 655
889 Ga0207697_10046050 3300025315 Bacteria 1796
890 Ga0207697_10146000 3300025315 Bacteria 1028
891 Ga0207697_10350704 3300025315 Bacteria 655
892 Ga0207697_10418582 3300025315 Bacteria 595
893 Ga0207656_10019106 3300025321 Bacteria 2708
894 Ga0207656_10054086 3300025321 Bacteria 1744
895 Ga0207656_10071784 3300025321 Bacteria 1540
896 Ga0207656_10078424 3300025321 Bacteria 1480
897 Ga0207656_10093435 3300025321 Bacteria 1369
898 Ga0207656_10302931 3300025321 Bacteria 791
899 Ga0207656_10410776 3300025321 Bacteria 681
900 Ga0207656_10415708 3300025321 Bacteria 677
901 Ga0207682_10002310 3300025893 Bacteria 8592
902 Ga0207682_10008487 3300025893 Bacteria 4061
903 Ga0207682_10026248 3300025893 Bacteria 2315
904 Ga0207682_10120596 3300025893 Bacteria 1163
905 Ga0207682_10200063 3300025893 Bacteria 918
906 Ga0207682_10397213 3300025893 Bacteria 651
907 Ga0207682_10616884 3300025893 Bacteria 511
908 Ga0207692_10443623 3300025898 Bacteria 816
909 Ga0207642_10006194 3300025899 Bacteria 3963
910 Ga0207642_10008862 3300025899 Bacteria 3476
911 Ga0207642_10210723 3300025899 Bacteria 1079
912 Ga0207710_10236509 3300025900 Bacteria 910
913 Ga0207688_10009912 3300025901 Bacteria 5186
914 Ga0207688_10264029 3300025901 Bacteria 1046
915 Ga0207688_10279028 3300025901 Bacteria 1018
916 Ga0207680_10002216 3300025903 Bacteria 9082
917 Ga0207680_10002264 3300025903 Bacteria 8971
918 Ga0207680_10270354 3300025903 Bacteria 1179
919 Ga0207680_10358265 3300025903 Bacteria 1025
920 Ga0207680_10474754 3300025903 Bacteria 889
921 Ga0207680_10895762 3300025903 Bacteria 636
922 Ga0207680_10945479 3300025903 Bacteria 618
923 Ga0207647_10221382 3300025904 Bacteria 1091
924 Ga0207685_10025303 3300025905 Bacteria 2047
925 Ga0207645_10003401 3300025907 Bacteria 12101
926 Ga0207645_10026486 3300025907 Bacteria 3746
927 Ga0207645_10046517 3300025907 Bacteria 2772
928 Ga0207645_10102536 3300025907 Bacteria 1847
929 Ga0207645_10207117 3300025907 Bacteria 1291
930 Ga0207645_10231411 3300025907 Bacteria 1220
931 Ga0207645_10313915 3300025907 Bacteria 1045
932 Ga0207643_10062542 3300025908 Bacteria 2127
933 Ga0207643_10173555 3300025908 Bacteria 1302
934 Ga0207643_10379750 3300025908 Bacteria 891
935 Ga0207643_10581104 3300025908 Bacteria 720
936 Ga0207643_10883314 3300025908 Bacteria 579
937 Ga0207705_10033984 3300025909 Bacteria 3645
938 Ga0207705_10276873 3300025909 Bacteria 1284
939 Ga0207705_10609256 3300025909 Bacteria 849
940 Ga0207705_10673759 3300025909 Bacteria 804
941 Ga0207705_11448229 3300025909 Bacteria 521
942 Ga0207684_10005949 3300025910 Bacteria 11169
943 Ga0207684_10071919 3300025910 Bacteria 2938
944 Ga0207654_10082391 3300025911 Bacteria 1940
945 Ga0207654_10736192 3300025911 Bacteria 710
946 Ga0207707_10174846 3300025912 Bacteria 1876
947 Ga0207707_10425784 3300025912 Bacteria 1137
948 Ga0207695_10002543 3300025913 Bacteria 26790
949 Ga0207695_10032900 3300025913 Bacteria 5667
950 Ga0207695_10061905 3300025913 Bacteria 3866
951 Ga0207695_10088943 3300025913 Bacteria 3107
952 Ga0207695_10218048 3300025913 Bacteria 1816
953 Ga0207695_10638987 3300025913 Bacteria 945
954 Ga0207671_10006429 3300025914 Bacteria 10462
955 Ga0207671_10010328 3300025914 Bacteria 7713
956 Ga0207671_10022402 3300025914 Bacteria 4778
957 Ga0207671_10035144 3300025914 Bacteria 3721
958 Ga0207671_10499298 3300025914 Bacteria 970
959 Ga0207671_10610822 3300025914 Bacteria 869
960 Ga0207671_10997043 3300025914 Bacteria 660
961 Ga0207660_10141322 3300025917 Bacteria 1841
962 Ga0207660_10458070 3300025917 Bacteria 1032
963 Ga0207662_10052728 3300025918 Bacteria 2421
964 Ga0207662_10434229 3300025918 Bacteria 896
965 Ga0207662_10449027 3300025918 Bacteria 881
966 Ga0207662_11227200 3300025918 Bacteria 533
967 Ga0207657_10002308 3300025919 Bacteria 20679
968 Ga0207657_10015804 3300025919 Bacteria 7296
969 Ga0207657_10224482 3300025919 Bacteria 1504
970 Ga0207657_11352505 3300025919 Bacteria 536
971 Ga0207649_10012057 3300025920 Bacteria 4783
972 Ga0207649_10019732 3300025920 Bacteria 3858
973 Ga0207649_10626611 3300025920 Bacteria 829
974 Ga0207649_10715711 3300025920 Bacteria 777
975 Ga0207652_10081244 3300025921 Bacteria 2835
976 Ga0207652_10197585 3300025921 Bacteria 1810
977 Ga0207652_10446683 3300025921 Bacteria 1166
978 Ga0207646_10033392 3300025922 Bacteria 4656
979 Ga0207681_10000795 3300025923 Bacteria 20798
980 Ga0207681_10017788 3300025923 Bacteria 4469
981 Ga0207681_10084282 3300025923 Bacteria 2252
982 Ga0207681_10084985 3300025923 Bacteria 2244
983 Ga0207681_10098706 3300025923 Bacteria 2101
984 Ga0207681_10527279 3300025923 Bacteria 970
985 Ga0207681_10586239 3300025923 Bacteria 920
986 Ga0207694_10004060 3300025924 Bacteria 11503
987 Ga0207694_10029043 3300025924 Bacteria 4217
988 Ga0207694_10213474 3300025924 Bacteria 1572
989 Ga0207694_10336316 3300025924 Bacteria 1248
990 Ga0207694_10357825 3300025924 Bacteria 1209
991 Ga0207694_10446452 3300025924 Bacteria 1079
992 Ga0207650_10002550 3300025925 Bacteria 12629
993 Ga0207650_10004501 3300025925 Bacteria 9532
994 Ga0207650_10014903 3300025925 Bacteria 5408
995 Ga0207650_10131086 3300025925 Bacteria 1961
996 Ga0207650_10209144 3300025925 Bacteria 1566
997 Ga0207650_10373972 3300025925 Bacteria 1176
998 Ga0207650_10410273 3300025925 Bacteria 1122
999 Ga0207650_11159414 3300025925 Bacteria 658
1000 Ga0207650_11297563 3300025925 Bacteria 620
1001 Ga0207659_10013398 3300025926 Bacteria 5249
1002 Ga0207659_10020083 3300025926 Bacteria 4408
1003 Ga0207659_10032887 3300025926 Bacteria 3563
1004 Ga0207659_10037282 3300025926 Bacteria 3374
1005 Ga0207659_10201000 3300025926 Bacteria 1592
1006 Ga0207659_10228388 3300025926 Bacteria 1500
1007 Ga0207659_10344347 3300025926 Bacteria 1235
1008 Ga0207659_10657623 3300025926 Bacteria 896
1009 Ga0207659_10917374 3300025926 Bacteria 753
1010 Ga0207659_10982537 3300025926 Bacteria 726
1011 Ga0207659_11119751 3300025926 Bacteria 677
1012 Ga0207687_11076475 3300025927 Bacteria 690
1013 Ga0207687_11099818 3300025927 Bacteria 683
1014 Ga0207664_10025828 3300025929 Bacteria 4431
1015 Ga0207644_10002048 3300025931 Bacteria 13051
1016 Ga0207644_10002949 3300025931 Bacteria 10959
1017 Ga0207644_10348255 3300025931 Bacteria 1202
1018 Ga0207644_10530117 3300025931 Bacteria 973
1019 Ga0207644_11180534 3300025931 Bacteria 643
1020 Ga0207644_11460616 3300025931 Bacteria 574
1021 Ga0207644_11659747 3300025931 Bacteria 536
1022 Ga0207690_10005174 3300025932 Bacteria 7694
1023 Ga0207690_10028785 3300025932 Bacteria 3524
1024 Ga0207690_10219101 3300025932 Bacteria 1455
1025 Ga0207690_11282417 3300025932 Bacteria 612
1026 Ga0207690_11301379 3300025932 Bacteria 607
1027 Ga0207690_11627988 3300025932 Bacteria 539
1028 Ga0207706_10014450 3300025933 Bacteria 7156
1029 Ga0207706_10032604 3300025933 Bacteria 4639
1030 Ga0207706_10208896 3300025933 Bacteria 1711
1031 Ga0207706_10265450 3300025933 Bacteria 1498
1032 Ga0207706_10445308 3300025933 Bacteria 1121
1033 Ga0207706_10474106 3300025933 Bacteria 1082
1034 Ga0207706_10616074 3300025933 Bacteria 931
1035 Ga0207706_10761981 3300025933 Bacteria 824
1036 Ga0207706_10886243 3300025933 Bacteria 754
1037 Ga0207706_11121191 3300025933 Bacteria 657
1038 Ga0207686_10046095 3300025934 Bacteria 2687
1039 Ga0207686_10047390 3300025934 Bacteria 2657
1040 Ga0207686_10131449 3300025934 Bacteria 1717
1041 Ga0207686_10249615 3300025934 Bacteria 1296
1042 Ga0207686_10289968 3300025934 Bacteria 1211
1043 Ga0207709_10000383 3300025935 Bacteria 43985
1044 Ga0207709_10001296 3300025935 Bacteria 17820
1045 Ga0207709_10030033 3300025935 Bacteria 3158
1046 Ga0207709_10858658 3300025935 Bacteria 736
1047 Ga0207709_10929598 3300025935 Bacteria 708
1048 Ga0207709_11292534 3300025935 Bacteria 603
1049 Ga0207670_10030732 3300025936 Bacteria 3433
1050 Ga0207670_10933017 3300025936 Bacteria 728
1051 Ga0207669_10041654 3300025937 Bacteria 2675
1052 Ga0207669_10935431 3300025937 Bacteria 726
1053 Ga0207669_11398536 3300025937 Bacteria 596
1054 Ga0207669_11432381 3300025937 Bacteria 588
1055 Ga0207669_11727593 3300025937 Bacteria 534
1056 Ga0207704_10243329 3300025938 Bacteria 1346
1057 Ga0207704_10330831 3300025938 Bacteria 1179
1058 Ga0207704_10860243 3300025938 Bacteria 760
1059 Ga0207704_11003114 3300025938 Bacteria 706
1060 Ga0207704_11184036 3300025938 Bacteria 651
1061 Ga0207665_10109570 3300025939 Bacteria 1938
1062 Ga0207691_10005390 3300025940 Bacteria 12350
1063 Ga0207691_10007761 3300025940 Bacteria 10333
1064 Ga0207691_10012093 3300025940 Bacteria 8276
1065 Ga0207691_10026402 3300025940 Bacteria 5449
1066 Ga0207691_10057886 3300025940 Bacteria 3526
1067 Ga0207691_10058275 3300025940 Bacteria 3513
1068 Ga0207691_10109518 3300025940 Bacteria 2457
1069 Ga0207691_10131930 3300025940 Bacteria 2206
1070 Ga0207691_10219778 3300025940 Bacteria 1648
1071 Ga0207691_10261767 3300025940 Bacteria 1491
1072 Ga0207691_10418523 3300025940 Bacteria 1142
1073 Ga0207691_10538352 3300025940 Bacteria 991
1074 Ga0207691_10713981 3300025940 Bacteria 845
1075 Ga0207711_10012457 3300025941 Bacteria 7068
1076 Ga0207711_10067509 3300025941 Bacteria 3096
1077 Ga0207711_10126201 3300025941 Bacteria 2289
1078 Ga0207711_10481256 3300025941 Bacteria 1156
1079 Ga0207711_10849956 3300025941 Bacteria 849
1080 Ga0207711_10968069 3300025941 Bacteria 790
1081 Ga0207711_11137038 3300025941 Bacteria 722
1082 Ga0207711_11974308 3300025941 Bacteria 526
1083 Ga0207689_10003512 3300025942 Bacteria 14319
1084 Ga0207689_10004908 3300025942 Bacteria 12049
1085 Ga0207689_10050658 3300025942 Bacteria 3423
1086 Ga0207689_10075589 3300025942 Bacteria 2769
1087 Ga0207689_10102173 3300025942 Bacteria 2355
1088 Ga0207689_10404359 3300025942 Bacteria 1138
1089 Ga0207689_11273389 3300025942 Bacteria 618
1090 Ga0207661_10191726 3300025944 Bacteria 1792
1091 Ga0207679_10004109 3300025945 Bacteria 9035
1092 Ga0207679_10011721 3300025945 Bacteria 5692
1093 Ga0207679_10014481 3300025945 Bacteria 5189
1094 Ga0207679_10053631 3300025945 Bacteria 2964
1095 Ga0207679_10061091 3300025945 Bacteria 2804
1096 Ga0207679_10417878 3300025945 Bacteria 1183
1097 Ga0207679_10613967 3300025945 Bacteria 981
1098 Ga0207679_10749071 3300025945 Bacteria 888
1099 Ga0207679_11674927 3300025945 Bacteria 582
1100 Ga0207667_10002655 3300025949 Bacteria 22096
1101 Ga0207667_10009860 3300025949 Bacteria 11213
1102 Ga0207667_10214430 3300025949 Bacteria 1973
1103 Ga0207667_10586071 3300025949 Bacteria 1125
1104 Ga0207651_10025563 3300025960 Bacteria 3672
1105 Ga0207651_10060152 3300025960 Bacteria 2635
1106 Ga0207651_10093139 3300025960 Bacteria 2212
1107 Ga0207651_10541167 3300025960 Bacteria 1011
1108 Ga0207651_10622978 3300025960 Bacteria 945
1109 Ga0207651_10722735 3300025960 Bacteria 879
1110 Ga0207651_11591610 3300025960 Bacteria 588
1111 Ga0207651_11774164 3300025960 Bacteria 555
1112 Ga0207712_10054882 3300025961 Bacteria 2800
1113 Ga0207712_10598083 3300025961 Bacteria 954
1114 Ga0207712_10600466 3300025961 Bacteria 952
1115 Ga0207712_10939869 3300025961 Bacteria 765
1116 Ga0207668_10017712 3300025972 Bacteria 4469
1117 Ga0207668_10633512 3300025972 Bacteria 934
1118 Ga0207668_10907040 3300025972 Bacteria 784
1119 Ga0207668_11450775 3300025972 Bacteria 619
1120 Ga0207640_10025789 3300025981 Bacteria 3562
1121 Ga0207640_10140289 3300025981 Bacteria 1761
1122 Ga0207640_10229824 3300025981 Bacteria 1426
1123 Ga0207640_10449149 3300025981 Bacteria 1062
1124 Ga0207640_10487586 3300025981 Bacteria 1024
1125 Ga0207640_10500017 3300025981 Bacteria 1012
1126 Ga0207640_10545529 3300025981 Bacteria 973
1127 Ga0207640_10711722 3300025981 Bacteria 862
1128 Ga0207658_10001151 3300025986 Bacteria 21193
1129 Ga0207658_10005593 3300025986 Bacteria 8597
1130 Ga0207658_10114940 3300025986 Bacteria 2135
1131 Ga0207658_10146914 3300025986 Bacteria 1916
1132 Ga0207658_10146925 3300025986 Bacteria 1916
1133 Ga0207658_10171038 3300025986 Bacteria 1790
1134 Ga0207658_10360032 3300025986 Bacteria 1269
1135 Ga0207658_10671075 3300025986 Bacteria 935
1136 Ga0207658_10965157 3300025986 Bacteria 777
1137 Ga0207658_11447551 3300025986 Bacteria 628
1138 Ga0207677_10000452 3300026023 Bacteria 27626
1139 Ga0207677_10037654 3300026023 Bacteria 3163
1140 Ga0207677_10381138 3300026023 Bacteria 1190
1141 Ga0207677_10482308 3300026023 Bacteria 1068
1142 Ga0207677_10932485 3300026023 Bacteria 784
1143 Ga0207677_12038880 3300026023 Bacteria 533
1144 Ga0207703_10003262 3300026035 Bacteria 13624
1145 Ga0207703_10007044 3300026035 Bacteria 8945
1146 Ga0207703_10121427 3300026035 Bacteria 2243
1147 Ga0207703_10413074 3300026035 Bacteria 1254
1148 Ga0207639_10005439 3300026041 Bacteria 8600
1149 Ga0207639_10025544 3300026041 Bacteria 4283
1150 Ga0207639_10117049 3300026041 Bacteria 2183
1151 Ga0207639_10190198 3300026041 Bacteria 1753
1152 Ga0207639_10248274 3300026041 Bacteria 1551
1153 Ga0207639_10354566 3300026041 Bacteria 1311
1154 Ga0207639_10634407 3300026041 Bacteria 987
1155 Ga0207639_11608274 3300026041 Bacteria 609
1156 Ga0207639_12256148 3300026041 Bacteria 506
1157 Ga0207678_10002363 3300026067 Bacteria 17106
1158 Ga0207678_10098740 3300026067 Bacteria 2494
1159 Ga0207678_10305127 3300026067 Bacteria 1368
1160 Ga0207678_10831301 3300026067 Bacteria 816
1161 Ga0207678_10968874 3300026067 Bacteria 753
1162 Ga0207678_11193875 3300026067 Bacteria 674
1163 Ga0207708_10064706 3300026075 Bacteria 2794
1164 Ga0207708_10458336 3300026075 Bacteria 1063
1165 Ga0207702_10044080 3300026078 Bacteria 3748
1166 Ga0207702_10182928 3300026078 Bacteria 1931
1167 Ga0207702_10578685 3300026078 Bacteria 1100
1168 Ga0207702_12211938 3300026078 Bacteria 539
1169 Ga0207641_10013179 3300026088 Bacteria 6778
1170 Ga0207641_10026325 3300026088 Bacteria 4799
1171 Ga0207641_10038644 3300026088 Bacteria 3990
1172 Ga0207641_10167453 3300026088 Bacteria 2003
1173 Ga0207641_10429589 3300026088 Bacteria 1273
1174 Ga0207641_10494108 3300026088 Bacteria 1187
1175 Ga0207641_11613931 3300026088 Bacteria 650
1176 Ga0207648_10000748 3300026089 Bacteria 36506
1177 Ga0207648_10004891 3300026089 Bacteria 13654
1178 Ga0207648_10009156 3300026089 Bacteria 9513
1179 Ga0207648_10015290 3300026089 Bacteria 7061
1180 Ga0207648_10018447 3300026089 Bacteria 6317
1181 Ga0207648_10153113 3300026089 Bacteria 2035
1182 Ga0207648_10159491 3300026089 Bacteria 1992
1183 Ga0207648_10308103 3300026089 Bacteria 1421
1184 Ga0207648_10503985 3300026089 Bacteria 1108
1185 Ga0207648_10877779 3300026089 Bacteria 837
1186 Ga0207648_10996400 3300026089 Bacteria 785
1187 Ga0207648_11329572 3300026089 Bacteria 675
1188 Ga0207648_11568146 3300026089 Bacteria 619
1189 Ga0207676_10012508 3300026095 Bacteria 6084
1190 Ga0207676_10042218 3300026095 Bacteria 3506
1191 Ga0207676_10052796 3300026095 Bacteria 3179
1192 Ga0207676_10149898 3300026095 Bacteria 2007
1193 Ga0207676_10163884 3300026095 Bacteria 1929
1194 Ga0207676_10873679 3300026095 Bacteria 880
1195 Ga0207676_12560108 3300026095 Bacteria 507
1196 Ga0207674_10000040 3300026116 Bacteria 130571
1197 Ga0207674_10009428 3300026116 Bacteria 11151
1198 Ga0207674_10078389 3300026116 Bacteria 3309
1199 Ga0207674_10082081 3300026116 Bacteria 3225
1200 Ga0207674_10253170 3300026116 Bacteria 1708
1201 Ga0207674_10773161 3300026116 Bacteria 927
1202 Ga0207674_10871479 3300026116 Bacteria 868
1203 Ga0207674_11484866 3300026116 Bacteria 647
1204 Ga0207674_11607913 3300026116 Bacteria 618
1205 Ga0207675_100003386 3300026118 Bacteria 15580
1206 Ga0207675_100005550 3300026118 Bacteria 12070
1207 Ga0207675_100059119 3300026118 Bacteria 3577
1208 Ga0207675_100100746 3300026118 Bacteria 2721
1209 Ga0207675_100731231 3300026118 Bacteria 1000
1210 Ga0207675_100812892 3300026118 Bacteria 948
1211 Ga0207683_10008569 3300026121 Bacteria 8752
1212 Ga0207683_10037960 3300026121 Bacteria 4195
1213 Ga0207683_10064870 3300026121 Bacteria 3219
1214 Ga0207683_10089863 3300026121 Bacteria 2734
1215 Ga0207683_10116457 3300026121 Bacteria 2396
1216 Ga0207683_10145705 3300026121 Bacteria 2135
1217 Ga0207683_10278749 3300026121 Bacteria 1528
1218 Ga0207683_10307655 3300026121 Bacteria 1450
1219 Ga0207683_10410972 3300026121 Bacteria 1246
1220 Ga0207683_10548197 3300026121 Bacteria 1069
1221 Ga0207683_10574489 3300026121 Bacteria 1043
1222 Ga0207683_10632075 3300026121 Bacteria 991
1223 Ga0207683_11151674 3300026121 Bacteria 719
1224 Ga0207683_12101076 3300026121 Bacteria 513
1225 Ga0207698_10005011 3300026142 Bacteria 8123
1226 Ga0207698_10011131 3300026142 Bacteria 5817
1227 Ga0207698_10115704 3300026142 Bacteria 2258
1228 Ga0207698_10445721 3300026142 Bacteria 1248
1229 Ga0207698_10672177 3300026142 Bacteria 1028
1230 Ga0207698_10688459 3300026142 Bacteria 1016
1231 Ga0207698_10787371 3300026142 Bacteria 952
1232 Ga0207698_10798694 3300026142 Bacteria 946
1233 Ga0207698_10994822 3300026142 Bacteria 849
1234 Ga0207698_11031752 3300026142 Bacteria 834
1235 Ga0207698_11308235 3300026142 Bacteria 740
1236 Ga0207698_11328955 3300026142 Bacteria 734
1237 Ga0207698_12659290 3300026142 Bacteria 509
1238 Ga0207698_12698549 3300026142 Bacteria 505
1239 Ga0209281_1000074 3300027111 Bacteria 267848
1240 Ga0209969_1012477 3300027360 Bacteria 1226
1241 Ga0209981_1004500 3300027378 Bacteria 1831
1242 Ga0209996_1002081 3300027395 Bacteria 2467
1243 Ga0209995_1016563 3300027471 Bacteria 1211
1244 Ga0209995_1064430 3300027471 Bacteria 625
1245 Ga0209968_1000140 3300027526 Bacteria 12794
1246 Ga0209999_1004899 3300027543 Bacteria 2407
1247 Ga0210002_1106826 3300027617 Bacteria 508
1248 Ga0209966_1000388 3300027695 Bacteria 13148
1249 Ga0209813_10061166 3300027866 Bacteria 1202
1250 Ga0209974_10006661 3300027876 Bacteria 4017
1251 Ga0209974_10034713 3300027876 Bacteria 1675
1252 Ga0209974_10284711 3300027876 Bacteria 629
1253 Ga0207428_10621197 3300027907 Bacteria 777
1254 Ga0207428_10876374 3300027907 Bacteria 635
1255 Ga0268266_10037082 3300028379 Bacteria 4153
1256 Ga0268266_11230998 3300028379 Bacteria 724
1257 Ga0268266_11705868 3300028379 Bacteria 605
1258 Ga0268265_10098075 3300028380 Bacteria 2359
1259 Ga0268265_10121264 3300028380 Bacteria 2154
1260 Ga0268265_10914139 3300028380 Bacteria 862
1261 Ga0268264_10003378 3300028381 Bacteria 13783
1262 Ga0268264_10003920 3300028381 Bacteria 12743
1263 Ga0268264_10141634 3300028381 Bacteria 2145
1264 Ga0268264_10672979 3300028381 Bacteria 1026
1265 Ga0268264_11168625 3300028381 Bacteria 779
1266 Ga0268264_11655308 3300028381 Bacteria 650
1267 Ga0268264_12694867 3300028381 Bacteria 501
1268 Ga0265323_10180575 3300028653 Bacteria 668
1269 Ga0307517_10005592 3300028786 Bacteria 18878
1270 Ga0307517_10193402 3300028786 Bacteria 1286
1271 Ga0307517_10222524 3300028786 Bacteria 1145
1272 Ga0307517_10569249 3300028786 Bacteria 563
1273 Ga0307515_10000165 3300028794 Bacteria 162589
1274 Ga0307515_10000232 3300028794 Bacteria 137778
1275 Ga0307515_10000716 3300028794 Bacteria 76332
1276 Ga0307515_10009711 3300028794 Bacteria 18549
1277 Ga0307515_10029175 3300028794 Bacteria 9340
1278 Ga0307515_10069456 3300028794 Bacteria 4815
1279 Ga0307515_10100821 3300028794 Bacteria 3492
1280 Ga0307515_10280252 3300028794 Bacteria 1375
1281 Ga0307515_10524851 3300028794 Bacteria 794
1282 Ga0265324_10000007 3300029957 Bacteria 264024
1283 Ga0307512_10125965 3300030522 Bacteria 1626
1284 Ga0307512_10310690 3300030522 Bacteria 725
1285 Ga0314311_1161279 3300030733 Bacteria 5559
1286 Ga0316179_1013512 3300030734 Bacteria 6580
1287 Ga0316178_1081817 3300030735 Bacteria 4049
1288 Ga0316180_1033826 3300030736 Bacteria 1837
1289 Ga0316183_1096459 3300030742 Bacteria 1261
1290 Ga0316181_1169024 3300030744 Bacteria 4022
1291 Ga0316182_1190268 3300030745 Bacteria 2981
1292 Ga0316182_1435093 3300030745 Bacteria 562
1293 Ga0265328_10004603 3300031239 Bacteria 5974
1294 Ga0265328_10270814 3300031239 Bacteria 652
1295 Ga0265331_10002534 3300031250 Bacteria 12300
1296 Ga0265331_10165768 3300031250 Bacteria 1000
1297 Ga0265327_10000028 3300031251 Bacteria 361066
1298 Ga0265327_10005919 3300031251 Bacteria 9987
1299 Ga0265327_10256515 3300031251 Bacteria 777
1300 Ga0265316_10000181 3300031344 Bacteria 71764
1301 Ga0265316_10040823 3300031344 Bacteria 3718
1302 Ga0265316_10175648 3300031344 Bacteria 1596
1303 Ga0307513_10020857 3300031456 Bacteria 7755
1304 Ga0307513_10198447 3300031456 Bacteria 1850
1305 Ga0307513_10223635 3300031456 Bacteria 1701
1306 Ga0307513_10336433 3300031456 Bacteria 1262
1307 Ga0307513_10382862 3300031456 Bacteria 1146
1308 Ga0307513_10392021 3300031456 Bacteria 1125
1309 Ga0307513_10757889 3300031456 Bacteria 676
1310 Ga0307509_10047896 3300031507 Bacteria 4595
1311 Ga0307509_10070806 3300031507 Bacteria 3640
1312 Ga0307509_10166102 3300031507 Bacteria 2095
1313 Ga0307509_10255000 3300031507 Bacteria 1534
1314 Ga0307509_10258468 3300031507 Bacteria 1519
1315 Ga0307509_10388258 3300031507 Bacteria 1107
1316 Ga0307408_100000160 3300031548 Bacteria 74342
1317 Ga0307408_100034418 3300031548 Bacteria 3549
1318 Ga0307408_100045283 3300031548 Bacteria 3141
1319 Ga0307408_100158236 3300031548 Bacteria 1796
1320 Ga0307408_100166791 3300031548 Bacteria 1755
1321 Ga0307408_100202535 3300031548 Bacteria 1607
1322 Ga0307408_100550048 3300031548 Bacteria 1018
1323 Ga0307408_101009952 3300031548 Bacteria 767
1324 Ga0307408_101237660 3300031548 Bacteria 697
1325 Ga0307408_101609315 3300031548 Bacteria 617
1326 Ga0307408_101710987 3300031548 Bacteria 599
1327 Ga0307408_102394828 3300031548 Bacteria 512
1328 Ga0307508_10000016 3300031616 Bacteria 206976
1329 Ga0307508_10001467 3300031616 Bacteria 26444
1330 Ga0307508_10052609 3300031616 Bacteria 3615
1331 Ga0307508_10538212 3300031616 Bacteria 765
1332 Ga0307508_10576065 3300031616 Bacteria 725
1333 Ga0307514_10037190 3300031649 Bacteria 3862
1334 Ga0307514_10375139 3300031649 Bacteria 742
1335 Ga0307516_10004400 3300031730 Bacteria 17413
1336 Ga0307516_10035476 3300031730 Bacteria 5004
1337 Ga0307516_10058975 3300031730 Bacteria 3734
1338 Ga0307516_10128425 3300031730 Bacteria 2317
1339 Ga0307516_10356786 3300031730 Bacteria 1127
1340 Ga0307516_10363028 3300031730 Bacteria 1112
1341 Ga0307516_10453728 3300031730 Bacteria 938
1342 Ga0307405_10021832 3300031731 Bacteria 3606
1343 Ga0307405_10053071 3300031731 Bacteria 2523
1344 Ga0307405_10058871 3300031731 Bacteria 2419
1345 Ga0307405_10190515 3300031731 Bacteria 1481
1346 Ga0307405_10226137 3300031731 Bacteria 1376
1347 Ga0307405_10260018 3300031731 Bacteria 1296
1348 Ga0307405_10894422 3300031731 Bacteria 750
1349 Ga0307405_10996428 3300031731 Bacteria 715
1350 Ga0307405_11040726 3300031731 Bacteria 700
1351 Ga0307405_11075034 3300031731 Bacteria 690
1352 Ga0307405_11313412 3300031731 Bacteria 630
1353 Ga0307405_11440125 3300031731 Bacteria 603
1354 Ga0307405_11608569 3300031731 Bacteria 573
1355 Ga0307413_10199627 3300031824 Bacteria 1443
1356 Ga0307413_11169348 3300031824 Bacteria 668
1357 Ga0307413_12123964 3300031824 Bacteria 508
1358 Ga0307410_10006186 3300031852 Bacteria 6431
1359 Ga0307410_10493002 3300031852 Bacteria 1007
1360 Ga0307410_10699597 3300031852 Bacteria 854
1361 Ga0307410_11238769 3300031852 Bacteria 651
1362 Ga0307406_10009086 3300031901 Bacteria 5560
1363 Ga0307406_10048547 3300031901 Bacteria 2682
1364 Ga0307406_10154488 3300031901 Bacteria 1641
1365 Ga0307406_10424736 3300031901 Bacteria 1060
1366 Ga0307406_10613602 3300031901 Bacteria 898
1367 Ga0307406_10795272 3300031901 Bacteria 798
1368 Ga0307407_10125284 3300031903 Bacteria 1635
1369 Ga0307407_10197530 3300031903 Bacteria 1345
1370 Ga0307407_10237909 3300031903 Bacteria 1241
1371 Ga0307407_10789264 3300031903 Bacteria 722
1372 Ga0307412_10008934 3300031911 Bacteria 5739
1373 Ga0307412_10106523 3300031911 Bacteria 1993
1374 Ga0307412_10152178 3300031911 Bacteria 1708
1375 Ga0307412_10156542 3300031911 Bacteria 1687
1376 Ga0307412_10209380 3300031911 Bacteria 1486
1377 Ga0307412_10427755 3300031911 Bacteria 1085
1378 Ga0307412_10565616 3300031911 Bacteria 957
1379 Ga0307412_10710080 3300031911 Bacteria 864
1380 Ga0307412_10725839 3300031911 Bacteria 855
1381 Ga0307412_11299118 3300031911 Bacteria 655
1382 Ga0307412_11376482 3300031911 Bacteria 638
1383 Ga0307412_11639177 3300031911 Bacteria 588
1384 Ga0307409_100001314 3300031995 Bacteria 12044
1385 Ga0307409_100049671 3300031995 Bacteria 3200
1386 Ga0307409_100065516 3300031995 Bacteria 2859
1387 Ga0307409_101124546 3300031995 Bacteria 807
1388 Ga0307409_101406187 3300031995 Bacteria 724
1389 Ga0307409_101614946 3300031995 Bacteria 677
1390 Ga0307416_100020404 3300032002 Bacteria 4727
1391 Ga0307416_100063772 3300032002 Bacteria 3019
1392 Ga0307416_100071278 3300032002 Bacteria 2886
1393 Ga0307416_100087114 3300032002 Bacteria 2665
1394 Ga0307416_100320417 3300032002 Bacteria 1552
1395 Ga0307416_100345066 3300032002 Bacteria 1504
1396 Ga0307416_100388486 3300032002 Bacteria 1429
1397 Ga0307416_100568835 3300032002 Bacteria 1209
1398 Ga0307416_100997030 3300032002 Bacteria 940
1399 Ga0307416_101441695 3300032002 Bacteria 794
1400 Ga0307416_101727569 3300032002 Bacteria 730
1401 Ga0307416_103778436 3300032002 Bacteria 507
1402 Ga0307414_10057023 3300032004 Bacteria 2743
1403 Ga0307414_10115978 3300032004 Bacteria 2049
1404 Ga0307414_10116063 3300032004 Bacteria 2049
1405 Ga0307414_10149621 3300032004 Bacteria 1840
1406 Ga0307414_10594092 3300032004 Bacteria 992
1407 Ga0307414_10808429 3300032004 Bacteria 855
1408 Ga0307414_10881583 3300032004 Bacteria 820
1409 Ga0307414_11170491 3300032004 Bacteria 711
1410 Ga0307414_12122285 3300032004 Bacteria 525
1411 Ga0307411_10006938 3300032005 Bacteria 5714
1412 Ga0307411_10022274 3300032005 Bacteria 3726
1413 Ga0307411_10239552 3300032005 Bacteria 1419
1414 Ga0307411_10247367 3300032005 Bacteria 1400
1415 Ga0307411_10814359 3300032005 Bacteria 823
1416 Ga0307411_10968779 3300032005 Bacteria 760
1417 Ga0307411_12363398 3300032005 Bacteria 500
1418 Ga0307415_100004417 3300032126 Bacteria 7292
1419 Ga0307415_100124110 3300032126 Bacteria 1942
1420 Ga0307415_100152845 3300032126 Bacteria 1779
1421 Ga0307415_100894793 3300032126 Bacteria 818
1422 Ga0307415_101060223 3300032126 Bacteria 757
1423 Ga0307507_10031462 3300033179 Bacteria 5570
1424 Ga0307507_10055670 3300033179 Bacteria 3746
1425 Ga0307507_10376296 3300033179 Bacteria 820
1426 Ga0307510_10000568 3300033180 Bacteria 37247
1427 Ga0307510_10564632 3300033180 Bacteria 585
1428 Ga0373950_0004635 3300034818 Bacteria 2022
1429 Ga0373958_0028957 3300034819 Bacteria 1075
1430 Ga0373959_0080937 3300034820 Bacteria 748
1431 Ga0373938_0018968 3300034957 Bacteria 1372
1432 Ga0373938_0247902 3300034957 Bacteria 508
1433 Ga0373928_0027809 3300035084 Bacteria 1233
1434 Ga0373928_0114285 3300035084 Bacteria 717
1435 Ga0373940_0035128 3300035088 Bacteria 1356
1436 Ga0373944_0326561 3300035089 Bacteria 580
1437 Ga0373952_0002684 3300035092 Bacteria 3210
1438 Ga0373952_0052535 3300035092 Bacteria 976
1439 Ga0373932_0018539 3300035112 Bacteria 1801
1440 Ga0373932_0030415 3300035112 Bacteria 1497
1441 Ga0373939_0133835 3300035114 Bacteria 887
1442 Ga0373941_0042220 3300035115 Bacteria 1415
1443 Ga0373945_0413159 3300035116 Bacteria 593
1444 Ga0373953_0270922 3300035117 Bacteria 739
1445 Ga0373960_0006818 3300035121 Bacteria 2690
1446 Ga0373946_0179335 3300035171 Bacteria 1005
1447 Ga0373946_0189477 3300035171 Bacteria 980
1448 Ga0373942_0031813 3300035207 Bacteria 1398
1449 Ga0373961_0112681 3300035241 Bacteria 893
1450 Ga0373961_0244560 3300035241 Bacteria 647
1451 Ga0373962_0019072 3300035242 Bacteria 1791
1452 Ga0373962_0040272 3300035242 Bacteria 1314
1453 Ga0373924_0050922 3300035410 Bacteria 1716
1454 Ga0373931_0007502 3300035691 Bacteria 5135
1455 Ga0373931_0306109 3300035691 Bacteria 983
1456 Ga0373935_0664801 3300035692 Bacteria 765
1457 Ga0373947_0273281 3300035725 Bacteria 1122
1458 Ga0373937_0168463 3300036401 Bacteria 2055
1459 Ga0373937_0377255 3300036401 Bacteria 1345
1460 Ga0373937_1291590 3300036401 Bacteria 678
1461 Ga0373937_1872254 3300036401 Bacteria 546
1462 Ga0373925_0219622 3300037068 Bacteria 1517
1463 Ga0373925_0487964 3300037068 Bacteria 1011
1464 Ga0395898_0707204 3300037466 Bacteria 949
1465 Ga0395905_0000071 3300037471 Bacteria 174580
1466 Ga0395905_0003377 3300037471 Bacteria 17102
1467 Ga0395905_0158997 3300037471 Bacteria 2124
1468 Ga0395905_0205360 3300037471 Bacteria 1846
1469 Ga0395905_0292538 3300037471 Bacteria 1515
1470 Ga0395905_0637559 3300037471 Bacteria 967
1471 Ga0395905_0726434 3300037471 Bacteria 895
1472 Ga0395905_1171095 3300037471 Bacteria 672
1473 Ga0395905_1245362 3300037471 Bacteria 648
1474 Ga0400483_050487 3300039062 Bacteria 45898
1475 Ga0400483_054100 3300039062 Bacteria 1406
1476 Ga0400483_058112 3300039062 Bacteria 39642
1477 Ga0400483_147621 3300039062 Bacteria 10623
1478 Ga0400483_243387 3300039062 Bacteria 56211
1479 Ga0400483_250036 3300039062 Bacteria 396353
1480 Ga0400483_259735 3300039062 Bacteria 8645
1481 Ga0436365_0385285 3300039437 Bacteria 2218
1482 Ga0436365_0393891 3300039437 Bacteria 1272
1483 Ga0436365_0508202 3300039437 Bacteria 921
1484 Ga0436365_1754335 3300039437 Bacteria 1182
1485 Ga0436365_1910867 3300039437 Bacteria 1720
1486 Ga0439436_0000087 3300041404 Bacteria 22052
1487 Ga0439438_022946 3300041405 Bacteria 1726
1488 Ga0439439_0023785 3300041406 Bacteria 1536
1489 Ga0439447_029848 3300041407 Bacteria 1378
1490 Ga0439461_0005108 3300041410 Bacteria 2224
1491 Ga0439461_0036152 3300041410 Bacteria 1050
1492 Ga0439466_0016508 3300041411 Bacteria 2667
1493 Ga0439466_0045273 3300041411 Bacteria 1455
1494 Ga0439466_0049909 3300041411 Bacteria 1373
1495 Ga0439465_0008564 3300041413 Bacteria 3227
1496 Ga0439465_0134195 3300041413 Bacteria 876
1497 Ga0451787_135752 3300041441 Bacteria 525
1498 Ga0451789_0485836 3300041443 Bacteria 713
1499 Ga0451789_0873756 3300041443 Bacteria 781
1500 Ga0451789_1195116 3300041443 Bacteria 1937
1501 Ga0451789_1353168 3300041443 Bacteria 695
1502 Ga0451791_0888711 3300041451 Bacteria 592
1503 Ga0451791_1547075 3300041451 Bacteria 825
1504 Ga0451793_0351601 3300041452 Bacteria 559
1505 Ga0451793_0606671 3300041452 Bacteria 1102
1506 Ga0451793_0969557 3300041452 Bacteria 1813
1507 Ga0451793_1911556 3300041452 Bacteria 551
1508 Ga0451797_0651689 3300041453 Bacteria 617
1509 Ga0451797_1136303 3300041453 Bacteria 524
1510 Ga0451797_1454471 3300041453 Bacteria 767
1511 Ga0451797_1559014 3300041453 Bacteria 734
1512 Ga0451795_0264279 3300041456 Bacteria 804
1513 Ga0451795_0458032 3300041456 Bacteria 542
1514 Ga0451795_0612071 3300041456 Bacteria 1521
1515 Ga0451795_1631029 3300041456 Bacteria 625
1516 Ga0451798_0075940 3300041458 Bacteria 2713
1517 Ga0451800_0112075 3300041459 Bacteria 643
1518 Ga0451802_0039409 3300041460 Bacteria 3366
1519 Ga0451802_0496814 3300041460 Bacteria 578
1520 Ga0451802_1029972 3300041460 Bacteria 548
1521 Ga0451804_1177037 3300041463 Bacteria 717
1522 Ga0451807_1456924 3300041486 Bacteria 517
1523 Ga0451833_0642716 3300041491 Bacteria 1416
1524 Ga0451833_0671749 3300041491 Bacteria 516
1525 Ga0451833_0863719 3300041491 Bacteria 978
1526 Ga0451839_0092707 3300041496 Bacteria 728
1527 Ga0451839_0195547 3300041496 Bacteria 1592
1528 Ga0451839_1646573 3300041496 Bacteria 564
1529 Ga0451841_0064685 3300041498 Bacteria 591
1530 Ga0451841_0374427 3300041498 Bacteria 551
1531 Ga0451849_0140783 3300041505 Bacteria 854
1532 Ga0451849_1174768 3300041505 Bacteria 633
1533 Ga0451851_0377524 3300041507 Bacteria 718
1534 Ga0451851_0664708 3300041507 Bacteria 617
1535 Ga0451851_0775016 3300041507 Bacteria 732
1536 Ga0451843_0094093 3300041509 Bacteria 783
1537 Ga0451843_0289726 3300041509 Bacteria 528
1538 Ga0451843_1448663 3300041509 Bacteria 604
1539 Ga0451855_1473803 3300041511 Bacteria 748
1540 Ga0451853_0258583 3300041512 Bacteria 675
1541 Ga0451853_0312486 3300041512 Bacteria 1389
1542 Ga0451853_2717321 3300041512 Bacteria 1246
1543 Ga0451853_2957169 3300041512 Bacteria 1168
1544 Ga0451853_3970409 3300041512 Bacteria 538
1545 Ga0439431_0002540 3300041997 Bacteria 4028
1546 Ga0439431_0019679 3300041997 Bacteria 1606
1547 Ga0439431_0161495 3300041997 Bacteria 640
1548 Ga0439433_0006733 3300041999 Bacteria 2475
1549 Ga0439433_0009312 3300041999 Bacteria 2137
1550 Ga0439437_000403 3300042000 Bacteria 4173
1551 Ga0439445_0000816 3300042004 Bacteria 6574
1552 Ga0439445_0067787 3300042004 Bacteria 984
1553 Ga0439445_0118103 3300042004 Bacteria 760
1554 Ga0439432_004375 3300042006 Bacteria 5160
1555 Ga0439449_0005260 3300042007 Bacteria 4967
1556 Ga0439449_0009502 3300042007 Bacteria 3685
1557 Ga0439449_0019959 3300042007 Bacteria 2512
1558 Ga0439449_0035314 3300042007 Bacteria 1861
1559 Ga0439449_0069502 3300042007 Bacteria 1298
1560 Ga0439449_0269811 3300042007 Bacteria 641
1561 Ga0439452_001338 3300042010 Bacteria 10284
1562 Ga0439452_021923 3300042010 Bacteria 1658
1563 Ga0439455_0023026 3300042012 Bacteria 1498
1564 Ga0439455_0031169 3300042012 Bacteria 1326
1565 Ga0439455_0103196 3300042012 Bacteria 789
1566 Ga0439457_006319 3300042014 Bacteria 2911
1567 Ga0439457_037410 3300042014 Bacteria 1080
1568 Ga0439457_160441 3300042014 Bacteria 543
1569 Ga0439462_0003614 3300042015 Bacteria 3722
1570 Ga0439462_0005695 3300042015 Bacteria 3078
1571 Ga0439462_0082272 3300042015 Bacteria 880
1572 Ga0439463_155667 3300042016 Bacteria 593
1573 Ga0450911_022634 3300042115 Bacteria 818
1574 Ga0450914_002759 3300042118 Bacteria 1288
1575 Ga0450917_007679 3300042120 Bacteria 825
1576 Ga0450919_000846 3300042121 Bacteria 3954
1577 Ga0450920_033140 3300042122 Bacteria 1020
1578 Ga0450922_013808 3300042124 Bacteria 792
1579 Ga0450923_062420 3300042125 Bacteria 815
1580 Ga0450890_010639 3300042127 Bacteria 1184
1581 Ga0450891_000064 3300042129 Bacteria 8447
1582 Ga0450891_018549 3300042129 Bacteria 674
1583 Ga0450892_003526 3300042130 Bacteria 1283
1584 Ga0450892_020418 3300042130 Bacteria 648
1585 Ga0450894_001711 3300042131 Bacteria 3096
1586 Ga0450896_048175 3300042133 Bacteria 675
1587 Ga0450898_030446 3300042134 Bacteria 988
1588 Ga0450898_030894 3300042134 Bacteria 983
1589 Ga0450898_055455 3300042134 Bacteria 772
1590 Ga0450899_009529 3300042135 Bacteria 1071
1591 Ga0450889_003240 3300042144 Bacteria 1606
1592 Ga0450906_007913 3300042145 Bacteria 2080
1593 Ga0450907_019923 3300042146 Bacteria 1125
1594 Ga0450910_042973 3300042147 Bacteria 734
1595 Ga0439446_0004543 3300042156 Bacteria 3517
1596 Ga0439446_0240238 3300042156 Bacteria 622
1597 Ga0439446_0253262 3300042156 Bacteria 608
1598 Ga0450909_002243 3300042185 Bacteria 2730
1599 Ga0450909_012351 3300042185 Bacteria 1252
1600 Ga0439434_0005187 3300042435 Bacteria 3809
1601 Ga0439434_0032148 3300042435 Bacteria 1596
1602 Ga0439434_0106731 3300042435 Bacteria 905
1603 Ga0439434_0120244 3300042435 Bacteria 856
1604 Ga0439434_0184084 3300042435 Bacteria 700
1605 Ga0439444_0193484 3300042437 Bacteria 510
1606 Ga0439459_0079902 3300042438 Bacteria 770
1607 Ga0439464_0021522 3300042439 Bacteria 1771
1608 Ga0439464_0169221 3300042439 Bacteria 689
1609 Ga0439460_0146488 3300042461 Bacteria 786
1610 Ga0450916_001775 3300042530 Bacteria 2199
1611 Ga0450918_000344 3300042531 Bacteria 10277
1612 Ga0450918_083618 3300042531 Bacteria 611
1613 Ga0450893_0021080 3300042532 Bacteria 1123
1614 Ga0450893_0059738 3300042532 Bacteria 726
1615 Ga0451577_0026364 3300042876 Bacteria 5265
1616 Ga0451577_0061568 3300042876 Bacteria 3347
1617 Ga0451577_1682399 3300042876 Bacteria 558
1618 Ga0439440_0185855 3300042993 Bacteria 611
1619 Ga0466969_0037790 3300044656 Bacteria 2433
1620 Ga0466969_0089971 3300044656 Bacteria 1455
1621 Ga0466972_0020558 3300044658 Bacteria 3298
1622 Ga0466972_0035894 3300044658 Bacteria 2427
1623 Ga0466972_0041116 3300044658 Bacteria 2251
1624 Ga0466972_0046599 3300044658 Bacteria 2098
1625 Ga0466972_0170373 3300044658 Bacteria 1022
1626 Ga0453683_0394669 3300044673 Bacteria 891
1627 Ga0453683_0429046 3300044673 Bacteria 854
1628 Ga0453683_0934536 3300044673 Bacteria 574
1629 Ga0466965_0068051 3300044683 Bacteria 1787
1630 Ga0466965_0108619 3300044683 Bacteria 1424
1631 Ga0466965_0131641 3300044683 Bacteria 1297
1632 Ga0466965_0212725 3300044683 Bacteria 1028
1633 Ga0466965_0386555 3300044683 Bacteria 771
1634 Ga0466965_0801347 3300044683 Bacteria 545
1635 Ga0466966_0015315 3300044684 Bacteria 5070
1636 Ga0466966_0752500 3300044684 Bacteria 587
1637 Ga0466961_0003217 3300044693 Bacteria 10163
1638 Ga0466961_0006410 3300044693 Bacteria 7472
1639 Ga0466961_0043879 3300044693 Bacteria 2863
1640 Ga0466963_0000935 3300044694 Bacteria 14918
1641 Ga0466964_0003021 3300044706 Bacteria 6099
1642 Ga0466964_0118004 3300044706 Bacteria 1192
1643 Ga0453684_0000917 3300044712 Bacteria 97990
1644 Ga0453684_0001658 3300044712 Bacteria 60385
1645 Ga0453684_0017401 3300044712 Bacteria 11136
1646 Ga0453684_0051049 3300044712 Bacteria 5429
1647 Ga0453684_0272674 3300044712 Bacteria 1932
1648 Ga0453684_0346557 3300044712 Bacteria 1676
1649 Ga0453684_0613701 3300044712 Bacteria 1191
1650 Ga0453684_1282602 3300044712 Bacteria 765
1651 Ga0466971_0382138 3300044719 Bacteria 684
1652 Ga0466968_0005264 3300044735 Bacteria 4847
1653 Ga0466968_0721818 3300044735 Bacteria 510
1654 Ga0466970_0007142 3300044765 Bacteria 5592
1655 Ga0466970_0015254 3300044765 Bacteria 3950
1656 Ga0466970_0128278 3300044765 Bacteria 1392
1657 Ga0466957_0007668 3300044842 Bacteria 6104
1658 Ga0466960_0012592 3300044901 Bacteria 3575
1659 Ga0466960_0654384 3300044901 Bacteria 627
1660 Ga0466959_0013106 3300045049 Bacteria 6003
1661 Ga0466959_0250383 3300045049 Bacteria 1222
1662 Ga0451576_0034152 3300045051 Bacteria 5402
1663 Ga0451576_0126973 3300045051 Bacteria 2657
1664 Ga0451576_0228247 3300045051 Bacteria 1944
1665 Ga0451576_0312262 3300045051 Bacteria 1645
1666 Ga0451576_0393108 3300045051 Bacteria 1454
1667 Ga0451576_0422698 3300045051 Bacteria 1398
1668 Ga0451576_1296890 3300045051 Bacteria 759
1669 Ga0466958_0023688 3300045836 Bacteria 3606
1670 Ga0466958_0695385 3300045836 Bacteria 662
1671 Ga0466967_0021184 3300045976 Bacteria 5272
1672 Ga0466967_0546277 3300045976 Bacteria 1140
1673 Ga0466967_1103268 3300045976 Bacteria 791
1674 Ga0495627_032297 3300046453 Bacteria 1648
1675 Ga0495590_0131290 3300046457 Bacteria 901
1676 Ga0495629_0040968 3300046459 Bacteria 3259
1677 Ga0495638_0191549 3300046460 Bacteria 1160
1678 Ga0495638_0240052 3300046460 Bacteria 1004
1679 Ga0495638_0306508 3300046460 Bacteria 854
1680 Ga0495651_0038375 3300046462 Bacteria 3730
1681 Ga0495650_0002988 3300046471 Bacteria 12804
1682 Ga0495650_0147479 3300046471 Bacteria 847
1683 Ga0495650_0200566 3300046471 Bacteria 693
1684 Ga0495580_0175846 3300046472 Bacteria 1479
1685 Ga0495580_0631714 3300046472 Bacteria 705
1686 Ga0495582_0409091 3300046473 Bacteria 783
1687 Ga0495582_0418253 3300046473 Bacteria 773
1688 Ga0495582_0578047 3300046473 Bacteria 650
1689 Ga0495605_0484521 3300046474 Bacteria 507
1690 Ga0495639_0518165 3300046475 Bacteria 609
1691 Ga0495662_0358629 3300046476 Bacteria 717
1692 Ga0495664_0543098 3300046477 Bacteria 693
1693 Ga0495583_0380114 3300046506 Bacteria 556
1694 Ga0495606_0103334 3300046507 Bacteria 1731
1695 Ga0495606_0184202 3300046507 Bacteria 1201
1696 Ga0495606_0426203 3300046507 Bacteria 685
1697 Ga0495606_0619442 3300046507 Bacteria 528
1698 Ga0495610_0020900 3300046512 Bacteria 3616
1699 Ga0495610_0035222 3300046512 Bacteria 2572
1700 Ga0495610_0201109 3300046512 Bacteria 816
1701 Ga0495616_0002648 3300046513 Bacteria 11757
1702 Ga0495618_0779930 3300046514 Bacteria 558
1703 Ga0495620_0083637 3300046515 Bacteria 1288
1704 Ga0495620_0134181 3300046515 Bacteria 970
1705 Ga0495620_0309700 3300046515 Bacteria 600
1706 Ga0495628_0503705 3300046516 Bacteria 874
1707 Ga0495628_0630016 3300046516 Bacteria 763
1708 Ga0495630_0141411 3300046517 Bacteria 1830
1709 Ga0495631_0000024 3300046518 Bacteria 90896
1710 Ga0495632_0007918 3300046519 Bacteria 6606
1711 Ga0495632_0010962 3300046519 Bacteria 5318
1712 Ga0495632_0067015 3300046519 Bacteria 1731
1713 Ga0495632_0485708 3300046519 Bacteria 534
1714 Ga0495637_0010974 3300046520 Bacteria 4366
1715 Ga0495637_0282631 3300046520 Bacteria 592
1716 Ga0495643_0106698 3300046522 Bacteria 1429
1717 Ga0495643_0248979 3300046522 Bacteria 830
1718 Ga0495648_0371714 3300046524 Bacteria 647
1719 Ga0495666_0197046 3300046526 Bacteria 927
1720 Ga0495642_0091393 3300046528 Bacteria 1289
1721 Ga0495642_0176947 3300046528 Bacteria 928
1722 Ga0495652_0345447 3300046529 Bacteria 1068
1723 Ga0495654_0041183 3300046530 Bacteria 2298
1724 Ga0495640_0302006 3300046533 Bacteria 994
1725 Ga0495586_0208483 3300046535 Bacteria 1109
1726 Ga0495586_0445148 3300046535 Bacteria 747
1727 Ga0495587_0680751 3300046536 Bacteria 564
1728 Ga0495598_0018863 3300046537 Bacteria 1799
1729 Ga0495598_0021212 3300046537 Bacteria 1725
1730 Ga0495621_0003869 3300046539 Bacteria 4159
1731 Ga0495621_0058128 3300046539 Bacteria 1398
1732 Ga0495621_0162718 3300046539 Bacteria 883
1733 Ga0495597_0010476 3300046542 Bacteria 4530
1734 Ga0495645_0203502 3300046543 Bacteria 1341
1735 Ga0495645_0313913 3300046543 Bacteria 1020
1736 Ga0495622_0121235 3300046557 Bacteria 1194
1737 Ga0495633_0254105 3300046558 Bacteria 802
1738 Ga0495667_0114833 3300046559 Bacteria 1740
1739 Ga0495667_0623864 3300046559 Bacteria 671
1740 Ga0495656_0001070 3300046615 Bacteria 8866
1741 Ga0495668_0056564 3300046616 Bacteria 2165
1742 Ga0495668_0148126 3300046616 Bacteria 1285
1743 Ga0495668_0340680 3300046616 Bacteria 823
1744 Ga0495611_0037183 3300046648 Bacteria 2163
1745 Ga0495611_0352882 3300046648 Bacteria 675
1746 Ga0495625_0021963 3300046660 Bacteria 4900
1747 Ga0495625_0040736 3300046660 Bacteria 3384
1748 Ga0495625_0060694 3300046660 Bacteria 2678
1749 Ga0495625_0078070 3300046660 Bacteria 2311
1750 Ga0495625_0161052 3300046660 Bacteria 1503
1751 Ga0495625_0683058 3300046660 Bacteria 608
1752 Ga0495635_0146612 3300046663 Bacteria 1607
1753 Ga0495635_0283978 3300046663 Bacteria 1112
1754 Ga0495635_0298249 3300046663 Bacteria 1081
1755 Ga0495588_0026440 3300046674 Bacteria 2897
1756 Ga0495588_0067240 3300046674 Bacteria 1860
1757 Ga0495588_0542843 3300046674 Bacteria 609
1758 Ga0495657_0592767 3300046675 Bacteria 642
1759 Ga0495599_0642120 3300046678 Bacteria 615
1760 Ga0495646_0176976 3300046680 Bacteria 1173
1761 Ga0495646_0186533 3300046680 Bacteria 1136
1762 Ga0495646_0525651 3300046680 Bacteria 606
1763 Ga0495647_0029408 3300046681 Bacteria 2032
1764 Ga0495647_0145353 3300046681 Bacteria 1013
1765 Ga0495658_0014926 3300046683 Bacteria 3979
1766 Ga0495658_0093624 3300046683 Bacteria 1783
1767 Ga0495658_0164808 3300046683 Bacteria 1369
1768 Ga0495658_0226087 3300046683 Bacteria 1173
1769 Ga0495613_0231866 3300046689 Bacteria 1293
1770 Ga0495624_0413054 3300046690 Bacteria 810
1771 Ga0495670_0501458 3300046691 Bacteria 659
1772 Ga0495670_0733163 3300046691 Bacteria 539
1773 Ga0495670_0818997 3300046691 Bacteria 508
1774 Ga0495671_0115776 3300046692 Bacteria 1309
1775 Ga0495671_0151942 3300046692 Bacteria 1127
1776 Ga0495671_0330015 3300046692 Bacteria 732
1777 Ga0495649_0009554 3300046694 Bacteria 5753
1778 Ga0495589_0137142 3300046794 Bacteria 1173
1779 Ga0495600_0792769 3300046809 Bacteria 565
1780 Ga0495600_0822637 3300046809 Bacteria 552
1781 Ga0495660_0119551 3300046810 Bacteria 1334
1782 Ga0495660_0368547 3300046810 Bacteria 635
1783 Ga0495581_0511806 3300047315 Bacteria 698
1784 Ga0495581_0903825 3300047315 Bacteria 504
1785 Ga0495674_1479822 3300047319 Bacteria 503
1786 Ga0495676_0035806 3300047321 Bacteria 4149
1787 Ga0495676_0078953 3300047321 Bacteria 2504
1788 Ga0495676_0682244 3300047321 Bacteria 665
1789 Ga0495680_0048736 3300047322 Bacteria 3325
1790 Ga0495687_002064 3300047443 Bacteria 16886
1791 Ga0495687_005696 3300047443 Bacteria 7855
1792 Ga0495687_022510 3300047443 Bacteria 3023
1793 Ga0495673_0107757 3300047469 Bacteria 1118
1794 Ga0495673_0153463 3300047469 Bacteria 889
1795 Ga0495681_0392955 3300047470 Bacteria 520
1796 Ga0495684_0548175 3300047471 Bacteria 788
1797 Ga0495686_0133926 3300047472 Bacteria 1467
1798 Ga0495686_0149048 3300047472 Bacteria 1375
1799 Ga0495614_0183605 3300048089 Bacteria 942
1800 Ga0495614_0219437 3300048089 Bacteria 864
1801 Ga0495615_0023842 3300048090 Bacteria 1406
1802 Ga0495615_0132714 3300048090 Bacteria 729
1803 Ga0495615_0168331 3300048090 Bacteria 662
1804 Ga0495626_0050116 3300048091 Bacteria 1930
1805 Ga0495626_0090337 3300048091 Bacteria 1347
1806 Ga0496100_0046363 3300048903 Bacteria 2794
1807 Ga0496100_0058669 3300048903 Bacteria 2527
1808 Ga0496100_0849746 3300048903 Bacteria 716
1809 Ga0496100_1204822 3300048903 Bacteria 597
1810 Ga0496101_0005293 3300048904 Bacteria 8218
1811 Ga0496101_0008869 3300048904 Bacteria 6584
1812 Ga0496101_0019357 3300048904 Bacteria 4646
1813 Ga0496101_0692603 3300048904 Bacteria 805
1814 Ga0496101_0891250 3300048904 Bacteria 701
1815 Ga0496102_0004160 3300048905 Bacteria 12251
1816 Ga0496102_0022357 3300048905 Bacteria 5603
1817 Ga0496102_0025441 3300048905 Bacteria 5269
1818 Ga0496102_1735265 3300048905 Bacteria 542
1819 Ga0496103_0052729 3300048906 Bacteria 2519
1820 Ga0496103_0545910 3300048906 Bacteria 740
1821 Ga0496104_0004072 3300048907 Bacteria 12679
1822 Ga0496104_0225894 3300048907 Bacteria 1784
1823 Ga0496105_0013340 3300048908 Bacteria 6521
1824 Ga0496105_0335099 3300048908 Bacteria 1210
1825 Ga0496105_0346090 3300048908 Bacteria 1188
1826 Ga0496105_1017770 3300048908 Bacteria 619
1827 Ga0496106_0004162 3300048909 Bacteria 10783
1828 Ga0496106_0054027 3300048909 Bacteria 3034
1829 Ga0496106_0118004 3300048909 Bacteria 2071
1830 Ga0496107_0012377 3300048910 Bacteria 5954
1831 Ga0496107_0185959 3300048910 Bacteria 1543
1832 Ga0496107_0743017 3300048910 Bacteria 720
1833 Ga0496107_1023953 3300048910 Bacteria 599
1834 Ga0496107_1315008 3300048910 Bacteria 517
1835 Ga0496108_0017286 3300048911 Bacteria 5899
1836 Ga0496108_0054001 3300048911 Bacteria 3371
1837 Ga0496108_0059614 3300048911 Bacteria 3209
1838 Ga0496108_1037113 3300048911 Bacteria 699
1839 Ga0496109_0040199 3300048912 Bacteria 4235
1840 Ga0496109_0069350 3300048912 Bacteria 3233
1841 Ga0496109_0499406 3300048912 Bacteria 1148
1842 Ga0496109_0508627 3300048912 Bacteria 1137
1843 Ga0496109_0959386 3300048912 Bacteria 793
1844 Ga0496110_0010357 3300048913 Bacteria 7579
1845 Ga0496110_0110191 3300048913 Bacteria 2473
1846 Ga0496110_0238223 3300048913 Bacteria 1655
1847 Ga0496111_0226566 3300048914 Bacteria 1388
1848 Ga0496111_0824314 3300048914 Bacteria 671
1849 Ga0496112_0290238 3300048915 Bacteria 1582
1850 Ga0496113_0185358 3300048916 Bacteria 1650
1851 Ga0496113_0713531 3300048916 Bacteria 800
1852 Ga0496114_0022464 3300048917 Bacteria 5143
1853 Ga0496114_0419093 3300048917 Bacteria 1186
1854 Ga0496114_0563757 3300048917 Bacteria 1006
1855 Ga0496114_0736330 3300048917 Bacteria 863
1856 Ga0496114_1051712 3300048917 Bacteria 698
1857 Ga0496115_0002077 3300048918 Bacteria 14341
1858 Ga0496116_0066945 3300048919 Bacteria 2296
1859 Ga0496117_0004106 3300048920 Bacteria 16315
1860 Ga0496117_0051373 3300048920 Bacteria 2914
1861 Ga0496117_0195326 3300048920 Bacteria 1148
1862 Ga0496118_0009212 3300048921 Bacteria 10026
1863 Ga0496118_0078153 3300048921 Bacteria 2343
1864 Ga0496118_0374968 3300048921 Bacteria 749
1865 Ga0496119_0213336 3300048922 Bacteria 992
1866 Ga0496120_0199693 3300048923 Bacteria 969
1867 Ga0496121_0002206 3300048924 Bacteria 30412
1868 Ga0496121_0026908 3300048924 Bacteria 5399
1869 Ga0496122_0000415 3300048925 Bacteria 90626
1870 Ga0496122_0092947 3300048925 Bacteria 2048
1871 Ga0496122_0181637 3300048925 Bacteria 1254
1872 Ga0496122_0223552 3300048925 Bacteria 1078
1873 Ga0496122_0491478 3300048925 Bacteria 598
1874 Ga0496123_0000330 3300048926 Bacteria 90102
1875 Ga0496123_0022183 3300048926 Bacteria 4903
1876 Ga0496123_0036339 3300048926 Bacteria 3495
1877 Ga0496123_0047297 3300048926 Bacteria 2909
1878 Ga0496123_0245124 3300048926 Bacteria 887
1879 Ga0496124_0044485 3300048927 Bacteria 3809
1880 Ga0496124_0135708 3300048927 Bacteria 1948
1881 Ga0496124_0415473 3300048927 Bacteria 929
1882 Ga0496124_0525099 3300048927 Bacteria 787
1883 Ga0496124_0874145 3300048927 Bacteria 548
1884 Ga0496125_0041632 3300048928 Bacteria 3925
1885 Ga0496125_0674360 3300048928 Bacteria 553
1886 Ga0496126_0148535 3300048929 Bacteria 2011
1887 Ga0501309_000004 3300049129 Bacteria 11581
1888 Ga0501309_092679 3300049129 Bacteria 517
1889 Ga0501310_002992 3300049130 Bacteria 1636
1890 Ga0501310_019556 3300049130 Bacteria 834
1891 Ga0501310_057280 3300049130 Bacteria 575
1892 Ga0501305_001609 3300049161 Bacteria 2255
1893 Ga0501305_036628 3300049161 Bacteria 785
1894 Ga0501305_096135 3300049161 Bacteria 547
1895 Ga0495682_0343906 3300049460 Bacteria 526
1896 Ga0501292_023460 3300049515 Bacteria 1008
1897 Ga0501297_002256 3300049520 Bacteria 1852
1898 Ga0501303_004947 3300049526 Bacteria 1117
1899 Ga0501312_026367 3300049528 Bacteria 891
1900 Ga0501333_022767 3300049549 Bacteria 507
1901 Ga0501032_0090633 3300049569 Bacteria 2029
1902 Ga0501034_0016622 3300049571 Bacteria 7544
1903 Ga0501034_0792889 3300049571 Bacteria 840
1904 Ga0501037_0007252 3300049573 Bacteria 8102
1905 Ga0501043_0000545 3300049579 Bacteria 33864
1906 Ga0501046_0000021 3300049580 Bacteria 217313
1907 Ga0501046_0004297 3300049580 Bacteria 12968
1908 Ga0501046_0008745 3300049580 Bacteria 8796
1909 Ga0501047_0000757 3300049581 Bacteria 33717
1910 Ga0501048_0013766 3300049582 Bacteria 6000
1911 Ga0501069_0002093 3300049585 Bacteria 10048
1912 Ga0501070_0008659 3300049586 Bacteria 8601
1913 Ga0501198_000047 3300049649 Bacteria 40126
1914 Ga0501198_133305 3300049649 Bacteria 534
1915 Ga0501201_004855 3300049651 Bacteria 1251
1916 Ga0501206_015864 3300049653 Bacteria 1044
1917 Ga0501207_019125 3300049654 Bacteria 1083
1918 Ga0501222_000056 3300049662 Bacteria 40303
1919 Ga0501222_010931 3300049662 Bacteria 1197
1920 Ga0501223_035862 3300049663 Bacteria 964
1921 Ga0501227_030701 3300049665 Bacteria 1288
1922 Ga0501233_174043 3300049668 Bacteria 613
1923 Ga0501235_029982 3300049669 Bacteria 1225
1924 Ga0501236_062095 3300049670 Bacteria 665
1925 Ga0501238_043408 3300049671 Bacteria 665
1926 Ga0501242_026331 3300049674 Bacteria 769
1927 Ga0501249_040180 3300049679 Bacteria 1059
1928 Ga0501253_020019 3300049683 Bacteria 1162
1929 Ga0501257_031579 3300049686 Bacteria 1278
1930 Ga0501258_028345 3300049687 Bacteria 695
1931 Ga0501221_000933 3300049704 Bacteria 4793
1932 Ga0501225_0013159 3300049705 Bacteria 2317
1933 Ga0501225_0032891 3300049705 Bacteria 1426
1934 Ga0501229_000077 3300049706 Bacteria 9792
1935 Ga0501079_0051579 3300049741 Bacteria 3177
1936 Ga0501080_0199531 3300049742 Bacteria 1837
1937 Ga0501232_004559 3300049757 Bacteria 1331
1938 Ga0501241_108453 3300049758 Bacteria 605
1939 Ga0501262_000157 3300049759 Bacteria 8322
1940 Ga0501265_002252 3300049762 Bacteria 2185
1941 Ga0501268_087695 3300049765 Bacteria 651
1942 Ga0501271_052504 3300049768 Bacteria 556
1943 Ga0501282_007907 3300049778 Bacteria 1138
1944 Ga0501035_0120765 3300049822 Bacteria 2291
1945 Ga0501044_0180518 3300049823 Bacteria 2078
1946 Ga0501045_0002486 3300049824 Bacteria 12544
1947 nmdc:mga03683_218037_c1 3300050489 Bacteria 879
1948 nmdc:mga03683_22920_c1 3300050489 Bacteria 2426
1949 nmdc:mga03683_30347_c1 3300050489 Bacteria 2163
1950 nmdc:mga03683_354569_c1 3300050489 Bacteria 695
1951 nmdc:mga03683_447720_c1 3300050489 Bacteria 621
1952 nmdc:mga03683_48543_c1 3300050489 Bacteria 1764
1953 nmdc:mga03683_51579_c1 3300050489 Bacteria 1718
1954 nmdc:mga03683_90285_c1 3300050489 Bacteria 1335
1955 nmdc:mga03n38_226732_c1 3300050490 Bacteria 978
1956 nmdc:mga03n38_399825_c1 3300050490 Bacteria 756
1957 nmdc:mga03n38_454002_c1 3300050490 Bacteria 713
1958 nmdc:mga03n38_603014_c1 3300050490 Bacteria 626
1959 nmdc:mga00v17_152383_c1 3300050491 Bacteria 1485
1960 nmdc:mga00v17_202355_c1 3300050491 Bacteria 1284
1961 nmdc:mga00v17_401612_c1 3300050491 Bacteria 890
1962 nmdc:mga00v17_87307_c1 3300050491 Bacteria 1955
1963 nmdc:mga0yw44_240784_c1 3300050492 Bacteria 1202
1964 nmdc:mga0k408_10460_c1 3300050493 Bacteria 5017
1965 nmdc:mga0k408_12490_c1 3300050493 Bacteria 4643
1966 nmdc:mga0k408_164742_c1 3300050493 Bacteria 1321
1967 nmdc:mga0k408_171695_c1 3300050493 Bacteria 1293
1968 nmdc:mga0k408_18200_c2 3300050493 Bacteria 3187
1969 nmdc:mga0k408_190517_c1 3300050493 Bacteria 1224
1970 nmdc:mga0k408_256190_c1 3300050493 Bacteria 1045
1971 nmdc:mga0k408_26610_c1 3300050493 Bacteria 3281
1972 nmdc:mga0k408_270913_c1 3300050493 Bacteria 1014
1973 nmdc:mga0k408_302597_c1 3300050493 Bacteria 954
1974 nmdc:mga0k408_36110_c1 3300050493 Bacteria 2836
1975 nmdc:mga0k408_40302_c1 3300050493 Bacteria 2687
1976 nmdc:mga0k408_438894_c1 3300050493 Bacteria 776
1977 nmdc:mga0k408_583656_c1 3300050493 Bacteria 660
1978 nmdc:mga0k408_6644_c1 3300050493 Bacteria 6167
1979 nmdc:mga0k408_794578_c1 3300050493 Bacteria 552
1980 nmdc:mga0k408_83530_c1 3300050493 Bacteria 1872
1981 nmdc:mga06z11_125624_c1 3300050494 Bacteria 1435
1982 nmdc:mga06z11_255108_c1 3300050494 Bacteria 1034
1983 nmdc:mga06z11_363850_c1 3300050494 Bacteria 867
1984 nmdc:mga06z11_37405_c1 3300050494 Bacteria 2403
1985 nmdc:mga06z11_445710_c1 3300050494 Bacteria 782
1986 nmdc:mga06z11_507645_c1 3300050494 Bacteria 731
1987 nmdc:mga04h51_235928_c1 3300050495 Bacteria 729
1988 nmdc:mga07m45_12950_c1 3300050496 Bacteria 4414
1989 nmdc:mga07m45_151739_c1 3300050496 Bacteria 1344
1990 nmdc:mga07m45_154307_c1 3300050496 Bacteria 1332
1991 nmdc:mga07m45_156357_c1 3300050496 Bacteria 1323
1992 nmdc:mga07m45_16681_c1 3300050496 Bacteria 3933
1993 nmdc:mga07m45_18099_c1 3300050496 Bacteria 3797
1994 nmdc:mga07m45_18802_c1 3300050496 Bacteria 3737
1995 nmdc:mga07m45_18856_c1 3300050496 Bacteria 3732
1996 nmdc:mga07m45_201253_c1 3300050496 Bacteria 1159
1997 nmdc:mga07m45_21210_c1 3300050496 Bacteria 3535
1998 nmdc:mga07m45_342605_c1 3300050496 Bacteria 869
1999 nmdc:mga07m45_399292_c1 3300050496 Bacteria 798
2000 nmdc:mga07m45_4213_c1 3300050496 Bacteria 7032
2001 nmdc:mga07m45_460138_c1 3300050496 Bacteria 738
2002 nmdc:mga07m45_506933_c1 3300050496 Bacteria 699
2003 nmdc:mga07m45_529161_c1 3300050496 Bacteria 682
2004 nmdc:mga07m45_724059_c1 3300050496 Bacteria 572
2005 nmdc:mga07m45_836123_c1 3300050496 Bacteria 527
2006 nmdc:mga07m45_912609_c1 3300050496 Bacteria 502
2007 nmdc:mga05p37_182246_c1 3300050507 Bacteria 2554
2008 nmdc:mga05p37_220452_c1 3300050507 Bacteria 2289
2009 nmdc:mga09592_14154_c1 3300050508 Bacteria 6507
2010 nmdc:mga0qj67_110899_c1 3300050509 Bacteria 2215
2011 nmdc:mga08y16_605174_c1 3300050511 Bacteria 1104
2012 nmdc:mga08y16_714912_c1 3300050511 Bacteria 1000
2013 nmdc:mga08y16_823151_c1 3300050511 Bacteria 920
2014 nmdc:mga08y16_950785_c1 3300050511 Bacteria 842
2015 nmdc:mga0n895_280592_c1 3300050512 Bacteria 1689
2016 nmdc:mga08x19_1194464_c1 3300050514 Bacteria 539
2017 nmdc:mga0sz30_14201_c1 3300050516 Bacteria 3130
2018 nmdc:mga0sz30_185966_c1 3300050516 Bacteria 922
2019 nmdc:mga0sz30_37847_c1 3300050516 Bacteria 2020
2020 nmdc:mga0sz30_405475_c1 3300050516 Bacteria 611
2021 nmdc:mga0sz30_442377_c1 3300050516 Bacteria 583
2022 nmdc:mga0sz30_5056_c1 3300050516 Bacteria 4821
2023 Ga0495601_0284010 3300053077 Bacteria 1079
2024 Ga0495612_0091577 3300053078 Bacteria 1288
2025 Ga0495612_0385124 3300053078 Bacteria 636
2026 Ga0500635_0087433 3300053080 Bacteria 1129
2027 Ga0495595_0323284 3300053084 Bacteria 777
2028 Ga0500578_0000006 3300053086 Bacteria 234598
2029 Ga0500578_0265118 3300053086 Bacteria 1030
2030 Ga0500643_006994 3300053087 Bacteria 4628
2031 Ga0500643_012618 3300053087 Bacteria 3020
2032 Ga0500644_0018587 3300053088 Bacteria 2039
2033 Ga0500646_0033981 3300053090 Bacteria 1412
2034 Ga0500646_0346932 3300053090 Bacteria 540
2035 Ga0500651_0000156 3300053093 Bacteria 43636
2036 Ga0500651_0076022 3300053093 Bacteria 2085
2037 Ga0500651_0168496 3300053093 Bacteria 1307
2038 Ga0500651_0444845 3300053093 Bacteria 722
2039 Ga0500566_0160156 3300053094 Bacteria 1174
2040 Ga0500650_0145041 3300053098 Bacteria 1099
2041 Ga0500650_0338961 3300053098 Bacteria 659
2042 Ga0500557_128395 3300053105 Bacteria 840
2043 Ga0500562_005406 3300053108 Bacteria 3208
2044 Ga0500562_008977 3300053108 Bacteria 2525
2045 Ga0500571_000005 3300053110 Bacteria 109625
2046 Ga0500594_0001096 3300053118 Bacteria 5806
2047 Ga0500597_317525 3300053120 Bacteria 616
2048 Ga0500608_022424 3300053122 Bacteria 2927
2049 Ga0500608_074158 3300053122 Bacteria 1614
2050 Ga0500618_164499 3300053125 Bacteria 508
2051 Ga0500621_251616 3300053126 Bacteria 593
2052 Ga0500623_007865 3300053127 Bacteria 5280
2053 Ga0500626_035282 3300053128 Bacteria 2260
2054 Ga0500628_003722 3300053129 Bacteria 2518
2055 Ga0500628_060492 3300053129 Bacteria 924
2056 Ga0500642_0064667 3300053130 Bacteria 1651
2057 Ga0500652_001283 3300053131 Bacteria 7966
2058 Ga0500655_000516 3300053133 Bacteria 7797
2059 Ga0500655_020988 3300053133 Bacteria 1222
2060 Ga0500658_0000141 3300053134 Bacteria 34224
2061 Ga0500658_0000561 3300053134 Bacteria 15644
2062 Ga0500658_0006983 3300053134 Bacteria 4179
2063 Ga0500658_0163347 3300053134 Bacteria 1009
2064 Ga0500559_0000880 3300053136 Bacteria 19209
2065 Ga0500559_0006764 3300053136 Bacteria 5146
2066 Ga0500564_001417 3300053138 Bacteria 8279
2067 Ga0500568_0001097 3300053139 Bacteria 18225
2068 Ga0500568_0127304 3300053139 Bacteria 947
2069 Ga0500573_0032467 3300053140 Bacteria 3013
2070 Ga0500579_150348 3300053143 Bacteria 1017
2071 Ga0500604_0019070 3300053151 Bacteria 1917
2072 Ga0500604_0284338 3300053151 Bacteria 573
2073 Ga0500616_0059379 3300053153 Bacteria 1986
2074 Ga0500619_000073 3300053154 Bacteria 28363
2075 Ga0500622_0001738 3300053156 Bacteria 16832
2076 Ga0500624_028461 3300053157 Bacteria 946
2077 Ga0500624_115262 3300053157 Bacteria 561
2078 Ga0500634_0055702 3300053161 Bacteria 2114
2079 Ga0500638_016327 3300053162 Bacteria 3423
2080 Ga0500636_0214708 3300053177 Bacteria 1007
2081 Ga0500625_115871 3300053729 Bacteria 1088
2082 Ga0500645_007607 3300053730 Bacteria 3758
2083 Ga0500596_018165 3300053735 Bacteria 1055
2084 Ga0590071_099013 3300059421 Bacteria 734
2085 Ga0501082_0033320 3300060353 Bacteria 4445
2086 Ga0501082_1844706 3300060353 Bacteria 527
2087 Ga0466962_0056126 3300061719 Bacteria 1881
2088 Ga0466962_0127631 3300061719 Bacteria 1228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_1136303 Ga0451797_1136303_147_416 68
2 3300050493 nmdc:mga0k408_83530_c1 nmdc:mga0k408_83530_c1_1458_1727 69
3 3300006353 Ga0075370_10182783 Ga0075370_101827831 75
4 3300050496 nmdc:mga07m45_18099_c1 nmdc:mga07m45_18099_c1_36_305 75
5 3300050496 nmdc:mga07m45_18856_c1 nmdc:mga07m45_18856_c1_189_458 75
6 3300046691 Ga0495670_0501458 Ga0495670_0501458_10_240 76
7 3300044656 Ga0466969_0089971 Ga0466969_0089971_35_304 77
8 3300044658 Ga0466972_0020558 Ga0466972_0020558_2445_2714 77
9 3300044683 Ga0466965_0068051 Ga0466965_0068051_1329_1598 77
10 3300044684 Ga0466966_0015315 Ga0466966_0015315_4621_4890 77
11 3300044693 Ga0466961_0003217 Ga0466961_0003217_22_291 77
12 3300044694 Ga0466963_0000935 Ga0466963_0000935_10153_10422 77
13 3300044706 Ga0466964_0003021 Ga0466964_0003021_4817_5086 77
14 3300044719 Ga0466971_0382138 Ga0466971_0382138_381_650 77
15 3300044735 Ga0466968_0721818 Ga0466968_0721818_150_419 77
16 3300044765 Ga0466970_0015254 Ga0466970_0015254_95_364 77
17 3300044842 Ga0466957_0007668 Ga0466957_0007668_165_434 77
18 3300045049 Ga0466959_0013106 Ga0466959_0013106_2113_2382 77
19 3300045051 Ga0451576_0126973 Ga0451576_0126973_902_1171 77
20 3300045836 Ga0466958_0023688 Ga0466958_0023688_53_322 77
21 3300045976 Ga0466967_0021184 Ga0466967_0021184_2108_2377 77
22 3300049822 Ga0501035_0120765 Ga0501035_0120765_360_629 77
23 3300061719 Ga0466962_0056126 Ga0466962_0056126_461_730 77
24 3300003316 rootH1_10056955 rootH1_100569551 78
25 3300003322 rootL2_10040047 rootL2_100400476 78
26 3300003323 rootH1_10038325 rootH1_100383251 78
27 3300005456 Ga0070678_100074682 Ga0070678_1000746823 78
28 3300005539 Ga0068853_100522230 Ga0068853_1005222302 78
29 3300005616 Ga0068852_100429912 Ga0068852_1004299122 78
30 3300009093 Ga0105240_10002903 Ga0105240_1000290312 78
31 3300009148 Ga0105243_10008438 Ga0105243_100084385 78
32 3300009174 Ga0105241_10669885 Ga0105241_106698851 78
33 3300009545 Ga0105237_10000605 Ga0105237_1000060518 78
34 3300009551 Ga0105238_10028942 Ga0105238_100289423 78
35 3300010375 Ga0105239_10000328 Ga0105239_1000032837 78
36 3300013100 Ga0157373_11092864 Ga0157373_110928642 78
37 3300013102 Ga0157371_10907224 Ga0157371_109072242 78
38 3300025299 Ga0209256_1036914 Ga0209256_10369143 78
39 3300025913 Ga0207695_10002543 Ga0207695_1000254312 78
40 3300025914 Ga0207671_10006429 Ga0207671_100064293 78
41 3300025924 Ga0207694_10213474 Ga0207694_102134742 78
42 3300026041 Ga0207639_11608274 Ga0207639_116082742 78
43 3300026121 Ga0207683_10064870 Ga0207683_100648703 78
44 3300026142 Ga0207698_10445721 Ga0207698_104457212 78
45 3300028794 Ga0307515_10069456 Ga0307515_100694565 78
46 3300031548 Ga0307408_100000160 Ga0307408_10000016079 78
47 3300031548 Ga0307408_100166791 Ga0307408_1001667913 78
48 3300031731 Ga0307405_10996428 Ga0307405_109964281 78
49 3300031901 Ga0307406_10424736 Ga0307406_104247362 78
50 3300031911 Ga0307412_10710080 Ga0307412_107100802 78
51 3300032002 Ga0307416_100388486 Ga0307416_1003884863 78
52 3300032002 Ga0307416_101441695 Ga0307416_1014416952 78
53 3300032004 Ga0307414_11170491 Ga0307414_111704911 78
54 3300032005 Ga0307411_10022274 Ga0307411_100222743 78
55 3300037471 Ga0395905_0000071 Ga0395905_0000071_45485_45754 78
56 3300041486 Ga0451807_1456924 Ga0451807_1456924_167_436 78
57 3300041511 Ga0451855_1473803 Ga0451855_1473803_239_508 78
58 3300042004 Ga0439445_0118103 Ga0439445_0118103_476_745 78
59 3300045051 Ga0451576_0228247 Ga0451576_0228247_1552_1821 78
60 3300048910 Ga0496107_1023953 Ga0496107_1023953_63_332 78
61 3300049129 Ga0501309_000004 Ga0501309_000004_11052_11321 78
62 3300049130 Ga0501310_002992 Ga0501310_002992_197_466 78
63 3300049130 Ga0501310_019556 Ga0501310_019556_197_466 78
64 3300049161 Ga0501305_001609 Ga0501305_001609_724_993 78
65 3300049520 Ga0501297_002256 Ga0501297_002256_721_990 78
66 3300049651 Ga0501201_004855 Ga0501201_004855_883_1152 78
67 3300049654 Ga0501207_019125 Ga0501207_019125_243_512 78
68 3300049662 Ga0501222_010931 Ga0501222_010931_837_1106 78
69 3300049663 Ga0501223_035862 Ga0501223_035862_556_825 78
70 3300049665 Ga0501227_030701 Ga0501227_030701_606_875 78
71 3300049668 Ga0501233_174043 Ga0501233_174043_200_469 78
72 3300049669 Ga0501235_029982 Ga0501235_029982_340_609 78
73 3300049670 Ga0501236_062095 Ga0501236_062095_381_650 78
74 3300049674 Ga0501242_026331 Ga0501242_026331_389_658 78
75 3300049683 Ga0501253_020019 Ga0501253_020019_190_459 78
76 3300049687 Ga0501258_028345 Ga0501258_028345_180_449 78
77 3300049704 Ga0501221_000933 Ga0501221_000933_4146_4415 78
78 3300049705 Ga0501225_0032891 Ga0501225_0032891_27_296 78
79 3300049706 Ga0501229_000077 Ga0501229_000077_7388_7657 78
80 3300049757 Ga0501232_004559 Ga0501232_004559_914_1183 78
81 3300049768 Ga0501271_052504 Ga0501271_052504_52_321 78
82 3300049778 Ga0501282_007907 Ga0501282_007907_115_384 78
83 3300027360 Ga0209969_1012477 Ga0209969_10124772 79
84 3300027471 Ga0209995_1064430 Ga0209995_10644302 79
85 3300027876 Ga0209974_10034713 Ga0209974_100347132 79
86 3300049549 Ga0501333_022767 Ga0501333_022767_221_490 79
87 3300028794 Ga0307515_10524851 Ga0307515_105248512 80
88 3300031456 Ga0307513_10020857 Ga0307513_100208574 80
89 3300044656 Ga0466969_0037790 Ga0466969_0037790_1793_2062 80
90 3300044658 Ga0466972_0046599 Ga0466972_0046599_1508_1777 80
91 3300044683 Ga0466965_0108619 Ga0466965_0108619_1018_1287 80
92 3300044683 Ga0466965_0801347 Ga0466965_0801347_249_518 80
93 3300044684 Ga0466966_0752500 Ga0466966_0752500_296_565 80
94 3300044693 Ga0466961_0006410 Ga0466961_0006410_6193_6462 80
95 3300044693 Ga0466961_0043879 Ga0466961_0043879_98_367 80
96 3300044706 Ga0466964_0118004 Ga0466964_0118004_577_846 80
97 3300044765 Ga0466970_0128278 Ga0466970_0128278_402_671 80
98 3300045836 Ga0466958_0695385 Ga0466958_0695385_285_554 80
99 3300061719 Ga0466962_0127631 Ga0466962_0127631_839_1108 80
100 3300025245 Ga0207425_1002203 Ga0207425_10022035 81
101 3300042000 Ga0439437_000403 Ga0439437_000403_63_332 81
102 3300042118 Ga0450914_002759 Ga0450914_002759_75_344 81
103 3300042120 Ga0450917_007679 Ga0450917_007679_322_591 81
104 3300042127 Ga0450890_010639 Ga0450890_010639_277_546 81
105 3300042129 Ga0450891_000064 Ga0450891_000064_7273_7542 81
106 3300042130 Ga0450892_003526 Ga0450892_003526_251_520 81
107 3300042144 Ga0450889_003240 Ga0450889_003240_908_1177 81
108 3300042530 Ga0450916_001775 Ga0450916_001775_159_428 81
109 3300042532 Ga0450893_0021080 Ga0450893_0021080_713_982 81
110 3300005366 Ga0070659_100510243 Ga0070659_1005102432 82
111 3300005457 Ga0070662_101616173 Ga0070662_1016161731 82
112 3300025937 Ga0207669_11398536 Ga0207669_113985362 82
113 3300027617 Ga0210002_1106826 Ga0210002_11068262 82
114 3300031731 Ga0307405_10190515 Ga0307405_101905152 82
115 3300006051 Ga0075364_10002974 Ga0075364_1000297412 83
116 3300009545 Ga0105237_10035003 Ga0105237_100350033 83
117 3300010375 Ga0105239_10031452 Ga0105239_100314523 83
118 3300013306 Ga0163162_11324107 Ga0163162_113241072 83
119 3300031824 Ga0307413_11169348 Ga0307413_111693482 83
120 3300035092 Ga0373952_0002684 Ga0373952_0002684_2599_2850 83
121 3300035121 Ga0373960_0006818 Ga0373960_0006818_2236_2487 83
122 3300035207 Ga0373942_0031813 Ga0373942_0031813_246_497 83
123 3300035241 Ga0373961_0244560 Ga0373961_0244560_329_580 83
124 3300042156 Ga0439446_0240238 Ga0439446_0240238_267_518 83
125 3300046507 Ga0495606_0426203 Ga0495606_0426203_332_583 83
126 3300048921 Ga0496118_0078153 Ga0496118_0078153_1068_1319 83
127 3300048924 Ga0496121_0026908 Ga0496121_0026908_3443_3694 83
128 3300048925 Ga0496122_0092947 Ga0496122_0092947_178_429 83
129 3300048925 Ga0496122_0181637 Ga0496122_0181637_484_735 83
130 3300048927 Ga0496124_0135708 Ga0496124_0135708_345_596 83
131 3300048928 Ga0496125_0674360 Ga0496125_0674360_79_330 83
132 3300050489 nmdc:mga03683_51579_c1 nmdc:mga03683_51579_c1_983_1234 83
133 3300050490 nmdc:mga03n38_226732_c1 nmdc:mga03n38_226732_c1_238_489 83
134 3300050491 nmdc:mga00v17_202355_c1 nmdc:mga00v17_202355_c1_243_494 83
135 3300042876 Ga0451577_1682399 Ga0451577_1682399_195_464 84
136 3300044712 Ga0453684_0346557 Ga0453684_0346557_542_811 84
137 iso_pu_bacteria 2585428057 2587725128 85
138 iso_pu_bacteria 2585428058 2587731512 85
139 iso_pu_bacteria 2585428062 2587756191 85
140 iso_pu_bacteria 2588253510 2588295157 85
141 iso_pu_bacteria 2599185214 2599623208 85
142 iso_pu_bacteria 2599185226 2599674855 85
143 iso_pu_bacteria 2599185227 2599680812 85
144 iso_pu_bacteria 2599185229 2599692827 85
145 iso_pu_bacteria 2643221544 2643743907 85
146 iso_pu_bacteria 2643221585 2643933067 85
147 iso_pu_bacteria 2643221592 2643966984 85
148 iso_pu_bacteria 2643221625 2644142647 85
149 iso_pu_bacteria 2643221639 2644217210 85
150 iso_pu_bacteria 2643221644 2644248385 85
151 iso_pu_bacteria 2643221646 2644259022 85
152 iso_pu_bacteria 2643221648 2644273678 85
153 iso_pu_bacteria 2643221654 2644301595 85
154 iso_pu_bacteria 2643221656 2644314316 85
155 iso_pu_bacteria 2643221660 2644340934 85
156 iso_pu_bacteria 2643221683 2644467186 85
157 iso_pu_bacteria 2648501241 2649122609 85
158 iso_pu_bacteria 2651869818 2652974065 85
159 iso_pu_bacteria 2738541277 2738723941 85
160 iso_pu_bacteria 2738541307 2738882767 85
161 iso_pu_bacteria 2738541337 2739055759 85
162 iso_pu_bacteria 2738543013 2739250496 85
163 iso_pu_bacteria 2738543019 2739280468 85
164 iso_pu_bacteria 2818991446 2819600344 85
165 iso_pu_bacteria 2831265667 2831271862 85
166 iso_pu_bacteria 2838054893 2838059700 85
167 iso_pu_bacteria 2842677519 2842682804 85
168 iso_pu_bacteria 2842733646 2842735792 85
169 iso_pu_bacteria 2885192300 2885193535 85
170 iso_pu_bacteria 2885198086 2885198646 85
171 iso_pu_bacteria 2885211737 2885211974 85
172 iso_pu_bacteria 2887630918 2887632367 85
173 iso_pu_bacteria 2899924645 2899928485 85
174 iso_pu_bacteria 2904449895 2904451787 85
175 iso_pu_bacteria 2904456579 2904462556 85
176 iso_pu_bacteria 2919462493 2919467229 85
177 iso_pu_bacteria 2919493220 2919494179 85
178 iso_pu_bacteria 2919543075 2919543811 85
179 iso_pu_bacteria 2919688452 2919688610 85
180 iso_pu_bacteria 2923525760 2923525961 85
181 iso_pu_bacteria 2923525760 2923527662 85
182 iso_pu_bacteria 2928037797 2928041406 85
183 iso_pu_bacteria 2928044640 2928048248 85
184 iso_pu_bacteria 2928051484 2928056092 85
185 iso_pu_bacteria 2928064002 2928066428 85
186 iso_pu_bacteria 2928070936 2928076083 85
187 iso_pu_bacteria 2928084124 2928087728 85
188 iso_pu_bacteria 2929520902 2929523670 85
189 iso_pu_bacteria 2945945610 2945946087 85
190 iso_pu_bacteria 2945972063 2945975686 85
191 iso_pu_bacteria 2954767861 2954768861 85
192 iso_pu_bacteria 8002745576 8002746423 85
193 3300045049 Ga0466959_0250383 Ga0466959_0250383_880_1140 86
194 3300044658 Ga0466972_0041116 Ga0466972_0041116_1200_1463 87
195 3300009094 Ga0111539_10492911 Ga0111539_104929112 88
196 3300027907 Ga0207428_10621197 Ga0207428_106211972 88
197 3300044673 Ga0453683_0429046 Ga0453683_0429046_362_631 88
198 3300044673 Ga0453683_0934536 Ga0453683_0934536_206_475 88
199 3300044712 Ga0453684_0613701 Ga0453684_0613701_680_949 88
200 3300050511 nmdc:mga08y16_823151_c1 nmdc:mga08y16_823151_c1_284_553 88
201 2162886007 SwRhRL2b_contig_93844 SwRhRL2b_0132.00002910 89
202 3300001977 JGI24746J21847_1025597 JGI24746J21847_10255972 89
203 3300001979 JGI24740J21852_10030620 JGI24740J21852_100306202 89
204 3300001979 JGI24740J21852_10061013 JGI24740J21852_100610132 89
205 3300001989 JGI24739J22299_10016035 JGI24739J22299_100160353 89
206 3300001989 JGI24739J22299_10125477 JGI24739J22299_101254772 89
207 3300002067 JGI24735J21928_10247644 JGI24735J21928_102476442 89
208 3300002070 JGI24750J21931_1076289 JGI24750J21931_10762892 89
209 3300002739 JGI25158J39367_1004622 JGI25158J39367_10046222 89
210 3300002739 JGI25158J39367_1015083 JGI25158J39367_10150832 89
211 3300002773 JGI25152J39213_1006440 JGI25152J39213_10064402 89
212 3300002774 JGI25150J39212_1000713 JGI25150J39212_10007135 89
213 3300002987 JGI25159J45721_1007232 JGI25159J45721_10072322 89
214 3300002987 JGI25159J45721_1009555 JGI25159J45721_10095553 89
215 3300003187 JGI25151J46595_10016692 JGI25151J46595_100166922 89
216 3300003215 JGI25153J46596_10004412 JGI25153J46596_100044122 89
217 3300003215 JGI25153J46596_10011494 JGI25153J46596_100114945 89
218 3300003215 JGI25153J46596_10012754 JGI25153J46596_100127543 89
219 3300003215 JGI25153J46596_10014829 JGI25153J46596_100148292 89
220 3300003215 JGI25153J46596_10028238 JGI25153J46596_100282383 89
221 3300003316 rootH1_10029168 rootH1_100291682 89
222 3300003320 rootH2_10190564 rootH2_101905643 89
223 3300003322 rootL2_10046934 rootL2_100469342 89
224 3300003322 rootL2_10150001 rootL2_101500012 89
225 3300003323 rootH1_10042098 rootH1_100420986 89
226 3300003323 rootH1_10068314 rootH1_100683142 89
227 3300003347 JGI26128J50194_1000847 JGI26128J50194_10008472 89
228 3300003354 JGI25160J50197_1011152 JGI25160J50197_10111522 89
229 3300003354 JGI25160J50197_1013627 JGI25160J50197_10136274 89
230 3300003371 JGI26145J50221_1025494 JGI26145J50221_10254942 89
231 3300003374 JGI25161J50226_1003238 JGI25161J50226_10032385 89
232 3300003374 JGI25161J50226_1008435 JGI25161J50226_10084352 89
233 3300003578 Ga0006562J51391_1125153 Ga0006562J51391_11251532 89
234 3300003578 Ga0006562J51391_1125156 Ga0006562J51391_11251562 89
235 3300003758 Ga0055532_1025643 Ga0055532_10256431 89
236 3300003761 Ga0055535_1001434 Ga0055535_10014348 89
237 3300003762 Ga0055542_1000127 Ga0055542_100012789 89
238 3300003771 Ga0055526_1002532 Ga0055526_100253213 89
239 3300003771 Ga0055526_1014660 Ga0055526_10146602 89
240 3300003771 Ga0055526_1014781 Ga0055526_10147813 89
241 3300003773 Ga0055537_1005895 Ga0055537_10058952 89
242 3300003773 Ga0055537_1005952 Ga0055537_10059522 89
243 3300003775 Ga0055524_1000207 Ga0055524_10002079 89
244 3300003775 Ga0055524_1012781 Ga0055524_10127812 89
245 3300003775 Ga0055524_1015362 Ga0055524_10153623 89
246 3300003781 Ga0055536_1000530 Ga0055536_10005305 89
247 3300003781 Ga0055536_1001748 Ga0055536_10017485 89
248 3300003781 Ga0055536_1038022 Ga0055536_10380222 89
249 3300003784 Ga0055534_1003750 Ga0055534_10037505 89
250 3300003784 Ga0055534_1005868 Ga0055534_10058682 89
251 3300003784 Ga0055534_1015344 Ga0055534_10153442 89
252 3300003790 Ga0055528_1007039 Ga0055528_10070395 89
253 3300003790 Ga0055528_1013037 Ga0055528_10130374 89
254 3300003790 Ga0055528_1063074 Ga0055528_10630741 89
255 3300003790 Ga0055528_1081495 Ga0055528_10814951 89
256 3300003791 Ga0055530_10000464 Ga0055530_100004649 89
257 3300003791 Ga0055530_10020044 Ga0055530_100200442 89
258 3300003791 Ga0055530_10057447 Ga0055530_100574472 89
259 3300003791 Ga0055530_10122084 Ga0055530_101220841 89
260 3300003792 Ga0055540_1000011 Ga0055540_1000011223 89
261 3300003792 Ga0055540_1000603 Ga0055540_10006034 89
262 3300003792 Ga0055540_1002445 Ga0055540_10024452 89
263 3300003792 Ga0055540_1002836 Ga0055540_10028367 89
264 3300003792 Ga0055540_1020072 Ga0055540_10200723 89
265 3300003794 Ga0055531_10001607 Ga0055531_100016079 89
266 3300003794 Ga0055531_10001895 Ga0055531_100018958 89
267 3300003794 Ga0055531_10011526 Ga0055531_100115263 89
268 3300004625 Ga0055543_1000771 Ga0055543_100077114 89
269 3300004625 Ga0055543_1003491 Ga0055543_10034912 89
270 3300005262 Ga0065165_1001786 Ga0065165_10017869 89
271 3300005262 Ga0065165_1003619 Ga0065165_100361910 89
272 3300005262 Ga0065165_1010543 Ga0065165_10105433 89
273 3300005288 Ga0065714_10276998 Ga0065714_102769981 89
274 3300005288 Ga0065714_10299280 Ga0065714_102992802 89
275 3300005289 Ga0065704_10100495 Ga0065704_101004953 89
276 3300005289 Ga0065704_10153191 Ga0065704_101531912 89
277 3300005289 Ga0065704_10178466 Ga0065704_101784662 89
278 3300005289 Ga0065704_10251990 Ga0065704_102519902 89
279 3300005289 Ga0065704_10776945 Ga0065704_107769452 89
280 3300005290 Ga0065712_10045136 Ga0065712_100451362 89
281 3300005290 Ga0065712_10054430 Ga0065712_100544302 89
282 3300005293 Ga0065715_10145513 Ga0065715_101455131 89
283 3300005293 Ga0065715_10245821 Ga0065715_102458212 89
284 3300005327 Ga0070658_10897051 Ga0070658_108970512 89
285 3300005328 Ga0070676_10001849 Ga0070676_1000184912 89
286 3300005328 Ga0070676_10019835 Ga0070676_100198356 89
287 3300005328 Ga0070676_10083237 Ga0070676_100832372 89
288 3300005328 Ga0070676_10099580 Ga0070676_100995802 89
289 3300005328 Ga0070676_10380340 Ga0070676_103803401 89
290 3300005328 Ga0070676_10420234 Ga0070676_104202341 89
291 3300005328 Ga0070676_10617389 Ga0070676_106173892 89
292 3300005328 Ga0070676_10841459 Ga0070676_108414592 89
293 3300005328 Ga0070676_11502463 Ga0070676_115024631 89
294 3300005329 Ga0070683_100032863 Ga0070683_1000328637 89
295 3300005329 Ga0070683_100713614 Ga0070683_1007136142 89
296 3300005329 Ga0070683_100935908 Ga0070683_1009359082 89
297 3300005330 Ga0070690_100006214 Ga0070690_10000621410 89
298 3300005331 Ga0070670_100013010 Ga0070670_1000130101 89
299 3300005331 Ga0070670_100037154 Ga0070670_1000371542 89
300 3300005331 Ga0070670_100095571 Ga0070670_1000955712 89
301 3300005331 Ga0070670_100199248 Ga0070670_1001992483 89
302 3300005331 Ga0070670_100465496 Ga0070670_1004654962 89
303 3300005331 Ga0070670_100545083 Ga0070670_1005450832 89
304 3300005331 Ga0070670_100594711 Ga0070670_1005947112 89
305 3300005331 Ga0070670_100678357 Ga0070670_1006783572 89
306 3300005331 Ga0070670_100738722 Ga0070670_1007387222 89
307 3300005331 Ga0070670_100947184 Ga0070670_1009471841 89
308 3300005331 Ga0070670_101263339 Ga0070670_1012633392 89
309 3300005331 Ga0070670_101497598 Ga0070670_1014975982 89
310 3300005331 Ga0070670_101693075 Ga0070670_1016930752 89
311 3300005333 Ga0070677_10017835 Ga0070677_100178352 89
312 3300005333 Ga0070677_10033687 Ga0070677_100336873 89
313 3300005333 Ga0070677_10071030 Ga0070677_100710302 89
314 3300005333 Ga0070677_10108197 Ga0070677_101081972 89
315 3300005333 Ga0070677_10146861 Ga0070677_101468612 89
316 3300005333 Ga0070677_10241124 Ga0070677_102411241 89
317 3300005333 Ga0070677_10241125 Ga0070677_102411251 89
318 3300005333 Ga0070677_10481215 Ga0070677_104812152 89
319 3300005334 Ga0068869_100014166 Ga0068869_1000141662 89
320 3300005334 Ga0068869_100036584 Ga0068869_1000365844 89
321 3300005334 Ga0068869_100067518 Ga0068869_1000675183 89
322 3300005334 Ga0068869_100095143 Ga0068869_1000951431 89
323 3300005334 Ga0068869_100347984 Ga0068869_1003479842 89
324 3300005334 Ga0068869_100378568 Ga0068869_1003785682 89
325 3300005334 Ga0068869_100447250 Ga0068869_1004472501 89
326 3300005334 Ga0068869_100666018 Ga0068869_1006660181 89
327 3300005334 Ga0068869_101160634 Ga0068869_1011606342 89
328 3300005335 Ga0070666_10020373 Ga0070666_100203736 89
329 3300005335 Ga0070666_10071419 Ga0070666_100714195 89
330 3300005335 Ga0070666_10332138 Ga0070666_103321382 89
331 3300005335 Ga0070666_10689634 Ga0070666_106896342 89
332 3300005335 Ga0070666_10735042 Ga0070666_107350422 89
333 3300005335 Ga0070666_11311054 Ga0070666_113110541 89
334 3300005335 Ga0070666_11338559 Ga0070666_113385592 89
335 3300005335 Ga0070666_11453302 Ga0070666_114533021 89
336 3300005336 Ga0070680_100012570 Ga0070680_10001257010 89
337 3300005336 Ga0070680_100121871 Ga0070680_1001218715 89
338 3300005336 Ga0070680_100130032 Ga0070680_1001300325 89
339 3300005336 Ga0070680_101068157 Ga0070680_1010681572 89
340 3300005338 Ga0068868_100003711 Ga0068868_1000037119 89
341 3300005338 Ga0068868_100052781 Ga0068868_1000527815 89
342 3300005338 Ga0068868_100058644 Ga0068868_1000586442 89
343 3300005338 Ga0068868_100059788 Ga0068868_1000597885 89
344 3300005338 Ga0068868_100140028 Ga0068868_1001400282 89
345 3300005338 Ga0068868_100205867 Ga0068868_1002058673 89
346 3300005338 Ga0068868_100233241 Ga0068868_1002332412 89
347 3300005338 Ga0068868_100322318 Ga0068868_1003223182 89
348 3300005338 Ga0068868_100362665 Ga0068868_1003626652 89
349 3300005338 Ga0068868_100982060 Ga0068868_1009820602 89
350 3300005338 Ga0068868_101411987 Ga0068868_1014119872 89
351 3300005338 Ga0068868_102317947 Ga0068868_1023179472 89
352 3300005338 Ga0068868_102431744 Ga0068868_1024317442 89
353 3300005339 Ga0070660_100002224 Ga0070660_1000022246 89
354 3300005339 Ga0070660_101270341 Ga0070660_1012703412 89
355 3300005339 Ga0070660_101583083 Ga0070660_1015830832 89
356 3300005339 Ga0070660_101863067 Ga0070660_1018630671 89
357 3300005340 Ga0070689_100021223 Ga0070689_1000212234 89
358 3300005340 Ga0070689_101343224 Ga0070689_1013432241 89
359 3300005341 Ga0070691_10522081 Ga0070691_105220812 89
360 3300005343 Ga0070687_100038494 Ga0070687_1000384943 89
361 3300005343 Ga0070687_100496478 Ga0070687_1004964782 89
362 3300005343 Ga0070687_100518213 Ga0070687_1005182132 89
363 3300005343 Ga0070687_101353116 Ga0070687_1013531162 89
364 3300005343 Ga0070687_101443009 Ga0070687_1014430091 89
365 3300005344 Ga0070661_100005152 Ga0070661_1000051526 89
366 3300005344 Ga0070661_100042215 Ga0070661_1000422155 89
367 3300005344 Ga0070661_100219593 Ga0070661_1002195932 89
368 3300005344 Ga0070661_100597918 Ga0070661_1005979182 89
369 3300005344 Ga0070661_100783587 Ga0070661_1007835872 89
370 3300005347 Ga0070668_100013101 Ga0070668_1000131016 89
371 3300005347 Ga0070668_100130926 Ga0070668_1001309262 89
372 3300005347 Ga0070668_100246169 Ga0070668_1002461692 89
373 3300005347 Ga0070668_100467784 Ga0070668_1004677842 89
374 3300005347 Ga0070668_100583008 Ga0070668_1005830082 89
375 3300005347 Ga0070668_100617705 Ga0070668_1006177052 89
376 3300005353 Ga0070669_100015642 Ga0070669_1000156422 89
377 3300005353 Ga0070669_100071256 Ga0070669_1000712562 89
378 3300005353 Ga0070669_100097794 Ga0070669_1000977945 89
379 3300005353 Ga0070669_100160545 Ga0070669_1001605452 89
380 3300005353 Ga0070669_100426231 Ga0070669_1004262312 89
381 3300005353 Ga0070669_100704995 Ga0070669_1007049952 89
382 3300005353 Ga0070669_101135656 Ga0070669_1011356562 89
383 3300005353 Ga0070669_101481984 Ga0070669_1014819841 89
384 3300005353 Ga0070669_101570594 Ga0070669_1015705941 89
385 3300005354 Ga0070675_100000250 Ga0070675_1000002502 89
386 3300005354 Ga0070675_100003213 Ga0070675_1000032136 89
387 3300005354 Ga0070675_100011215 Ga0070675_1000112159 89
388 3300005354 Ga0070675_100012571 Ga0070675_1000125716 89
389 3300005354 Ga0070675_100018746 Ga0070675_1000187461 89
390 3300005354 Ga0070675_100025359 Ga0070675_1000253591 89
391 3300005354 Ga0070675_100114393 Ga0070675_1001143932 89
392 3300005354 Ga0070675_100171767 Ga0070675_1001717672 89
393 3300005354 Ga0070675_100207755 Ga0070675_1002077552 89
394 3300005354 Ga0070675_100326159 Ga0070675_1003261592 89
395 3300005354 Ga0070675_100419443 Ga0070675_1004194432 89
396 3300005354 Ga0070675_100571434 Ga0070675_1005714342 89
397 3300005354 Ga0070675_101423761 Ga0070675_1014237611 89
398 3300005354 Ga0070675_101469976 Ga0070675_1014699762 89
399 3300005354 Ga0070675_101820912 Ga0070675_1018209121 89
400 3300005355 Ga0070671_100006682 Ga0070671_1000066829 89
401 3300005355 Ga0070671_100126528 Ga0070671_1001265284 89
402 3300005355 Ga0070671_100152385 Ga0070671_1001523852 89
403 3300005355 Ga0070671_100202994 Ga0070671_1002029942 89
404 3300005355 Ga0070671_100315170 Ga0070671_1003151701 89
405 3300005355 Ga0070671_100440500 Ga0070671_1004405001 89
406 3300005355 Ga0070671_100656227 Ga0070671_1006562272 89
407 3300005355 Ga0070671_101156220 Ga0070671_1011562202 89
408 3300005355 Ga0070671_101169761 Ga0070671_1011697612 89
409 3300005355 Ga0070671_101200285 Ga0070671_1012002851 89
410 3300005355 Ga0070671_101970988 Ga0070671_1019709881 89
411 3300005355 Ga0070671_102000250 Ga0070671_1020002501 89
412 3300005356 Ga0070674_100002846 Ga0070674_10000284612 89
413 3300005356 Ga0070674_100029632 Ga0070674_1000296323 89
414 3300005356 Ga0070674_100038484 Ga0070674_1000384845 89
415 3300005356 Ga0070674_100233224 Ga0070674_1002332242 89
416 3300005356 Ga0070674_100792281 Ga0070674_1007922812 89
417 3300005356 Ga0070674_101416738 Ga0070674_1014167381 89
418 3300005356 Ga0070674_101536814 Ga0070674_1015368142 89
419 3300005356 Ga0070674_101616631 Ga0070674_1016166312 89
420 3300005356 Ga0070674_101700792 Ga0070674_1017007922 89
421 3300005364 Ga0070673_100027009 Ga0070673_1000270093 89
422 3300005364 Ga0070673_100073056 Ga0070673_1000730564 89
423 3300005364 Ga0070673_100102804 Ga0070673_1001028042 89
424 3300005364 Ga0070673_100164539 Ga0070673_1001645392 89
425 3300005364 Ga0070673_100260429 Ga0070673_1002604292 89
426 3300005364 Ga0070673_100274931 Ga0070673_1002749312 89
427 3300005364 Ga0070673_100329470 Ga0070673_1003294702 89
428 3300005364 Ga0070673_100490950 Ga0070673_1004909502 89
429 3300005364 Ga0070673_100768445 Ga0070673_1007684452 89
430 3300005364 Ga0070673_101126854 Ga0070673_1011268542 89
431 3300005365 Ga0070688_100004925 Ga0070688_1000049252 89
432 3300005365 Ga0070688_100578414 Ga0070688_1005784141 89
433 3300005365 Ga0070688_100648628 Ga0070688_1006486281 89
434 3300005365 Ga0070688_101656546 Ga0070688_1016565462 89
435 3300005366 Ga0070659_100008671 Ga0070659_1000086719 89
436 3300005366 Ga0070659_100011205 Ga0070659_1000112052 89
437 3300005366 Ga0070659_100051316 Ga0070659_1000513164 89
438 3300005366 Ga0070659_100710562 Ga0070659_1007105622 89
439 3300005366 Ga0070659_100882452 Ga0070659_1008824522 89
440 3300005366 Ga0070659_101020976 Ga0070659_1010209761 89
441 3300005366 Ga0070659_101026845 Ga0070659_1010268452 89
442 3300005366 Ga0070659_101090530 Ga0070659_1010905302 89
443 3300005367 Ga0070667_100039183 Ga0070667_1000391832 89
444 3300005367 Ga0070667_100257230 Ga0070667_1002572302 89
445 3300005367 Ga0070667_100334063 Ga0070667_1003340631 89
446 3300005367 Ga0070667_100334570 Ga0070667_1003345702 89
447 3300005367 Ga0070667_100354680 Ga0070667_1003546802 89
448 3300005367 Ga0070667_100533371 Ga0070667_1005333712 89
449 3300005367 Ga0070667_100958035 Ga0070667_1009580352 89
450 3300005367 Ga0070667_100989473 Ga0070667_1009894732 89
451 3300005367 Ga0070667_101176329 Ga0070667_1011763292 89
452 3300005367 Ga0070667_101205557 Ga0070667_1012055572 89
453 3300005367 Ga0070667_101609601 Ga0070667_1016096012 89
454 3300005367 Ga0070667_101677350 Ga0070667_1016773502 89
455 3300005367 Ga0070667_102151080 Ga0070667_1021510801 89
456 3300005406 Ga0070703_10571995 Ga0070703_105719951 89
457 3300005434 Ga0070709_10084240 Ga0070709_100842403 89
458 3300005435 Ga0070714_100003247 Ga0070714_10000324712 89
459 3300005436 Ga0070713_100255447 Ga0070713_1002554473 89
460 3300005436 Ga0070713_102202206 Ga0070713_1022022062 89
461 3300005437 Ga0070710_10151357 Ga0070710_101513573 89
462 3300005437 Ga0070710_10918525 Ga0070710_109185252 89
463 3300005438 Ga0070701_10500696 Ga0070701_105006962 89
464 3300005438 Ga0070701_10595090 Ga0070701_105950901 89
465 3300005439 Ga0070711_100892482 Ga0070711_1008924822 89
466 3300005440 Ga0070705_100393727 Ga0070705_1003937271 89
467 3300005441 Ga0070700_101212675 Ga0070700_1012126751 89
468 3300005445 Ga0070708_100063831 Ga0070708_1000638315 89
469 3300005445 Ga0070708_101003617 Ga0070708_1010036172 89
470 3300005455 Ga0070663_100003281 Ga0070663_1000032817 89
471 3300005455 Ga0070663_100196930 Ga0070663_1001969302 89
472 3300005455 Ga0070663_100290568 Ga0070663_1002905681 89
473 3300005455 Ga0070663_100316389 Ga0070663_1003163892 89
474 3300005455 Ga0070663_100974126 Ga0070663_1009741262 89
475 3300005455 Ga0070663_101134196 Ga0070663_1011341961 89
476 3300005455 Ga0070663_101300241 Ga0070663_1013002411 89
477 3300005455 Ga0070663_101584809 Ga0070663_1015848091 89
478 3300005455 Ga0070663_101716594 Ga0070663_1017165942 89
479 3300005456 Ga0070678_100053998 Ga0070678_1000539984 89
480 3300005456 Ga0070678_100060240 Ga0070678_1000602403 89
481 3300005456 Ga0070678_100080841 Ga0070678_1000808412 89
482 3300005456 Ga0070678_100086444 Ga0070678_1000864442 89
483 3300005456 Ga0070678_100093252 Ga0070678_1000932521 89
484 3300005456 Ga0070678_100097628 Ga0070678_1000976283 89
485 3300005456 Ga0070678_100226044 Ga0070678_1002260442 89
486 3300005456 Ga0070678_100417015 Ga0070678_1004170152 89
487 3300005456 Ga0070678_100435618 Ga0070678_1004356182 89
488 3300005456 Ga0070678_100736692 Ga0070678_1007366921 89
489 3300005456 Ga0070678_100964237 Ga0070678_1009642371 89
490 3300005456 Ga0070678_100974049 Ga0070678_1009740492 89
491 3300005456 Ga0070678_101332825 Ga0070678_1013328251 89
492 3300005456 Ga0070678_101701187 Ga0070678_1017011872 89
493 3300005456 Ga0070678_101707733 Ga0070678_1017077332 89
494 3300005456 Ga0070678_101961243 Ga0070678_1019612432 89
495 3300005456 Ga0070678_102104866 Ga0070678_1021048661 89
496 3300005457 Ga0070662_100013275 Ga0070662_1000132755 89
497 3300005457 Ga0070662_100043528 Ga0070662_1000435282 89
498 3300005457 Ga0070662_100052894 Ga0070662_1000528944 89
499 3300005457 Ga0070662_100127998 Ga0070662_1001279982 89
500 3300005457 Ga0070662_100262606 Ga0070662_1002626062 89
501 3300005457 Ga0070662_100287034 Ga0070662_1002870342 89
502 3300005457 Ga0070662_100418097 Ga0070662_1004180972 89
503 3300005457 Ga0070662_100576707 Ga0070662_1005767071 89
504 3300005457 Ga0070662_100596614 Ga0070662_1005966142 89
505 3300005457 Ga0070662_100598633 Ga0070662_1005986332 89
506 3300005457 Ga0070662_100896512 Ga0070662_1008965122 89
507 3300005457 Ga0070662_101444633 Ga0070662_1014446332 89
508 3300005457 Ga0070662_101678461 Ga0070662_1016784612 89
509 3300005458 Ga0070681_10170120 Ga0070681_101701203 89
510 3300005458 Ga0070681_10265946 Ga0070681_102659462 89
511 3300005459 Ga0068867_100000329 Ga0068867_10000032917 89
512 3300005459 Ga0068867_100001932 Ga0068867_1000019327 89
513 3300005459 Ga0068867_100020667 Ga0068867_1000206673 89
514 3300005459 Ga0068867_100056082 Ga0068867_1000560824 89
515 3300005459 Ga0068867_100102861 Ga0068867_1001028613 89
516 3300005459 Ga0068867_100115742 Ga0068867_1001157422 89
517 3300005459 Ga0068867_100178615 Ga0068867_1001786152 89
518 3300005459 Ga0068867_100248108 Ga0068867_1002481082 89
519 3300005459 Ga0068867_100422376 Ga0068867_1004223762 89
520 3300005459 Ga0068867_100548975 Ga0068867_1005489752 89
521 3300005459 Ga0068867_100623126 Ga0068867_1006231262 89
522 3300005459 Ga0068867_100691947 Ga0068867_1006919472 89
523 3300005459 Ga0068867_100944551 Ga0068867_1009445512 89
524 3300005459 Ga0068867_101049289 Ga0068867_1010492892 89
525 3300005459 Ga0068867_101129962 Ga0068867_1011299622 89
526 3300005466 Ga0070685_10693949 Ga0070685_106939492 89
527 3300005466 Ga0070685_10833306 Ga0070685_108333061 89
528 3300005466 Ga0070685_11177346 Ga0070685_111773461 89
529 3300005466 Ga0070685_11588165 Ga0070685_115881651 89
530 3300005467 Ga0070706_100004486 Ga0070706_1000044869 89
531 3300005467 Ga0070706_100096620 Ga0070706_1000966202 89
532 3300005468 Ga0070707_100355610 Ga0070707_1003556103 89
533 3300005471 Ga0070698_100138790 Ga0070698_1001387905 89
534 3300005518 Ga0070699_101436279 Ga0070699_1014362791 89
535 3300005530 Ga0070679_100043614 Ga0070679_1000436147 89
536 3300005530 Ga0070679_100212093 Ga0070679_1002120932 89
537 3300005530 Ga0070679_100241396 Ga0070679_1002413963 89
538 3300005530 Ga0070679_100475313 Ga0070679_1004753131 89
539 3300005530 Ga0070679_101126452 Ga0070679_1011264522 89
540 3300005535 Ga0070684_100181994 Ga0070684_1001819942 89
541 3300005535 Ga0070684_100202985 Ga0070684_1002029852 89
542 3300005535 Ga0070684_100775796 Ga0070684_1007757962 89
543 3300005535 Ga0070684_102145738 Ga0070684_1021457381 89
544 3300005539 Ga0068853_100004811 Ga0068853_1000048113 89
545 3300005539 Ga0068853_100007795 Ga0068853_1000077958 89
546 3300005539 Ga0068853_100010420 Ga0068853_1000104207 89
547 3300005539 Ga0068853_100105575 Ga0068853_1001055753 89
548 3300005539 Ga0068853_100160997 Ga0068853_1001609972 89
549 3300005539 Ga0068853_100281317 Ga0068853_1002813172 89
550 3300005539 Ga0068853_100490057 Ga0068853_1004900572 89
551 3300005543 Ga0070672_100001451 Ga0070672_1000014512 89
552 3300005543 Ga0070672_100015547 Ga0070672_1000155475 89
553 3300005543 Ga0070672_100021276 Ga0070672_1000212765 89
554 3300005543 Ga0070672_100027777 Ga0070672_1000277774 89
555 3300005543 Ga0070672_100030773 Ga0070672_1000307733 89
556 3300005543 Ga0070672_100033709 Ga0070672_1000337092 89
557 3300005543 Ga0070672_100042276 Ga0070672_1000422762 89
558 3300005543 Ga0070672_100135479 Ga0070672_1001354791 89
559 3300005543 Ga0070672_100318781 Ga0070672_1003187812 89
560 3300005543 Ga0070672_100332166 Ga0070672_1003321662 89
561 3300005543 Ga0070672_100412143 Ga0070672_1004121432 89
562 3300005543 Ga0070672_100572100 Ga0070672_1005721002 89
563 3300005543 Ga0070672_101391110 Ga0070672_1013911101 89
564 3300005545 Ga0070695_100085874 Ga0070695_1000858742 89
565 3300005547 Ga0070693_100026317 Ga0070693_1000263172 89
566 3300005547 Ga0070693_100629876 Ga0070693_1006298761 89
567 3300005548 Ga0070665_100543803 Ga0070665_1005438032 89
568 3300005548 Ga0070665_100790261 Ga0070665_1007902612 89
569 3300005548 Ga0070665_100853711 Ga0070665_1008537111 89
570 3300005548 Ga0070665_101205973 Ga0070665_1012059732 89
571 3300005548 Ga0070665_102467209 Ga0070665_1024672092 89
572 3300005563 Ga0068855_100015899 Ga0068855_1000158995 89
573 3300005563 Ga0068855_100019544 Ga0068855_1000195446 89
574 3300005563 Ga0068855_100399137 Ga0068855_1003991373 89
575 3300005563 Ga0068855_100409839 Ga0068855_1004098393 89
576 3300005563 Ga0068855_100546779 Ga0068855_1005467792 89
577 3300005564 Ga0070664_100001831 Ga0070664_10000183110 89
578 3300005564 Ga0070664_100040136 Ga0070664_1000401362 89
579 3300005564 Ga0070664_100148636 Ga0070664_1001486363 89
580 3300005564 Ga0070664_100230636 Ga0070664_1002306362 89
581 3300005564 Ga0070664_100262430 Ga0070664_1002624303 89
582 3300005564 Ga0070664_100285705 Ga0070664_1002857052 89
583 3300005564 Ga0070664_100512445 Ga0070664_1005124452 89
584 3300005564 Ga0070664_100832791 Ga0070664_1008327912 89
585 3300005564 Ga0070664_101046865 Ga0070664_1010468652 89
586 3300005564 Ga0070664_101047334 Ga0070664_1010473342 89
587 3300005564 Ga0070664_101638866 Ga0070664_1016388662 89
588 3300005564 Ga0070664_102223047 Ga0070664_1022230471 89
589 3300005577 Ga0068857_100001323 Ga0068857_1000013233 89
590 3300005577 Ga0068857_100188666 Ga0068857_1001886662 89
591 3300005577 Ga0068857_100220281 Ga0068857_1002202812 89
592 3300005577 Ga0068857_100804946 Ga0068857_1008049462 89
593 3300005577 Ga0068857_100923447 Ga0068857_1009234472 89
594 3300005577 Ga0068857_101427885 Ga0068857_1014278852 89
595 3300005577 Ga0068857_102188780 Ga0068857_1021887801 89
596 3300005578 Ga0068854_100014719 Ga0068854_1000147192 89
597 3300005578 Ga0068854_100499034 Ga0068854_1004990342 89
598 3300005578 Ga0068854_100691507 Ga0068854_1006915072 89
599 3300005578 Ga0068854_100801982 Ga0068854_1008019822 89
600 3300005614 Ga0068856_100012520 Ga0068856_1000125207 89
601 3300005614 Ga0068856_100234744 Ga0068856_1002347442 89
602 3300005614 Ga0068856_100588995 Ga0068856_1005889951 89
603 3300005615 Ga0070702_100330559 Ga0070702_1003305591 89
604 3300005615 Ga0070702_100390308 Ga0070702_1003903082 89
605 3300005615 Ga0070702_100970483 Ga0070702_1009704832 89
606 3300005615 Ga0070702_101678808 Ga0070702_1016788082 89
607 3300005616 Ga0068852_100003059 Ga0068852_10000305913 89
608 3300005616 Ga0068852_100003215 Ga0068852_1000032158 89
609 3300005616 Ga0068852_100005883 Ga0068852_1000058834 89
610 3300005616 Ga0068852_100060508 Ga0068852_1000605084 89
611 3300005616 Ga0068852_100063413 Ga0068852_1000634133 89
612 3300005616 Ga0068852_100081438 Ga0068852_1000814384 89
613 3300005616 Ga0068852_100085851 Ga0068852_1000858515 89
614 3300005616 Ga0068852_100281484 Ga0068852_1002814842 89
615 3300005616 Ga0068852_100289797 Ga0068852_1002897973 89
616 3300005616 Ga0068852_100338183 Ga0068852_1003381832 89
617 3300005616 Ga0068852_100496905 Ga0068852_1004969052 89
618 3300005616 Ga0068852_100623488 Ga0068852_1006234882 89
619 3300005616 Ga0068852_100877640 Ga0068852_1008776402 89
620 3300005616 Ga0068852_100944013 Ga0068852_1009440132 89
621 3300005616 Ga0068852_101778848 Ga0068852_1017788482 89
622 3300005616 Ga0068852_101993761 Ga0068852_1019937612 89
623 3300005616 Ga0068852_102203231 Ga0068852_1022032312 89
624 3300005616 Ga0068852_102555406 Ga0068852_1025554062 89
625 3300005617 Ga0068859_100024423 Ga0068859_1000244237 89
626 3300005617 Ga0068859_100030871 Ga0068859_1000308712 89
627 3300005617 Ga0068859_100205505 Ga0068859_1002055054 89
628 3300005617 Ga0068859_100420551 Ga0068859_1004205512 89
629 3300005618 Ga0068864_100003978 Ga0068864_1000039788 89
630 3300005618 Ga0068864_100026806 Ga0068864_1000268063 89
631 3300005618 Ga0068864_100070862 Ga0068864_1000708624 89
632 3300005618 Ga0068864_100074432 Ga0068864_1000744322 89
633 3300005618 Ga0068864_100186642 Ga0068864_1001866423 89
634 3300005618 Ga0068864_100507830 Ga0068864_1005078302 89
635 3300005618 Ga0068864_100959443 Ga0068864_1009594432 89
636 3300005618 Ga0068864_102179872 Ga0068864_1021798722 89
637 3300005618 Ga0068864_102491605 Ga0068864_1024916052 89
638 3300005718 Ga0068866_10010148 Ga0068866_100101482 89
639 3300005718 Ga0068866_10092812 Ga0068866_100928121 89
640 3300005718 Ga0068866_10246875 Ga0068866_102468752 89
641 3300005718 Ga0068866_10624189 Ga0068866_106241892 89
642 3300005719 Ga0068861_100007969 Ga0068861_1000079696 89
643 3300005719 Ga0068861_100050459 Ga0068861_1000504592 89
644 3300005719 Ga0068861_100252792 Ga0068861_1002527922 89
645 3300005719 Ga0068861_100566595 Ga0068861_1005665952 89
646 3300005719 Ga0068861_100754860 Ga0068861_1007548601 89
647 3300005719 Ga0068861_101024062 Ga0068861_1010240622 89
648 3300005719 Ga0068861_101437731 Ga0068861_1014377311 89
649 3300005719 Ga0068861_102366491 Ga0068861_1023664912 89
650 3300005834 Ga0068851_10010993 Ga0068851_100109936 89
651 3300005834 Ga0068851_10013080 Ga0068851_100130803 89
652 3300005834 Ga0068851_10049026 Ga0068851_100490262 89
653 3300005834 Ga0068851_10061522 Ga0068851_100615223 89
654 3300005834 Ga0068851_10110219 Ga0068851_101102192 89
655 3300005834 Ga0068851_10232097 Ga0068851_102320972 89
656 3300005834 Ga0068851_10365005 Ga0068851_103650052 89
657 3300005834 Ga0068851_10403524 Ga0068851_104035242 89
658 3300005834 Ga0068851_10871972 Ga0068851_108719722 89
659 3300005840 Ga0068870_10184872 Ga0068870_101848722 89
660 3300005840 Ga0068870_10286484 Ga0068870_102864842 89
661 3300005840 Ga0068870_10433751 Ga0068870_104337511 89
662 3300005841 Ga0068863_100019694 Ga0068863_1000196942 89
663 3300005841 Ga0068863_100076202 Ga0068863_1000762023 89
664 3300005841 Ga0068863_100160408 Ga0068863_1001604082 89
665 3300005841 Ga0068863_100294731 Ga0068863_1002947312 89
666 3300005841 Ga0068863_100352912 Ga0068863_1003529122 89
667 3300005841 Ga0068863_100587577 Ga0068863_1005875772 89
668 3300005841 Ga0068863_102685320 Ga0068863_1026853202 89
669 3300005842 Ga0068858_100001515 Ga0068858_10000151518 89
670 3300005842 Ga0068858_100001818 Ga0068858_10000181816 89
671 3300005842 Ga0068858_100003704 Ga0068858_1000037049 89
672 3300005843 Ga0068860_100001009 Ga0068860_10000100912 89
673 3300005843 Ga0068860_100003030 Ga0068860_10000303016 89
674 3300005843 Ga0068860_100057253 Ga0068860_1000572532 89
675 3300005843 Ga0068860_100249680 Ga0068860_1002496802 89
676 3300005843 Ga0068860_100730483 Ga0068860_1007304832 89
677 3300005843 Ga0068860_102665865 Ga0068860_1026658652 89
678 3300005844 Ga0068862_100036617 Ga0068862_1000366174 89
679 3300005844 Ga0068862_100243673 Ga0068862_1002436731 89
680 3300005844 Ga0068862_101222035 Ga0068862_1012220352 89
681 3300006028 Ga0070717_10994756 Ga0070717_109947562 89
682 3300006038 Ga0075365_10270767 Ga0075365_102707673 89
683 3300006042 Ga0075368_10069600 Ga0075368_100696002 89
684 3300006048 Ga0075363_100009238 Ga0075363_1000092385 89
685 3300006048 Ga0075363_100131110 Ga0075363_1001311102 89
686 3300006048 Ga0075363_100157455 Ga0075363_1001574552 89
687 3300006048 Ga0075363_100301776 Ga0075363_1003017762 89
688 3300006051 Ga0075364_10121068 Ga0075364_101210682 89
689 3300006051 Ga0075364_10187923 Ga0075364_101879232 89
690 3300006163 Ga0070715_10214039 Ga0070715_102140392 89
691 3300006173 Ga0070716_100205061 Ga0070716_1002050613 89
692 3300006173 Ga0070716_100776094 Ga0070716_1007760942 89
693 3300006175 Ga0070712_101297678 Ga0070712_1012976782 89
694 3300006177 Ga0075362_10010715 Ga0075362_100107152 89
695 3300006177 Ga0075362_10021615 Ga0075362_100216152 89
696 3300006177 Ga0075362_10064250 Ga0075362_100642503 89
697 3300006177 Ga0075362_10162263 Ga0075362_101622632 89
698 3300006177 Ga0075362_10173547 Ga0075362_101735472 89
699 3300006177 Ga0075362_10190963 Ga0075362_101909632 89
700 3300006177 Ga0075362_10409447 Ga0075362_104094471 89
701 3300006177 Ga0075362_10434037 Ga0075362_104340372 89
702 3300006177 Ga0075362_10500658 Ga0075362_105006582 89
703 3300006177 Ga0075362_10516424 Ga0075362_105164242 89
704 3300006177 Ga0075362_10672741 Ga0075362_106727412 89
705 3300006178 Ga0075367_10015588 Ga0075367_100155885 89
706 3300006178 Ga0075367_10033387 Ga0075367_100333872 89
707 3300006178 Ga0075367_10056015 Ga0075367_100560154 89
708 3300006178 Ga0075367_10078408 Ga0075367_100784083 89
709 3300006178 Ga0075367_10389942 Ga0075367_103899422 89
710 3300006186 Ga0075369_10007815 Ga0075369_100078154 89
711 3300006186 Ga0075369_10013367 Ga0075369_100133673 89
712 3300006186 Ga0075369_10104184 Ga0075369_101041842 89
713 3300006186 Ga0075369_10408093 Ga0075369_104080932 89
714 3300006195 Ga0075366_10025896 Ga0075366_100258962 89
715 3300006195 Ga0075366_10046947 Ga0075366_100469473 89
716 3300006195 Ga0075366_10058370 Ga0075366_100583702 89
717 3300006195 Ga0075366_10083646 Ga0075366_100836464 89
718 3300006195 Ga0075366_10124788 Ga0075366_101247882 89
719 3300006195 Ga0075366_10179318 Ga0075366_101793182 89
720 3300006195 Ga0075366_10251270 Ga0075366_102512702 89
721 3300006195 Ga0075366_10317687 Ga0075366_103176872 89
722 3300006195 Ga0075366_10371893 Ga0075366_103718932 89
723 3300006195 Ga0075366_10479410 Ga0075366_104794102 89
724 3300006195 Ga0075366_10485219 Ga0075366_104852192 89
725 3300006195 Ga0075366_10577374 Ga0075366_105773742 89
726 3300006195 Ga0075366_10638500 Ga0075366_106385001 89
727 3300006195 Ga0075366_10859577 Ga0075366_108595771 89
728 3300006195 Ga0075366_10944258 Ga0075366_109442582 89
729 3300006237 Ga0097621_100016134 Ga0097621_1000161347 89
730 3300006237 Ga0097621_100056447 Ga0097621_1000564472 89
731 3300006237 Ga0097621_100096593 Ga0097621_1000965932 89
732 3300006237 Ga0097621_100104372 Ga0097621_1001043724 89
733 3300006237 Ga0097621_100406286 Ga0097621_1004062862 89
734 3300006237 Ga0097621_100566255 Ga0097621_1005662552 89
735 3300006237 Ga0097621_101293660 Ga0097621_1012936602 89
736 3300006237 Ga0097621_101392461 Ga0097621_1013924612 89
737 3300006353 Ga0075370_10000524 Ga0075370_100005245 89
738 3300006353 Ga0075370_10002753 Ga0075370_100027535 89
739 3300006353 Ga0075370_10010292 Ga0075370_100102922 89
740 3300006353 Ga0075370_10014590 Ga0075370_100145906 89
741 3300006353 Ga0075370_10024961 Ga0075370_100249612 89
742 3300006353 Ga0075370_10054018 Ga0075370_100540182 89
743 3300006353 Ga0075370_10104776 Ga0075370_101047762 89
744 3300006353 Ga0075370_10130104 Ga0075370_101301042 89
745 3300006353 Ga0075370_10137636 Ga0075370_101376363 89
746 3300006353 Ga0075370_10194837 Ga0075370_101948372 89
747 3300006353 Ga0075370_10198370 Ga0075370_101983702 89
748 3300006353 Ga0075370_10321799 Ga0075370_103217992 89
749 3300006353 Ga0075370_10440707 Ga0075370_104407072 89
750 3300006353 Ga0075370_10479758 Ga0075370_104797582 89
751 3300006353 Ga0075370_10505437 Ga0075370_105054372 89
752 3300006353 Ga0075370_10511414 Ga0075370_105114142 89
753 3300006353 Ga0075370_10656904 Ga0075370_106569042 89
754 3300006353 Ga0075370_10795353 Ga0075370_107953532 89
755 3300006358 Ga0068871_100083637 Ga0068871_1000836374 89
756 3300006358 Ga0068871_100163910 Ga0068871_1001639102 89
757 3300006358 Ga0068871_100183476 Ga0068871_1001834763 89
758 3300006358 Ga0068871_100321654 Ga0068871_1003216542 89
759 3300006358 Ga0068871_100518079 Ga0068871_1005180792 89
760 3300006358 Ga0068871_100886165 Ga0068871_1008861652 89
761 3300006358 Ga0068871_100890569 Ga0068871_1008905692 89
762 3300006358 Ga0068871_101112981 Ga0068871_1011129812 89
763 3300006358 Ga0068871_101214269 Ga0068871_1012142692 89
764 3300006358 Ga0068871_101446739 Ga0068871_1014467392 89
765 3300006358 Ga0068871_101757230 Ga0068871_1017572302 89
766 3300006844 Ga0075428_100529609 Ga0075428_1005296092 89
767 3300006844 Ga0075428_101653622 Ga0075428_1016536221 89
768 3300006846 Ga0075430_100023009 Ga0075430_1000230093 89
769 3300006871 Ga0075434_100130115 Ga0075434_1001301153 89
770 3300006880 Ga0075429_100008966 Ga0075429_1000089667 89
771 3300006881 Ga0068865_100091831 Ga0068865_1000918314 89
772 3300006881 Ga0068865_100097410 Ga0068865_1000974103 89
773 3300006881 Ga0068865_100112935 Ga0068865_1001129352 89
774 3300006881 Ga0068865_100367678 Ga0068865_1003676782 89
775 3300006881 Ga0068865_100546026 Ga0068865_1005460262 89
776 3300006931 Ga0097620_100024424 Ga0097620_1000244247 89
777 3300006931 Ga0097620_100030873 Ga0097620_1000308732 89
778 3300006931 Ga0097620_100205485 Ga0097620_1002054852 89
779 3300006931 Ga0097620_100420551 Ga0097620_1004205512 89
780 3300006946 Ga0079104_1000040 Ga0079104_100004054 89
781 3300006946 Ga0079104_1044093 Ga0079104_10440932 89
782 3300006948 Ga0099826_10238378 Ga0099826_102383782 89
783 3300009011 Ga0105251_10343262 Ga0105251_103432622 89
784 3300009036 Ga0105244_10026422 Ga0105244_100264222 89
785 3300009036 Ga0105244_10480951 Ga0105244_104809511 89
786 3300009093 Ga0105240_10030212 Ga0105240_100302121 89
787 3300009093 Ga0105240_10039246 Ga0105240_100392467 89
788 3300009093 Ga0105240_10183372 Ga0105240_101833724 89
789 3300009093 Ga0105240_10221428 Ga0105240_102214282 89
790 3300009093 Ga0105240_10721263 Ga0105240_107212632 89
791 3300009094 Ga0111539_10542458 Ga0111539_105424582 89
792 3300009094 Ga0111539_10867708 Ga0111539_108677082 89
793 3300009098 Ga0105245_10008631 Ga0105245_100086316 89
794 3300009098 Ga0105245_10049840 Ga0105245_100498403 89
795 3300009098 Ga0105245_10061364 Ga0105245_100613643 89
796 3300009098 Ga0105245_10293445 Ga0105245_102934453 89
797 3300009098 Ga0105245_11520681 Ga0105245_115206812 89
798 3300009098 Ga0105245_12155683 Ga0105245_121556832 89
799 3300009101 Ga0105247_10237932 Ga0105247_102379322 89
800 3300009101 Ga0105247_10253737 Ga0105247_102537372 89
801 3300009101 Ga0105247_10947597 Ga0105247_109475971 89
802 3300009147 Ga0114129_10023973 Ga0114129_100239735 89
803 3300009147 Ga0114129_10267738 Ga0114129_102677382 89
804 3300009148 Ga0105243_10000197 Ga0105243_1000019753 89
805 3300009148 Ga0105243_10013128 Ga0105243_1001312810 89
806 3300009148 Ga0105243_10083870 Ga0105243_100838701 89
807 3300009148 Ga0105243_10312678 Ga0105243_103126782 89
808 3300009148 Ga0105243_10475551 Ga0105243_104755512 89
809 3300009148 Ga0105243_11079602 Ga0105243_110796022 89
810 3300009148 Ga0105243_11459518 Ga0105243_114595182 89
811 3300009148 Ga0105243_12658700 Ga0105243_126587001 89
812 3300009174 Ga0105241_10086637 Ga0105241_100866373 89
813 3300009174 Ga0105241_10191455 Ga0105241_101914553 89
814 3300009174 Ga0105241_11599311 Ga0105241_115993112 89
815 3300009174 Ga0105241_11902796 Ga0105241_119027962 89
816 3300009176 Ga0105242_10058974 Ga0105242_100589744 89
817 3300009176 Ga0105242_10282573 Ga0105242_102825732 89
818 3300009176 Ga0105242_10339727 Ga0105242_103397273 89
819 3300009176 Ga0105242_11759390 Ga0105242_117593902 89
820 3300009176 Ga0105242_12123191 Ga0105242_121231912 89
821 3300009177 Ga0105248_10013699 Ga0105248_100136992 89
822 3300009177 Ga0105248_10031936 Ga0105248_100319364 89
823 3300009177 Ga0105248_10285735 Ga0105248_102857353 89
824 3300009177 Ga0105248_10446577 Ga0105248_104465773 89
825 3300009177 Ga0105248_10459956 Ga0105248_104599563 89
826 3300009177 Ga0105248_10754462 Ga0105248_107544622 89
827 3300009177 Ga0105248_10989899 Ga0105248_109898992 89
828 3300009177 Ga0105248_11718831 Ga0105248_117188311 89
829 3300009177 Ga0105248_11948689 Ga0105248_119486891 89
830 3300009545 Ga0105237_10014977 Ga0105237_100149777 89
831 3300009545 Ga0105237_10021204 Ga0105237_100212049 89
832 3300009545 Ga0105237_10024647 Ga0105237_100246476 89
833 3300009545 Ga0105237_10073055 Ga0105237_100730555 89
834 3300009545 Ga0105237_10452160 Ga0105237_104521602 89
835 3300009551 Ga0105238_10001575 Ga0105238_100015757 89
836 3300009551 Ga0105238_10307061 Ga0105238_103070612 89
837 3300009551 Ga0105238_10378039 Ga0105238_103780391 89
838 3300009551 Ga0105238_10393781 Ga0105238_103937812 89
839 3300009551 Ga0105238_10483868 Ga0105238_104838682 89
840 3300009551 Ga0105238_10898267 Ga0105238_108982671 89
841 3300009553 Ga0105249_10138150 Ga0105249_101381504 89
842 3300009553 Ga0105249_10394623 Ga0105249_103946233 89
843 3300009553 Ga0105249_10755732 Ga0105249_107557322 89
844 3300009553 Ga0105249_10957132 Ga0105249_109571322 89
845 3300009553 Ga0105249_10978956 Ga0105249_109789562 89
846 3300009553 Ga0105249_12241215 Ga0105249_122412152 89
847 3300010375 Ga0105239_10026320 Ga0105239_100263202 89
848 3300010375 Ga0105239_10114097 Ga0105239_101140972 89
849 3300010375 Ga0105239_11237406 Ga0105239_112374062 89
850 3300011119 Ga0105246_10153471 Ga0105246_101534713 89
851 3300011119 Ga0105246_10439382 Ga0105246_104393822 89
852 3300011119 Ga0105246_10458010 Ga0105246_104580102 89
853 3300011119 Ga0105246_10616419 Ga0105246_106164192 89
854 3300011119 Ga0105246_11820562 Ga0105246_118205622 89
855 3300011119 Ga0105246_12419946 Ga0105246_124199462 89
856 3300012475 Ga0157317_1005765 Ga0157317_10057652 89
857 3300012478 Ga0157328_1027883 Ga0157328_10278832 89
858 3300012483 Ga0157337_1031094 Ga0157337_10310941 89
859 3300012485 Ga0157325_1015900 Ga0157325_10159002 89
860 3300012491 Ga0157329_1014777 Ga0157329_10147772 89
861 3300012495 Ga0157323_1004876 Ga0157323_10048762 89
862 3300012500 Ga0157314_1005685 Ga0157314_10056851 89
863 3300012508 Ga0157315_1034929 Ga0157315_10349291 89
864 3300012510 Ga0157316_1005909 Ga0157316_10059092 89
865 3300012512 Ga0157327_1046621 Ga0157327_10466212 89
866 3300012515 Ga0157338_1059789 Ga0157338_10597891 89
867 3300013100 Ga0157373_10009706 Ga0157373_100097065 89
868 3300013100 Ga0157373_10020413 Ga0157373_100204137 89
869 3300013100 Ga0157373_10213609 Ga0157373_102136092 89
870 3300013100 Ga0157373_10329462 Ga0157373_103294622 89
871 3300013100 Ga0157373_10371991 Ga0157373_103719912 89
872 3300013100 Ga0157373_11023067 Ga0157373_110230672 89
873 3300013102 Ga0157371_10034557 Ga0157371_100345575 89
874 3300013102 Ga0157371_10094994 Ga0157371_100949942 89
875 3300013102 Ga0157371_10095280 Ga0157371_100952803 89
876 3300013102 Ga0157371_11150079 Ga0157371_111500792 89
877 3300013102 Ga0157371_11595439 Ga0157371_115954391 89
878 3300013104 Ga0157370_10026238 Ga0157370_100262387 89
879 3300013104 Ga0157370_10233816 Ga0157370_102338163 89
880 3300013104 Ga0157370_10653068 Ga0157370_106530682 89
881 3300013104 Ga0157370_11467787 Ga0157370_114677872 89
882 3300013104 Ga0157370_11660903 Ga0157370_116609031 89
883 3300013104 Ga0157370_11811047 Ga0157370_118110472 89
884 3300013104 Ga0157370_12092579 Ga0157370_120925791 89
885 3300013105 Ga0157369_10014064 Ga0157369_100140646 89
886 3300013105 Ga0157369_10014312 Ga0157369_100143129 89
887 3300013105 Ga0157369_10298892 Ga0157369_102988923 89
888 3300013105 Ga0157369_10957638 Ga0157369_109576382 89
889 3300013296 Ga0157374_10007375 Ga0157374_100073755 89
890 3300013296 Ga0157374_10047442 Ga0157374_100474425 89
891 3300013296 Ga0157374_10074924 Ga0157374_100749244 89
892 3300013296 Ga0157374_10202503 Ga0157374_102025032 89
893 3300013296 Ga0157374_10765796 Ga0157374_107657961 89
894 3300013296 Ga0157374_10994380 Ga0157374_109943802 89
895 3300013296 Ga0157374_11476736 Ga0157374_114767362 89
896 3300013296 Ga0157374_12492433 Ga0157374_124924331 89
897 3300013297 Ga0157378_10113037 Ga0157378_101130374 89
898 3300013297 Ga0157378_10138443 Ga0157378_101384432 89
899 3300013297 Ga0157378_10754387 Ga0157378_107543872 89
900 3300013297 Ga0157378_11027931 Ga0157378_110279312 89
901 3300013297 Ga0157378_11150283 Ga0157378_111502832 89
902 3300013297 Ga0157378_11505132 Ga0157378_115051322 89
903 3300013306 Ga0163162_10023275 Ga0163162_100232757 89
904 3300013306 Ga0163162_10060967 Ga0163162_100609675 89
905 3300013306 Ga0163162_10080866 Ga0163162_100808663 89
906 3300013306 Ga0163162_10128822 Ga0163162_101288222 89
907 3300013306 Ga0163162_10218886 Ga0163162_102188862 89
908 3300013306 Ga0163162_10696994 Ga0163162_106969942 89
909 3300013306 Ga0163162_10816582 Ga0163162_108165822 89
910 3300013306 Ga0163162_11052362 Ga0163162_110523622 89
911 3300013306 Ga0163162_11054926 Ga0163162_110549262 89
912 3300013306 Ga0163162_11989478 Ga0163162_119894782 89
913 3300013306 Ga0163162_12242593 Ga0163162_122425931 89
914 3300013306 Ga0163162_12253968 Ga0163162_122539682 89
915 3300013306 Ga0163162_12395248 Ga0163162_123952482 89
916 3300013307 Ga0157372_10005958 Ga0157372_1000595814 89
917 3300013307 Ga0157372_10010263 Ga0157372_100102636 89
918 3300013307 Ga0157372_10059208 Ga0157372_100592084 89
919 3300013307 Ga0157372_10502453 Ga0157372_105024532 89
920 3300013307 Ga0157372_10507343 Ga0157372_105073433 89
921 3300013307 Ga0157372_11772534 Ga0157372_117725342 89
922 3300013307 Ga0157372_11943755 Ga0157372_119437551 89
923 3300013308 Ga0157375_10024076 Ga0157375_100240768 89
924 3300013308 Ga0157375_10044133 Ga0157375_100441335 89
925 3300013308 Ga0157375_10165940 Ga0157375_101659402 89
926 3300013308 Ga0157375_10220885 Ga0157375_102208852 89
927 3300013308 Ga0157375_10543308 Ga0157375_105433082 89
928 3300013308 Ga0157375_11008528 Ga0157375_110085282 89
929 3300013308 Ga0157375_11096261 Ga0157375_110962612 89
930 3300013308 Ga0157375_11410600 Ga0157375_114106002 89
931 3300013308 Ga0157375_11918122 Ga0157375_119181222 89
932 3300013308 Ga0157375_12704414 Ga0157375_127044142 89
933 3300013308 Ga0157375_12882360 Ga0157375_128823602 89
934 3300013308 Ga0157375_13344920 Ga0157375_133449202 89
935 3300014325 Ga0163163_10220374 Ga0163163_102203741 89
936 3300014325 Ga0163163_10251732 Ga0163163_102517322 89
937 3300014325 Ga0163163_10394057 Ga0163163_103940572 89
938 3300014325 Ga0163163_10527368 Ga0163163_105273682 89
939 3300014325 Ga0163163_10767023 Ga0163163_107670232 89
940 3300014325 Ga0163163_10998768 Ga0163163_109987682 89
941 3300014325 Ga0163163_11021015 Ga0163163_110210152 89
942 3300014325 Ga0163163_11230600 Ga0163163_112306002 89
943 3300014325 Ga0163163_11713957 Ga0163163_117139571 89
944 3300014325 Ga0163163_12521296 Ga0163163_125212962 89
945 3300014326 Ga0157380_10360353 Ga0157380_103603532 89
946 3300014326 Ga0157380_10607993 Ga0157380_106079932 89
947 3300014326 Ga0157380_10854464 Ga0157380_108544642 89
948 3300014326 Ga0157380_11008816 Ga0157380_110088162 89
949 3300014326 Ga0157380_11107608 Ga0157380_111076082 89
950 3300014326 Ga0157380_11265346 Ga0157380_112653462 89
951 3300014326 Ga0157380_11730149 Ga0157380_117301491 89
952 3300014326 Ga0157380_12519827 Ga0157380_125198272 89
953 3300014326 Ga0157380_12697823 Ga0157380_126978231 89
954 3300014326 Ga0157380_13486133 Ga0157380_134861332 89
955 3300014497 Ga0182008_10020420 Ga0182008_100204205 89
956 3300014497 Ga0182008_10096215 Ga0182008_100962152 89
957 3300014497 Ga0182008_10136468 Ga0182008_101364683 89
958 3300014497 Ga0182008_10383655 Ga0182008_103836552 89
959 3300014745 Ga0157377_10000170 Ga0157377_1000017024 89
960 3300014745 Ga0157377_10043830 Ga0157377_100438304 89
961 3300014745 Ga0157377_10165085 Ga0157377_101650852 89
962 3300014745 Ga0157377_10461045 Ga0157377_104610451 89
963 3300014968 Ga0157379_10006124 Ga0157379_100061244 89
964 3300014968 Ga0157379_10018100 Ga0157379_100181009 89
965 3300014968 Ga0157379_10039682 Ga0157379_100396824 89
966 3300014968 Ga0157379_10082445 Ga0157379_100824454 89
967 3300014968 Ga0157379_10724686 Ga0157379_107246862 89
968 3300014968 Ga0157379_11528669 Ga0157379_115286691 89
969 3300014969 Ga0157376_10029275 Ga0157376_100292755 89
970 3300014969 Ga0157376_10128576 Ga0157376_101285762 89
971 3300014969 Ga0157376_10328604 Ga0157376_103286042 89
972 3300014969 Ga0157376_10334767 Ga0157376_103347672 89
973 3300014969 Ga0157376_10537979 Ga0157376_105379792 89
974 3300014969 Ga0157376_10998736 Ga0157376_109987362 89
975 3300014969 Ga0157376_11986897 Ga0157376_119868972 89
976 3300014969 Ga0157376_12879482 Ga0157376_128794821 89
977 3300014969 Ga0157376_12881165 Ga0157376_128811652 89
978 3300015261 Ga0182006_1051132 Ga0182006_10511322 89
979 3300015261 Ga0182006_1121441 Ga0182006_11214412 89
980 3300015261 Ga0182006_1179085 Ga0182006_11790851 89
981 3300015261 Ga0182006_1273992 Ga0182006_12739922 89
982 3300015262 Ga0182007_10002567 Ga0182007_100025673 89
983 3300015265 Ga0182005_1017803 Ga0182005_10178032 89
984 3300015265 Ga0182005_1033460 Ga0182005_10334602 89
985 3300015265 Ga0182005_1120196 Ga0182005_11201962 89
986 3300015683 Ga0183362_10001 Ga0183362_10001354 89
987 3300017792 Ga0163161_10017494 Ga0163161_100174947 89
988 3300017792 Ga0163161_10144969 Ga0163161_101449693 89
989 3300017792 Ga0163161_10255007 Ga0163161_102550072 89
990 3300017792 Ga0163161_10325350 Ga0163161_103253502 89
991 3300017792 Ga0163161_10401696 Ga0163161_104016962 89
992 3300017792 Ga0163161_10443080 Ga0163161_104430802 89
993 3300017792 Ga0163161_10999557 Ga0163161_109995572 89
994 3300017792 Ga0163161_11013310 Ga0163161_110133102 89
995 3300017792 Ga0163161_11119543 Ga0163161_111195432 89
996 3300017792 Ga0163161_11681147 Ga0163161_116811471 89
997 3300017792 Ga0163161_11761836 Ga0163161_117618362 89
998 3300020082 Ga0206353_11880330 Ga0206353_118803302 89
999 3300021384 Ga0213876_10076899 Ga0213876_100768993 89
1000 3300021384 Ga0213876_10358837 Ga0213876_103588372 89
1001 3300025208 Ga0209436_102722 Ga0209436_1027222 89
1002 3300025208 Ga0209436_113640 Ga0209436_1136402 89
1003 3300025228 Ga0209672_102060 Ga0209672_1020607 89
1004 3300025229 Ga0209147_101677 Ga0209147_1016778 89
1005 3300025242 Ga0209258_100078 Ga0209258_100078235 89
1006 3300025245 Ga0207425_1000726 Ga0207425_100072612 89
1007 3300025245 Ga0207425_1000881 Ga0207425_10008817 89
1008 3300025254 Ga0209148_1000086 Ga0209148_1000086235 89
1009 3300025258 Ga0209129_1000027 Ga0209129_1000027332 89
1010 3300025258 Ga0209129_1000054 Ga0209129_1000054226 89
1011 3300025263 Ga0209565_1000317 Ga0209565_100031741 89
1012 3300025263 Ga0209565_1001263 Ga0209565_10012635 89
1013 3300025263 Ga0209565_1015434 Ga0209565_10154342 89
1014 3300025271 Ga0207666_1004468 Ga0207666_10044682 89
1015 3300025273 Ga0209673_1000168 Ga0209673_100016871 89
1016 3300025273 Ga0209673_1000355 Ga0209673_100035517 89
1017 3300025273 Ga0209673_1005247 Ga0209673_10052472 89
1018 3300025273 Ga0209673_1038095 Ga0209673_10380951 89
1019 3300025284 Ga0209130_1000206 Ga0209130_100020648 89
1020 3300025284 Ga0209130_1001172 Ga0209130_10011725 89
1021 3300025284 Ga0209130_1035061 Ga0209130_10350612 89
1022 3300025290 Ga0207673_1007194 Ga0207673_10071942 89
1023 3300025290 Ga0207673_1042741 Ga0207673_10427412 89
1024 3300025291 Ga0209675_1000388 Ga0209675_100038820 89
1025 3300025291 Ga0209675_1002561 Ga0209675_10025613 89
1026 3300025291 Ga0209675_1004338 Ga0209675_10043385 89
1027 3300025291 Ga0209675_1013516 Ga0209675_10135163 89
1028 3300025292 Ga0209676_1000103 Ga0209676_1000103161 89
1029 3300025292 Ga0209676_1000290 Ga0209676_100029063 89
1030 3300025292 Ga0209676_1005377 Ga0209676_10053777 89
1031 3300025294 Ga0209025_1000201 Ga0209025_100020164 89
1032 3300025294 Ga0209025_1019038 Ga0209025_10190382 89
1033 3300025295 Ga0209564_1000014 Ga0209564_1000014450 89
1034 3300025295 Ga0209564_1000289 Ga0209564_100028984 89
1035 3300025295 Ga0209564_1000408 Ga0209564_10004085 89
1036 3300025297 Ga0209758_1000034 Ga0209758_1000034212 89
1037 3300025297 Ga0209758_1000193 Ga0209758_1000193118 89
1038 3300025297 Ga0209758_1000208 Ga0209758_10002085 89
1039 3300025297 Ga0209758_1005547 Ga0209758_10055473 89
1040 3300025298 Ga0209050_1000012 Ga0209050_1000012545 89
1041 3300025298 Ga0209050_1000416 Ga0209050_100041677 89
1042 3300025298 Ga0209050_1001233 Ga0209050_100123312 89
1043 3300025298 Ga0209050_1005046 Ga0209050_10050465 89
1044 3300025298 Ga0209050_1008921 Ga0209050_10089212 89
1045 3300025298 Ga0209050_1052859 Ga0209050_10528592 89
1046 3300025299 Ga0209256_1000066 Ga0209256_1000066176 89
1047 3300025299 Ga0209256_1000092 Ga0209256_1000092110 89
1048 3300025299 Ga0209256_1001887 Ga0209256_10018875 89
1049 3300025299 Ga0209256_1022736 Ga0209256_10227362 89
1050 3300025302 Ga0207426_1000067 Ga0207426_1000067114 89
1051 3300025302 Ga0207426_1000266 Ga0207426_100026684 89
1052 3300025303 Ga0209051_1000019 Ga0209051_1000019465 89
1053 3300025303 Ga0209051_1000020 Ga0209051_1000020222 89
1054 3300025303 Ga0209051_1000141 Ga0209051_100014139 89
1055 3300025303 Ga0209051_1000235 Ga0209051_100023593 89
1056 3300025303 Ga0209051_1007019 Ga0209051_10070198 89
1057 3300025303 Ga0209051_1054597 Ga0209051_10545973 89
1058 3300025304 Ga0209257_1000024 Ga0209257_1000024491 89
1059 3300025304 Ga0209257_1000085 Ga0209257_1000085222 89
1060 3300025304 Ga0209257_1002015 Ga0209257_10020159 89
1061 3300025304 Ga0209257_1014801 Ga0209257_10148013 89
1062 3300025304 Ga0209257_1028057 Ga0209257_10280572 89
1063 3300025304 Ga0209257_1110720 Ga0209257_11107201 89
1064 3300025315 Ga0207697_10046050 Ga0207697_100460504 89
1065 3300025315 Ga0207697_10146000 Ga0207697_101460002 89
1066 3300025315 Ga0207697_10350704 Ga0207697_103507042 89
1067 3300025315 Ga0207697_10418582 Ga0207697_104185822 89
1068 3300025321 Ga0207656_10019106 Ga0207656_100191064 89
1069 3300025321 Ga0207656_10054086 Ga0207656_100540862 89
1070 3300025321 Ga0207656_10071784 Ga0207656_100717843 89
1071 3300025321 Ga0207656_10078424 Ga0207656_100784243 89
1072 3300025321 Ga0207656_10093435 Ga0207656_100934352 89
1073 3300025321 Ga0207656_10302931 Ga0207656_103029312 89
1074 3300025321 Ga0207656_10410776 Ga0207656_104107762 89
1075 3300025321 Ga0207656_10415708 Ga0207656_104157082 89
1076 3300025893 Ga0207682_10002310 Ga0207682_100023104 89
1077 3300025893 Ga0207682_10008487 Ga0207682_100084873 89
1078 3300025893 Ga0207682_10026248 Ga0207682_100262483 89
1079 3300025893 Ga0207682_10120596 Ga0207682_101205962 89
1080 3300025893 Ga0207682_10200063 Ga0207682_102000632 89
1081 3300025893 Ga0207682_10397213 Ga0207682_103972131 89
1082 3300025893 Ga0207682_10616884 Ga0207682_106168842 89
1083 3300025898 Ga0207692_10443623 Ga0207692_104436232 89
1084 3300025899 Ga0207642_10006194 Ga0207642_100061946 89
1085 3300025899 Ga0207642_10008862 Ga0207642_100088624 89
1086 3300025899 Ga0207642_10210723 Ga0207642_102107232 89
1087 3300025900 Ga0207710_10236509 Ga0207710_102365092 89
1088 3300025901 Ga0207688_10009912 Ga0207688_100099125 89
1089 3300025901 Ga0207688_10264029 Ga0207688_102640292 89
1090 3300025901 Ga0207688_10279028 Ga0207688_102790282 89
1091 3300025903 Ga0207680_10002216 Ga0207680_100022166 89
1092 3300025903 Ga0207680_10002264 Ga0207680_1000226412 89
1093 3300025903 Ga0207680_10270354 Ga0207680_102703542 89
1094 3300025903 Ga0207680_10358265 Ga0207680_103582652 89
1095 3300025903 Ga0207680_10474754 Ga0207680_104747542 89
1096 3300025903 Ga0207680_10895762 Ga0207680_108957621 89
1097 3300025903 Ga0207680_10945479 Ga0207680_109454792 89
1098 3300025904 Ga0207647_10221382 Ga0207647_102213822 89
1099 3300025905 Ga0207685_10025303 Ga0207685_100253033 89
1100 3300025907 Ga0207645_10003401 Ga0207645_100034012 89
1101 3300025907 Ga0207645_10026486 Ga0207645_100264865 89
1102 3300025907 Ga0207645_10046517 Ga0207645_100465173 89
1103 3300025907 Ga0207645_10102536 Ga0207645_101025363 89
1104 3300025907 Ga0207645_10207117 Ga0207645_102071172 89
1105 3300025907 Ga0207645_10231411 Ga0207645_102314111 89
1106 3300025907 Ga0207645_10313915 Ga0207645_103139151 89
1107 3300025908 Ga0207643_10062542 Ga0207643_100625422 89
1108 3300025908 Ga0207643_10173555 Ga0207643_101735552 89
1109 3300025908 Ga0207643_10379750 Ga0207643_103797502 89
1110 3300025908 Ga0207643_10581104 Ga0207643_105811042 89
1111 3300025908 Ga0207643_10883314 Ga0207643_108833142 89
1112 3300025909 Ga0207705_10033984 Ga0207705_100339846 89
1113 3300025909 Ga0207705_10276873 Ga0207705_102768732 89
1114 3300025909 Ga0207705_10609256 Ga0207705_106092562 89
1115 3300025909 Ga0207705_10673759 Ga0207705_106737592 89
1116 3300025909 Ga0207705_11448229 Ga0207705_114482292 89
1117 3300025910 Ga0207684_10005949 Ga0207684_100059496 89
1118 3300025910 Ga0207684_10071919 Ga0207684_100719194 89
1119 3300025911 Ga0207654_10082391 Ga0207654_100823912 89
1120 3300025911 Ga0207654_10736192 Ga0207654_107361922 89
1121 3300025912 Ga0207707_10174846 Ga0207707_101748463 89
1122 3300025912 Ga0207707_10425784 Ga0207707_104257842 89
1123 3300025913 Ga0207695_10032900 Ga0207695_100329001 89
1124 3300025913 Ga0207695_10061905 Ga0207695_100619053 89
1125 3300025913 Ga0207695_10088943 Ga0207695_100889435 89
1126 3300025913 Ga0207695_10218048 Ga0207695_102180483 89
1127 3300025913 Ga0207695_10638987 Ga0207695_106389872 89
1128 3300025914 Ga0207671_10010328 Ga0207671_100103287 89
1129 3300025914 Ga0207671_10022402 Ga0207671_100224025 89
1130 3300025914 Ga0207671_10035144 Ga0207671_100351445 89
1131 3300025914 Ga0207671_10499298 Ga0207671_104992982 89
1132 3300025914 Ga0207671_10610822 Ga0207671_106108222 89
1133 3300025914 Ga0207671_10997043 Ga0207671_109970432 89
1134 3300025917 Ga0207660_10141322 Ga0207660_101413221 89
1135 3300025917 Ga0207660_10458070 Ga0207660_104580702 89
1136 3300025918 Ga0207662_10052728 Ga0207662_100527282 89
1137 3300025918 Ga0207662_10434229 Ga0207662_104342292 89
1138 3300025918 Ga0207662_10449027 Ga0207662_104490272 89
1139 3300025918 Ga0207662_11227200 Ga0207662_112272001 89
1140 3300025919 Ga0207657_10002308 Ga0207657_1000230816 89
1141 3300025919 Ga0207657_10015804 Ga0207657_100158049 89
1142 3300025919 Ga0207657_10224482 Ga0207657_102244822 89
1143 3300025919 Ga0207657_11352505 Ga0207657_113525052 89
1144 3300025920 Ga0207649_10012057 Ga0207649_100120573 89
1145 3300025920 Ga0207649_10019732 Ga0207649_100197322 89
1146 3300025920 Ga0207649_10626611 Ga0207649_106266112 89
1147 3300025920 Ga0207649_10715711 Ga0207649_107157112 89
1148 3300025921 Ga0207652_10081244 Ga0207652_100812443 89
1149 3300025921 Ga0207652_10197585 Ga0207652_101975853 89
1150 3300025921 Ga0207652_10446683 Ga0207652_104466832 89
1151 3300025922 Ga0207646_10033392 Ga0207646_100333922 89
1152 3300025923 Ga0207681_10000795 Ga0207681_1000079516 89
1153 3300025923 Ga0207681_10017788 Ga0207681_100177883 89
1154 3300025923 Ga0207681_10084282 Ga0207681_100842825 89
1155 3300025923 Ga0207681_10084985 Ga0207681_100849854 89
1156 3300025923 Ga0207681_10098706 Ga0207681_100987063 89
1157 3300025923 Ga0207681_10527279 Ga0207681_105272792 89
1158 3300025923 Ga0207681_10586239 Ga0207681_105862392 89
1159 3300025924 Ga0207694_10004060 Ga0207694_100040607 89
1160 3300025924 Ga0207694_10029043 Ga0207694_100290432 89
1161 3300025924 Ga0207694_10336316 Ga0207694_103363162 89
1162 3300025924 Ga0207694_10357825 Ga0207694_103578252 89
1163 3300025924 Ga0207694_10446452 Ga0207694_104464522 89
1164 3300025925 Ga0207650_10002550 Ga0207650_100025504 89
1165 3300025925 Ga0207650_10004501 Ga0207650_100045012 89
1166 3300025925 Ga0207650_10014903 Ga0207650_100149031 89
1167 3300025925 Ga0207650_10131086 Ga0207650_101310863 89
1168 3300025925 Ga0207650_10209144 Ga0207650_102091442 89
1169 3300025925 Ga0207650_10373972 Ga0207650_103739722 89
1170 3300025925 Ga0207650_10410273 Ga0207650_104102732 89
1171 3300025925 Ga0207650_11159414 Ga0207650_111594142 89
1172 3300025925 Ga0207650_11297563 Ga0207650_112975631 89
1173 3300025926 Ga0207659_10013398 Ga0207659_100133983 89
1174 3300025926 Ga0207659_10020083 Ga0207659_100200833 89
1175 3300025926 Ga0207659_10032887 Ga0207659_100328873 89
1176 3300025926 Ga0207659_10037282 Ga0207659_100372822 89
1177 3300025926 Ga0207659_10201000 Ga0207659_102010001 89
1178 3300025926 Ga0207659_10228388 Ga0207659_102283882 89
1179 3300025926 Ga0207659_10344347 Ga0207659_103443472 89
1180 3300025926 Ga0207659_10657623 Ga0207659_106576231 89
1181 3300025926 Ga0207659_10917374 Ga0207659_109173742 89
1182 3300025926 Ga0207659_10982537 Ga0207659_109825372 89
1183 3300025926 Ga0207659_11119751 Ga0207659_111197512 89
1184 3300025927 Ga0207687_11076475 Ga0207687_110764752 89
1185 3300025927 Ga0207687_11099818 Ga0207687_110998182 89
1186 3300025929 Ga0207664_10025828 Ga0207664_100258285 89
1187 3300025931 Ga0207644_10002048 Ga0207644_1000204814 89
1188 3300025931 Ga0207644_10002949 Ga0207644_100029493 89
1189 3300025931 Ga0207644_10348255 Ga0207644_103482552 89
1190 3300025931 Ga0207644_10530117 Ga0207644_105301172 89
1191 3300025931 Ga0207644_11180534 Ga0207644_111805341 89
1192 3300025931 Ga0207644_11460616 Ga0207644_114606162 89
1193 3300025931 Ga0207644_11659747 Ga0207644_116597472 89
1194 3300025932 Ga0207690_10005174 Ga0207690_100051744 89
1195 3300025932 Ga0207690_10028785 Ga0207690_100287852 89
1196 3300025932 Ga0207690_10219101 Ga0207690_102191013 89
1197 3300025932 Ga0207690_11282417 Ga0207690_112824172 89
1198 3300025932 Ga0207690_11301379 Ga0207690_113013792 89
1199 3300025932 Ga0207690_11627988 Ga0207690_116279882 89
1200 3300025933 Ga0207706_10014450 Ga0207706_1001445010 89
1201 3300025933 Ga0207706_10032604 Ga0207706_100326042 89
1202 3300025933 Ga0207706_10208896 Ga0207706_102088962 89
1203 3300025933 Ga0207706_10265450 Ga0207706_102654503 89
1204 3300025933 Ga0207706_10445308 Ga0207706_104453082 89
1205 3300025933 Ga0207706_10474106 Ga0207706_104741062 89
1206 3300025933 Ga0207706_10616074 Ga0207706_106160742 89
1207 3300025933 Ga0207706_10761981 Ga0207706_107619812 89
1208 3300025933 Ga0207706_10886243 Ga0207706_108862432 89
1209 3300025933 Ga0207706_11121191 Ga0207706_111211912 89
1210 3300025934 Ga0207686_10046095 Ga0207686_100460952 89
1211 3300025934 Ga0207686_10047390 Ga0207686_100473904 89
1212 3300025934 Ga0207686_10131449 Ga0207686_101314492 89
1213 3300025934 Ga0207686_10249615 Ga0207686_102496152 89
1214 3300025934 Ga0207686_10289968 Ga0207686_102899683 89
1215 3300025935 Ga0207709_10000383 Ga0207709_1000038315 89
1216 3300025935 Ga0207709_10001296 Ga0207709_100012968 89
1217 3300025935 Ga0207709_10030033 Ga0207709_100300331 89
1218 3300025935 Ga0207709_10858658 Ga0207709_108586582 89
1219 3300025935 Ga0207709_10929598 Ga0207709_109295982 89
1220 3300025935 Ga0207709_11292534 Ga0207709_112925342 89
1221 3300025936 Ga0207670_10030732 Ga0207670_100307324 89
1222 3300025936 Ga0207670_10933017 Ga0207670_109330171 89
1223 3300025937 Ga0207669_10041654 Ga0207669_100416541 89
1224 3300025937 Ga0207669_10935431 Ga0207669_109354311 89
1225 3300025937 Ga0207669_11432381 Ga0207669_114323812 89
1226 3300025937 Ga0207669_11727593 Ga0207669_117275931 89
1227 3300025938 Ga0207704_10243329 Ga0207704_102433292 89
1228 3300025938 Ga0207704_10330831 Ga0207704_103308312 89
1229 3300025938 Ga0207704_10860243 Ga0207704_108602432 89
1230 3300025938 Ga0207704_11003114 Ga0207704_110031142 89
1231 3300025938 Ga0207704_11184036 Ga0207704_111840362 89
1232 3300025939 Ga0207665_10109570 Ga0207665_101095702 89
1233 3300025940 Ga0207691_10005390 Ga0207691_1000539012 89
1234 3300025940 Ga0207691_10007761 Ga0207691_1000776110 89
1235 3300025940 Ga0207691_10012093 Ga0207691_100120932 89
1236 3300025940 Ga0207691_10026402 Ga0207691_100264023 89
1237 3300025940 Ga0207691_10057886 Ga0207691_100578864 89
1238 3300025940 Ga0207691_10058275 Ga0207691_100582752 89
1239 3300025940 Ga0207691_10109518 Ga0207691_101095182 89
1240 3300025940 Ga0207691_10131930 Ga0207691_101319302 89
1241 3300025940 Ga0207691_10219778 Ga0207691_102197782 89
1242 3300025940 Ga0207691_10261767 Ga0207691_102617672 89
1243 3300025940 Ga0207691_10418523 Ga0207691_104185232 89
1244 3300025940 Ga0207691_10538352 Ga0207691_105383522 89
1245 3300025940 Ga0207691_10713981 Ga0207691_107139812 89
1246 3300025941 Ga0207711_10012457 Ga0207711_100124577 89
1247 3300025941 Ga0207711_10067509 Ga0207711_100675094 89
1248 3300025941 Ga0207711_10126201 Ga0207711_101262014 89
1249 3300025941 Ga0207711_10481256 Ga0207711_104812562 89
1250 3300025941 Ga0207711_10849956 Ga0207711_108499562 89
1251 3300025941 Ga0207711_10968069 Ga0207711_109680692 89
1252 3300025941 Ga0207711_11137038 Ga0207711_111370382 89
1253 3300025941 Ga0207711_11974308 Ga0207711_119743081 89
1254 3300025942 Ga0207689_10003512 Ga0207689_100035124 89
1255 3300025942 Ga0207689_10004908 Ga0207689_100049084 89
1256 3300025942 Ga0207689_10050658 Ga0207689_100506582 89
1257 3300025942 Ga0207689_10075589 Ga0207689_100755893 89
1258 3300025942 Ga0207689_10102173 Ga0207689_101021732 89
1259 3300025942 Ga0207689_10404359 Ga0207689_104043592 89
1260 3300025942 Ga0207689_11273389 Ga0207689_112733892 89
1261 3300025944 Ga0207661_10191726 Ga0207661_101917264 89
1262 3300025945 Ga0207679_10004109 Ga0207679_1000410911 89
1263 3300025945 Ga0207679_10011721 Ga0207679_100117216 89
1264 3300025945 Ga0207679_10014481 Ga0207679_100144813 89
1265 3300025945 Ga0207679_10053631 Ga0207679_100536312 89
1266 3300025945 Ga0207679_10061091 Ga0207679_100610912 89
1267 3300025945 Ga0207679_10417878 Ga0207679_104178782 89
1268 3300025945 Ga0207679_10613967 Ga0207679_106139672 89
1269 3300025945 Ga0207679_10749071 Ga0207679_107490712 89
1270 3300025945 Ga0207679_11674927 Ga0207679_116749272 89
1271 3300025949 Ga0207667_10002655 Ga0207667_1000265519 89
1272 3300025949 Ga0207667_10009860 Ga0207667_1000986012 89
1273 3300025949 Ga0207667_10214430 Ga0207667_102144303 89
1274 3300025949 Ga0207667_10586071 Ga0207667_105860712 89
1275 3300025960 Ga0207651_10025563 Ga0207651_100255633 89
1276 3300025960 Ga0207651_10060152 Ga0207651_100601523 89
1277 3300025960 Ga0207651_10093139 Ga0207651_100931392 89
1278 3300025960 Ga0207651_10541167 Ga0207651_105411672 89
1279 3300025960 Ga0207651_10622978 Ga0207651_106229782 89
1280 3300025960 Ga0207651_10722735 Ga0207651_107227352 89
1281 3300025960 Ga0207651_11591610 Ga0207651_115916102 89
1282 3300025960 Ga0207651_11774164 Ga0207651_117741642 89
1283 3300025961 Ga0207712_10054882 Ga0207712_100548824 89
1284 3300025961 Ga0207712_10598083 Ga0207712_105980832 89
1285 3300025961 Ga0207712_10600466 Ga0207712_106004662 89
1286 3300025961 Ga0207712_10939869 Ga0207712_109398691 89
1287 3300025972 Ga0207668_10017712 Ga0207668_100177125 89
1288 3300025972 Ga0207668_10633512 Ga0207668_106335122 89
1289 3300025972 Ga0207668_10907040 Ga0207668_109070401 89
1290 3300025972 Ga0207668_11450775 Ga0207668_114507752 89
1291 3300025981 Ga0207640_10025789 Ga0207640_100257896 89
1292 3300025981 Ga0207640_10140289 Ga0207640_101402892 89
1293 3300025981 Ga0207640_10229824 Ga0207640_102298243 89
1294 3300025981 Ga0207640_10449149 Ga0207640_104491492 89
1295 3300025981 Ga0207640_10487586 Ga0207640_104875862 89
1296 3300025981 Ga0207640_10500017 Ga0207640_105000172 89
1297 3300025981 Ga0207640_10545529 Ga0207640_105455292 89
1298 3300025981 Ga0207640_10711722 Ga0207640_107117221 89
1299 3300025986 Ga0207658_10001151 Ga0207658_100011514 89
1300 3300025986 Ga0207658_10005593 Ga0207658_100055936 89
1301 3300025986 Ga0207658_10114940 Ga0207658_101149403 89
1302 3300025986 Ga0207658_10146914 Ga0207658_101469142 89
1303 3300025986 Ga0207658_10146925 Ga0207658_101469252 89
1304 3300025986 Ga0207658_10171038 Ga0207658_101710382 89
1305 3300025986 Ga0207658_10360032 Ga0207658_103600322 89
1306 3300025986 Ga0207658_10671075 Ga0207658_106710752 89
1307 3300025986 Ga0207658_10965157 Ga0207658_109651572 89
1308 3300025986 Ga0207658_11447551 Ga0207658_114475512 89
1309 3300026023 Ga0207677_10000452 Ga0207677_100004526 89
1310 3300026023 Ga0207677_10037654 Ga0207677_100376545 89
1311 3300026023 Ga0207677_10381138 Ga0207677_103811382 89
1312 3300026023 Ga0207677_10482308 Ga0207677_104823082 89
1313 3300026023 Ga0207677_10932485 Ga0207677_109324852 89
1314 3300026023 Ga0207677_12038880 Ga0207677_120388802 89
1315 3300026035 Ga0207703_10003262 Ga0207703_1000326210 89
1316 3300026035 Ga0207703_10007044 Ga0207703_100070442 89
1317 3300026035 Ga0207703_10121427 Ga0207703_101214273 89
1318 3300026035 Ga0207703_10413074 Ga0207703_104130742 89
1319 3300026041 Ga0207639_10005439 Ga0207639_100054395 89
1320 3300026041 Ga0207639_10025544 Ga0207639_100255444 89
1321 3300026041 Ga0207639_10117049 Ga0207639_101170493 89
1322 3300026041 Ga0207639_10190198 Ga0207639_101901982 89
1323 3300026041 Ga0207639_10248274 Ga0207639_102482743 89
1324 3300026041 Ga0207639_10354566 Ga0207639_103545662 89
1325 3300026041 Ga0207639_10634407 Ga0207639_106344072 89
1326 3300026041 Ga0207639_12256148 Ga0207639_122561482 89
1327 3300026067 Ga0207678_10002363 Ga0207678_1000236310 89
1328 3300026067 Ga0207678_10098740 Ga0207678_100987403 89
1329 3300026067 Ga0207678_10305127 Ga0207678_103051272 89
1330 3300026067 Ga0207678_10831301 Ga0207678_108313012 89
1331 3300026067 Ga0207678_10968874 Ga0207678_109688742 89
1332 3300026067 Ga0207678_11193875 Ga0207678_111938751 89
1333 3300026075 Ga0207708_10064706 Ga0207708_100647063 89
1334 3300026075 Ga0207708_10458336 Ga0207708_104583362 89
1335 3300026078 Ga0207702_10044080 Ga0207702_100440806 89
1336 3300026078 Ga0207702_10182928 Ga0207702_101829281 89
1337 3300026078 Ga0207702_10578685 Ga0207702_105786852 89
1338 3300026078 Ga0207702_12211938 Ga0207702_122119381 89
1339 3300026088 Ga0207641_10013179 Ga0207641_100131798 89
1340 3300026088 Ga0207641_10026325 Ga0207641_100263254 89
1341 3300026088 Ga0207641_10038644 Ga0207641_100386446 89
1342 3300026088 Ga0207641_10167453 Ga0207641_101674533 89
1343 3300026088 Ga0207641_10429589 Ga0207641_104295892 89
1344 3300026088 Ga0207641_10494108 Ga0207641_104941082 89
1345 3300026088 Ga0207641_11613931 Ga0207641_116139312 89
1346 3300026089 Ga0207648_10000748 Ga0207648_1000074821 89
1347 3300026089 Ga0207648_10004891 Ga0207648_100048912 89
1348 3300026089 Ga0207648_10009156 Ga0207648_1000915612 89
1349 3300026089 Ga0207648_10015290 Ga0207648_100152903 89
1350 3300026089 Ga0207648_10018447 Ga0207648_100184474 89
1351 3300026089 Ga0207648_10153113 Ga0207648_101531133 89
1352 3300026089 Ga0207648_10159491 Ga0207648_101594914 89
1353 3300026089 Ga0207648_10308103 Ga0207648_103081032 89
1354 3300026089 Ga0207648_10503985 Ga0207648_105039852 89
1355 3300026089 Ga0207648_10877779 Ga0207648_108777792 89
1356 3300026089 Ga0207648_10996400 Ga0207648_109964001 89
1357 3300026089 Ga0207648_11329572 Ga0207648_113295722 89
1358 3300026089 Ga0207648_11568146 Ga0207648_115681461 89
1359 3300026095 Ga0207676_10012508 Ga0207676_100125083 89
1360 3300026095 Ga0207676_10042218 Ga0207676_100422181 89
1361 3300026095 Ga0207676_10052796 Ga0207676_100527965 89
1362 3300026095 Ga0207676_10149898 Ga0207676_101498984 89
1363 3300026095 Ga0207676_10163884 Ga0207676_101638842 89
1364 3300026095 Ga0207676_10873679 Ga0207676_108736792 89
1365 3300026095 Ga0207676_12560108 Ga0207676_125601081 89
1366 3300026116 Ga0207674_10000040 Ga0207674_1000004093 89
1367 3300026116 Ga0207674_10009428 Ga0207674_100094285 89
1368 3300026116 Ga0207674_10078389 Ga0207674_100783893 89
1369 3300026116 Ga0207674_10082081 Ga0207674_100820812 89
1370 3300026116 Ga0207674_10253170 Ga0207674_102531702 89
1371 3300026116 Ga0207674_10773161 Ga0207674_107731612 89
1372 3300026116 Ga0207674_10871479 Ga0207674_108714792 89
1373 3300026116 Ga0207674_11484866 Ga0207674_114848662 89
1374 3300026116 Ga0207674_11607913 Ga0207674_116079131 89
1375 3300026118 Ga0207675_100003386 Ga0207675_10000338620 89
1376 3300026118 Ga0207675_100005550 Ga0207675_1000055504 89
1377 3300026118 Ga0207675_100059119 Ga0207675_1000591192 89
1378 3300026118 Ga0207675_100100746 Ga0207675_1001007464 89
1379 3300026118 Ga0207675_100731231 Ga0207675_1007312312 89
1380 3300026118 Ga0207675_100812892 Ga0207675_1008128922 89
1381 3300026121 Ga0207683_10008569 Ga0207683_100085699 89
1382 3300026121 Ga0207683_10037960 Ga0207683_100379602 89
1383 3300026121 Ga0207683_10089863 Ga0207683_100898632 89
1384 3300026121 Ga0207683_10116457 Ga0207683_101164572 89
1385 3300026121 Ga0207683_10145705 Ga0207683_101457052 89
1386 3300026121 Ga0207683_10278749 Ga0207683_102787491 89
1387 3300026121 Ga0207683_10307655 Ga0207683_103076552 89
1388 3300026121 Ga0207683_10410972 Ga0207683_104109722 89
1389 3300026121 Ga0207683_10548197 Ga0207683_105481972 89
1390 3300026121 Ga0207683_10574489 Ga0207683_105744892 89
1391 3300026121 Ga0207683_10632075 Ga0207683_106320752 89
1392 3300026121 Ga0207683_11151674 Ga0207683_111516742 89
1393 3300026121 Ga0207683_12101076 Ga0207683_121010762 89
1394 3300026142 Ga0207698_10005011 Ga0207698_100050112 89
1395 3300026142 Ga0207698_10011131 Ga0207698_100111314 89
1396 3300026142 Ga0207698_10115704 Ga0207698_101157043 89
1397 3300026142 Ga0207698_10672177 Ga0207698_106721772 89
1398 3300026142 Ga0207698_10688459 Ga0207698_106884592 89
1399 3300026142 Ga0207698_10787371 Ga0207698_107873712 89
1400 3300026142 Ga0207698_10798694 Ga0207698_107986942 89
1401 3300026142 Ga0207698_10994822 Ga0207698_109948222 89
1402 3300026142 Ga0207698_11031752 Ga0207698_110317522 89
1403 3300026142 Ga0207698_11308235 Ga0207698_113082351 89
1404 3300026142 Ga0207698_11328955 Ga0207698_113289552 89
1405 3300026142 Ga0207698_12659290 Ga0207698_126592901 89
1406 3300026142 Ga0207698_12698549 Ga0207698_126985491 89
1407 3300027111 Ga0209281_1000074 Ga0209281_1000074134 89
1408 3300027378 Ga0209981_1004500 Ga0209981_10045002 89
1409 3300027395 Ga0209996_1002081 Ga0209996_10020813 89
1410 3300027471 Ga0209995_1016563 Ga0209995_10165632 89
1411 3300027526 Ga0209968_1000140 Ga0209968_100014010 89
1412 3300027543 Ga0209999_1004899 Ga0209999_10048992 89
1413 3300027695 Ga0209966_1000388 Ga0209966_10003887 89
1414 3300027866 Ga0209813_10061166 Ga0209813_100611662 89
1415 3300027876 Ga0209974_10006661 Ga0209974_100066612 89
1416 3300027876 Ga0209974_10284711 Ga0209974_102847111 89
1417 3300027907 Ga0207428_10876374 Ga0207428_108763742 89
1418 3300028379 Ga0268266_10037082 Ga0268266_100370827 89
1419 3300028379 Ga0268266_11230998 Ga0268266_112309982 89
1420 3300028379 Ga0268266_11705868 Ga0268266_117058681 89
1421 3300028380 Ga0268265_10098075 Ga0268265_100980752 89
1422 3300028380 Ga0268265_10121264 Ga0268265_101212644 89
1423 3300028380 Ga0268265_10914139 Ga0268265_109141392 89
1424 3300028381 Ga0268264_10003378 Ga0268264_1000337815 89
1425 3300028381 Ga0268264_10003920 Ga0268264_100039204 89
1426 3300028381 Ga0268264_10141634 Ga0268264_101416344 89
1427 3300028381 Ga0268264_10672979 Ga0268264_106729792 89
1428 3300028381 Ga0268264_11168625 Ga0268264_111686252 89
1429 3300028381 Ga0268264_11655308 Ga0268264_116553082 89
1430 3300028381 Ga0268264_12694867 Ga0268264_126948672 89
1431 3300028653 Ga0265323_10180575 Ga0265323_101805752 89
1432 3300028786 Ga0307517_10005592 Ga0307517_1000559216 89
1433 3300028786 Ga0307517_10193402 Ga0307517_101934022 89
1434 3300028786 Ga0307517_10222524 Ga0307517_102225242 89
1435 3300028786 Ga0307517_10569249 Ga0307517_105692492 89
1436 3300028794 Ga0307515_10000165 Ga0307515_1000016595 89
1437 3300028794 Ga0307515_10000232 Ga0307515_1000023251 89
1438 3300028794 Ga0307515_10000716 Ga0307515_1000071671 89
1439 3300028794 Ga0307515_10009711 Ga0307515_1000971118 89
1440 3300028794 Ga0307515_10029175 Ga0307515_100291755 89
1441 3300028794 Ga0307515_10100821 Ga0307515_101008215 89
1442 3300028794 Ga0307515_10280252 Ga0307515_102802522 89
1443 3300029957 Ga0265324_10000007 Ga0265324_1000000789 89
1444 3300030522 Ga0307512_10125965 Ga0307512_101259652 89
1445 3300030522 Ga0307512_10310690 Ga0307512_103106901 89
1446 3300030733 Ga0314311_1161279 Ga0314311_11612795 89
1447 3300030734 Ga0316179_1013512 Ga0316179_10135125 89
1448 3300030735 Ga0316178_1081817 Ga0316178_10818173 89
1449 3300030736 Ga0316180_1033826 Ga0316180_10338262 89
1450 3300030742 Ga0316183_1096459 Ga0316183_10964592 89
1451 3300030744 Ga0316181_1169024 Ga0316181_11690243 89
1452 3300030745 Ga0316182_1190268 Ga0316182_11902685 89
1453 3300030745 Ga0316182_1435093 Ga0316182_14350932 89
1454 3300031239 Ga0265328_10004603 Ga0265328_100046037 89
1455 3300031239 Ga0265328_10270814 Ga0265328_102708142 89
1456 3300031250 Ga0265331_10002534 Ga0265331_1000253412 89
1457 3300031250 Ga0265331_10165768 Ga0265331_101657682 89
1458 3300031251 Ga0265327_10000028 Ga0265327_10000028172 89
1459 3300031251 Ga0265327_10005919 Ga0265327_100059199 89
1460 3300031251 Ga0265327_10256515 Ga0265327_102565152 89
1461 3300031344 Ga0265316_10000181 Ga0265316_1000018145 89
1462 3300031344 Ga0265316_10040823 Ga0265316_100408235 89
1463 3300031344 Ga0265316_10175648 Ga0265316_101756482 89
1464 3300031456 Ga0307513_10198447 Ga0307513_101984472 89
1465 3300031456 Ga0307513_10223635 Ga0307513_102236351 89
1466 3300031456 Ga0307513_10336433 Ga0307513_103364332 89
1467 3300031456 Ga0307513_10382862 Ga0307513_103828622 89
1468 3300031456 Ga0307513_10392021 Ga0307513_103920211 89
1469 3300031456 Ga0307513_10757889 Ga0307513_107578891 89
1470 3300031507 Ga0307509_10047896 Ga0307509_100478964 89
1471 3300031507 Ga0307509_10070806 Ga0307509_100708064 89
1472 3300031507 Ga0307509_10166102 Ga0307509_101661022 89
1473 3300031507 Ga0307509_10255000 Ga0307509_102550002 89
1474 3300031507 Ga0307509_10258468 Ga0307509_102584683 89
1475 3300031507 Ga0307509_10388258 Ga0307509_103882582 89
1476 3300031548 Ga0307408_100034418 Ga0307408_1000344184 89
1477 3300031548 Ga0307408_100045283 Ga0307408_1000452834 89
1478 3300031548 Ga0307408_100158236 Ga0307408_1001582362 89
1479 3300031548 Ga0307408_100202535 Ga0307408_1002025351 89
1480 3300031548 Ga0307408_100550048 Ga0307408_1005500482 89
1481 3300031548 Ga0307408_101009952 Ga0307408_1010099522 89
1482 3300031548 Ga0307408_101237660 Ga0307408_1012376602 89
1483 3300031548 Ga0307408_101609315 Ga0307408_1016093152 89
1484 3300031548 Ga0307408_101710987 Ga0307408_1017109872 89
1485 3300031548 Ga0307408_102394828 Ga0307408_1023948282 89
1486 3300031616 Ga0307508_10000016 Ga0307508_1000001641 89
1487 3300031616 Ga0307508_10001467 Ga0307508_1000146730 89
1488 3300031616 Ga0307508_10052609 Ga0307508_100526093 89
1489 3300031616 Ga0307508_10538212 Ga0307508_105382122 89
1490 3300031616 Ga0307508_10576065 Ga0307508_105760652 89
1491 3300031649 Ga0307514_10037190 Ga0307514_100371907 89
1492 3300031649 Ga0307514_10375139 Ga0307514_103751392 89
1493 3300031730 Ga0307516_10004400 Ga0307516_1000440020 89
1494 3300031730 Ga0307516_10035476 Ga0307516_100354766 89
1495 3300031730 Ga0307516_10058975 Ga0307516_100589754 89
1496 3300031730 Ga0307516_10128425 Ga0307516_101284254 89
1497 3300031730 Ga0307516_10356786 Ga0307516_103567862 89
1498 3300031730 Ga0307516_10363028 Ga0307516_103630282 89
1499 3300031730 Ga0307516_10453728 Ga0307516_104537281 89
1500 3300031731 Ga0307405_10021832 Ga0307405_100218326 89
1501 3300031731 Ga0307405_10053071 Ga0307405_100530715 89
1502 3300031731 Ga0307405_10058871 Ga0307405_100588715 89
1503 3300031731 Ga0307405_10226137 Ga0307405_102261371 89
1504 3300031731 Ga0307405_10260018 Ga0307405_102600182 89
1505 3300031731 Ga0307405_10894422 Ga0307405_108944222 89
1506 3300031731 Ga0307405_11040726 Ga0307405_110407262 89
1507 3300031731 Ga0307405_11075034 Ga0307405_110750342 89
1508 3300031731 Ga0307405_11313412 Ga0307405_113134121 89
1509 3300031731 Ga0307405_11440125 Ga0307405_114401252 89
1510 3300031731 Ga0307405_11608569 Ga0307405_116085691 89
1511 3300031824 Ga0307413_10199627 Ga0307413_101996272 89
1512 3300031824 Ga0307413_12123964 Ga0307413_121239641 89
1513 3300031852 Ga0307410_10006186 Ga0307410_100061866 89
1514 3300031852 Ga0307410_10493002 Ga0307410_104930022 89
1515 3300031852 Ga0307410_10699597 Ga0307410_106995972 89
1516 3300031852 Ga0307410_11238769 Ga0307410_112387692 89
1517 3300031901 Ga0307406_10009086 Ga0307406_100090868 89
1518 3300031901 Ga0307406_10048547 Ga0307406_100485474 89
1519 3300031901 Ga0307406_10154488 Ga0307406_101544883 89
1520 3300031901 Ga0307406_10613602 Ga0307406_106136022 89
1521 3300031901 Ga0307406_10795272 Ga0307406_107952722 89
1522 3300031903 Ga0307407_10125284 Ga0307407_101252842 89
1523 3300031903 Ga0307407_10197530 Ga0307407_101975301 89
1524 3300031903 Ga0307407_10237909 Ga0307407_102379092 89
1525 3300031903 Ga0307407_10789264 Ga0307407_107892642 89
1526 3300031911 Ga0307412_10008934 Ga0307412_100089342 89
1527 3300031911 Ga0307412_10106523 Ga0307412_101065231 89
1528 3300031911 Ga0307412_10152178 Ga0307412_101521783 89
1529 3300031911 Ga0307412_10156542 Ga0307412_101565422 89
1530 3300031911 Ga0307412_10209380 Ga0307412_102093802 89
1531 3300031911 Ga0307412_10427755 Ga0307412_104277552 89
1532 3300031911 Ga0307412_10565616 Ga0307412_105656162 89
1533 3300031911 Ga0307412_10725839 Ga0307412_107258392 89
1534 3300031911 Ga0307412_11299118 Ga0307412_112991182 89
1535 3300031911 Ga0307412_11376482 Ga0307412_113764822 89
1536 3300031911 Ga0307412_11639177 Ga0307412_116391771 89
1537 3300031995 Ga0307409_100001314 Ga0307409_10000131410 89
1538 3300031995 Ga0307409_100049671 Ga0307409_1000496715 89
1539 3300031995 Ga0307409_100065516 Ga0307409_1000655165 89
1540 3300031995 Ga0307409_101124546 Ga0307409_1011245462 89
1541 3300031995 Ga0307409_101406187 Ga0307409_1014061871 89
1542 3300031995 Ga0307409_101614946 Ga0307409_1016149461 89
1543 3300032002 Ga0307416_100020404 Ga0307416_1000204044 89
1544 3300032002 Ga0307416_100063772 Ga0307416_1000637723 89
1545 3300032002 Ga0307416_100071278 Ga0307416_1000712782 89
1546 3300032002 Ga0307416_100087114 Ga0307416_1000871142 89
1547 3300032002 Ga0307416_100320417 Ga0307416_1003204173 89
1548 3300032002 Ga0307416_100345066 Ga0307416_1003450662 89
1549 3300032002 Ga0307416_100568835 Ga0307416_1005688352 89
1550 3300032002 Ga0307416_100997030 Ga0307416_1009970302 89
1551 3300032002 Ga0307416_101727569 Ga0307416_1017275691 89
1552 3300032002 Ga0307416_103778436 Ga0307416_1037784361 89
1553 3300032004 Ga0307414_10057023 Ga0307414_100570235 89
1554 3300032004 Ga0307414_10115978 Ga0307414_101159782 89
1555 3300032004 Ga0307414_10116063 Ga0307414_101160632 89
1556 3300032004 Ga0307414_10149621 Ga0307414_101496214 89
1557 3300032004 Ga0307414_10594092 Ga0307414_105940922 89
1558 3300032004 Ga0307414_10808429 Ga0307414_108084292 89
1559 3300032004 Ga0307414_10881583 Ga0307414_108815832 89
1560 3300032004 Ga0307414_12122285 Ga0307414_121222852 89
1561 3300032005 Ga0307411_10006938 Ga0307411_100069384 89
1562 3300032005 Ga0307411_10239552 Ga0307411_102395522 89
1563 3300032005 Ga0307411_10247367 Ga0307411_102473672 89
1564 3300032005 Ga0307411_10814359 Ga0307411_108143592 89
1565 3300032005 Ga0307411_10968779 Ga0307411_109687792 89
1566 3300032005 Ga0307411_12363398 Ga0307411_123633982 89
1567 3300032126 Ga0307415_100004417 Ga0307415_10000441710 89
1568 3300032126 Ga0307415_100124110 Ga0307415_1001241101 89
1569 3300032126 Ga0307415_100152845 Ga0307415_1001528453 89
1570 3300032126 Ga0307415_100894793 Ga0307415_1008947932 89
1571 3300032126 Ga0307415_101060223 Ga0307415_1010602231 89
1572 3300033179 Ga0307507_10031462 Ga0307507_100314622 89
1573 3300033179 Ga0307507_10055670 Ga0307507_100556701 89
1574 3300033179 Ga0307507_10376296 Ga0307507_103762962 89
1575 3300033180 Ga0307510_10000568 Ga0307510_1000056836 89
1576 3300033180 Ga0307510_10564632 Ga0307510_105646321 89
1577 3300034818 Ga0373950_0004635 Ga0373950_0004635_1385_1654 89
1578 3300034819 Ga0373958_0028957 Ga0373958_0028957_388_657 89
1579 3300034820 Ga0373959_0080937 Ga0373959_0080937_271_540 89
1580 3300034957 Ga0373938_0018968 Ga0373938_0018968_449_718 89
1581 3300034957 Ga0373938_0247902 Ga0373938_0247902_147_416 89
1582 3300035084 Ga0373928_0027809 Ga0373928_0027809_897_1166 89
1583 3300035084 Ga0373928_0114285 Ga0373928_0114285_160_429 89
1584 3300035088 Ga0373940_0035128 Ga0373940_0035128_388_657 89
1585 3300035089 Ga0373944_0326561 Ga0373944_0326561_256_525 89
1586 3300035092 Ga0373952_0052535 Ga0373952_0052535_444_713 89
1587 3300035112 Ga0373932_0018539 Ga0373932_0018539_950_1219 89
1588 3300035112 Ga0373932_0030415 Ga0373932_0030415_1072_1341 89
1589 3300035114 Ga0373939_0133835 Ga0373939_0133835_310_579 89
1590 3300035115 Ga0373941_0042220 Ga0373941_0042220_389_658 89
1591 3300035116 Ga0373945_0413159 Ga0373945_0413159_148_417 89
1592 3300035117 Ga0373953_0270922 Ga0373953_0270922_97_366 89
1593 3300035171 Ga0373946_0179335 Ga0373946_0179335_267_536 89
1594 3300035171 Ga0373946_0189477 Ga0373946_0189477_199_468 89
1595 3300035241 Ga0373961_0112681 Ga0373961_0112681_347_616 89
1596 3300035242 Ga0373962_0019072 Ga0373962_0019072_545_814 89
1597 3300035242 Ga0373962_0040272 Ga0373962_0040272_367_636 89
1598 3300035410 Ga0373924_0050922 Ga0373924_0050922_958_1227 89
1599 3300035691 Ga0373931_0007502 Ga0373931_0007502_4604_4873 89
1600 3300035691 Ga0373931_0306109 Ga0373931_0306109_317_586 89
1601 3300035692 Ga0373935_0664801 Ga0373935_0664801_408_677 89
1602 3300035725 Ga0373947_0273281 Ga0373947_0273281_171_440 89
1603 3300036401 Ga0373937_0168463 Ga0373937_0168463_294_563 89
1604 3300036401 Ga0373937_0377255 Ga0373937_0377255_863_1132 89
1605 3300036401 Ga0373937_1291590 Ga0373937_1291590_180_449 89
1606 3300036401 Ga0373937_1872254 Ga0373937_1872254_135_404 89
1607 3300037068 Ga0373925_0219622 Ga0373925_0219622_854_1123 89
1608 3300037068 Ga0373925_0487964 Ga0373925_0487964_56_325 89
1609 3300037466 Ga0395898_0707204 Ga0395898_0707204_125_394 89
1610 3300037471 Ga0395905_0003377 Ga0395905_0003377_11299_11568 89
1611 3300037471 Ga0395905_0158997 Ga0395905_0158997_1705_1974 89
1612 3300037471 Ga0395905_0205360 Ga0395905_0205360_1061_1330 89
1613 3300037471 Ga0395905_0292538 Ga0395905_0292538_576_845 89
1614 3300037471 Ga0395905_0637559 Ga0395905_0637559_198_467 89
1615 3300037471 Ga0395905_0726434 Ga0395905_0726434_91_360 89
1616 3300037471 Ga0395905_1171095 Ga0395905_1171095_111_380 89
1617 3300037471 Ga0395905_1245362 Ga0395905_1245362_161_430 89
1618 3300039062 Ga0400483_050487 Ga0400483_050487_44762_45031 89
1619 3300039062 Ga0400483_054100 Ga0400483_054100_539_808 89
1620 3300039062 Ga0400483_058112 Ga0400483_058112_6098_6367 89
1621 3300039062 Ga0400483_147621 Ga0400483_147621_8730_8999 89
1622 3300039062 Ga0400483_243387 Ga0400483_243387_50549_50818 89
1623 3300039062 Ga0400483_250036 Ga0400483_250036_78461_78730 89
1624 3300039062 Ga0400483_259735 Ga0400483_259735_3087_3356 89
1625 3300039437 Ga0436365_0385285 Ga0436365_0385285_450_719 89
1626 3300039437 Ga0436365_0393891 Ga0436365_0393891_319_588 89
1627 3300039437 Ga0436365_0508202 Ga0436365_0508202_619_888 89
1628 3300039437 Ga0436365_1754335 Ga0436365_1754335_661_930 89
1629 3300039437 Ga0436365_1910867 Ga0436365_1910867_1346_1615 89
1630 3300041404 Ga0439436_0000087 Ga0439436_0000087_14458_14727 89
1631 3300041405 Ga0439438_022946 Ga0439438_022946_695_964 89
1632 3300041406 Ga0439439_0023785 Ga0439439_0023785_725_994 89
1633 3300041407 Ga0439447_029848 Ga0439447_029848_861_1130 89
1634 3300041410 Ga0439461_0005108 Ga0439461_0005108_1156_1425 89
1635 3300041410 Ga0439461_0036152 Ga0439461_0036152_668_937 89
1636 3300041411 Ga0439466_0016508 Ga0439466_0016508_1861_2130 89
1637 3300041411 Ga0439466_0045273 Ga0439466_0045273_536_805 89
1638 3300041411 Ga0439466_0049909 Ga0439466_0049909_943_1212 89
1639 3300041413 Ga0439465_0008564 Ga0439465_0008564_405_674 89
1640 3300041413 Ga0439465_0134195 Ga0439465_0134195_568_837 89
1641 3300041441 Ga0451787_135752 Ga0451787_135752_230_499 89
1642 3300041443 Ga0451789_0485836 Ga0451789_0485836_370_639 89
1643 3300041443 Ga0451789_0873756 Ga0451789_0873756_398_667 89
1644 3300041443 Ga0451789_1195116 Ga0451789_1195116_236_505 89
1645 3300041443 Ga0451789_1353168 Ga0451789_1353168_70_339 89
1646 3300041451 Ga0451791_0888711 Ga0451791_0888711_19_288 89
1647 3300041451 Ga0451791_1547075 Ga0451791_1547075_472_741 89
1648 3300041452 Ga0451793_0351601 Ga0451793_0351601_107_376 89
1649 3300041452 Ga0451793_0606671 Ga0451793_0606671_744_1013 89
1650 3300041452 Ga0451793_0969557 Ga0451793_0969557_1285_1554 89
1651 3300041452 Ga0451793_1911556 Ga0451793_1911556_102_371 89
1652 3300041453 Ga0451797_0651689 Ga0451797_0651689_282_551 89
1653 3300041453 Ga0451797_1454471 Ga0451797_1454471_418_687 89
1654 3300041453 Ga0451797_1559014 Ga0451797_1559014_241_510 89
1655 3300041456 Ga0451795_0264279 Ga0451795_0264279_214_483 89
1656 3300041456 Ga0451795_0458032 Ga0451795_0458032_126_395 89
1657 3300041456 Ga0451795_0612071 Ga0451795_0612071_483_752 89
1658 3300041456 Ga0451795_1631029 Ga0451795_1631029_138_407 89
1659 3300041458 Ga0451798_0075940 Ga0451798_0075940_1820_2089 89
1660 3300041459 Ga0451800_0112075 Ga0451800_0112075_245_514 89
1661 3300041460 Ga0451802_0039409 Ga0451802_0039409_540_809 89
1662 3300041460 Ga0451802_0496814 Ga0451802_0496814_133_402 89
1663 3300041460 Ga0451802_1029972 Ga0451802_1029972_85_354 89
1664 3300041463 Ga0451804_1177037 Ga0451804_1177037_319_588 89
1665 3300041491 Ga0451833_0642716 Ga0451833_0642716_1054_1323 89
1666 3300041491 Ga0451833_0671749 Ga0451833_0671749_109_378 89
1667 3300041491 Ga0451833_0863719 Ga0451833_0863719_603_872 89
1668 3300041496 Ga0451839_0092707 Ga0451839_0092707_95_364 89
1669 3300041496 Ga0451839_0195547 Ga0451839_0195547_495_764 89
1670 3300041496 Ga0451839_1646573 Ga0451839_1646573_107_376 89
1671 3300041498 Ga0451841_0064685 Ga0451841_0064685_200_469 89
1672 3300041498 Ga0451841_0374427 Ga0451841_0374427_143_412 89
1673 3300041505 Ga0451849_0140783 Ga0451849_0140783_469_738 89
1674 3300041505 Ga0451849_1174768 Ga0451849_1174768_347_616 89
1675 3300041507 Ga0451851_0377524 Ga0451851_0377524_14_283 89
1676 3300041507 Ga0451851_0664708 Ga0451851_0664708_262_531 89
1677 3300041507 Ga0451851_0775016 Ga0451851_0775016_144_413 89
1678 3300041509 Ga0451843_0094093 Ga0451843_0094093_161_430 89
1679 3300041509 Ga0451843_0289726 Ga0451843_0289726_47_316 89
1680 3300041509 Ga0451843_1448663 Ga0451843_1448663_287_556 89
1681 3300041512 Ga0451853_0258583 Ga0451853_0258583_300_569 89
1682 3300041512 Ga0451853_0312486 Ga0451853_0312486_928_1197 89
1683 3300041512 Ga0451853_2717321 Ga0451853_2717321_739_1008 89
1684 3300041512 Ga0451853_2957169 Ga0451853_2957169_363_632 89
1685 3300041512 Ga0451853_3970409 Ga0451853_3970409_158_427 89
1686 3300041997 Ga0439431_0002540 Ga0439431_0002540_3337_3606 89
1687 3300041997 Ga0439431_0019679 Ga0439431_0019679_64_333 89
1688 3300041997 Ga0439431_0161495 Ga0439431_0161495_35_304 89
1689 3300041999 Ga0439433_0006733 Ga0439433_0006733_1421_1690 89
1690 3300041999 Ga0439433_0009312 Ga0439433_0009312_222_491 89
1691 3300042004 Ga0439445_0000816 Ga0439445_0000816_3971_4240 89
1692 3300042004 Ga0439445_0067787 Ga0439445_0067787_368_637 89
1693 3300042006 Ga0439432_004375 Ga0439432_004375_4410_4679 89
1694 3300042007 Ga0439449_0005260 Ga0439449_0005260_886_1155 89
1695 3300042007 Ga0439449_0009502 Ga0439449_0009502_1577_1846 89
1696 3300042007 Ga0439449_0019959 Ga0439449_0019959_1804_2073 89
1697 3300042007 Ga0439449_0035314 Ga0439449_0035314_902_1171 89
1698 3300042007 Ga0439449_0069502 Ga0439449_0069502_727_996 89
1699 3300042007 Ga0439449_0269811 Ga0439449_0269811_337_606 89
1700 3300042010 Ga0439452_001338 Ga0439452_001338_4476_4745 89
1701 3300042010 Ga0439452_021923 Ga0439452_021923_638_907 89
1702 3300042012 Ga0439455_0023026 Ga0439455_0023026_782_1051 89
1703 3300042012 Ga0439455_0031169 Ga0439455_0031169_1045_1314 89
1704 3300042012 Ga0439455_0103196 Ga0439455_0103196_510_779 89
1705 3300042014 Ga0439457_006319 Ga0439457_006319_2078_2347 89
1706 3300042014 Ga0439457_037410 Ga0439457_037410_644_913 89
1707 3300042014 Ga0439457_160441 Ga0439457_160441_128_397 89
1708 3300042015 Ga0439462_0003614 Ga0439462_0003614_72_341 89
1709 3300042015 Ga0439462_0005695 Ga0439462_0005695_1687_1956 89
1710 3300042015 Ga0439462_0082272 Ga0439462_0082272_494_763 89
1711 3300042016 Ga0439463_155667 Ga0439463_155667_270_539 89
1712 3300042115 Ga0450911_022634 Ga0450911_022634_319_588 89
1713 3300042121 Ga0450919_000846 Ga0450919_000846_3274_3543 89
1714 3300042122 Ga0450920_033140 Ga0450920_033140_266_535 89
1715 3300042124 Ga0450922_013808 Ga0450922_013808_84_353 89
1716 3300042125 Ga0450923_062420 Ga0450923_062420_35_304 89
1717 3300042129 Ga0450891_018549 Ga0450891_018549_189_458 89
1718 3300042130 Ga0450892_020418 Ga0450892_020418_306_575 89
1719 3300042131 Ga0450894_001711 Ga0450894_001711_2774_3043 89
1720 3300042133 Ga0450896_048175 Ga0450896_048175_198_467 89
1721 3300042134 Ga0450898_030446 Ga0450898_030446_546_815 89
1722 3300042134 Ga0450898_030894 Ga0450898_030894_703_972 89
1723 3300042134 Ga0450898_055455 Ga0450898_055455_119_388 89
1724 3300042135 Ga0450899_009529 Ga0450899_009529_435_704 89
1725 3300042145 Ga0450906_007913 Ga0450906_007913_452_721 89
1726 3300042146 Ga0450907_019923 Ga0450907_019923_766_1035 89
1727 3300042147 Ga0450910_042973 Ga0450910_042973_70_339 89
1728 3300042156 Ga0439446_0004543 Ga0439446_0004543_2876_3145 89
1729 3300042156 Ga0439446_0253262 Ga0439446_0253262_41_310 89
1730 3300042185 Ga0450909_002243 Ga0450909_002243_1199_1468 89
1731 3300042185 Ga0450909_012351 Ga0450909_012351_876_1145 89
1732 3300042435 Ga0439434_0005187 Ga0439434_0005187_1073_1342 89
1733 3300042435 Ga0439434_0032148 Ga0439434_0032148_566_835 89
1734 3300042435 Ga0439434_0106731 Ga0439434_0106731_96_365 89
1735 3300042435 Ga0439434_0120244 Ga0439434_0120244_64_333 89
1736 3300042435 Ga0439434_0184084 Ga0439434_0184084_333_602 89
1737 3300042437 Ga0439444_0193484 Ga0439444_0193484_56_325 89
1738 3300042438 Ga0439459_0079902 Ga0439459_0079902_16_285 89
1739 3300042439 Ga0439464_0021522 Ga0439464_0021522_1211_1480 89
1740 3300042439 Ga0439464_0169221 Ga0439464_0169221_296_565 89
1741 3300042461 Ga0439460_0146488 Ga0439460_0146488_31_300 89
1742 3300042531 Ga0450918_000344 Ga0450918_000344_5488_5757 89
1743 3300042531 Ga0450918_083618 Ga0450918_083618_325_594 89
1744 3300042532 Ga0450893_0059738 Ga0450893_0059738_346_615 89
1745 3300042876 Ga0451577_0026364 Ga0451577_0026364_3222_3491 89
1746 3300042876 Ga0451577_0061568 Ga0451577_0061568_2327_2596 89
1747 3300042993 Ga0439440_0185855 Ga0439440_0185855_132_401 89
1748 3300044658 Ga0466972_0035894 Ga0466972_0035894_268_537 89
1749 3300044658 Ga0466972_0170373 Ga0466972_0170373_454_723 89
1750 3300044673 Ga0453683_0394669 Ga0453683_0394669_399_668 89
1751 3300044683 Ga0466965_0131641 Ga0466965_0131641_772_1041 89
1752 3300044683 Ga0466965_0212725 Ga0466965_0212725_610_879 89
1753 3300044683 Ga0466965_0386555 Ga0466965_0386555_130_399 89
1754 3300044712 Ga0453684_0000917 Ga0453684_0000917_66808_67077 89
1755 3300044712 Ga0453684_0001658 Ga0453684_0001658_534_803 89
1756 3300044712 Ga0453684_0017401 Ga0453684_0017401_10841_11110 89
1757 3300044712 Ga0453684_0051049 Ga0453684_0051049_2577_2846 89
1758 3300044712 Ga0453684_0272674 Ga0453684_0272674_950_1219 89
1759 3300044712 Ga0453684_1282602 Ga0453684_1282602_166_435 89
1760 3300044735 Ga0466968_0005264 Ga0466968_0005264_4099_4368 89
1761 3300044765 Ga0466970_0007142 Ga0466970_0007142_4378_4647 89
1762 3300044901 Ga0466960_0012592 Ga0466960_0012592_1966_2235 89
1763 3300044901 Ga0466960_0654384 Ga0466960_0654384_111_380 89
1764 3300045051 Ga0451576_0034152 Ga0451576_0034152_1962_2231 89
1765 3300045051 Ga0451576_0312262 Ga0451576_0312262_1211_1480 89
1766 3300045051 Ga0451576_0393108 Ga0451576_0393108_601_870 89
1767 3300045051 Ga0451576_0422698 Ga0451576_0422698_945_1214 89
1768 3300045051 Ga0451576_1296890 Ga0451576_1296890_384_653 89
1769 3300045976 Ga0466967_0546277 Ga0466967_0546277_467_736 89
1770 3300045976 Ga0466967_1103268 Ga0466967_1103268_150_419 89
1771 3300046453 Ga0495627_032297 Ga0495627_032297_1158_1427 89
1772 3300046457 Ga0495590_0131290 Ga0495590_0131290_404_673 89
1773 3300046459 Ga0495629_0040968 Ga0495629_0040968_1954_2223 89
1774 3300046460 Ga0495638_0191549 Ga0495638_0191549_79_348 89
1775 3300046460 Ga0495638_0240052 Ga0495638_0240052_248_517 89
1776 3300046460 Ga0495638_0306508 Ga0495638_0306508_25_294 89
1777 3300046462 Ga0495651_0038375 Ga0495651_0038375_538_807 89
1778 3300046471 Ga0495650_0002988 Ga0495650_0002988_4950_5219 89
1779 3300046471 Ga0495650_0147479 Ga0495650_0147479_166_435 89
1780 3300046471 Ga0495650_0200566 Ga0495650_0200566_202_471 89
1781 3300046472 Ga0495580_0175846 Ga0495580_0175846_112_381 89
1782 3300046472 Ga0495580_0631714 Ga0495580_0631714_267_536 89
1783 3300046473 Ga0495582_0409091 Ga0495582_0409091_270_539 89
1784 3300046473 Ga0495582_0418253 Ga0495582_0418253_380_649 89
1785 3300046473 Ga0495582_0578047 Ga0495582_0578047_249_518 89
1786 3300046474 Ga0495605_0484521 Ga0495605_0484521_133_402 89
1787 3300046475 Ga0495639_0518165 Ga0495639_0518165_62_331 89
1788 3300046476 Ga0495662_0358629 Ga0495662_0358629_243_512 89
1789 3300046477 Ga0495664_0543098 Ga0495664_0543098_130_399 89
1790 3300046506 Ga0495583_0380114 Ga0495583_0380114_126_395 89
1791 3300046507 Ga0495606_0103334 Ga0495606_0103334_79_348 89
1792 3300046507 Ga0495606_0184202 Ga0495606_0184202_814_1083 89
1793 3300046507 Ga0495606_0619442 Ga0495606_0619442_125_394 89
1794 3300046512 Ga0495610_0020900 Ga0495610_0020900_1619_1888 89
1795 3300046512 Ga0495610_0035222 Ga0495610_0035222_2094_2363 89
1796 3300046512 Ga0495610_0201109 Ga0495610_0201109_230_499 89
1797 3300046513 Ga0495616_0002648 Ga0495616_0002648_4195_4464 89
1798 3300046514 Ga0495618_0779930 Ga0495618_0779930_44_313 89
1799 3300046515 Ga0495620_0083637 Ga0495620_0083637_773_1042 89
1800 3300046515 Ga0495620_0134181 Ga0495620_0134181_36_305 89
1801 3300046515 Ga0495620_0309700 Ga0495620_0309700_304_573 89
1802 3300046516 Ga0495628_0503705 Ga0495628_0503705_127_396 89
1803 3300046516 Ga0495628_0630016 Ga0495628_0630016_124_393 89
1804 3300046517 Ga0495630_0141411 Ga0495630_0141411_1531_1800 89
1805 3300046518 Ga0495631_0000024 Ga0495631_0000024_82300_82569 89
1806 3300046519 Ga0495632_0007918 Ga0495632_0007918_2787_3056 89
1807 3300046519 Ga0495632_0010962 Ga0495632_0010962_4854_5123 89
1808 3300046519 Ga0495632_0067015 Ga0495632_0067015_1204_1473 89
1809 3300046519 Ga0495632_0485708 Ga0495632_0485708_89_358 89
1810 3300046520 Ga0495637_0010974 Ga0495637_0010974_2658_2927 89
1811 3300046520 Ga0495637_0282631 Ga0495637_0282631_176_445 89
1812 3300046522 Ga0495643_0106698 Ga0495643_0106698_62_331 89
1813 3300046522 Ga0495643_0248979 Ga0495643_0248979_371_640 89
1814 3300046524 Ga0495648_0371714 Ga0495648_0371714_254_523 89
1815 3300046526 Ga0495666_0197046 Ga0495666_0197046_328_597 89
1816 3300046528 Ga0495642_0091393 Ga0495642_0091393_216_485 89
1817 3300046528 Ga0495642_0176947 Ga0495642_0176947_476_745 89
1818 3300046529 Ga0495652_0345447 Ga0495652_0345447_726_995 89
1819 3300046530 Ga0495654_0041183 Ga0495654_0041183_1643_1912 89
1820 3300046533 Ga0495640_0302006 Ga0495640_0302006_275_544 89
1821 3300046535 Ga0495586_0208483 Ga0495586_0208483_148_417 89
1822 3300046535 Ga0495586_0445148 Ga0495586_0445148_192_461 89
1823 3300046536 Ga0495587_0680751 Ga0495587_0680751_189_458 89
1824 3300046537 Ga0495598_0018863 Ga0495598_0018863_1342_1611 89
1825 3300046537 Ga0495598_0021212 Ga0495598_0021212_853_1122 89
1826 3300046539 Ga0495621_0003869 Ga0495621_0003869_801_1070 89
1827 3300046539 Ga0495621_0058128 Ga0495621_0058128_919_1188 89
1828 3300046539 Ga0495621_0162718 Ga0495621_0162718_256_525 89
1829 3300046542 Ga0495597_0010476 Ga0495597_0010476_2958_3227 89
1830 3300046543 Ga0495645_0203502 Ga0495645_0203502_371_640 89
1831 3300046543 Ga0495645_0313913 Ga0495645_0313913_438_707 89
1832 3300046557 Ga0495622_0121235 Ga0495622_0121235_852_1121 89
1833 3300046558 Ga0495633_0254105 Ga0495633_0254105_499_768 89
1834 3300046559 Ga0495667_0114833 Ga0495667_0114833_366_635 89
1835 3300046559 Ga0495667_0623864 Ga0495667_0623864_187_456 89
1836 3300046615 Ga0495656_0001070 Ga0495656_0001070_3827_4096 89
1837 3300046616 Ga0495668_0056564 Ga0495668_0056564_77_346 89
1838 3300046616 Ga0495668_0148126 Ga0495668_0148126_212_481 89
1839 3300046616 Ga0495668_0340680 Ga0495668_0340680_249_518 89
1840 3300046648 Ga0495611_0037183 Ga0495611_0037183_441_710 89
1841 3300046648 Ga0495611_0352882 Ga0495611_0352882_345_614 89
1842 3300046660 Ga0495625_0021963 Ga0495625_0021963_3473_3742 89
1843 3300046660 Ga0495625_0040736 Ga0495625_0040736_951_1220 89
1844 3300046660 Ga0495625_0060694 Ga0495625_0060694_1133_1402 89
1845 3300046660 Ga0495625_0078070 Ga0495625_0078070_158_427 89
1846 3300046660 Ga0495625_0161052 Ga0495625_0161052_1185_1454 89
1847 3300046660 Ga0495625_0683058 Ga0495625_0683058_73_342 89
1848 3300046663 Ga0495635_0146612 Ga0495635_0146612_949_1218 89
1849 3300046663 Ga0495635_0283978 Ga0495635_0283978_735_1004 89
1850 3300046663 Ga0495635_0298249 Ga0495635_0298249_722_991 89
1851 3300046674 Ga0495588_0026440 Ga0495588_0026440_1527_1796 89
1852 3300046674 Ga0495588_0067240 Ga0495588_0067240_543_812 89
1853 3300046674 Ga0495588_0542843 Ga0495588_0542843_125_394 89
1854 3300046675 Ga0495657_0592767 Ga0495657_0592767_242_511 89
1855 3300046678 Ga0495599_0642120 Ga0495599_0642120_98_367 89
1856 3300046680 Ga0495646_0176976 Ga0495646_0176976_28_297 89
1857 3300046680 Ga0495646_0186533 Ga0495646_0186533_417_686 89
1858 3300046680 Ga0495646_0525651 Ga0495646_0525651_34_303 89
1859 3300046681 Ga0495647_0029408 Ga0495647_0029408_642_911 89
1860 3300046681 Ga0495647_0145353 Ga0495647_0145353_188_457 89
1861 3300046683 Ga0495658_0014926 Ga0495658_0014926_3523_3792 89
1862 3300046683 Ga0495658_0093624 Ga0495658_0093624_342_611 89
1863 3300046683 Ga0495658_0164808 Ga0495658_0164808_610_879 89
1864 3300046683 Ga0495658_0226087 Ga0495658_0226087_660_929 89
1865 3300046689 Ga0495613_0231866 Ga0495613_0231866_370_639 89
1866 3300046690 Ga0495624_0413054 Ga0495624_0413054_423_692 89
1867 3300046691 Ga0495670_0733163 Ga0495670_0733163_29_298 89
1868 3300046691 Ga0495670_0818997 Ga0495670_0818997_101_370 89
1869 3300046692 Ga0495671_0115776 Ga0495671_0115776_643_912 89
1870 3300046692 Ga0495671_0151942 Ga0495671_0151942_489_758 89
1871 3300046692 Ga0495671_0330015 Ga0495671_0330015_232_501 89
1872 3300046694 Ga0495649_0009554 Ga0495649_0009554_5099_5368 89
1873 3300046794 Ga0495589_0137142 Ga0495589_0137142_286_555 89
1874 3300046809 Ga0495600_0792769 Ga0495600_0792769_216_485 89
1875 3300046809 Ga0495600_0822637 Ga0495600_0822637_106_375 89
1876 3300046810 Ga0495660_0119551 Ga0495660_0119551_244_513 89
1877 3300046810 Ga0495660_0368547 Ga0495660_0368547_326_595 89
1878 3300047315 Ga0495581_0511806 Ga0495581_0511806_261_530 89
1879 3300047315 Ga0495581_0903825 Ga0495581_0903825_65_334 89
1880 3300047319 Ga0495674_1479822 Ga0495674_1479822_129_398 89
1881 3300047321 Ga0495676_0035806 Ga0495676_0035806_355_624 89
1882 3300047321 Ga0495676_0078953 Ga0495676_0078953_2017_2286 89
1883 3300047321 Ga0495676_0682244 Ga0495676_0682244_46_315 89
1884 3300047322 Ga0495680_0048736 Ga0495680_0048736_259_528 89
1885 3300047443 Ga0495687_002064 Ga0495687_002064_8656_8925 89
1886 3300047443 Ga0495687_005696 Ga0495687_005696_2546_2815 89
1887 3300047443 Ga0495687_022510 Ga0495687_022510_2536_2805 89
1888 3300047469 Ga0495673_0107757 Ga0495673_0107757_632_901 89
1889 3300047469 Ga0495673_0153463 Ga0495673_0153463_359_628 89
1890 3300047470 Ga0495681_0392955 Ga0495681_0392955_37_306 89
1891 3300047471 Ga0495684_0548175 Ga0495684_0548175_140_409 89
1892 3300047472 Ga0495686_0133926 Ga0495686_0133926_733_1002 89
1893 3300047472 Ga0495686_0149048 Ga0495686_0149048_808_1077 89
1894 3300048089 Ga0495614_0183605 Ga0495614_0183605_639_908 89
1895 3300048089 Ga0495614_0219437 Ga0495614_0219437_40_309 89
1896 3300048090 Ga0495615_0023842 Ga0495615_0023842_940_1209 89
1897 3300048090 Ga0495615_0132714 Ga0495615_0132714_265_534 89
1898 3300048090 Ga0495615_0168331 Ga0495615_0168331_20_289 89
1899 3300048091 Ga0495626_0050116 Ga0495626_0050116_1569_1838 89
1900 3300048091 Ga0495626_0090337 Ga0495626_0090337_160_429 89
1901 3300048903 Ga0496100_0046363 Ga0496100_0046363_160_429 89
1902 3300048903 Ga0496100_0058669 Ga0496100_0058669_839_1108 89
1903 3300048903 Ga0496100_0849746 Ga0496100_0849746_143_412 89
1904 3300048903 Ga0496100_1204822 Ga0496100_1204822_207_476 89
1905 3300048904 Ga0496101_0005293 Ga0496101_0005293_6929_7198 89
1906 3300048904 Ga0496101_0008869 Ga0496101_0008869_3146_3415 89
1907 3300048904 Ga0496101_0019357 Ga0496101_0019357_2319_2588 89
1908 3300048904 Ga0496101_0692603 Ga0496101_0692603_192_461 89
1909 3300048904 Ga0496101_0891250 Ga0496101_0891250_22_291 89
1910 3300048905 Ga0496102_0004160 Ga0496102_0004160_6362_6631 89
1911 3300048905 Ga0496102_0022357 Ga0496102_0022357_4524_4793 89
1912 3300048905 Ga0496102_0025441 Ga0496102_0025441_894_1163 89
1913 3300048905 Ga0496102_1735265 Ga0496102_1735265_20_289 89
1914 3300048906 Ga0496103_0052729 Ga0496103_0052729_581_850 89
1915 3300048906 Ga0496103_0545910 Ga0496103_0545910_166_435 89
1916 3300048907 Ga0496104_0004072 Ga0496104_0004072_5856_6125 89
1917 3300048907 Ga0496104_0225894 Ga0496104_0225894_31_300 89
1918 3300048908 Ga0496105_0013340 Ga0496105_0013340_2142_2411 89
1919 3300048908 Ga0496105_0335099 Ga0496105_0335099_40_309 89
1920 3300048908 Ga0496105_0346090 Ga0496105_0346090_20_289 89
1921 3300048908 Ga0496105_1017770 Ga0496105_1017770_140_409 89
1922 3300048909 Ga0496106_0004162 Ga0496106_0004162_2088_2357 89
1923 3300048909 Ga0496106_0054027 Ga0496106_0054027_2561_2830 89
1924 3300048909 Ga0496106_0118004 Ga0496106_0118004_1527_1796 89
1925 3300048910 Ga0496107_0012377 Ga0496107_0012377_3467_3736 89
1926 3300048910 Ga0496107_0185959 Ga0496107_0185959_1117_1386 89
1927 3300048910 Ga0496107_0743017 Ga0496107_0743017_324_593 89
1928 3300048910 Ga0496107_1315008 Ga0496107_1315008_166_435 89
1929 3300048911 Ga0496108_0017286 Ga0496108_0017286_4482_4751 89
1930 3300048911 Ga0496108_0054001 Ga0496108_0054001_2021_2290 89
1931 3300048911 Ga0496108_0059614 Ga0496108_0059614_2023_2292 89
1932 3300048911 Ga0496108_1037113 Ga0496108_1037113_222_491 89
1933 3300048912 Ga0496109_0040199 Ga0496109_0040199_1123_1392 89
1934 3300048912 Ga0496109_0069350 Ga0496109_0069350_2712_2981 89
1935 3300048912 Ga0496109_0499406 Ga0496109_0499406_114_383 89
1936 3300048912 Ga0496109_0508627 Ga0496109_0508627_839_1108 89
1937 3300048912 Ga0496109_0959386 Ga0496109_0959386_68_337 89
1938 3300048913 Ga0496110_0010357 Ga0496110_0010357_6443_6712 89
1939 3300048913 Ga0496110_0110191 Ga0496110_0110191_15_284 89
1940 3300048913 Ga0496110_0238223 Ga0496110_0238223_235_504 89
1941 3300048914 Ga0496111_0226566 Ga0496111_0226566_266_535 89
1942 3300048914 Ga0496111_0824314 Ga0496111_0824314_355_624 89
1943 3300048915 Ga0496112_0290238 Ga0496112_0290238_420_689 89
1944 3300048916 Ga0496113_0185358 Ga0496113_0185358_237_506 89
1945 3300048916 Ga0496113_0713531 Ga0496113_0713531_31_300 89
1946 3300048917 Ga0496114_0022464 Ga0496114_0022464_1514_1783 89
1947 3300048917 Ga0496114_0419093 Ga0496114_0419093_652_921 89
1948 3300048917 Ga0496114_0563757 Ga0496114_0563757_702_971 89
1949 3300048917 Ga0496114_0736330 Ga0496114_0736330_342_611 89
1950 3300048917 Ga0496114_1051712 Ga0496114_1051712_294_563 89
1951 3300048918 Ga0496115_0002077 Ga0496115_0002077_12321_12590 89
1952 3300048919 Ga0496116_0066945 Ga0496116_0066945_1239_1508 89
1953 3300048920 Ga0496117_0004106 Ga0496117_0004106_4771_5040 89
1954 3300048920 Ga0496117_0051373 Ga0496117_0051373_513_782 89
1955 3300048920 Ga0496117_0195326 Ga0496117_0195326_135_404 89
1956 3300048921 Ga0496118_0009212 Ga0496118_0009212_4275_4544 89
1957 3300048921 Ga0496118_0374968 Ga0496118_0374968_433_702 89
1958 3300048922 Ga0496119_0213336 Ga0496119_0213336_263_532 89
1959 3300048923 Ga0496120_0199693 Ga0496120_0199693_494_763 89
1960 3300048924 Ga0496121_0002206 Ga0496121_0002206_27157_27426 89
1961 3300048925 Ga0496122_0000415 Ga0496122_0000415_79104_79373 89
1962 3300048925 Ga0496122_0223552 Ga0496122_0223552_66_335 89
1963 3300048925 Ga0496122_0491478 Ga0496122_0491478_278_547 89
1964 3300048926 Ga0496123_0000330 Ga0496123_0000330_79156_79425 89
1965 3300048926 Ga0496123_0022183 Ga0496123_0022183_203_472 89
1966 3300048926 Ga0496123_0036339 Ga0496123_0036339_1824_2093 89
1967 3300048926 Ga0496123_0047297 Ga0496123_0047297_233_502 89
1968 3300048926 Ga0496123_0245124 Ga0496123_0245124_56_325 89
1969 3300048927 Ga0496124_0044485 Ga0496124_0044485_868_1137 89
1970 3300048927 Ga0496124_0415473 Ga0496124_0415473_449_718 89
1971 3300048927 Ga0496124_0525099 Ga0496124_0525099_314_583 89
1972 3300048927 Ga0496124_0874145 Ga0496124_0874145_21_290 89
1973 3300048928 Ga0496125_0041632 Ga0496125_0041632_2712_2981 89
1974 3300048929 Ga0496126_0148535 Ga0496126_0148535_295_564 89
1975 3300049129 Ga0501309_092679 Ga0501309_092679_63_332 89
1976 3300049130 Ga0501310_057280 Ga0501310_057280_229_498 89
1977 3300049161 Ga0501305_036628 Ga0501305_036628_22_291 89
1978 3300049161 Ga0501305_096135 Ga0501305_096135_206_475 89
1979 3300049460 Ga0495682_0343906 Ga0495682_0343906_17_286 89
1980 3300049515 Ga0501292_023460 Ga0501292_023460_721_990 89
1981 3300049526 Ga0501303_004947 Ga0501303_004947_778_1047 89
1982 3300049528 Ga0501312_026367 Ga0501312_026367_169_438 89
1983 3300049569 Ga0501032_0090633 Ga0501032_0090633_633_902 89
1984 3300049571 Ga0501034_0016622 Ga0501034_0016622_2056_2325 89
1985 3300049571 Ga0501034_0792889 Ga0501034_0792889_519_788 89
1986 3300049573 Ga0501037_0007252 Ga0501037_0007252_5656_5925 89
1987 3300049579 Ga0501043_0000545 Ga0501043_0000545_1094_1363 89
1988 3300049580 Ga0501046_0000021 Ga0501046_0000021_54110_54379 89
1989 3300049580 Ga0501046_0004297 Ga0501046_0004297_11606_11875 89
1990 3300049580 Ga0501046_0008745 Ga0501046_0008745_220_489 89
1991 3300049581 Ga0501047_0000757 Ga0501047_0000757_32355_32624 89
1992 3300049582 Ga0501048_0013766 Ga0501048_0013766_3650_3919 89
1993 3300049585 Ga0501069_0002093 Ga0501069_0002093_6309_6578 89
1994 3300049586 Ga0501070_0008659 Ga0501070_0008659_4184_4453 89
1995 3300049649 Ga0501198_000047 Ga0501198_000047_4577_4846 89
1996 3300049649 Ga0501198_133305 Ga0501198_133305_129_398 89
1997 3300049653 Ga0501206_015864 Ga0501206_015864_39_308 89
1998 3300049662 Ga0501222_000056 Ga0501222_000056_4578_4847 89
1999 3300049671 Ga0501238_043408 Ga0501238_043408_294_563 89
2000 3300049679 Ga0501249_040180 Ga0501249_040180_698_967 89
2001 3300049686 Ga0501257_031579 Ga0501257_031579_816_1085 89
2002 3300049705 Ga0501225_0013159 Ga0501225_0013159_1699_1968 89
2003 3300049741 Ga0501079_0051579 Ga0501079_0051579_1687_1956 89
2004 3300049742 Ga0501080_0199531 Ga0501080_0199531_1327_1596 89
2005 3300049758 Ga0501241_108453 Ga0501241_108453_245_514 89
2006 3300049759 Ga0501262_000157 Ga0501262_000157_3417_3686 89
2007 3300049762 Ga0501265_002252 Ga0501265_002252_66_335 89
2008 3300049765 Ga0501268_087695 Ga0501268_087695_152_421 89
2009 3300049823 Ga0501044_0180518 Ga0501044_0180518_931_1200 89
2010 3300049824 Ga0501045_0002486 Ga0501045_0002486_984_1253 89
2011 3300050489 nmdc:mga03683_218037_c1 nmdc:mga03683_218037_c1_31_300 89
2012 3300050489 nmdc:mga03683_22920_c1 nmdc:mga03683_22920_c1_776_1045 89
2013 3300050489 nmdc:mga03683_30347_c1 nmdc:mga03683_30347_c1_507_776 89
2014 3300050489 nmdc:mga03683_354569_c1 nmdc:mga03683_354569_c1_251_520 89
2015 3300050489 nmdc:mga03683_447720_c1 nmdc:mga03683_447720_c1_214_483 89
2016 3300050489 nmdc:mga03683_48543_c1 nmdc:mga03683_48543_c1_992_1261 89
2017 3300050489 nmdc:mga03683_90285_c1 nmdc:mga03683_90285_c1_163_432 89
2018 3300050490 nmdc:mga03n38_399825_c1 nmdc:mga03n38_399825_c1_23_292 89
2019 3300050490 nmdc:mga03n38_454002_c1 nmdc:mga03n38_454002_c1_433_702 89
2020 3300050490 nmdc:mga03n38_603014_c1 nmdc:mga03n38_603014_c1_133_402 89
2021 3300050491 nmdc:mga00v17_152383_c1 nmdc:mga00v17_152383_c1_798_1067 89
2022 3300050491 nmdc:mga00v17_401612_c1 nmdc:mga00v17_401612_c1_417_686 89
2023 3300050491 nmdc:mga00v17_87307_c1 nmdc:mga00v17_87307_c1_629_898 89
2024 3300050492 nmdc:mga0yw44_240784_c1 nmdc:mga0yw44_240784_c1_639_908 89
2025 3300050493 nmdc:mga0k408_10460_c1 nmdc:mga0k408_10460_c1_2118_2387 89
2026 3300050493 nmdc:mga0k408_12490_c1 nmdc:mga0k408_12490_c1_774_1043 89
2027 3300050493 nmdc:mga0k408_164742_c1 nmdc:mga0k408_164742_c1_454_723 89
2028 3300050493 nmdc:mga0k408_171695_c1 nmdc:mga0k408_171695_c1_712_981 89
2029 3300050493 nmdc:mga0k408_18200_c2 nmdc:mga0k408_18200_c2_2659_2928 89
2030 3300050493 nmdc:mga0k408_190517_c1 nmdc:mga0k408_190517_c1_721_990 89
2031 3300050493 nmdc:mga0k408_256190_c1 nmdc:mga0k408_256190_c1_144_413 89
2032 3300050493 nmdc:mga0k408_26610_c1 nmdc:mga0k408_26610_c1_483_752 89
2033 3300050493 nmdc:mga0k408_270913_c1 nmdc:mga0k408_270913_c1_160_429 89
2034 3300050493 nmdc:mga0k408_302597_c1 nmdc:mga0k408_302597_c1_44_313 89
2035 3300050493 nmdc:mga0k408_36110_c1 nmdc:mga0k408_36110_c1_32_301 89
2036 3300050493 nmdc:mga0k408_40302_c1 nmdc:mga0k408_40302_c1_812_1081 89
2037 3300050493 nmdc:mga0k408_438894_c1 nmdc:mga0k408_438894_c1_27_296 89
2038 3300050493 nmdc:mga0k408_583656_c1 nmdc:mga0k408_583656_c1_272_541 89
2039 3300050493 nmdc:mga0k408_6644_c1 nmdc:mga0k408_6644_c1_4434_4703 89
2040 3300050493 nmdc:mga0k408_794578_c1 nmdc:mga0k408_794578_c1_45_314 89
2041 3300050494 nmdc:mga06z11_125624_c1 nmdc:mga06z11_125624_c1_577_846 89
2042 3300050494 nmdc:mga06z11_255108_c1 nmdc:mga06z11_255108_c1_264_533 89
2043 3300050494 nmdc:mga06z11_363850_c1 nmdc:mga06z11_363850_c1_51_320 89
2044 3300050494 nmdc:mga06z11_37405_c1 nmdc:mga06z11_37405_c1_2053_2322 89
2045 3300050494 nmdc:mga06z11_445710_c1 nmdc:mga06z11_445710_c1_99_368 89
2046 3300050494 nmdc:mga06z11_507645_c1 nmdc:mga06z11_507645_c1_334_603 89
2047 3300050495 nmdc:mga04h51_235928_c1 nmdc:mga04h51_235928_c1_159_428 89
2048 3300050496 nmdc:mga07m45_12950_c1 nmdc:mga07m45_12950_c1_336_605 89
2049 3300050496 nmdc:mga07m45_151739_c1 nmdc:mga07m45_151739_c1_759_1028 89
2050 3300050496 nmdc:mga07m45_154307_c1 nmdc:mga07m45_154307_c1_825_1094 89
2051 3300050496 nmdc:mga07m45_156357_c1 nmdc:mga07m45_156357_c1_150_419 89
2052 3300050496 nmdc:mga07m45_16681_c1 nmdc:mga07m45_16681_c1_576_845 89
2053 3300050496 nmdc:mga07m45_18802_c1 nmdc:mga07m45_18802_c1_2953_3222 89
2054 3300050496 nmdc:mga07m45_201253_c1 nmdc:mga07m45_201253_c1_41_310 89
2055 3300050496 nmdc:mga07m45_21210_c1 nmdc:mga07m45_21210_c1_921_1190 89
2056 3300050496 nmdc:mga07m45_342605_c1 nmdc:mga07m45_342605_c1_387_656 89
2057 3300050496 nmdc:mga07m45_399292_c1 nmdc:mga07m45_399292_c1_210_479 89
2058 3300050496 nmdc:mga07m45_4213_c1 nmdc:mga07m45_4213_c1_1998_2267 89
2059 3300050496 nmdc:mga07m45_460138_c1 nmdc:mga07m45_460138_c1_84_353 89
2060 3300050496 nmdc:mga07m45_506933_c1 nmdc:mga07m45_506933_c1_143_412 89
2061 3300050496 nmdc:mga07m45_529161_c1 nmdc:mga07m45_529161_c1_373_642 89
2062 3300050496 nmdc:mga07m45_724059_c1 nmdc:mga07m45_724059_c1_252_521 89
2063 3300050496 nmdc:mga07m45_836123_c1 nmdc:mga07m45_836123_c1_177_446 89
2064 3300050496 nmdc:mga07m45_912609_c1 nmdc:mga07m45_912609_c1_50_319 89
2065 3300050507 nmdc:mga05p37_182246_c1 nmdc:mga05p37_182246_c1_1041_1310 89
2066 3300050507 nmdc:mga05p37_220452_c1 nmdc:mga05p37_220452_c1_143_412 89
2067 3300050508 nmdc:mga09592_14154_c1 nmdc:mga09592_14154_c1_3867_4157 89
2068 3300050509 nmdc:mga0qj67_110899_c1 nmdc:mga0qj67_110899_c1_1443_1733 89
2069 3300050511 nmdc:mga08y16_605174_c1 nmdc:mga08y16_605174_c1_334_603 89
2070 3300050511 nmdc:mga08y16_714912_c1 nmdc:mga08y16_714912_c1_416_685 89
2071 3300050511 nmdc:mga08y16_950785_c1 nmdc:mga08y16_950785_c1_359_628 89
2072 3300050512 nmdc:mga0n895_280592_c1 nmdc:mga0n895_280592_c1_580_849 89
2073 3300050514 nmdc:mga08x19_1194464_c1 nmdc:mga08x19_1194464_c1_40_309 89
2074 3300050516 nmdc:mga0sz30_14201_c1 nmdc:mga0sz30_14201_c1_1711_1980 89
2075 3300050516 nmdc:mga0sz30_185966_c1 nmdc:mga0sz30_185966_c1_32_301 89
2076 3300050516 nmdc:mga0sz30_37847_c1 nmdc:mga0sz30_37847_c1_524_793 89
2077 3300050516 nmdc:mga0sz30_405475_c1 nmdc:mga0sz30_405475_c1_60_329 89
2078 3300050516 nmdc:mga0sz30_442377_c1 nmdc:mga0sz30_442377_c1_230_499 89
2079 3300050516 nmdc:mga0sz30_5056_c1 nmdc:mga0sz30_5056_c1_3312_3581 89
2080 3300053077 Ga0495601_0284010 Ga0495601_0284010_30_299 89
2081 3300053078 Ga0495612_0091577 Ga0495612_0091577_85_354 89
2082 3300053078 Ga0495612_0385124 Ga0495612_0385124_14_283 89
2083 3300053080 Ga0500635_0087433 Ga0500635_0087433_828_1097 89
2084 3300053084 Ga0495595_0323284 Ga0495595_0323284_43_312 89
2085 3300053086 Ga0500578_0000006 Ga0500578_0000006_97593_97862 89
2086 3300053086 Ga0500578_0265118 Ga0500578_0265118_642_911 89
2087 3300053087 Ga0500643_006994 Ga0500643_006994_4218_4487 89
2088 3300053087 Ga0500643_012618 Ga0500643_012618_2134_2403 89
2089 3300053088 Ga0500644_0018587 Ga0500644_0018587_1488_1757 89
2090 3300053090 Ga0500646_0033981 Ga0500646_0033981_520_789 89
2091 3300053090 Ga0500646_0346932 Ga0500646_0346932_253_522 89
2092 3300053093 Ga0500651_0000156 Ga0500651_0000156_19963_20232 89
2093 3300053093 Ga0500651_0076022 Ga0500651_0076022_1033_1302 89
2094 3300053093 Ga0500651_0168496 Ga0500651_0168496_154_423 89
2095 3300053093 Ga0500651_0444845 Ga0500651_0444845_256_525 89
2096 3300053094 Ga0500566_0160156 Ga0500566_0160156_96_365 89
2097 3300053098 Ga0500650_0145041 Ga0500650_0145041_181_450 89
2098 3300053098 Ga0500650_0338961 Ga0500650_0338961_287_556 89
2099 3300053105 Ga0500557_128395 Ga0500557_128395_311_580 89
2100 3300053108 Ga0500562_005406 Ga0500562_005406_255_524 89
2101 3300053108 Ga0500562_008977 Ga0500562_008977_2191_2460 89
2102 3300053110 Ga0500571_000005 Ga0500571_000005_97461_97730 89
2103 3300053118 Ga0500594_0001096 Ga0500594_0001096_2180_2449 89
2104 3300053120 Ga0500597_317525 Ga0500597_317525_286_555 89
2105 3300053122 Ga0500608_022424 Ga0500608_022424_2642_2911 89
2106 3300053122 Ga0500608_074158 Ga0500608_074158_269_538 89
2107 3300053125 Ga0500618_164499 Ga0500618_164499_102_371 89
2108 3300053126 Ga0500621_251616 Ga0500621_251616_40_309 89
2109 3300053127 Ga0500623_007865 Ga0500623_007865_3283_3552 89
2110 3300053128 Ga0500626_035282 Ga0500626_035282_117_386 89
2111 3300053129 Ga0500628_003722 Ga0500628_003722_1651_1920 89
2112 3300053129 Ga0500628_060492 Ga0500628_060492_428_697 89
2113 3300053130 Ga0500642_0064667 Ga0500642_0064667_186_455 89
2114 3300053131 Ga0500652_001283 Ga0500652_001283_3996_4265 89
2115 3300053133 Ga0500655_000516 Ga0500655_000516_2886_3155 89
2116 3300053133 Ga0500655_020988 Ga0500655_020988_22_291 89
2117 3300053134 Ga0500658_0000141 Ga0500658_0000141_25544_25813 89
2118 3300053134 Ga0500658_0000561 Ga0500658_0000561_7625_7894 89
2119 3300053134 Ga0500658_0006983 Ga0500658_0006983_448_717 89
2120 3300053134 Ga0500658_0163347 Ga0500658_0163347_525_794 89
2121 3300053136 Ga0500559_0000880 Ga0500559_0000880_14836_15105 89
2122 3300053136 Ga0500559_0006764 Ga0500559_0006764_1445_1714 89
2123 3300053138 Ga0500564_001417 Ga0500564_001417_5914_6183 89
2124 3300053139 Ga0500568_0001097 Ga0500568_0001097_9949_10218 89
2125 3300053139 Ga0500568_0127304 Ga0500568_0127304_186_455 89
2126 3300053140 Ga0500573_0032467 Ga0500573_0032467_2280_2549 89
2127 3300053143 Ga0500579_150348 Ga0500579_150348_511_780 89
2128 3300053151 Ga0500604_0019070 Ga0500604_0019070_293_562 89
2129 3300053151 Ga0500604_0284338 Ga0500604_0284338_294_563 89
2130 3300053153 Ga0500616_0059379 Ga0500616_0059379_628_897 89
2131 3300053154 Ga0500619_000073 Ga0500619_000073_4033_4302 89
2132 3300053156 Ga0500622_0001738 Ga0500622_0001738_12540_12809 89
2133 3300053157 Ga0500624_028461 Ga0500624_028461_361_630 89
2134 3300053157 Ga0500624_115262 Ga0500624_115262_216_485 89
2135 3300053161 Ga0500634_0055702 Ga0500634_0055702_1307_1576 89
2136 3300053162 Ga0500638_016327 Ga0500638_016327_1390_1659 89
2137 3300053177 Ga0500636_0214708 Ga0500636_0214708_717_986 89
2138 3300053729 Ga0500625_115871 Ga0500625_115871_573_842 89
2139 3300053730 Ga0500645_007607 Ga0500645_007607_3220_3489 89
2140 3300053735 Ga0500596_018165 Ga0500596_018165_65_334 89
2141 3300059421 Ga0590071_099013 Ga0590071_099013_193_462 89
2142 3300060353 Ga0501082_0033320 Ga0501082_0033320_1098_1367 89
2143 3300060353 Ga0501082_1844706 Ga0501082_1844706_162_431 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

12

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.9257 4 81
6r6b-assembly1.cif.gz_H structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.9188 4 85
8axk-assembly1.cif.gz_G type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri 0.9099 1 85
7ah9-assembly1.cif.gz_1J substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 1 0.9019 4 86
7bin-assembly1.cif.gz_G salmonella export gate and rod refined in focussed c1 map 0.8997 1 89
ID Description Score Start End Superfamily
af_O53692_1_97_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.57 1 87 1.10.287.1060
af_O53692_1_97_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.5572 1 87 1.10.287.1060
af_O16530_48_904_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5513 8 59 1.20.1640.10
af_Q54DE8_365_465_1.10.472.100 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin 0.5225 6 69 1.10.472.100
af_Q9H3M0_307_417_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5161 4 79 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A074TVX4-F1-model_v4 deleted 0.9918 12 89
AF-R9VIP8-F1-model_v4 deleted 0.9903 10 89
AF-A0A0Q8XBI4-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9852 14 89 GO:0005886
GO:0009306
AF-T1BP84-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9794 10 89 GO:0005886
GO:0009306
GO:0009425
GO:0031514
GO:0044780
AF-A0A0R2D0F7-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9793 11 85 GO:0005886
GO:0009306
GO:0009425
GO:0044780

Feature Viewer

pLDDT pTM Quality
92.04 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map