F496436

General Info

Members Datasets Scaffolds Average Seq Length
2123 431 4246 67

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0016435|Ga0451576_0016435_5512_5733
Length 73
Sequence VKWIDAEDIGIALSEKFPEIDPLTVRFTDLRERVLQLDEFDDDPKTSNEPKLEAIQMAWYEEWKENHRDSSDV

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
227 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
228 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
229 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
230 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
231 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
232 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
237 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
270 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
271 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
276 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
363 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
364 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
365 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
366 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
367 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
383 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
387 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
388 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
389 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
390 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
391 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
392 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
393 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
394 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
395 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
396 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
397 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
398 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
399 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
403 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
404 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
405 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
406 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
407 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
408 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
420 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
421 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
422 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
423 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
424 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
425 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
426 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
427 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
428 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.64
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 27.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0016435 3300045051 Bacteria 8169
2 SwRhRL2b_contig_2148127 2162886007 Bacteria 1046
3 JGI24744J21845_10081025 3300002077 Bacteria 593
4 JGI25406J46586_10002033 3300003203 Bacteria 9551
5 JGI25406J46586_10004955 3300003203 Bacteria 6185
6 Ga0058859_11225154 3300004798 Bacteria 666
7 Ga0058859_11833474 3300004798 Unclassified 1434
8 Ga0058860_11509978 3300004801 Unclassified 505
9 Ga0058860_12001900 3300004801 Unclassified 705
10 Ga0058860_12034974 3300004801 Unclassified 756
11 Ga0058860_12173101 3300004801 Unclassified 753
12 Ga0058862_12398501 3300004803 Bacteria 1161
13 Ga0065714_10095225 3300005288 Bacteria 1792
14 Ga0065714_10333917 3300005288 Unclassified 654
15 Ga0065704_10135640 3300005289 Bacteria 1575
16 Ga0065704_10730815 3300005289 Unclassified 549
17 Ga0065712_10002663 3300005290 Bacteria 5248
18 Ga0065712_10017476 3300005290 Bacteria 5332
19 Ga0065712_10162898 3300005290 Bacteria 1290
20 Ga0065712_10184946 3300005290 Unclassified 1174
21 Ga0065712_10315517 3300005290 Bacteria 830
22 Ga0065712_10566396 3300005290 Bacteria 609
23 Ga0065715_10023281 3300005293 Bacteria 2316
24 Ga0065715_10069454 3300005293 Unclassified 778
25 Ga0065715_10095276 3300005293 Bacteria 4121
26 Ga0065715_10106779 3300005293 Bacteria 2809
27 Ga0065715_10114455 3300005293 Bacteria 2438
28 Ga0065715_10132989 3300005293 Bacteria 1975
29 Ga0065715_10194207 3300005293 Unclassified 1394
30 Ga0065715_10308400 3300005293 Bacteria 1026
31 Ga0065715_10328266 3300005293 Unclassified 989
32 Ga0065715_10527144 3300005293 Unclassified 759
33 Ga0065715_10666723 3300005293 Bacteria 670
34 Ga0065715_10800108 3300005293 Unclassified 610
35 Ga0065715_10871502 3300005293 Bacteria 573
36 Ga0065707_10002879 3300005295 Bacteria 9391
37 Ga0065707_10023547 3300005295 Bacteria 1747
38 Ga0065707_10026073 3300005295 Unclassified 1173
39 Ga0065707_10100675 3300005295 Bacteria 2912
40 Ga0065707_10132350 3300005295 Bacteria 1898
41 Ga0065707_10194363 3300005295 Unclassified 1343
42 Ga0065707_10226146 3300005295 Bacteria 1206
43 Ga0065707_10227450 3300005295 Bacteria 1164
44 Ga0065707_10511618 3300005295 Bacteria 749
45 Ga0065707_11156542 3300005295 Unclassified 503
46 Ga0070658_10127997 3300005327 Bacteria 2115
47 Ga0070676_10024441 3300005328 Bacteria 3403
48 Ga0070676_10074653 3300005328 Bacteria 2043
49 Ga0070676_10122409 3300005328 Bacteria 1635
50 Ga0070676_10245857 3300005328 Bacteria 1192
51 Ga0070676_10390668 3300005328 Unclassified 966
52 Ga0070676_10560524 3300005328 Bacteria 819
53 Ga0070676_10756453 3300005328 Unclassified 714
54 Ga0070683_100005622 3300005329 Bacteria 10477
55 Ga0070683_100327732 3300005329 Bacteria 1458
56 Ga0070683_100700519 3300005329 Bacteria 970
57 Ga0070683_101587079 3300005329 Unclassified 629
58 Ga0070683_102359480 3300005329 Bacteria 510
59 Ga0070690_100010440 3300005330 Bacteria 5406
60 Ga0070690_100013784 3300005330 Bacteria 4788
61 Ga0070690_100067794 3300005330 Bacteria 2313
62 Ga0070690_100238345 3300005330 Bacteria 1282
63 Ga0070690_100470749 3300005330 Bacteria 935
64 Ga0070690_100521804 3300005330 Unclassified 892
65 Ga0070690_100537069 3300005330 Unclassified 880
66 Ga0070690_100737070 3300005330 Unclassified 760
67 Ga0070690_101648002 3300005330 Bacteria 521
68 Ga0070670_100007350 3300005331 Bacteria 9350
69 Ga0070670_100019871 3300005331 Bacteria 5767
70 Ga0070670_100046970 3300005331 Bacteria 3715
71 Ga0070670_100047679 3300005331 Bacteria 3686
72 Ga0070670_100233445 3300005331 Bacteria 1601
73 Ga0070670_100261849 3300005331 Bacteria 1508
74 Ga0070670_100303374 3300005331 Bacteria 1397
75 Ga0070670_100392641 3300005331 Unclassified 1224
76 Ga0070670_101027695 3300005331 Bacteria 750
77 Ga0070670_102243699 3300005331 Unclassified 503
78 Ga0070677_10048799 3300005333 Unclassified 1703
79 Ga0070677_10099213 3300005333 Bacteria 1281
80 Ga0070677_10297371 3300005333 Bacteria 819
81 Ga0070677_10460740 3300005333 Unclassified 682
82 Ga0070677_10505284 3300005333 Unclassified 656
83 Ga0068869_100009775 3300005334 Bacteria 6228
84 Ga0068869_100108607 3300005334 Bacteria 2108
85 Ga0068869_100374281 3300005334 Unclassified 1166
86 Ga0068869_100398332 3300005334 Bacteria 1132
87 Ga0068869_100615339 3300005334 Unclassified 919
88 Ga0068869_100650616 3300005334 Bacteria 895
89 Ga0068869_100661596 3300005334 Bacteria 888
90 Ga0068869_100703930 3300005334 Unclassified 862
91 Ga0068869_101095695 3300005334 Bacteria 697
92 Ga0068869_101313923 3300005334 Unclassified 638
93 Ga0068869_101659123 3300005334 Bacteria 570
94 Ga0068869_101664703 3300005334 Bacteria 569
95 Ga0070666_10039561 3300005335 Bacteria 3144
96 Ga0070666_10120025 3300005335 Bacteria 1823
97 Ga0070666_10307932 3300005335 Unclassified 1129
98 Ga0070666_10310976 3300005335 Bacteria 1123
99 Ga0070666_10370755 3300005335 Bacteria 1027
100 Ga0070666_11107206 3300005335 Unclassified 589
101 Ga0070666_11205262 3300005335 Bacteria 564
102 Ga0070666_11484800 3300005335 Unclassified 507
103 Ga0070680_100412459 3300005336 Unclassified 1152
104 Ga0070680_100497460 3300005336 Unclassified 1043
105 Ga0070680_100844237 3300005336 Bacteria 790
106 Ga0070680_100934098 3300005336 Bacteria 749
107 Ga0070680_101275735 3300005336 Unclassified 636
108 Ga0070680_101480742 3300005336 Unclassified 588
109 Ga0070680_101506034 3300005336 Bacteria 583
110 Ga0070682_100453073 3300005337 Unclassified 983
111 Ga0070682_101171712 3300005337 Unclassified 647
112 Ga0068868_100076339 3300005338 Bacteria 2679
113 Ga0068868_100211519 3300005338 Bacteria 1621
114 Ga0068868_100462053 3300005338 Bacteria 1106
115 Ga0068868_100488255 3300005338 Bacteria 1077
116 Ga0068868_100884178 3300005338 Bacteria 811
117 Ga0068868_101838642 3300005338 Unclassified 573
118 Ga0070660_100161973 3300005339 Bacteria 1803
119 Ga0070660_100933514 3300005339 Unclassified 732
120 Ga0070660_101089696 3300005339 Unclassified 676
121 Ga0070660_101108555 3300005339 Unclassified 670
122 Ga0070660_101369563 3300005339 Bacteria 601
123 Ga0070689_100005041 3300005340 Bacteria 8977
124 Ga0070689_100011742 3300005340 Bacteria 6283
125 Ga0070689_100051462 3300005340 Bacteria 3184
126 Ga0070689_100060714 3300005340 Bacteria 2940
127 Ga0070689_100137374 3300005340 Bacteria 1964
128 Ga0070689_100292431 3300005340 Unclassified 1354
129 Ga0070689_100306504 3300005340 Bacteria 1323
130 Ga0070689_100395869 3300005340 Bacteria 1167
131 Ga0070689_100582969 3300005340 Bacteria 967
132 Ga0070689_100735187 3300005340 Unclassified 864
133 Ga0070689_101219738 3300005340 Unclassified 676
134 Ga0070689_101329399 3300005340 Bacteria 648
135 Ga0070691_10188218 3300005341 Unclassified 1078
136 Ga0070687_100002090 3300005343 Bacteria 7356
137 Ga0070687_100950177 3300005343 Unclassified 620
138 Ga0070687_100977576 3300005343 Bacteria 612
139 Ga0070687_101269788 3300005343 Bacteria 546
140 Ga0070661_100217276 3300005344 Bacteria 1465
141 Ga0070661_100241856 3300005344 Bacteria 1390
142 Ga0070661_100266999 3300005344 Bacteria 1324
143 Ga0070661_100891090 3300005344 Bacteria 734
144 Ga0070661_101493268 3300005344 Unclassified 570
145 Ga0070692_10189569 3300005345 Bacteria 1197
146 Ga0070692_10200794 3300005345 Unclassified 1168
147 Ga0070692_10277022 3300005345 Bacteria 1015
148 Ga0070692_11212981 3300005345 Unclassified 538
149 Ga0070668_100067062 3300005347 Bacteria 2786
150 Ga0070668_100196670 3300005347 Bacteria 1654
151 Ga0070668_100224774 3300005347 Unclassified 1550
152 Ga0070668_100676367 3300005347 Unclassified 909
153 Ga0070668_100982748 3300005347 Bacteria 758
154 Ga0070669_100005475 3300005353 Bacteria 9166
155 Ga0070669_100015084 3300005353 Bacteria 5506
156 Ga0070669_100037760 3300005353 Bacteria 3504
157 Ga0070669_100061952 3300005353 Bacteria 2750
158 Ga0070669_100072047 3300005353 Bacteria 2557
159 Ga0070669_100106080 3300005353 Bacteria 2126
160 Ga0070669_100126660 3300005353 Unclassified 1955
161 Ga0070669_100230765 3300005353 Unclassified 1467
162 Ga0070669_100660566 3300005353 Bacteria 880
163 Ga0070669_101064389 3300005353 Bacteria 696
164 Ga0070669_101292227 3300005353 Unclassified 632
165 Ga0070669_101570221 3300005353 Bacteria 573
166 Ga0070675_100000785 3300005354 Bacteria 22225
167 Ga0070675_100006317 3300005354 Bacteria 9097
168 Ga0070675_100015402 3300005354 Bacteria 6044
169 Ga0070675_100021027 3300005354 Bacteria 5211
170 Ga0070675_100023859 3300005354 Unclassified 4896
171 Ga0070675_100031702 3300005354 Bacteria 4274
172 Ga0070675_100035816 3300005354 Bacteria 4036
173 Ga0070675_100054006 3300005354 Bacteria 3305
174 Ga0070675_100121191 3300005354 Bacteria 2222
175 Ga0070675_100171061 3300005354 Bacteria 1873
176 Ga0070675_100183149 3300005354 Bacteria 1812
177 Ga0070675_100303961 3300005354 Bacteria 1406
178 Ga0070675_100369004 3300005354 Bacteria 1276
179 Ga0070675_100525810 3300005354 Unclassified 1068
180 Ga0070675_100660338 3300005354 Bacteria 951
181 Ga0070675_102200369 3300005354 Unclassified 508
182 Ga0070671_100008522 3300005355 Bacteria 8218
183 Ga0070671_100520940 3300005355 Unclassified 1024
184 Ga0070671_100580359 3300005355 Bacteria 968
185 Ga0070671_100917087 3300005355 Unclassified 766
186 Ga0070671_101167641 3300005355 Bacteria 677
187 Ga0070671_101682484 3300005355 Bacteria 563
188 Ga0070674_100005809 3300005356 Bacteria 7166
189 Ga0070674_100105712 3300005356 Bacteria 2059
190 Ga0070674_100213240 3300005356 Bacteria 1498
191 Ga0070674_100567705 3300005356 Unclassified 954
192 Ga0070674_100892454 3300005356 Unclassified 774
193 Ga0070674_100982888 3300005356 Unclassified 740
194 Ga0070674_101008626 3300005356 Unclassified 731
195 Ga0070674_101164679 3300005356 Unclassified 683
196 Ga0070674_101226774 3300005356 Bacteria 667
197 Ga0070674_101241425 3300005356 Unclassified 663
198 Ga0070673_100006588 3300005364 Bacteria 7559
199 Ga0070673_100008523 3300005364 Bacteria 6820
200 Ga0070673_100047974 3300005364 Bacteria 3327
201 Ga0070673_100188801 3300005364 Bacteria 1769
202 Ga0070673_100198379 3300005364 Bacteria 1727
203 Ga0070673_100276701 3300005364 Bacteria 1471
204 Ga0070673_100283888 3300005364 Bacteria 1453
205 Ga0070673_100297696 3300005364 Unclassified 1419
206 Ga0070673_100312330 3300005364 Unclassified 1387
207 Ga0070673_100460942 3300005364 Bacteria 1144
208 Ga0070673_100522757 3300005364 Bacteria 1075
209 Ga0070673_100564622 3300005364 Bacteria 1035
210 Ga0070673_101282237 3300005364 Unclassified 688
211 Ga0070688_100008455 3300005365 Bacteria 5586
212 Ga0070688_100049444 3300005365 Bacteria 2616
213 Ga0070688_100070345 3300005365 Unclassified 2237
214 Ga0070688_100124710 3300005365 Bacteria 1730
215 Ga0070688_100178884 3300005365 Bacteria 1470
216 Ga0070688_100186682 3300005365 Bacteria 1441
217 Ga0070688_100279442 3300005365 Bacteria 1199
218 Ga0070688_100449028 3300005365 Bacteria 963
219 Ga0070688_100609102 3300005365 Bacteria 837
220 Ga0070688_101726580 3300005365 Bacteria 513
221 Ga0070659_100125835 3300005366 Bacteria 2079
222 Ga0070659_100171502 3300005366 Bacteria 1777
223 Ga0070659_100240569 3300005366 Bacteria 1498
224 Ga0070659_100337585 3300005366 Bacteria 1262
225 Ga0070659_100344197 3300005366 Unclassified 1250
226 Ga0070659_101111214 3300005366 Bacteria 697
227 Ga0070667_100028378 3300005367 Bacteria 4659
228 Ga0070667_100094543 3300005367 Bacteria 2576
229 Ga0070667_100240308 3300005367 Unclassified 1617
230 Ga0070667_100405796 3300005367 Bacteria 1241
231 Ga0070667_100416480 3300005367 Unclassified 1224
232 Ga0070667_101767131 3300005367 Unclassified 582
233 Ga0070703_10233017 3300005406 Unclassified 739
234 Ga0070703_10572211 3300005406 Bacteria 518
235 Ga0070709_10014162 3300005434 Bacteria 4505
236 Ga0070709_10518276 3300005434 Bacteria 908
237 Ga0070709_10621115 3300005434 Bacteria 834
238 Ga0070714_101191261 3300005435 Bacteria 743
239 Ga0070713_100343648 3300005436 Unclassified 1383
240 Ga0070713_100386806 3300005436 Bacteria 1304
241 Ga0070710_10374637 3300005437 Bacteria 948
242 Ga0070701_10007649 3300005438 Bacteria 4632
243 Ga0070701_10015376 3300005438 Bacteria 3533
244 Ga0070701_10623043 3300005438 Unclassified 717
245 Ga0070701_10879432 3300005438 Unclassified 617
246 Ga0070701_11181992 3300005438 Bacteria 542
247 Ga0070701_11197008 3300005438 Bacteria 539
248 Ga0070711_100414982 3300005439 Unclassified 1096
249 Ga0070711_100500955 3300005439 Unclassified 1001
250 Ga0070711_100851390 3300005439 Unclassified 776
251 Ga0070705_100001204 3300005440 Bacteria 14089
252 Ga0070705_100019732 3300005440 Bacteria 3552
253 Ga0070705_100160764 3300005440 Bacteria 1501
254 Ga0070705_100174191 3300005440 Bacteria 1451
255 Ga0070705_100234459 3300005440 Unclassified 1279
256 Ga0070705_100544153 3300005440 Bacteria 889
257 Ga0070705_101063937 3300005440 Bacteria 660
258 Ga0070700_100093816 3300005441 Unclassified 1964
259 Ga0070700_100232156 3300005441 Bacteria 1314
260 Ga0070700_100247876 3300005441 Bacteria 1276
261 Ga0070700_100251928 3300005441 Unclassified 1267
262 Ga0070700_100457418 3300005441 Unclassified 972
263 Ga0070700_100496670 3300005441 Bacteria 938
264 Ga0070700_101092355 3300005441 Unclassified 661
265 Ga0070694_100000199 3300005444 Bacteria 31924
266 Ga0070694_100039897 3300005444 Bacteria 3127
267 Ga0070694_100047092 3300005444 Bacteria 2896
268 Ga0070694_100135188 3300005444 Unclassified 1786
269 Ga0070694_100203569 3300005444 Unclassified 1477
270 Ga0070694_100249946 3300005444 Unclassified 1341
271 Ga0070694_100261021 3300005444 Bacteria 1314
272 Ga0070694_100291505 3300005444 Bacteria 1247
273 Ga0070694_100487636 3300005444 Bacteria 979
274 Ga0070694_100507138 3300005444 Bacteria 961
275 Ga0070694_100588536 3300005444 Unclassified 895
276 Ga0070694_101138592 3300005444 Unclassified 652
277 Ga0070694_101411918 3300005444 Bacteria 588
278 Ga0070694_101778476 3300005444 Bacteria 525
279 Ga0070708_100015924 3300005445 Bacteria 6223
280 Ga0070708_100073351 3300005445 Bacteria 3085
281 Ga0070708_100650688 3300005445 Unclassified 993
282 Ga0070708_101067006 3300005445 Unclassified 757
283 Ga0070708_101363565 3300005445 Bacteria 662
284 Ga0070708_101676736 3300005445 Bacteria 591
285 Ga0070663_100018690 3300005455 Bacteria 4550
286 Ga0070663_100348019 3300005455 Unclassified 1199
287 Ga0070663_100724833 3300005455 Bacteria 847
288 Ga0070663_101890450 3300005455 Bacteria 536
289 Ga0070678_100007601 3300005456 Bacteria 6438
290 Ga0070678_100028082 3300005456 Bacteria 3831
291 Ga0070678_100073186 3300005456 Bacteria 2571
292 Ga0070678_100167410 3300005456 Bacteria 1786
293 Ga0070678_100246278 3300005456 Bacteria 1497
294 Ga0070678_100411585 3300005456 Unclassified 1177
295 Ga0070678_101356710 3300005456 Bacteria 663
296 Ga0070678_101477490 3300005456 Bacteria 636
297 Ga0070662_100051755 3300005457 Bacteria 2967
298 Ga0070662_100169063 3300005457 Unclassified 1716
299 Ga0070662_100190740 3300005457 Bacteria 1621
300 Ga0070681_10014967 3300005458 Bacteria 7713
301 Ga0070681_10032641 3300005458 Bacteria 5226
302 Ga0070681_10086022 3300005458 Bacteria 3097
303 Ga0070681_10357396 3300005458 Bacteria 1371
304 Ga0068867_100001191 3300005459 Bacteria 17832
305 Ga0068867_100002272 3300005459 Bacteria 13511
306 Ga0068867_100013275 3300005459 Bacteria 5835
307 Ga0068867_100158218 3300005459 Bacteria 1785
308 Ga0068867_100478326 3300005459 Unclassified 1067
309 Ga0068867_100714667 3300005459 Bacteria 885
310 Ga0068867_100773825 3300005459 Unclassified 854
311 Ga0068867_100878481 3300005459 Bacteria 805
312 Ga0068867_100928827 3300005459 Unclassified 785
313 Ga0070685_10018710 3300005466 Bacteria 3729
314 Ga0070685_10262479 3300005466 Bacteria 1149
315 Ga0070685_10410375 3300005466 Bacteria 940
316 Ga0070685_10575439 3300005466 Bacteria 807
317 Ga0070685_11313699 3300005466 Unclassified 553
318 Ga0070685_11393870 3300005466 Bacteria 538
319 Ga0070685_11608758 3300005466 Bacteria 503
320 Ga0070706_100124050 3300005467 Bacteria 2408
321 Ga0070706_100221094 3300005467 Bacteria 1768
322 Ga0070706_100769239 3300005467 Unclassified 892
323 Ga0070706_101336329 3300005467 Bacteria 657
324 Ga0070706_101437599 3300005467 Unclassified 631
325 Ga0070706_101823435 3300005467 Unclassified 553
326 Ga0070706_101903111 3300005467 Bacteria 540
327 Ga0070706_101928880 3300005467 Unclassified 536
328 Ga0070707_100062625 3300005468 Bacteria 3569
329 Ga0070707_100084624 3300005468 Bacteria 3064
330 Ga0070707_100092228 3300005468 Bacteria 2933
331 Ga0070707_100290025 3300005468 Bacteria 1590
332 Ga0070707_100412000 3300005468 Bacteria 1312
333 Ga0070707_100667742 3300005468 Bacteria 1002
334 Ga0070707_101340903 3300005468 Bacteria 682
335 Ga0070698_100002764 3300005471 Bacteria 19294
336 Ga0070698_100004315 3300005471 Bacteria 15640
337 Ga0070698_100024808 3300005471 Bacteria 6252
338 Ga0070698_100086145 3300005471 Bacteria 3127
339 Ga0070698_100283194 3300005471 Bacteria 1589
340 Ga0070698_100572861 3300005471 Unclassified 1069
341 Ga0070698_100677907 3300005471 Bacteria 972
342 Ga0070698_100693759 3300005471 Bacteria 960
343 Ga0070698_101075174 3300005471 Bacteria 753
344 Ga0070698_101164071 3300005471 Bacteria 720
345 Ga0070698_101860901 3300005471 Bacteria 555
346 Ga0070699_100000172 3300005518 Bacteria 62043
347 Ga0070699_100008183 3300005518 Bacteria 9073
348 Ga0070699_100045608 3300005518 Bacteria 3794
349 Ga0070699_100065455 3300005518 Bacteria 3155
350 Ga0070699_100161479 3300005518 Bacteria 1983
351 Ga0070699_100186084 3300005518 Unclassified 1844
352 Ga0070699_100212512 3300005518 Bacteria 1722
353 Ga0070699_100837213 3300005518 Unclassified 842
354 Ga0070699_101003010 3300005518 Bacteria 766
355 Ga0070699_101750862 3300005518 Bacteria 569
356 Ga0070699_101847079 3300005518 Unclassified 553
357 Ga0070679_100305411 3300005530 Bacteria 1541
358 Ga0070679_100332442 3300005530 Bacteria 1468
359 Ga0070679_100611524 3300005530 Bacteria 1033
360 Ga0070679_100694605 3300005530 Bacteria 960
361 Ga0070684_100042447 3300005535 Bacteria 3926
362 Ga0070684_100196125 3300005535 Bacteria 1839
363 Ga0070684_100654684 3300005535 Bacteria 978
364 Ga0070684_100840404 3300005535 Unclassified 859
365 Ga0070684_101515821 3300005535 Bacteria 632
366 Ga0070684_101872147 3300005535 Bacteria 566
367 Ga0070684_102328242 3300005535 Unclassified 505
368 Ga0070697_100099767 3300005536 Bacteria 2411
369 Ga0070697_100130792 3300005536 Unclassified 2105
370 Ga0070697_100263238 3300005536 Bacteria 1477
371 Ga0070697_100807893 3300005536 Bacteria 830
372 Ga0070697_100830402 3300005536 Bacteria 818
373 Ga0070697_101035517 3300005536 Bacteria 730
374 Ga0070697_101288278 3300005536 Bacteria 652
375 Ga0070697_101636146 3300005536 Unclassified 576
376 Ga0070697_101703915 3300005536 Unclassified 564
377 Ga0068853_101468135 3300005539 Bacteria 660
378 Ga0068853_101601435 3300005539 Bacteria 631
379 Ga0070672_100031975 3300005543 Bacteria 3967
380 Ga0070672_100058398 3300005543 Bacteria 3032
381 Ga0070672_100060185 3300005543 Bacteria 2990
382 Ga0070672_100074122 3300005543 Bacteria 2715
383 Ga0070672_100091256 3300005543 Bacteria 2458
384 Ga0070672_100099686 3300005543 Unclassified 2355
385 Ga0070672_100160706 3300005543 Bacteria 1864
386 Ga0070672_100326655 3300005543 Bacteria 1305
387 Ga0070672_100502436 3300005543 Unclassified 1049
388 Ga0070672_100624721 3300005543 Bacteria 940
389 Ga0070672_100891067 3300005543 Bacteria 786
390 Ga0070672_101056918 3300005543 Unclassified 721
391 Ga0070672_101078543 3300005543 Unclassified 713
392 Ga0070672_101113648 3300005543 Bacteria 702
393 Ga0070672_101267608 3300005543 Bacteria 657
394 Ga0070672_101504822 3300005543 Bacteria 603
395 Ga0070686_100007548 3300005544 Bacteria 6072
396 Ga0070686_100012930 3300005544 Bacteria 4766
397 Ga0070686_100058396 3300005544 Bacteria 2482
398 Ga0070686_100151436 3300005544 Unclassified 1625
399 Ga0070686_100199369 3300005544 Unclassified 1434
400 Ga0070686_100350660 3300005544 Bacteria 1109
401 Ga0070686_100490959 3300005544 Unclassified 951
402 Ga0070695_100000002 3300005545 Bacteria 128335
403 Ga0070695_100001675 3300005545 Bacteria 12485
404 Ga0070695_100015542 3300005545 Bacteria 4597
405 Ga0070695_100043868 3300005545 Bacteria 2845
406 Ga0070695_100073857 3300005545 Bacteria 2239
407 Ga0070695_100258091 3300005545 Bacteria 1271
408 Ga0070695_100423483 3300005545 Bacteria 1014
409 Ga0070695_100457569 3300005545 Unclassified 979
410 Ga0070695_100671628 3300005545 Unclassified 820
411 Ga0070695_100753567 3300005545 Unclassified 777
412 Ga0070695_101209342 3300005545 Unclassified 622
413 Ga0070696_100018496 3300005546 Bacteria 4709
414 Ga0070696_100025383 3300005546 Bacteria 4029
415 Ga0070696_100098274 3300005546 Bacteria 2094
416 Ga0070696_100102001 3300005546 Bacteria 2057
417 Ga0070696_100188051 3300005546 Bacteria 1536
418 Ga0070696_100511151 3300005546 Bacteria 957
419 Ga0070696_100580023 3300005546 Unclassified 902
420 Ga0070696_100850970 3300005546 Bacteria 754
421 Ga0070696_100898535 3300005546 Unclassified 735
422 Ga0070696_101101178 3300005546 Bacteria 668
423 Ga0070693_100146440 3300005547 Bacteria 1492
424 Ga0070693_100169120 3300005547 Unclassified 1398
425 Ga0070693_100212516 3300005547 Bacteria 1263
426 Ga0070693_100848024 3300005547 Bacteria 681
427 Ga0070693_100995942 3300005547 Bacteria 634
428 Ga0070693_101527429 3300005547 Bacteria 522
429 Ga0070665_100002623 3300005548 Bacteria 19608
430 Ga0070665_100028738 3300005548 Bacteria 5598
431 Ga0070665_100091624 3300005548 Bacteria 3044
432 Ga0070665_100601071 3300005548 Bacteria 1113
433 Ga0070665_102195848 3300005548 Bacteria 556
434 Ga0070665_102255672 3300005548 Bacteria 548
435 Ga0070704_100000468 3300005549 Bacteria 19028
436 Ga0070704_100002643 3300005549 Bacteria 10113
437 Ga0070704_100007220 3300005549 Bacteria 6606
438 Ga0070704_100022196 3300005549 Bacteria 4127
439 Ga0070704_100073177 3300005549 Bacteria 2496
440 Ga0070704_100192897 3300005549 Bacteria 1639
441 Ga0070704_100296312 3300005549 Bacteria 1346
442 Ga0070704_100665164 3300005549 Unclassified 921
443 Ga0070704_101158624 3300005549 Unclassified 704
444 Ga0070704_101266903 3300005549 Unclassified 674
445 Ga0070704_101330574 3300005549 Unclassified 658
446 Ga0070704_102070239 3300005549 Bacteria 529
447 Ga0070704_102234396 3300005549 Unclassified 509
448 Ga0070704_102280395 3300005549 Bacteria 504
449 Ga0068855_101152549 3300005563 Bacteria 808
450 Ga0068855_102093755 3300005563 Bacteria 570
451 Ga0070664_100002860 3300005564 Bacteria 13977
452 Ga0070664_100045421 3300005564 Bacteria 3710
453 Ga0070664_100069720 3300005564 Bacteria 3009
454 Ga0070664_100105276 3300005564 Bacteria 2457
455 Ga0070664_100126456 3300005564 Bacteria 2243
456 Ga0070664_100127011 3300005564 Bacteria 2238
457 Ga0070664_100177350 3300005564 Bacteria 1892
458 Ga0070664_100182108 3300005564 Unclassified 1867
459 Ga0070664_100564297 3300005564 Unclassified 1053
460 Ga0070664_100826129 3300005564 Bacteria 867
461 Ga0070664_101013673 3300005564 Bacteria 780
462 Ga0070664_101092977 3300005564 Bacteria 751
463 Ga0070664_101262791 3300005564 Unclassified 697
464 Ga0070664_101813091 3300005564 Unclassified 579
465 Ga0070664_102126924 3300005564 Bacteria 533
466 Ga0068857_100077346 3300005577 Bacteria 2969
467 Ga0068857_100093599 3300005577 Bacteria 2691
468 Ga0068857_100486190 3300005577 Bacteria 1157
469 Ga0068857_101087540 3300005577 Bacteria 772
470 Ga0068857_101773924 3300005577 Unclassified 604
471 Ga0068857_102090674 3300005577 Unclassified 556
472 Ga0068854_100127031 3300005578 Bacteria 1943
473 Ga0068854_100247639 3300005578 Bacteria 1422
474 Ga0068854_100267523 3300005578 Bacteria 1371
475 Ga0068854_101027515 3300005578 Unclassified 731
476 Ga0068854_101588209 3300005578 Bacteria 596
477 Ga0068854_101826008 3300005578 Unclassified 558
478 Ga0070702_100103508 3300005615 Bacteria 1751
479 Ga0070702_100129212 3300005615 Unclassified 1593
480 Ga0070702_100207281 3300005615 Bacteria 1302
481 Ga0070702_100245320 3300005615 Bacteria 1211
482 Ga0070702_100256718 3300005615 Unclassified 1188
483 Ga0070702_101535113 3300005615 Unclassified 549
484 Ga0068852_100482501 3300005616 Unclassified 1232
485 Ga0068852_100835748 3300005616 Bacteria 936
486 Ga0068852_100934372 3300005616 Bacteria 885
487 Ga0068852_101103134 3300005616 Bacteria 814
488 Ga0068852_101734338 3300005616 Unclassified 647
489 Ga0068852_102515116 3300005616 Bacteria 535
490 Ga0068859_100001189 3300005617 Bacteria 26592
491 Ga0068859_100007303 3300005617 Bacteria 11207
492 Ga0068859_100057695 3300005617 Bacteria 3910
493 Ga0068859_100057987 3300005617 Bacteria 3900
494 Ga0068859_100084219 3300005617 Bacteria 3224
495 Ga0068859_100085528 3300005617 Bacteria 3199
496 Ga0068859_100088877 3300005617 Bacteria 3139
497 Ga0068859_100131680 3300005617 Bacteria 2573
498 Ga0068859_100179780 3300005617 Bacteria 2198
499 Ga0068859_100209245 3300005617 Unclassified 2037
500 Ga0068859_100267030 3300005617 Bacteria 1803
501 Ga0068859_100672695 3300005617 Bacteria 1127
502 Ga0068859_100714990 3300005617 Bacteria 1092
503 Ga0068859_100871461 3300005617 Bacteria 986
504 Ga0068859_101168972 3300005617 Bacteria 847
505 Ga0068859_102132531 3300005617 Bacteria 619
506 Ga0068859_102234570 3300005617 Bacteria 603
507 Ga0068859_102585109 3300005617 Bacteria 559
508 Ga0068859_102855231 3300005617 Unclassified 530
509 Ga0068864_100010745 3300005618 Bacteria 7568
510 Ga0068864_100013376 3300005618 Bacteria 6801
511 Ga0068864_100029117 3300005618 Bacteria 4673
512 Ga0068864_100037542 3300005618 Bacteria 4134
513 Ga0068864_100124697 3300005618 Bacteria 2307
514 Ga0068864_100347414 3300005618 Bacteria 1399
515 Ga0068864_100371880 3300005618 Bacteria 1353
516 Ga0068864_100405000 3300005618 Bacteria 1297
517 Ga0068864_100425924 3300005618 Bacteria 1265
518 Ga0068864_100553860 3300005618 Bacteria 1112
519 Ga0068864_100929793 3300005618 Unclassified 860
520 Ga0068864_101714657 3300005618 Bacteria 633
521 Ga0068864_101771466 3300005618 Unclassified 623
522 Ga0068866_10018862 3300005718 Bacteria 3129
523 Ga0068866_10029981 3300005718 Unclassified 2606
524 Ga0068866_10179654 3300005718 Bacteria 1249
525 Ga0068866_10257470 3300005718 Bacteria 1071
526 Ga0068866_11303960 3300005718 Bacteria 528
527 Ga0068866_11443576 3300005718 Bacteria 504
528 Ga0068861_100003348 3300005719 Bacteria 10619
529 Ga0068861_100007806 3300005719 Bacteria 7354
530 Ga0068861_100052196 3300005719 Bacteria 3107
531 Ga0068861_100093932 3300005719 Bacteria 2372
532 Ga0068861_100130694 3300005719 Bacteria 2038
533 Ga0068861_100328220 3300005719 Unclassified 1335
534 Ga0068861_100401730 3300005719 Bacteria 1216
535 Ga0068861_100595368 3300005719 Bacteria 1014
536 Ga0068861_101734904 3300005719 Unclassified 618
537 Ga0068861_102053012 3300005719 Unclassified 571
538 Ga0068851_10017577 3300005834 Bacteria 3437
539 Ga0068851_11073450 3300005834 Bacteria 510
540 Ga0068870_10002734 3300005840 Bacteria 7404
541 Ga0068870_10007232 3300005840 Bacteria 4943
542 Ga0068870_10008504 3300005840 Bacteria 4621
543 Ga0068870_10025218 3300005840 Bacteria 2949
544 Ga0068870_10071365 3300005840 Bacteria 1895
545 Ga0068870_10119366 3300005840 Bacteria 1517
546 Ga0068870_10154531 3300005840 Bacteria 1355
547 Ga0068870_10516032 3300005840 Bacteria 799
548 Ga0068870_10655141 3300005840 Bacteria 720
549 Ga0068870_10749815 3300005840 Unclassified 678
550 Ga0068863_100001594 3300005841 Bacteria 22409
551 Ga0068863_100029322 3300005841 Bacteria 5252
552 Ga0068863_100042275 3300005841 Bacteria 4330
553 Ga0068863_100148402 3300005841 Bacteria 2243
554 Ga0068863_100184035 3300005841 Bacteria 2006
555 Ga0068863_100455353 3300005841 Bacteria 1256
556 Ga0068863_100616685 3300005841 Unclassified 1074
557 Ga0068863_100872114 3300005841 Unclassified 900
558 Ga0068863_101241027 3300005841 Unclassified 752
559 Ga0068863_101343686 3300005841 Unclassified 722
560 Ga0068863_101992893 3300005841 Unclassified 591
561 Ga0068858_100003439 3300005842 Bacteria 15721
562 Ga0068858_100015584 3300005842 Bacteria 7150
563 Ga0068858_100031755 3300005842 Bacteria 4908
564 Ga0068858_100048955 3300005842 Bacteria 3915
565 Ga0068858_100057459 3300005842 Bacteria 3596
566 Ga0068858_100225921 3300005842 Bacteria 1774
567 Ga0068858_100371815 3300005842 Unclassified 1371
568 Ga0068858_100507933 3300005842 Bacteria 1165
569 Ga0068858_100622638 3300005842 Bacteria 1048
570 Ga0068858_100832285 3300005842 Bacteria 901
571 Ga0068858_101665512 3300005842 Bacteria 630
572 Ga0068858_101979541 3300005842 Bacteria 576
573 Ga0068860_100002831 3300005843 Bacteria 18044
574 Ga0068860_100038554 3300005843 Bacteria 4571
575 Ga0068860_100087227 3300005843 Bacteria 2971
576 Ga0068860_100340393 3300005843 Bacteria 1475
577 Ga0068860_100355286 3300005843 Unclassified 1443
578 Ga0068860_100880887 3300005843 Unclassified 911
579 Ga0068860_100982344 3300005843 Bacteria 862
580 Ga0068860_101080094 3300005843 Bacteria 822
581 Ga0068860_101251590 3300005843 Unclassified 763
582 Ga0068860_101441027 3300005843 Bacteria 710
583 Ga0068860_101640610 3300005843 Bacteria 665
584 Ga0068860_101710642 3300005843 Unclassified 651
585 Ga0068860_102087572 3300005843 Unclassified 588
586 Ga0068860_102428102 3300005843 Unclassified 544
587 Ga0068862_100001533 3300005844 Bacteria 21121
588 Ga0068862_100001812 3300005844 Bacteria 19342
589 Ga0068862_100107479 3300005844 Bacteria 2446
590 Ga0068862_100129265 3300005844 Bacteria 2233
591 Ga0068862_100306841 3300005844 Unclassified 1462
592 Ga0068862_100307715 3300005844 Unclassified 1460
593 Ga0068862_100323645 3300005844 Unclassified 1424
594 Ga0068862_100502490 3300005844 Unclassified 1151
595 Ga0068862_100762930 3300005844 Unclassified 942
596 Ga0068862_101075054 3300005844 Unclassified 799
597 Ga0068862_101126102 3300005844 Bacteria 781
598 Ga0068862_101775328 3300005844 Unclassified 626
599 Ga0068862_102108496 3300005844 Unclassified 575
600 Ga0068862_102494216 3300005844 Bacteria 529
601 Ga0081455_10081091 3300005937 Bacteria 2658
602 Ga0081455_10194880 3300005937 Bacteria 1522
603 Ga0081539_10000024 3300005985 Bacteria 354702
604 Ga0081539_10000096 3300005985 Bacteria 204059
605 Ga0081539_10028795 3300005985 Unclassified 3486
606 Ga0081539_10258575 3300005985 Bacteria 769
607 Ga0081539_10268453 3300005985 Bacteria 749
608 Ga0081539_10272946 3300005985 Bacteria 740
609 Ga0070717_10230633 3300006028 Unclassified 1630
610 Ga0070717_10850684 3300006028 Bacteria 830
611 Ga0075432_10029143 3300006058 Bacteria 1905
612 Ga0075432_10363888 3300006058 Unclassified 616
613 Ga0070716_100984168 3300006173 Bacteria 666
614 Ga0070712_101809275 3300006175 Unclassified 535
615 Ga0070712_101849360 3300006175 Unclassified 529
616 Ga0075427_10025470 3300006194 Bacteria 954
617 Ga0097621_100000820 3300006237 Bacteria 21967
618 Ga0097621_100010172 3300006237 Bacteria 6867
619 Ga0097621_100019068 3300006237 Bacteria 5259
620 Ga0097621_100035057 3300006237 Unclassified 4007
621 Ga0097621_100133659 3300006237 Bacteria 2114
622 Ga0097621_100232519 3300006237 Bacteria 1610
623 Ga0097621_100247823 3300006237 Unclassified 1559
624 Ga0097621_100259946 3300006237 Unclassified 1523
625 Ga0097621_100305225 3300006237 Bacteria 1407
626 Ga0097621_100311632 3300006237 Unclassified 1392
627 Ga0097621_100717133 3300006237 Bacteria 922
628 Ga0097621_101323250 3300006237 Unclassified 681
629 Ga0068871_100000748 3300006358 Bacteria 22005
630 Ga0068871_100007358 3300006358 Bacteria 7855
631 Ga0068871_100019530 3300006358 Bacteria 5175
632 Ga0068871_100100346 3300006358 Bacteria 2424
633 Ga0068871_100471852 3300006358 Bacteria 1127
634 Ga0068871_100485606 3300006358 Bacteria 1112
635 Ga0068871_100808173 3300006358 Bacteria 865
636 Ga0068871_100825898 3300006358 Bacteria 856
637 Ga0068871_100996534 3300006358 Unclassified 780
638 Ga0068871_101583866 3300006358 Bacteria 620
639 Ga0075428_100012777 3300006844 Bacteria 9336
640 Ga0075428_100030141 3300006844 Bacteria 6001
641 Ga0075428_100061549 3300006844 Bacteria 4111
642 Ga0075428_100092638 3300006844 Bacteria 3295
643 Ga0075428_100121571 3300006844 Bacteria 2843
644 Ga0075428_100219659 3300006844 Bacteria 2052
645 Ga0075428_100226840 3300006844 Bacteria 2016
646 Ga0075428_100374076 3300006844 Bacteria 1527
647 Ga0075428_100520688 3300006844 Bacteria 1272
648 Ga0075428_100842671 3300006844 Bacteria 974
649 Ga0075430_100009273 3300006846 Bacteria 8315
650 Ga0075430_100017018 3300006846 Bacteria 6192
651 Ga0075430_100058440 3300006846 Bacteria 3242
652 Ga0075430_100591270 3300006846 Bacteria 916
653 Ga0075431_100051008 3300006847 Bacteria 4267
654 Ga0075431_100076833 3300006847 Bacteria 3446
655 Ga0075431_100248873 3300006847 Bacteria 1806
656 Ga0075431_100589924 3300006847 Bacteria 1096
657 Ga0075433_10026165 3300006852 Bacteria 4937
658 Ga0075433_10044412 3300006852 Bacteria 3860
659 Ga0075433_10115117 3300006852 Bacteria 2386
660 Ga0075433_10165487 3300006852 Unclassified 1968
661 Ga0075433_10205477 3300006852 Bacteria 1751
662 Ga0075433_10244578 3300006852 Bacteria 1593
663 Ga0075433_10273510 3300006852 Bacteria 1497
664 Ga0075433_10319208 3300006852 Bacteria 1374
665 Ga0075433_10395913 3300006852 Bacteria 1219
666 Ga0075433_10455278 3300006852 Bacteria 1128
667 Ga0075433_10830909 3300006852 Unclassified 807
668 Ga0075433_11045324 3300006852 Unclassified 711
669 Ga0075433_11677241 3300006852 Unclassified 547
670 Ga0075433_11927954 3300006852 Unclassified 507
671 Ga0075434_100000213 3300006871 Bacteria 39624
672 Ga0075434_100007002 3300006871 Bacteria 10399
673 Ga0075434_100046593 3300006871 Bacteria 4302
674 Ga0075434_100083019 3300006871 Bacteria 3201
675 Ga0075434_100123977 3300006871 Bacteria 2600
676 Ga0075434_100170073 3300006871 Bacteria 2199
677 Ga0075434_100170935 3300006871 Bacteria 2193
678 Ga0075434_100208315 3300006871 Bacteria 1976
679 Ga0075434_100247411 3300006871 Unclassified 1802
680 Ga0075434_100251669 3300006871 Bacteria 1786
681 Ga0075434_100367886 3300006871 Unclassified 1459
682 Ga0075434_100579372 3300006871 Unclassified 1141
683 Ga0075434_100669491 3300006871 Bacteria 1056
684 Ga0075434_100706222 3300006871 Unclassified 1026
685 Ga0075434_101209000 3300006871 Bacteria 768
686 Ga0075434_101240119 3300006871 Bacteria 757
687 Ga0075434_101254459 3300006871 Bacteria 752
688 Ga0075434_101689809 3300006871 Bacteria 641
689 Ga0075434_102278326 3300006871 Bacteria 545
690 Ga0075429_100021950 3300006880 Bacteria 5535
691 Ga0075429_100051497 3300006880 Bacteria 3583
692 Ga0075429_100154212 3300006880 Bacteria 2011
693 Ga0075429_100179118 3300006880 Bacteria 1857
694 Ga0075429_100313118 3300006880 Unclassified 1374
695 Ga0075429_100765807 3300006880 Unclassified 846
696 Ga0075429_100948481 3300006880 Bacteria 752
697 Ga0068865_100004635 3300006881 Bacteria 8301
698 Ga0068865_100028224 3300006881 Unclassified 3715
699 Ga0068865_100034892 3300006881 Bacteria 3379
700 Ga0068865_100035056 3300006881 Bacteria 3372
701 Ga0068865_100178498 3300006881 Bacteria 1634
702 Ga0068865_100399955 3300006881 Unclassified 1125
703 Ga0068865_100427629 3300006881 Bacteria 1090
704 Ga0068865_100519202 3300006881 Bacteria 996
705 Ga0068865_101558683 3300006881 Unclassified 593
706 Ga0068865_102089268 3300006881 Unclassified 515
707 Ga0068865_102175901 3300006881 Unclassified 505
708 Ga0075436_100004018 3300006914 Bacteria 10094
709 Ga0075436_100065371 3300006914 Bacteria 2514
710 Ga0075436_100117826 3300006914 Bacteria 1856
711 Ga0075436_100545411 3300006914 Bacteria 851
712 Ga0075436_101090075 3300006914 Bacteria 601
713 Ga0075436_101130864 3300006914 Bacteria 590
714 Ga0097620_100001189 3300006931 Bacteria 26592
715 Ga0097620_100007303 3300006931 Bacteria 11207
716 Ga0097620_100057695 3300006931 Bacteria 3910
717 Ga0097620_100057987 3300006931 Bacteria 3900
718 Ga0097620_100084218 3300006931 Bacteria 3224
719 Ga0097620_100085522 3300006931 Bacteria 3199
720 Ga0097620_100088882 3300006931 Bacteria 3139
721 Ga0097620_100131683 3300006931 Bacteria 2573
722 Ga0097620_100179776 3300006931 Bacteria 2198
723 Ga0097620_100209228 3300006931 Unclassified 2037
724 Ga0097620_100267053 3300006931 Bacteria 1803
725 Ga0097620_100672748 3300006931 Bacteria 1127
726 Ga0097620_100715091 3300006931 Bacteria 1092
727 Ga0097620_100871292 3300006931 Bacteria 986
728 Ga0097620_101169074 3300006931 Bacteria 847
729 Ga0097620_102132446 3300006931 Bacteria 619
730 Ga0097620_102234580 3300006931 Bacteria 603
731 Ga0097620_102584934 3300006931 Bacteria 559
732 Ga0097620_102855792 3300006931 Unclassified 530
733 Ga0075435_100002059 3300007076 Bacteria 13182
734 Ga0075435_100002813 3300007076 Bacteria 11639
735 Ga0075435_100003388 3300007076 Bacteria 10812
736 Ga0075435_100015991 3300007076 Bacteria 5649
737 Ga0075435_100028816 3300007076 Bacteria 4356
738 Ga0075435_100053296 3300007076 Bacteria 3262
739 Ga0075435_100103311 3300007076 Bacteria 2363
740 Ga0075435_100618144 3300007076 Bacteria 940
741 Ga0075435_100901266 3300007076 Bacteria 771
742 Ga0099794_10572816 3300007265 Unclassified 597
743 Ga0105244_10456420 3300009036 Unclassified 588
744 Ga0105240_10171136 3300009093 Bacteria 2572
745 Ga0105240_10234875 3300009093 Bacteria 2128
746 Ga0105240_11652470 3300009093 Bacteria 669
747 Ga0105240_11988535 3300009093 Bacteria 604
748 Ga0111539_10002001 3300009094 Bacteria 27198
749 Ga0111539_10002576 3300009094 Bacteria 24001
750 Ga0111539_10010325 3300009094 Bacteria 11757
751 Ga0111539_10011738 3300009094 Bacteria 10990
752 Ga0111539_10046784 3300009094 Bacteria 5174
753 Ga0111539_10115406 3300009094 Bacteria 3149
754 Ga0111539_10359532 3300009094 Unclassified 1695
755 Ga0111539_10390820 3300009094 Bacteria 1620
756 Ga0111539_10470607 3300009094 Bacteria 1463
757 Ga0111539_10555941 3300009094 Bacteria 1336
758 Ga0111539_10594898 3300009094 Bacteria 1288
759 Ga0111539_10699382 3300009094 Bacteria 1180
760 Ga0111539_10750549 3300009094 Bacteria 1136
761 Ga0111539_10750724 3300009094 Bacteria 1136
762 Ga0111539_11087553 3300009094 Bacteria 929
763 Ga0111539_11128549 3300009094 Unclassified 911
764 Ga0111539_11812289 3300009094 Bacteria 708
765 Ga0111539_12952699 3300009094 Unclassified 550
766 Ga0111539_13244993 3300009094 Unclassified 524
767 Ga0105245_10021064 3300009098 Bacteria 5719
768 Ga0105245_10025776 3300009098 Bacteria 5170
769 Ga0105245_10253059 3300009098 Bacteria 1712
770 Ga0105245_10407729 3300009098 Bacteria 1360
771 Ga0105245_11264531 3300009098 Unclassified 787
772 Ga0105245_12203332 3300009098 Unclassified 605
773 Ga0105245_13114656 3300009098 Unclassified 514
774 Ga0105245_13279846 3300009098 Bacteria 501
775 Ga0105247_10034310 3300009101 Bacteria 3090
776 Ga0105247_10047882 3300009101 Bacteria 2626
777 Ga0105247_10098845 3300009101 Bacteria 1863
778 Ga0105247_10657528 3300009101 Bacteria 784
779 Ga0114129_10001136 3300009147 Bacteria 35167
780 Ga0114129_10002946 3300009147 Bacteria 23809
781 Ga0114129_10004592 3300009147 Bacteria 19487
782 Ga0114129_10020123 3300009147 Bacteria 9497
783 Ga0114129_10022122 3300009147 Bacteria 9023
784 Ga0114129_10027105 3300009147 Bacteria 8113
785 Ga0114129_10028461 3300009147 Bacteria 7918
786 Ga0114129_10037467 3300009147 Bacteria 6845
787 Ga0114129_10040079 3300009147 Bacteria 6604
788 Ga0114129_10057047 3300009147 Bacteria 5468
789 Ga0114129_10078980 3300009147 Bacteria 4576
790 Ga0114129_10115977 3300009147 Bacteria 3690
791 Ga0114129_10117373 3300009147 Bacteria 3667
792 Ga0114129_10117933 3300009147 Bacteria 3656
793 Ga0114129_10157558 3300009147 Bacteria 3104
794 Ga0114129_10171996 3300009147 Bacteria 2952
795 Ga0114129_10277709 3300009147 Bacteria 2239
796 Ga0114129_10661319 3300009147 Unclassified 1347
797 Ga0114129_10897615 3300009147 Unclassified 1123
798 Ga0114129_11017005 3300009147 Unclassified 1043
799 Ga0114129_11065124 3300009147 Bacteria 1014
800 Ga0114129_11154774 3300009147 Bacteria 967
801 Ga0114129_11550771 3300009147 Unclassified 812
802 Ga0114129_13127635 3300009147 Unclassified 540
803 Ga0105243_10026404 3300009148 Bacteria 4444
804 Ga0105243_10028744 3300009148 Bacteria 4270
805 Ga0105243_10032111 3300009148 Bacteria 4053
806 Ga0105243_10436531 3300009148 Unclassified 1225
807 Ga0105243_10736250 3300009148 Unclassified 965
808 Ga0105243_10739879 3300009148 Bacteria 963
809 Ga0105243_10776727 3300009148 Unclassified 942
810 Ga0105243_11440226 3300009148 Bacteria 711
811 Ga0105243_11560607 3300009148 Unclassified 686
812 Ga0105243_11648404 3300009148 Bacteria 669
813 Ga0105241_10582711 3300009174 Unclassified 1008
814 Ga0105242_10012518 3300009176 Bacteria 6530
815 Ga0105242_10013395 3300009176 Bacteria 6336
816 Ga0105242_10068550 3300009176 Bacteria 2935
817 Ga0105242_10104044 3300009176 Bacteria 2409
818 Ga0105242_10131338 3300009176 Bacteria 2162
819 Ga0105242_10132461 3300009176 Unclassified 2154
820 Ga0105242_10325452 3300009176 Bacteria 1411
821 Ga0105242_10329470 3300009176 Unclassified 1403
822 Ga0105242_10381741 3300009176 Unclassified 1310
823 Ga0105242_10524107 3300009176 Bacteria 1131
824 Ga0105242_10551704 3300009176 Bacteria 1105
825 Ga0105242_11343377 3300009176 Unclassified 740
826 Ga0105242_11413407 3300009176 Unclassified 724
827 Ga0105242_12500736 3300009176 Bacteria 565
828 Ga0105242_12795040 3300009176 Unclassified 538
829 Ga0105242_13147865 3300009176 Unclassified 512
830 Ga0105248_10043347 3300009177 Bacteria 5044
831 Ga0105248_10127746 3300009177 Bacteria 2868
832 Ga0105248_10188311 3300009177 Unclassified 2325
833 Ga0105248_10197994 3300009177 Bacteria 2264
834 Ga0105248_10401003 3300009177 Bacteria 1544
835 Ga0105248_10416931 3300009177 Bacteria 1512
836 Ga0105248_10515982 3300009177 Bacteria 1348
837 Ga0105248_10516236 3300009177 Bacteria 1347
838 Ga0105248_10544739 3300009177 Unclassified 1309
839 Ga0105248_10651381 3300009177 Unclassified 1188
840 Ga0105248_11201750 3300009177 Bacteria 857
841 Ga0105248_11853336 3300009177 Bacteria 684
842 Ga0105248_11872614 3300009177 Bacteria 681
843 Ga0105248_11923027 3300009177 Bacteria 671
844 Ga0105248_12202258 3300009177 Bacteria 627
845 Ga0105237_10455188 3300009545 Bacteria 1286
846 Ga0105237_10706170 3300009545 Bacteria 1015
847 Ga0105237_11028602 3300009545 Bacteria 831
848 Ga0105237_11291122 3300009545 Bacteria 736
849 Ga0105237_11593893 3300009545 Bacteria 660
850 Ga0105238_10013992 3300009551 Bacteria 8114
851 Ga0105238_10174139 3300009551 Bacteria 2128
852 Ga0105238_10547814 3300009551 Unclassified 1161
853 Ga0105238_10825350 3300009551 Bacteria 943
854 Ga0105238_10847370 3300009551 Bacteria 931
855 Ga0105238_11344746 3300009551 Unclassified 741
856 Ga0105238_11641694 3300009551 Bacteria 673
857 Ga0105249_10038160 3300009553 Bacteria 4358
858 Ga0105249_10112023 3300009553 Bacteria 2580
859 Ga0105249_10377746 3300009553 Bacteria 1442
860 Ga0105249_10396448 3300009553 Bacteria 1409
861 Ga0105249_10966485 3300009553 Bacteria 920
862 Ga0105249_11296063 3300009553 Unclassified 800
863 Ga0105249_11683134 3300009553 Bacteria 707
864 Ga0099796_10437513 3300010159 Bacteria 580
865 Ga0099796_10586792 3300010159 Bacteria 502
866 Ga0105239_10884365 3300010375 Unclassified 1025
867 Ga0105246_10279464 3300011119 Bacteria 1338
868 Ga0105246_10386151 3300011119 Bacteria 1158
869 Ga0105246_12007378 3300011119 Unclassified 558
870 Ga0157370_10315396 3300013104 Bacteria 1443
871 Ga0157370_11773769 3300013104 Bacteria 554
872 Ga0157369_10694071 3300013105 Unclassified 1048
873 Ga0157374_10019059 3300013296 Bacteria 6070
874 Ga0157374_10021116 3300013296 Bacteria 5787
875 Ga0157374_10158911 3300013296 Bacteria 2201
876 Ga0157374_10248981 3300013296 Bacteria 1748
877 Ga0157374_10388333 3300013296 Bacteria 1391
878 Ga0157374_11910677 3300013296 Unclassified 619
879 Ga0157374_12131109 3300013296 Bacteria 587
880 Ga0157374_12271394 3300013296 Bacteria 570
881 Ga0157378_10116848 3300013297 Bacteria 2453
882 Ga0157378_10122414 3300013297 Bacteria 2400
883 Ga0157378_10144012 3300013297 Bacteria 2215
884 Ga0157378_12250994 3300013297 Bacteria 596
885 Ga0157378_12536566 3300013297 Bacteria 565
886 Ga0157378_13029328 3300013297 Bacteria 521
887 Ga0157378_13160646 3300013297 Bacteria 511
888 Ga0157378_13217066 3300013297 Bacteria 507
889 Ga0163162_10023215 3300013306 Bacteria 6119
890 Ga0163162_10085251 3300013306 Bacteria 3236
891 Ga0163162_10366532 3300013306 Bacteria 1574
892 Ga0163162_10821690 3300013306 Bacteria 1046
893 Ga0163162_10859269 3300013306 Unclassified 1022
894 Ga0163162_11043154 3300013306 Bacteria 925
895 Ga0163162_11114219 3300013306 Bacteria 894
896 Ga0163162_11130956 3300013306 Bacteria 888
897 Ga0163162_11172367 3300013306 Unclassified 871
898 Ga0163162_11246390 3300013306 Bacteria 844
899 Ga0163162_11766125 3300013306 Unclassified 707
900 Ga0163162_11993916 3300013306 Bacteria 665
901 Ga0163162_13185473 3300013306 Bacteria 526
902 Ga0163162_13269016 3300013306 Unclassified 519
903 Ga0157372_10190621 3300013307 Bacteria 2375
904 Ga0157372_10568317 3300013307 Bacteria 1322
905 Ga0157372_11432019 3300013307 Bacteria 796
906 Ga0157372_12182924 3300013307 Bacteria 636
907 Ga0157372_13370353 3300013307 Bacteria 509
908 Ga0157375_10002809 3300013308 Bacteria 15073
909 Ga0157375_10195198 3300013308 Bacteria 2179
910 Ga0157375_10267924 3300013308 Bacteria 1870
911 Ga0157375_10965827 3300013308 Unclassified 993
912 Ga0157375_11406502 3300013308 Unclassified 822
913 Ga0157375_11577475 3300013308 Bacteria 776
914 Ga0157375_11854257 3300013308 Bacteria 715
915 Ga0157375_11863662 3300013308 Unclassified 713
916 Ga0157375_12107995 3300013308 Unclassified 671
917 Ga0157375_12321154 3300013308 Bacteria 640
918 Ga0157375_12609371 3300013308 Unclassified 604
919 Ga0157375_13606814 3300013308 Unclassified 515
920 Ga0163163_10019062 3300014325 Bacteria 6437
921 Ga0163163_10029929 3300014325 Bacteria 5241
922 Ga0163163_10034366 3300014325 Bacteria 4909
923 Ga0163163_10035670 3300014325 Unclassified 4826
924 Ga0163163_10131460 3300014325 Bacteria 2543
925 Ga0163163_10152247 3300014325 Bacteria 2356
926 Ga0163163_10212125 3300014325 Bacteria 1986
927 Ga0163163_10404711 3300014325 Bacteria 1423
928 Ga0163163_10718221 3300014325 Bacteria 1063
929 Ga0163163_12579260 3300014325 Unclassified 566
930 Ga0163163_12625527 3300014325 Bacteria 561
931 Ga0157380_10033704 3300014326 Bacteria 3945
932 Ga0157380_10043376 3300014326 Bacteria 3522
933 Ga0157380_10073134 3300014326 Bacteria 2778
934 Ga0157380_10078972 3300014326 Bacteria 2686
935 Ga0157380_10089956 3300014326 Bacteria 2531
936 Ga0157380_10295034 3300014326 Unclassified 1490
937 Ga0157380_10301337 3300014326 Bacteria 1476
938 Ga0157380_10315357 3300014326 Bacteria 1447
939 Ga0157380_10320424 3300014326 Bacteria 1437
940 Ga0157380_10820105 3300014326 Unclassified 949
941 Ga0157380_11160073 3300014326 Unclassified 814
942 Ga0157380_11654413 3300014326 Unclassified 697
943 Ga0157380_11861662 3300014326 Unclassified 662
944 Ga0157380_12090282 3300014326 Unclassified 629
945 Ga0157380_12516602 3300014326 Bacteria 580
946 Ga0157380_12781108 3300014326 Unclassified 556
947 Ga0157377_10049493 3300014745 Bacteria 2363
948 Ga0157377_10097784 3300014745 Bacteria 1744
949 Ga0157377_10108179 3300014745 Bacteria 1667
950 Ga0157377_10202313 3300014745 Bacteria 1261
951 Ga0157377_10396339 3300014745 Bacteria 939
952 Ga0157377_10437902 3300014745 Unclassified 899
953 Ga0157377_10790353 3300014745 Bacteria 699
954 Ga0157377_10938283 3300014745 Unclassified 650
955 Ga0157377_11327752 3300014745 Unclassified 563
956 Ga0157377_11425515 3300014745 Unclassified 547
957 Ga0157379_10003474 3300014968 Bacteria 13338
958 Ga0157379_10075144 3300014968 Unclassified 3025
959 Ga0157379_10117348 3300014968 Bacteria 2394
960 Ga0157379_10191381 3300014968 Bacteria 1849
961 Ga0157379_10249808 3300014968 Unclassified 1610
962 Ga0157379_10378050 3300014968 Bacteria 1299
963 Ga0157379_10472510 3300014968 Bacteria 1160
964 Ga0157379_10512462 3300014968 Bacteria 1113
965 Ga0157379_10553275 3300014968 Unclassified 1071
966 Ga0157379_10945388 3300014968 Unclassified 819
967 Ga0157376_10008040 3300014969 Bacteria 7576
968 Ga0157376_10017626 3300014969 Bacteria 5454
969 Ga0157376_10018373 3300014969 Bacteria 5359
970 Ga0157376_10069948 3300014969 Bacteria 2978
971 Ga0157376_10200328 3300014969 Bacteria 1836
972 Ga0157376_10264606 3300014969 Bacteria 1613
973 Ga0157376_10301913 3300014969 Bacteria 1516
974 Ga0157376_10411659 3300014969 Bacteria 1310
975 Ga0157376_12620232 3300014969 Bacteria 544
976 Ga0163161_10437450 3300017792 Bacteria 1055
977 Ga0163161_10497282 3300017792 Bacteria 992
978 Ga0163161_10537660 3300017792 Bacteria 956
979 Ga0163161_11833857 3300017792 Bacteria 540
980 Ga0206350_10273369 3300020080 Unclassified 1044
981 Ga0213876_10130218 3300021384 Bacteria 1337
982 Ga0207697_10049925 3300025315 Bacteria 1727
983 Ga0207697_10064197 3300025315 Unclassified 1531
984 Ga0207697_10159881 3300025315 Unclassified 982
985 Ga0207697_10222430 3300025315 Bacteria 833
986 Ga0207697_10353957 3300025315 Bacteria 652
987 Ga0207697_10465749 3300025315 Unclassified 560
988 Ga0207697_10470305 3300025315 Bacteria 557
989 Ga0207656_10084620 3300025321 Unclassified 1431
990 Ga0207653_10043956 3300025885 Bacteria 1472
991 Ga0207682_10014308 3300025893 Bacteria 3090
992 Ga0207682_10056482 3300025893 Bacteria 1634
993 Ga0207682_10352289 3300025893 Unclassified 694
994 Ga0207682_10479119 3300025893 Unclassified 589
995 Ga0207692_10286169 3300025898 Bacteria 999
996 Ga0207642_10049260 3300025899 Bacteria 1893
997 Ga0207642_10091674 3300025899 Bacteria 1502
998 Ga0207642_10153016 3300025899 Bacteria 1230
999 Ga0207642_10355579 3300025899 Bacteria 865
1000 Ga0207642_10418167 3300025899 Unclassified 806
1001 Ga0207710_10019937 3300025900 Bacteria 2864
1002 Ga0207710_10027337 3300025900 Bacteria 2469
1003 Ga0207710_10029566 3300025900 Unclassified 2386
1004 Ga0207688_10184921 3300025901 Bacteria 1244
1005 Ga0207688_10589021 3300025901 Bacteria 700
1006 Ga0207688_10715990 3300025901 Unclassified 633
1007 Ga0207688_10962474 3300025901 Bacteria 540
1008 Ga0207680_10067236 3300025903 Bacteria 2207
1009 Ga0207680_10176061 3300025903 Bacteria 1444
1010 Ga0207680_10248151 3300025903 Unclassified 1229
1011 Ga0207680_10398804 3300025903 Bacteria 972
1012 Ga0207680_10472893 3300025903 Bacteria 891
1013 Ga0207680_10830626 3300025903 Unclassified 662
1014 Ga0207680_10909453 3300025903 Unclassified 631
1015 Ga0207680_10955625 3300025903 Bacteria 614
1016 Ga0207680_10996224 3300025903 Unclassified 600
1017 Ga0207680_10997477 3300025903 Bacteria 600
1018 Ga0207680_11212266 3300025903 Unclassified 538
1019 Ga0207680_11221007 3300025903 Unclassified 536
1020 Ga0207680_11306948 3300025903 Unclassified 516
1021 Ga0207647_10782042 3300025904 Unclassified 514
1022 Ga0207685_10053071 3300025905 Bacteria 1573
1023 Ga0207699_10010829 3300025906 Bacteria 4591
1024 Ga0207699_10091637 3300025906 Bacteria 1909
1025 Ga0207645_10014261 3300025907 Bacteria 5322
1026 Ga0207645_10242702 3300025907 Bacteria 1190
1027 Ga0207645_10250164 3300025907 Bacteria 1172
1028 Ga0207645_10360987 3300025907 Unclassified 973
1029 Ga0207645_10364706 3300025907 Bacteria 968
1030 Ga0207645_10648592 3300025907 Unclassified 717
1031 Ga0207645_10696259 3300025907 Unclassified 691
1032 Ga0207645_11191276 3300025907 Unclassified 512
1033 Ga0207643_10004564 3300025908 Bacteria 7442
1034 Ga0207643_10008987 3300025908 Bacteria 5364
1035 Ga0207643_10035071 3300025908 Bacteria 2812
1036 Ga0207643_10065663 3300025908 Bacteria 2079
1037 Ga0207643_10136963 3300025908 Bacteria 1460
1038 Ga0207643_10154565 3300025908 Unclassified 1377
1039 Ga0207643_10156111 3300025908 Bacteria 1371
1040 Ga0207643_10193751 3300025908 Bacteria 1235
1041 Ga0207643_10306345 3300025908 Bacteria 989
1042 Ga0207643_10537439 3300025908 Unclassified 749
1043 Ga0207643_10947459 3300025908 Unclassified 557
1044 Ga0207684_10257555 3300025910 Bacteria 1505
1045 Ga0207684_10381313 3300025910 Bacteria 1213
1046 Ga0207684_10622887 3300025910 Unclassified 920
1047 Ga0207684_10812381 3300025910 Bacteria 790
1048 Ga0207684_10912112 3300025910 Bacteria 738
1049 Ga0207684_11163112 3300025910 Bacteria 640
1050 Ga0207684_11426903 3300025910 Unclassified 566
1051 Ga0207684_11557443 3300025910 Bacteria 536
1052 Ga0207654_10177645 3300025911 Unclassified 1387
1053 Ga0207654_11070021 3300025911 Bacteria 587
1054 Ga0207707_10024100 3300025912 Bacteria 5322
1055 Ga0207707_10032794 3300025912 Bacteria 4546
1056 Ga0207707_10279831 3300025912 Unclassified 1445
1057 Ga0207707_10601049 3300025912 Bacteria 931
1058 Ga0207707_11121255 3300025912 Bacteria 640
1059 Ga0207707_11520945 3300025912 Bacteria 530
1060 Ga0207695_10529415 3300025913 Bacteria 1060
1061 Ga0207695_10788680 3300025913 Bacteria 830
1062 Ga0207695_11164215 3300025913 Unclassified 651
1063 Ga0207671_10523927 3300025914 Bacteria 945
1064 Ga0207693_10950933 3300025915 Unclassified 658
1065 Ga0207663_10094880 3300025916 Bacteria 1989
1066 Ga0207663_10266738 3300025916 Unclassified 1267
1067 Ga0207663_11135376 3300025916 Bacteria 628
1068 Ga0207660_10225449 3300025917 Unclassified 1472
1069 Ga0207660_10265138 3300025917 Unclassified 1359
1070 Ga0207660_10272707 3300025917 Bacteria 1340
1071 Ga0207660_10431858 3300025917 Unclassified 1063
1072 Ga0207660_10622017 3300025917 Unclassified 880
1073 Ga0207660_10921116 3300025917 Unclassified 713
1074 Ga0207660_11551999 3300025917 Bacteria 534
1075 Ga0207662_10002904 3300025918 Bacteria 8689
1076 Ga0207662_10011988 3300025918 Bacteria 4821
1077 Ga0207662_10017112 3300025918 Bacteria 4098
1078 Ga0207662_10110207 3300025918 Unclassified 1715
1079 Ga0207662_10141593 3300025918 Bacteria 1524
1080 Ga0207662_10356241 3300025918 Unclassified 984
1081 Ga0207662_11183159 3300025918 Unclassified 543
1082 Ga0207662_11370855 3300025918 Unclassified 502
1083 Ga0207657_10188145 3300025919 Bacteria 1667
1084 Ga0207657_10542384 3300025919 Bacteria 910
1085 Ga0207649_10152232 3300025920 Bacteria 1594
1086 Ga0207649_10292330 3300025920 Bacteria 1188
1087 Ga0207649_10827093 3300025920 Unclassified 724
1088 Ga0207649_11098679 3300025920 Bacteria 627
1089 Ga0207649_11450030 3300025920 Bacteria 543
1090 Ga0207652_10119412 3300025921 Bacteria 2345
1091 Ga0207652_10121939 3300025921 Bacteria 2320
1092 Ga0207652_10625792 3300025921 Unclassified 964
1093 Ga0207652_10886454 3300025921 Unclassified 789
1094 Ga0207646_10038633 3300025922 Bacteria 4298
1095 Ga0207646_10072249 3300025922 Bacteria 3082
1096 Ga0207646_10121718 3300025922 Bacteria 2344
1097 Ga0207646_10242014 3300025922 Unclassified 1630
1098 Ga0207646_10965973 3300025922 Bacteria 754
1099 Ga0207646_11039703 3300025922 Bacteria 723
1100 Ga0207646_11777976 3300025922 Unclassified 528
1101 Ga0207681_10018017 3300025923 Bacteria 4443
1102 Ga0207681_10030217 3300025923 Bacteria 3530
1103 Ga0207681_10033207 3300025923 Bacteria 3381
1104 Ga0207681_10043090 3300025923 Bacteria 3019
1105 Ga0207681_10060642 3300025923 Bacteria 2597
1106 Ga0207681_10060846 3300025923 Bacteria 2594
1107 Ga0207681_10084558 3300025923 Bacteria 2249
1108 Ga0207681_10129938 3300025923 Bacteria 1861
1109 Ga0207681_10158937 3300025923 Bacteria 1701
1110 Ga0207681_10226443 3300025923 Bacteria 1449
1111 Ga0207681_10515486 3300025923 Bacteria 981
1112 Ga0207681_10834221 3300025923 Bacteria 771
1113 Ga0207694_10013622 3300025924 Bacteria 6130
1114 Ga0207694_11132165 3300025924 Bacteria 662
1115 Ga0207650_10028078 3300025925 Bacteria 4032
1116 Ga0207650_10064428 3300025925 Bacteria 2743
1117 Ga0207650_10076891 3300025925 Bacteria 2522
1118 Ga0207650_10171181 3300025925 Bacteria 1726
1119 Ga0207650_10214392 3300025925 Bacteria 1547
1120 Ga0207650_10276071 3300025925 Bacteria 1367
1121 Ga0207650_10868048 3300025925 Bacteria 766
1122 Ga0207650_11001007 3300025925 Unclassified 711
1123 Ga0207650_11004823 3300025925 Bacteria 709
1124 Ga0207659_10000165 3300025926 Bacteria 39413
1125 Ga0207659_10014307 3300025926 Bacteria 5112
1126 Ga0207659_10014896 3300025926 Bacteria 5027
1127 Ga0207659_10045471 3300025926 Bacteria 3095
1128 Ga0207659_10065813 3300025926 Bacteria 2628
1129 Ga0207659_10067674 3300025926 Bacteria 2595
1130 Ga0207659_10089736 3300025926 Bacteria 2293
1131 Ga0207659_10270937 3300025926 Bacteria 1385
1132 Ga0207659_10274873 3300025926 Bacteria 1375
1133 Ga0207659_10301783 3300025926 Bacteria 1315
1134 Ga0207659_10324308 3300025926 Unclassified 1271
1135 Ga0207659_10369885 3300025926 Unclassified 1193
1136 Ga0207659_10615186 3300025926 Bacteria 927
1137 Ga0207659_10832869 3300025926 Bacteria 793
1138 Ga0207659_11162154 3300025926 Bacteria 664
1139 Ga0207687_10034358 3300025927 Bacteria 3442
1140 Ga0207687_10096210 3300025927 Bacteria 2170
1141 Ga0207687_10162619 3300025927 Bacteria 1715
1142 Ga0207687_10290488 3300025927 Bacteria 1314
1143 Ga0207700_10086331 3300025928 Unclassified 2466
1144 Ga0207700_10359270 3300025928 Unclassified 1270
1145 Ga0207700_11587640 3300025928 Bacteria 579
1146 Ga0207644_10022799 3300025931 Bacteria 4280
1147 Ga0207644_10240169 3300025931 Unclassified 1442
1148 Ga0207644_10250864 3300025931 Bacteria 1412
1149 Ga0207644_10318543 3300025931 Bacteria 1257
1150 Ga0207644_10706626 3300025931 Bacteria 841
1151 Ga0207644_10723932 3300025931 Bacteria 830
1152 Ga0207644_10768858 3300025931 Bacteria 805
1153 Ga0207644_10967400 3300025931 Bacteria 714
1154 Ga0207644_10974822 3300025931 Bacteria 711
1155 Ga0207690_10215206 3300025932 Bacteria 1467
1156 Ga0207690_10449546 3300025932 Bacteria 1035
1157 Ga0207690_10460417 3300025932 Unclassified 1023
1158 Ga0207690_11181628 3300025932 Bacteria 638
1159 Ga0207690_11802667 3300025932 Unclassified 511
1160 Ga0207706_10015695 3300025933 Bacteria 6847
1161 Ga0207706_10068523 3300025933 Bacteria 3122
1162 Ga0207706_10077397 3300025933 Bacteria 2925
1163 Ga0207706_10096178 3300025933 Unclassified 2604
1164 Ga0207706_10250863 3300025933 Bacteria 1546
1165 Ga0207706_10357566 3300025933 Unclassified 1269
1166 Ga0207706_11035438 3300025933 Bacteria 688
1167 Ga0207706_11172750 3300025933 Unclassified 639
1168 Ga0207706_11582591 3300025933 Unclassified 532
1169 Ga0207706_11680527 3300025933 Bacteria 512
1170 Ga0207686_10031500 3300025934 Bacteria 3150
1171 Ga0207686_10048667 3300025934 Bacteria 2627
1172 Ga0207686_10193033 3300025934 Bacteria 1453
1173 Ga0207686_10205680 3300025934 Unclassified 1412
1174 Ga0207686_10213253 3300025934 Unclassified 1389
1175 Ga0207686_10279108 3300025934 Unclassified 1232
1176 Ga0207686_10306610 3300025934 Bacteria 1181
1177 Ga0207686_10414150 3300025934 Bacteria 1029
1178 Ga0207686_10626753 3300025934 Unclassified 849
1179 Ga0207686_10758118 3300025934 Bacteria 775
1180 Ga0207709_10003211 3300025935 Bacteria 9827
1181 Ga0207709_10019406 3300025935 Bacteria 3822
1182 Ga0207709_10023716 3300025935 Bacteria 3495
1183 Ga0207709_10034561 3300025935 Bacteria 2980
1184 Ga0207709_10155331 3300025935 Bacteria 1589
1185 Ga0207709_10570687 3300025935 Bacteria 892
1186 Ga0207709_10584420 3300025935 Bacteria 882
1187 Ga0207709_10678031 3300025935 Unclassified 823
1188 Ga0207670_10009012 3300025936 Bacteria 5664
1189 Ga0207670_10139424 3300025936 Bacteria 1786
1190 Ga0207670_10226134 3300025936 Unclassified 1435
1191 Ga0207670_10318199 3300025936 Unclassified 1224
1192 Ga0207670_10496393 3300025936 Unclassified 990
1193 Ga0207670_10537851 3300025936 Bacteria 953
1194 Ga0207670_10635179 3300025936 Bacteria 879
1195 Ga0207670_10727907 3300025936 Unclassified 823
1196 Ga0207670_10740851 3300025936 Bacteria 816
1197 Ga0207670_10946453 3300025936 Bacteria 723
1198 Ga0207670_11167465 3300025936 Unclassified 651
1199 Ga0207670_11797082 3300025936 Bacteria 521
1200 Ga0207669_10008814 3300025937 Bacteria 4758
1201 Ga0207669_10369871 3300025937 Unclassified 1114
1202 Ga0207669_10400745 3300025937 Unclassified 1075
1203 Ga0207669_10575256 3300025937 Bacteria 912
1204 Ga0207669_10749922 3300025937 Unclassified 806
1205 Ga0207669_11085890 3300025937 Unclassified 675
1206 Ga0207669_11677889 3300025937 Bacteria 543
1207 Ga0207669_11918973 3300025937 Unclassified 506
1208 Ga0207669_11928588 3300025937 Unclassified 505
1209 Ga0207704_10009747 3300025938 Bacteria 4651
1210 Ga0207704_10022277 3300025938 Bacteria 3391
1211 Ga0207704_10068788 3300025938 Bacteria 2234
1212 Ga0207704_10197852 3300025938 Bacteria 1468
1213 Ga0207704_10369956 3300025938 Bacteria 1122
1214 Ga0207704_10405746 3300025938 Unclassified 1077
1215 Ga0207704_10603234 3300025938 Bacteria 899
1216 Ga0207704_10646160 3300025938 Bacteria 871
1217 Ga0207704_10963292 3300025938 Bacteria 720
1218 Ga0207704_11535749 3300025938 Unclassified 572
1219 Ga0207665_10069360 3300025939 Bacteria 2404
1220 Ga0207665_10352338 3300025939 Bacteria 1111
1221 Ga0207665_10441477 3300025939 Bacteria 997
1222 Ga0207691_10015223 3300025940 Bacteria 7318
1223 Ga0207691_10028979 3300025940 Bacteria 5181
1224 Ga0207691_10034416 3300025940 Bacteria 4710
1225 Ga0207691_10042880 3300025940 Bacteria 4170
1226 Ga0207691_10045474 3300025940 Bacteria 4035
1227 Ga0207691_10057115 3300025940 Bacteria 3553
1228 Ga0207691_10072796 3300025940 Bacteria 3100
1229 Ga0207691_10164347 3300025940 Bacteria 1946
1230 Ga0207691_10588403 3300025940 Bacteria 942
1231 Ga0207691_10769479 3300025940 Bacteria 810
1232 Ga0207691_10962129 3300025940 Unclassified 713
1233 Ga0207691_11056678 3300025940 Bacteria 676
1234 Ga0207691_11172131 3300025940 Bacteria 638
1235 Ga0207691_11526656 3300025940 Bacteria 545
1236 Ga0207711_10049790 3300025941 Bacteria 3587
1237 Ga0207711_10091868 3300025941 Bacteria 2670
1238 Ga0207711_10131402 3300025941 Bacteria 2245
1239 Ga0207711_10245490 3300025941 Bacteria 1643
1240 Ga0207711_10308424 3300025941 Bacteria 1461
1241 Ga0207711_10334302 3300025941 Bacteria 1401
1242 Ga0207711_10688196 3300025941 Bacteria 954
1243 Ga0207711_11090561 3300025941 Bacteria 739
1244 Ga0207689_10000643 3300025942 Bacteria 33304
1245 Ga0207689_10012520 3300025942 Bacteria 7247
1246 Ga0207689_10027940 3300025942 Bacteria 4720
1247 Ga0207689_10112350 3300025942 Bacteria 2240
1248 Ga0207689_10307612 3300025942 Unclassified 1314
1249 Ga0207689_10403197 3300025942 Bacteria 1140
1250 Ga0207689_10595304 3300025942 Unclassified 930
1251 Ga0207689_10693756 3300025942 Unclassified 858
1252 Ga0207689_10699686 3300025942 Unclassified 855
1253 Ga0207689_10965934 3300025942 Unclassified 719
1254 Ga0207689_11224060 3300025942 Bacteria 632
1255 Ga0207661_10024608 3300025944 Bacteria 4565
1256 Ga0207661_10163985 3300025944 Bacteria 1930
1257 Ga0207661_10876146 3300025944 Unclassified 827
1258 Ga0207661_11404642 3300025944 Bacteria 641
1259 Ga0207679_10005908 3300025945 Bacteria 7696
1260 Ga0207679_10031345 3300025945 Bacteria 3720
1261 Ga0207679_10065947 3300025945 Bacteria 2711
1262 Ga0207679_10088086 3300025945 Bacteria 2392
1263 Ga0207679_10092172 3300025945 Unclassified 2347
1264 Ga0207679_10430540 3300025945 Unclassified 1166
1265 Ga0207679_10439324 3300025945 Unclassified 1155
1266 Ga0207679_10594321 3300025945 Unclassified 997
1267 Ga0207679_10598109 3300025945 Unclassified 994
1268 Ga0207679_10689792 3300025945 Bacteria 926
1269 Ga0207679_10799201 3300025945 Bacteria 860
1270 Ga0207679_10825695 3300025945 Bacteria 846
1271 Ga0207679_10919010 3300025945 Bacteria 801
1272 Ga0207679_11153628 3300025945 Bacteria 711
1273 Ga0207679_11525040 3300025945 Unclassified 613
1274 Ga0207679_12005714 3300025945 Bacteria 527
1275 Ga0207667_10309437 3300025949 Unclassified 1614
1276 Ga0207667_11210429 3300025949 Bacteria 735
1277 Ga0207651_10007557 3300025960 Bacteria 5797
1278 Ga0207651_10016199 3300025960 Bacteria 4358
1279 Ga0207651_10041108 3300025960 Bacteria 3066
1280 Ga0207651_10046772 3300025960 Unclassified 2913
1281 Ga0207651_10052086 3300025960 Bacteria 2789
1282 Ga0207651_10166720 3300025960 Bacteria 1733
1283 Ga0207651_10167347 3300025960 Bacteria 1730
1284 Ga0207651_10278176 3300025960 Bacteria 1382
1285 Ga0207651_10449675 3300025960 Unclassified 1105
1286 Ga0207651_10674156 3300025960 Bacteria 909
1287 Ga0207651_10744216 3300025960 Bacteria 866
1288 Ga0207651_10894005 3300025960 Bacteria 791
1289 Ga0207651_10927054 3300025960 Unclassified 776
1290 Ga0207651_11071257 3300025960 Bacteria 722
1291 Ga0207651_11119671 3300025960 Bacteria 706
1292 Ga0207651_11147183 3300025960 Bacteria 697
1293 Ga0207651_11545355 3300025960 Unclassified 598
1294 Ga0207651_11982127 3300025960 Bacteria 523
1295 Ga0207712_10017338 3300025961 Bacteria 4676
1296 Ga0207712_10200611 3300025961 Bacteria 1582
1297 Ga0207712_10319392 3300025961 Bacteria 1281
1298 Ga0207712_10445306 3300025961 Bacteria 1097
1299 Ga0207712_10665168 3300025961 Bacteria 906
1300 Ga0207712_11546699 3300025961 Unclassified 594
1301 Ga0207668_10023731 3300025972 Bacteria 3948
1302 Ga0207668_10106115 3300025972 Bacteria 2098
1303 Ga0207668_10251701 3300025972 Unclassified 1435
1304 Ga0207668_10670254 3300025972 Unclassified 909
1305 Ga0207668_10832751 3300025972 Bacteria 818
1306 Ga0207668_11029862 3300025972 Bacteria 736
1307 Ga0207668_11210671 3300025972 Bacteria 679
1308 Ga0207640_10026642 3300025981 Bacteria 3513
1309 Ga0207640_10103802 3300025981 Bacteria 1999
1310 Ga0207640_10591060 3300025981 Unclassified 938
1311 Ga0207640_10826655 3300025981 Bacteria 804
1312 Ga0207640_10869540 3300025981 Bacteria 785
1313 Ga0207640_10947345 3300025981 Bacteria 754
1314 Ga0207640_11397624 3300025981 Unclassified 627
1315 Ga0207658_10069509 3300025986 Bacteria 2661
1316 Ga0207658_10095471 3300025986 Bacteria 2317
1317 Ga0207658_10226337 3300025986 Unclassified 1576
1318 Ga0207658_10314518 3300025986 Bacteria 1354
1319 Ga0207658_11660041 3300025986 Unclassified 584
1320 Ga0207677_10169465 3300026023 Unclassified 1706
1321 Ga0207677_10668226 3300026023 Bacteria 919
1322 Ga0207677_10900899 3300026023 Unclassified 797
1323 Ga0207677_11093760 3300026023 Bacteria 726
1324 Ga0207677_11235143 3300026023 Bacteria 685
1325 Ga0207677_11403119 3300026023 Bacteria 643
1326 Ga0207677_11760033 3300026023 Bacteria 575
1327 Ga0207703_10006564 3300026035 Bacteria 9281
1328 Ga0207703_10012636 3300026035 Bacteria 6583
1329 Ga0207703_10016387 3300026035 Bacteria 5777
1330 Ga0207703_10045106 3300026035 Bacteria 3545
1331 Ga0207703_10100769 3300026035 Bacteria 2448
1332 Ga0207703_10148031 3300026035 Bacteria 2044
1333 Ga0207703_10162401 3300026035 Bacteria 1957
1334 Ga0207703_10285938 3300026035 Unclassified 1499
1335 Ga0207703_10314417 3300026035 Bacteria 1432
1336 Ga0207703_10428486 3300026035 Bacteria 1232
1337 Ga0207703_10664248 3300026035 Bacteria 989
1338 Ga0207703_10950113 3300026035 Unclassified 824
1339 Ga0207703_11114922 3300026035 Unclassified 758
1340 Ga0207703_11396596 3300026035 Bacteria 673
1341 Ga0207639_10338372 3300026041 Bacteria 1341
1342 Ga0207639_11101652 3300026041 Bacteria 745
1343 Ga0207639_11295974 3300026041 Bacteria 684
1344 Ga0207639_11299872 3300026041 Bacteria 683
1345 Ga0207639_12260954 3300026041 Unclassified 505
1346 Ga0207678_10025441 3300026067 Bacteria 5166
1347 Ga0207678_10362109 3300026067 Unclassified 1252
1348 Ga0207678_10731721 3300026067 Bacteria 872
1349 Ga0207678_10897194 3300026067 Bacteria 784
1350 Ga0207708_10018340 3300026075 Bacteria 5271
1351 Ga0207708_10040694 3300026075 Bacteria 3543
1352 Ga0207708_10096306 3300026075 Unclassified 2287
1353 Ga0207708_10128468 3300026075 Unclassified 1980
1354 Ga0207708_10133563 3300026075 Bacteria 1942
1355 Ga0207708_10200597 3300026075 Bacteria 1592
1356 Ga0207708_10422587 3300026075 Bacteria 1105
1357 Ga0207708_10525207 3300026075 Unclassified 995
1358 Ga0207708_10734479 3300026075 Unclassified 846
1359 Ga0207708_11328993 3300026075 Unclassified 630
1360 Ga0207708_11626520 3300026075 Unclassified 567
1361 Ga0207708_11988270 3300026075 Bacteria 509
1362 Ga0207641_10000431 3300026088 Bacteria 48383
1363 Ga0207641_10031847 3300026088 Bacteria 4375
1364 Ga0207641_10036202 3300026088 Bacteria 4119
1365 Ga0207641_10206608 3300026088 Bacteria 1814
1366 Ga0207641_10252308 3300026088 Unclassified 1648
1367 Ga0207641_10264777 3300026088 Bacteria 1611
1368 Ga0207641_10441704 3300026088 Bacteria 1256
1369 Ga0207641_10468946 3300026088 Bacteria 1219
1370 Ga0207641_10645218 3300026088 Unclassified 1039
1371 Ga0207641_12167456 3300026088 Bacteria 556
1372 Ga0207648_10002155 3300026089 Bacteria 21410
1373 Ga0207648_10018357 3300026089 Bacteria 6336
1374 Ga0207648_10026873 3300026089 Bacteria 5111
1375 Ga0207648_10030598 3300026089 Bacteria 4765
1376 Ga0207648_10031427 3300026089 Bacteria 4695
1377 Ga0207648_10087590 3300026089 Bacteria 2717
1378 Ga0207648_10156347 3300026089 Bacteria 2013
1379 Ga0207648_10277219 3300026089 Bacteria 1499
1380 Ga0207648_10360323 3300026089 Bacteria 1312
1381 Ga0207648_10362586 3300026089 Bacteria 1308
1382 Ga0207648_10851950 3300026089 Bacteria 850
1383 Ga0207648_11751664 3300026089 Bacteria 583
1384 Ga0207648_11949796 3300026089 Unclassified 549
1385 Ga0207648_11989844 3300026089 Unclassified 542
1386 Ga0207676_10030791 3300026095 Bacteria 4031
1387 Ga0207676_10032794 3300026095 Bacteria 3918
1388 Ga0207676_10055223 3300026095 Bacteria 3117
1389 Ga0207676_10067449 3300026095 Unclassified 2858
1390 Ga0207676_10070230 3300026095 Bacteria 2808
1391 Ga0207676_10090359 3300026095 Unclassified 2513
1392 Ga0207676_10132256 3300026095 Bacteria 2123
1393 Ga0207676_10211203 3300026095 Bacteria 1722
1394 Ga0207676_10322560 3300026095 Bacteria 1418
1395 Ga0207676_10409868 3300026095 Unclassified 1269
1396 Ga0207676_10823230 3300026095 Bacteria 907
1397 Ga0207676_11198411 3300026095 Bacteria 752
1398 Ga0207676_11809298 3300026095 Unclassified 609
1399 Ga0207676_11883429 3300026095 Unclassified 597
1400 Ga0207674_10006828 3300026116 Bacteria 13385
1401 Ga0207674_10091271 3300026116 Bacteria 3036
1402 Ga0207674_10142420 3300026116 Bacteria 2357
1403 Ga0207674_10161299 3300026116 Bacteria 2196
1404 Ga0207674_10187239 3300026116 Bacteria 2020
1405 Ga0207674_10257171 3300026116 Unclassified 1693
1406 Ga0207674_10374322 3300026116 Bacteria 1377
1407 Ga0207674_11130554 3300026116 Bacteria 753
1408 Ga0207675_100004553 3300026118 Bacteria 13372
1409 Ga0207675_100009694 3300026118 Bacteria 9010
1410 Ga0207675_100014548 3300026118 Bacteria 7335
1411 Ga0207675_100197314 3300026118 Unclassified 1932
1412 Ga0207675_100210134 3300026118 Unclassified 1871
1413 Ga0207675_100239658 3300026118 Bacteria 1752
1414 Ga0207675_100447241 3300026118 Bacteria 1280
1415 Ga0207675_100687561 3300026118 Unclassified 1031
1416 Ga0207675_100920913 3300026118 Bacteria 891
1417 Ga0207675_101042616 3300026118 Bacteria 837
1418 Ga0207675_101207690 3300026118 Unclassified 776
1419 Ga0207675_101627606 3300026118 Bacteria 666
1420 Ga0207683_10008415 3300026121 Bacteria 8830
1421 Ga0207683_10010954 3300026121 Bacteria 7733
1422 Ga0207683_10142568 3300026121 Bacteria 2159
1423 Ga0207683_10179410 3300026121 Unclassified 1920
1424 Ga0207683_10256864 3300026121 Bacteria 1595
1425 Ga0207683_10379802 3300026121 Bacteria 1299
1426 Ga0207683_10486276 3300026121 Unclassified 1139
1427 Ga0207683_10549442 3300026121 Bacteria 1068
1428 Ga0207683_10552254 3300026121 Bacteria 1065
1429 Ga0207683_10577111 3300026121 Bacteria 1040
1430 Ga0207683_10837759 3300026121 Unclassified 854
1431 Ga0207683_10859681 3300026121 Unclassified 842
1432 Ga0207683_11922119 3300026121 Bacteria 540
1433 Ga0207698_10147970 3300026142 Bacteria 2034
1434 Ga0207698_10255878 3300026142 Bacteria 1605
1435 Ga0207698_10679312 3300026142 Bacteria 1023
1436 Ga0207698_10717755 3300026142 Bacteria 996
1437 Ga0207698_10930436 3300026142 Bacteria 878
1438 Ga0209981_1071703 3300027378 Bacteria 535
1439 Ga0209968_1088074 3300027526 Unclassified 562
1440 Ga0209974_10319506 3300027876 Unclassified 597
1441 Ga0209974_10320713 3300027876 Unclassified 596
1442 Ga0207428_10000527 3300027907 Bacteria 45656
1443 Ga0207428_10004414 3300027907 Bacteria 13390
1444 Ga0207428_10017113 3300027907 Bacteria 6228
1445 Ga0207428_10142308 3300027907 Bacteria 1829
1446 Ga0207428_10150857 3300027907 Bacteria 1769
1447 Ga0207428_10241319 3300027907 Unclassified 1350
1448 Ga0207428_10294418 3300027907 Unclassified 1202
1449 Ga0207428_10321461 3300027907 Bacteria 1143
1450 Ga0207428_10402596 3300027907 Unclassified 1002
1451 Ga0207428_10491164 3300027907 Unclassified 892
1452 Ga0207428_10494367 3300027907 Unclassified 889
1453 Ga0207428_10734045 3300027907 Unclassified 705
1454 Ga0207428_10914384 3300027907 Bacteria 619
1455 Ga0268266_10009542 3300028379 Bacteria 8540
1456 Ga0268266_10130451 3300028379 Bacteria 2247
1457 Ga0268266_10726883 3300028379 Bacteria 958
1458 Ga0268266_10927708 3300028379 Bacteria 842
1459 Ga0268266_11027035 3300028379 Bacteria 798
1460 Ga0268266_11314676 3300028379 Unclassified 698
1461 Ga0268266_11389472 3300028379 Unclassified 678
1462 Ga0268265_10001463 3300028380 Bacteria 19839
1463 Ga0268265_10009722 3300028380 Bacteria 6491
1464 Ga0268265_10077817 3300028380 Bacteria 2606
1465 Ga0268265_10144587 3300028380 Bacteria 1996
1466 Ga0268265_10146120 3300028380 Bacteria 1987
1467 Ga0268265_10223835 3300028380 Unclassified 1648
1468 Ga0268265_10483891 3300028380 Bacteria 1163
1469 Ga0268265_10985565 3300028380 Bacteria 832
1470 Ga0268265_11108192 3300028380 Unclassified 786
1471 Ga0268265_11196130 3300028380 Unclassified 757
1472 Ga0268265_11263798 3300028380 Unclassified 737
1473 Ga0268265_11294758 3300028380 Unclassified 729
1474 Ga0268265_11297125 3300028380 Unclassified 728
1475 Ga0268265_11440996 3300028380 Unclassified 691
1476 Ga0268265_11643542 3300028380 Bacteria 648
1477 Ga0268264_10011300 3300028381 Bacteria 7376
1478 Ga0268264_10064504 3300028381 Bacteria 3083
1479 Ga0268264_10145089 3300028381 Bacteria 2121
1480 Ga0268264_10259747 3300028381 Bacteria 1617
1481 Ga0268264_10427837 3300028381 Bacteria 1278
1482 Ga0268264_10429280 3300028381 Bacteria 1276
1483 Ga0268264_10446884 3300028381 Unclassified 1252
1484 Ga0268264_10570671 3300028381 Unclassified 1112
1485 Ga0268264_10715505 3300028381 Bacteria 995
1486 Ga0268264_10743360 3300028381 Bacteria 977
1487 Ga0268264_11101824 3300028381 Unclassified 802
1488 Ga0268264_11109541 3300028381 Bacteria 800
1489 Ga0268264_11544391 3300028381 Unclassified 674
1490 Ga0268264_11783778 3300028381 Bacteria 625
1491 Ga0265318_10401734 3300028577 Unclassified 501
1492 Ga0307511_10228856 3300030521 Unclassified 923
1493 Ga0316177_1067784 3300030731 Bacteria 741
1494 Ga0307408_100065395 3300031548 Unclassified 2667
1495 Ga0307408_100335153 3300031548 Unclassified 1279
1496 Ga0307408_100340286 3300031548 Unclassified 1270
1497 Ga0307408_100613114 3300031548 Unclassified 968
1498 Ga0307408_100690569 3300031548 Unclassified 916
1499 Ga0307408_101565426 3300031548 Bacteria 625
1500 Ga0307405_10020527 3300031731 Bacteria 3694
1501 Ga0307405_10046873 3300031731 Bacteria 2659
1502 Ga0307405_10103027 3300031731 Unclassified 1918
1503 Ga0307405_10731235 3300031731 Bacteria 823
1504 Ga0307405_10843144 3300031731 Bacteria 771
1505 Ga0307405_11458077 3300031731 Unclassified 600
1506 Ga0307413_10024650 3300031824 Bacteria 3283
1507 Ga0307413_10148712 3300031824 Bacteria 1629
1508 Ga0307413_10450460 3300031824 Bacteria 1021
1509 Ga0307413_10702311 3300031824 Bacteria 840
1510 Ga0307413_10808995 3300031824 Bacteria 788
1511 Ga0307410_10002707 3300031852 Bacteria 8651
1512 Ga0307410_10018326 3300031852 Bacteria 4229
1513 Ga0307410_10320242 3300031852 Bacteria 1230
1514 Ga0307410_10780237 3300031852 Unclassified 811
1515 Ga0307410_12030454 3300031852 Bacteria 513
1516 Ga0307406_10084061 3300031901 Bacteria 2124
1517 Ga0307406_10188675 3300031901 Bacteria 1507
1518 Ga0307407_10005552 3300031903 Bacteria 5488
1519 Ga0307407_10162816 3300031903 Bacteria 1461
1520 Ga0307412_10046165 3300031911 Bacteria 2853
1521 Ga0307412_10068745 3300031911 Bacteria 2409
1522 Ga0307412_10092398 3300031911 Unclassified 2120
1523 Ga0307412_10112945 3300031911 Bacteria 1943
1524 Ga0307409_100142461 3300031995 Bacteria 2067
1525 Ga0307409_100178191 3300031995 Bacteria 1878
1526 Ga0307409_100640346 3300031995 Unclassified 1056
1527 Ga0307409_100684838 3300031995 Unclassified 1023
1528 Ga0307416_100018347 3300032002 Bacteria 4926
1529 Ga0307416_100037547 3300032002 Bacteria 3728
1530 Ga0307416_100049139 3300032002 Bacteria 3352
1531 Ga0307416_100057896 3300032002 Bacteria 3138
1532 Ga0307416_100834107 3300032002 Bacteria 1019
1533 Ga0307416_101458423 3300032002 Unclassified 790
1534 Ga0307416_102673387 3300032002 Unclassified 596
1535 Ga0307416_102931836 3300032002 Bacteria 571
1536 Ga0307414_10014285 3300032004 Bacteria 4755
1537 Ga0307414_11737759 3300032004 Bacteria 582
1538 Ga0307414_12311757 3300032004 Unclassified 502
1539 Ga0307411_10003895 3300032005 Bacteria 7037
1540 Ga0307411_10007445 3300032005 Bacteria 5577
1541 Ga0307411_10041606 3300032005 Unclassified 2925
1542 Ga0307411_10080942 3300032005 Bacteria 2235
1543 Ga0307411_10196221 3300032005 Bacteria 1546
1544 Ga0307411_10518552 3300032005 Unclassified 1011
1545 Ga0307411_10715944 3300032005 Bacteria 873
1546 Ga0307411_11534026 3300032005 Bacteria 613
1547 Ga0307411_12039251 3300032005 Bacteria 536
1548 Ga0307415_100010976 3300032126 Bacteria 5158
1549 Ga0307415_100076840 3300032126 Bacteria 2369
1550 Ga0307415_100204903 3300032126 Bacteria 1568
1551 Ga0307415_100827319 3300032126 Unclassified 848
1552 Ga0307415_102546267 3300032126 Bacteria 504
1553 Ga0373930_0004713 3300034816 Unclassified 2234
1554 Ga0373948_0005040 3300034817 Bacteria 2118
1555 Ga0373950_0000276 3300034818 Bacteria 6482
1556 Ga0373958_0076447 3300034819 Bacteria 751
1557 Ga0373958_0082838 3300034819 Bacteria 729
1558 Ga0373959_0001408 3300034820 Bacteria 3844
1559 Ga0373938_0023830 3300034957 Unclassified 1261
1560 Ga0373928_0001861 3300035084 Bacteria 4118
1561 Ga0373928_0060923 3300035084 Bacteria 913
1562 Ga0373928_0224993 3300035084 Unclassified 550
1563 Ga0373929_0001848 3300035085 Bacteria 3967
1564 Ga0373934_0068660 3300035086 Unclassified 1416
1565 Ga0373940_0010101 3300035088 Unclassified 2211
1566 Ga0373940_0010283 3300035088 Bacteria 2196
1567 Ga0373940_0317709 3300035088 Bacteria 540
1568 Ga0373944_0129337 3300035089 Bacteria 877
1569 Ga0373949_0005325 3300035090 Bacteria 2874
1570 Ga0373951_0000713 3300035091 Bacteria 9122
1571 Ga0373952_0015128 3300035092 Bacteria 1554
1572 Ga0373923_0066682 3300035111 Bacteria 1538
1573 Ga0373923_0354952 3300035111 Bacteria 701
1574 Ga0373923_0624523 3300035111 Unclassified 532
1575 Ga0373932_0000374 3300035112 Bacteria 13771
1576 Ga0373936_0097095 3300035113 Unclassified 1240
1577 Ga0373939_0007192 3300035114 Bacteria 2699
1578 Ga0373941_0000482 3300035115 Bacteria 7964
1579 Ga0373941_0072643 3300035115 Bacteria 1145
1580 Ga0373941_0143507 3300035115 Bacteria 870
1581 Ga0373941_0392162 3300035115 Bacteria 573
1582 Ga0373945_0108029 3300035116 Bacteria 1095
1583 Ga0373945_0334156 3300035116 Bacteria 654
1584 Ga0373953_0125717 3300035117 Unclassified 1091
1585 Ga0373954_0264189 3300035118 Bacteria 848
1586 Ga0373954_0283438 3300035118 Bacteria 817
1587 Ga0373954_0472783 3300035118 Unclassified 621
1588 Ga0373954_0564697 3300035118 Unclassified 564
1589 Ga0373956_0235062 3300035119 Bacteria 871
1590 Ga0373956_0385097 3300035119 Unclassified 669
1591 Ga0373957_0264647 3300035120 Unclassified 725
1592 Ga0373960_0000304 3300035121 Bacteria 9361
1593 Ga0373960_0037020 3300035121 Bacteria 1393
1594 Ga0373943_0008686 3300035170 Bacteria 4555
1595 Ga0373943_0166348 3300035170 Unclassified 1204
1596 Ga0373946_0004998 3300035171 Bacteria 4775
1597 Ga0373955_0051069 3300035172 Bacteria 2251
1598 Ga0373955_0152885 3300035172 Unclassified 1359
1599 Ga0373955_0194798 3300035172 Bacteria 1206
1600 Ga0373955_0339826 3300035172 Unclassified 908
1601 Ga0373955_0582579 3300035172 Unclassified 685
1602 Ga0373942_0002761 3300035207 Bacteria 4191
1603 Ga0373961_0003133 3300035241 Bacteria 4132
1604 Ga0373961_0145965 3300035241 Bacteria 803
1605 Ga0373962_0000484 3300035242 Bacteria 8817
1606 Ga0373962_0154014 3300035242 Bacteria 754
1607 Ga0373962_0167020 3300035242 Bacteria 729
1608 Ga0373962_0190474 3300035242 Unclassified 690
1609 Ga0373924_0104962 3300035410 Unclassified 1218
1610 Ga0373924_0189700 3300035410 Unclassified 905
1611 Ga0373931_0002957 3300035691 Bacteria 7585
1612 Ga0373931_0226314 3300035691 Bacteria 1128
1613 Ga0373931_0506019 3300035691 Bacteria 780
1614 Ga0373931_0718744 3300035691 Unclassified 661
1615 Ga0373935_0090223 3300035692 Bacteria 2005
1616 Ga0373935_0223769 3300035692 Bacteria 1308
1617 Ga0373935_0275347 3300035692 Unclassified 1184
1618 Ga0373935_0677332 3300035692 Bacteria 758
1619 Ga0373935_0691331 3300035692 Bacteria 750
1620 Ga0373927_0178932 3300035695 Bacteria 1391
1621 Ga0373927_0277996 3300035695 Unclassified 1101
1622 Ga0373933_0203563 3300035724 Unclassified 1267
1623 Ga0373933_0414151 3300035724 Unclassified 880
1624 Ga0373933_0418019 3300035724 Unclassified 876
1625 Ga0373933_0580133 3300035724 Bacteria 736
1626 Ga0373947_0008171 3300035725 Bacteria 6033
1627 Ga0373947_0359307 3300035725 Bacteria 978
1628 Ga0373947_1091361 3300035725 Bacteria 544
1629 Ga0373937_0009059 3300036401 Bacteria 8638
1630 Ga0373937_0080467 3300036401 Bacteria 3013
1631 Ga0373937_0186363 3300036401 Bacteria 1949
1632 Ga0373937_0371473 3300036401 Unclassified 1356
1633 Ga0373937_0575744 3300036401 Unclassified 1069
1634 Ga0373937_0853517 3300036401 Bacteria 859
1635 Ga0373937_1105041 3300036401 Bacteria 741
1636 Ga0373937_1809025 3300036401 Unclassified 557
1637 Ga0373925_0015313 3300037068 Bacteria 5546
1638 Ga0373925_0379196 3300037068 Bacteria 1151
1639 Ga0373925_0669279 3300037068 Bacteria 856
1640 Ga0373925_0826530 3300037068 Unclassified 764
1641 Ga0373925_0863433 3300037068 Bacteria 746
1642 Ga0373925_1007934 3300037068 Bacteria 686
1643 Ga0242420_043178 3300038996 Unclassified 866
1644 Ga0436365_0974042 3300039437 Bacteria 7230
1645 Ga0436363_0695528 3300039450 Bacteria 666
1646 Ga0436362_1204701 3300039453 Unclassified 507
1647 Ga0439436_0155822 3300041404 Unclassified 645
1648 Ga0439439_0150124 3300041406 Bacteria 661
1649 Ga0439453_0106445 3300041408 Unclassified 630
1650 Ga0451800_1099042 3300041459 Bacteria 899
1651 Ga0451807_0514159 3300041486 Bacteria 720
1652 Ga0451807_1968602 3300041486 Bacteria 1957
1653 Ga0451845_0428115 3300041501 Bacteria 607
1654 Ga0451853_0326641 3300041512 Bacteria 649
1655 Ga0451853_1148563 3300041512 Bacteria 1251
1656 Ga0439448_0315695 3300042005 Bacteria 556
1657 Ga0439450_091565 3300042008 Unclassified 764
1658 Ga0439462_0086984 3300042015 Bacteria 856
1659 Ga0450923_067636 3300042125 Unclassified 788
1660 Ga0450923_117699 3300042125 Unclassified 625
1661 Ga0439446_0217893 3300042156 Unclassified 649
1662 Ga0439446_0227777 3300042156 Bacteria 637
1663 Ga0450908_108368 3300042184 Unclassified 512
1664 Ga0439434_0128720 3300042435 Bacteria 829
1665 Ga0439435_0024756 3300042436 Unclassified 1586
1666 Ga0439464_0291688 3300042439 Unclassified 532
1667 Ga0451577_0952727 3300042876 Bacteria 772
1668 Ga0451577_1132996 3300042876 Unclassified 699
1669 Ga0439440_0151667 3300042993 Unclassified 664
1670 Ga0453683_0430943 3300044673 Bacteria 852
1671 Ga0453683_0481647 3300044673 Unclassified 804
1672 Ga0466963_0026043 3300044694 Bacteria 3738
1673 Ga0466964_0370735 3300044706 Bacteria 741
1674 Ga0453684_0530056 3300044712 Unclassified 1300
1675 Ga0466968_0431886 3300044735 Bacteria 649
1676 Ga0466957_0492813 3300044842 Bacteria 849
1677 Ga0451576_0036825 3300045051 Bacteria 5184
1678 Ga0451576_0069886 3300045051 Bacteria 3654
1679 Ga0451576_0074874 3300045051 Bacteria 3522
1680 Ga0451576_0282376 3300045051 Unclassified 1736
1681 Ga0451576_0782165 3300045051 Bacteria 1002
1682 Ga0451576_1114216 3300045051 Bacteria 826
1683 Ga0451576_2124176 3300045051 Unclassified 577
1684 Ga0451576_2201159 3300045051 Unclassified 566
1685 Ga0451576_2296737 3300045051 Bacteria 553
1686 Ga0451576_2492645 3300045051 Bacteria 528
1687 Ga0451576_2718879 3300045051 Bacteria 504
1688 Ga0466958_0436147 3300045836 Bacteria 848
1689 Ga0466967_0489595 3300045976 Bacteria 1206
1690 Ga0466967_0583039 3300045976 Unclassified 1103
1691 Ga0466967_0609524 3300045976 Bacteria 1078
1692 Ga0466967_1760039 3300045976 Bacteria 617
1693 Ga0466967_2467962 3300045976 Bacteria 515
1694 Ga0495603_0107715 3300046455 Bacteria 1626
1695 Ga0495591_179204 3300046458 Unclassified 505
1696 Ga0495629_0026452 3300046459 Unclassified 4121
1697 Ga0495629_0211359 3300046459 Unclassified 1340
1698 Ga0495629_0892849 3300046459 Unclassified 583
1699 Ga0495629_0966855 3300046459 Unclassified 556
1700 Ga0495651_0136250 3300046462 Unclassified 1786
1701 Ga0495580_0031838 3300046472 Bacteria 3809
1702 Ga0495580_0037989 3300046472 Bacteria 3452
1703 Ga0495580_0302143 3300046472 Bacteria 1090
1704 Ga0495580_0455137 3300046472 Unclassified 858
1705 Ga0495580_0479049 3300046472 Bacteria 833
1706 Ga0495580_0798990 3300046472 Bacteria 612
1707 Ga0495582_0311273 3300046473 Unclassified 906
1708 Ga0495582_0387856 3300046473 Bacteria 805
1709 Ga0495582_0628807 3300046473 Unclassified 621
1710 Ga0495582_0711689 3300046473 Unclassified 581
1711 Ga0495639_0425853 3300046475 Bacteria 672
1712 Ga0495584_0050641 3300046491 Unclassified 2091
1713 Ga0495584_0263799 3300046491 Bacteria 876
1714 Ga0495594_0016304 3300046499 Bacteria 3914
1715 Ga0495594_0068088 3300046499 Bacteria 1977
1716 Ga0495594_0447550 3300046499 Bacteria 734
1717 Ga0495608_0010373 3300046511 Bacteria 6503
1718 Ga0495618_0100511 3300046514 Bacteria 1851
1719 Ga0495618_0252638 3300046514 Bacteria 1106
1720 Ga0495628_0197372 3300046516 Bacteria 1517
1721 Ga0495628_0831276 3300046516 Bacteria 645
1722 Ga0495630_0021167 3300046517 Bacteria 4802
1723 Ga0495630_0475789 3300046517 Bacteria 958
1724 Ga0495630_0500145 3300046517 Bacteria 932
1725 Ga0495630_0501930 3300046517 Bacteria 930
1726 Ga0495643_0011009 3300046522 Bacteria 5532
1727 Ga0495644_0230447 3300046523 Unclassified 717
1728 Ga0495663_0134568 3300046525 Bacteria 836
1729 Ga0495663_0159732 3300046525 Unclassified 773
1730 Ga0495663_0161489 3300046525 Bacteria 769
1731 Ga0495642_0005763 3300046528 Bacteria 4752
1732 Ga0495642_0344802 3300046528 Bacteria 654
1733 Ga0495652_0036799 3300046529 Bacteria 4252
1734 Ga0495652_0211056 3300046529 Unclassified 1466
1735 Ga0495665_0056144 3300046531 Unclassified 2079
1736 Ga0495640_0106328 3300046533 Unclassified 1838
1737 Ga0495640_0366047 3300046533 Bacteria 888
1738 Ga0495640_0732195 3300046533 Bacteria 592
1739 Ga0495586_0260109 3300046535 Unclassified 991
1740 Ga0495586_0429547 3300046535 Bacteria 761
1741 Ga0495587_0046585 3300046536 Bacteria 2573
1742 Ga0495598_0018119 3300046537 Bacteria 1825
1743 Ga0495598_0050984 3300046537 Unclassified 1246
1744 Ga0495598_0059865 3300046537 Bacteria 1172
1745 Ga0495598_0079003 3300046537 Bacteria 1052
1746 Ga0495598_0171509 3300046537 Bacteria 769
1747 Ga0495598_0199497 3300046537 Bacteria 722
1748 Ga0495598_0215782 3300046537 Bacteria 698
1749 Ga0495598_0444409 3300046537 Bacteria 513
1750 Ga0495609_0108794 3300046538 Bacteria 1197
1751 Ga0495621_0000734 3300046539 Bacteria 8310
1752 Ga0495621_0002328 3300046539 Bacteria 5100
1753 Ga0495621_0004301 3300046539 Bacteria 3992
1754 Ga0495621_0104597 3300046539 Bacteria 1080
1755 Ga0495645_0110321 3300046543 Bacteria 1947
1756 Ga0495633_0018310 3300046558 Bacteria 3559
1757 Ga0495667_0434609 3300046559 Bacteria 825
1758 Ga0495656_0007731 3300046615 Bacteria 3813
1759 Ga0495656_0541895 3300046615 Bacteria 620
1760 Ga0495668_0774921 3300046616 Bacteria 531
1761 Ga0495634_0185935 3300046642 Bacteria 1298
1762 Ga0495634_0822900 3300046642 Bacteria 529
1763 Ga0495659_0005213 3300046664 Bacteria 4086
1764 Ga0495659_0006176 3300046664 Bacteria 3786
1765 Ga0495659_0043745 3300046664 Bacteria 1608
1766 Ga0495659_0099457 3300046664 Bacteria 1125
1767 Ga0495659_0143842 3300046664 Bacteria 954
1768 Ga0495659_0226285 3300046664 Bacteria 774
1769 Ga0495659_0246536 3300046664 Bacteria 743
1770 Ga0495659_0395920 3300046664 Bacteria 595
1771 Ga0495659_0418048 3300046664 Unclassified 580
1772 Ga0495659_0536433 3300046664 Bacteria 515
1773 Ga0495588_0154419 3300046674 Bacteria 1213
1774 Ga0495588_0571087 3300046674 Unclassified 593
1775 Ga0495588_0631335 3300046674 Bacteria 561
1776 Ga0495657_0275115 3300046675 Bacteria 1009
1777 Ga0495623_0609141 3300046679 Bacteria 567
1778 Ga0495646_0459353 3300046680 Unclassified 657
1779 Ga0495647_0046635 3300046681 Bacteria 1670
1780 Ga0495647_0187730 3300046681 Bacteria 902
1781 Ga0495658_0085033 3300046683 Unclassified 1864
1782 Ga0495658_0114637 3300046683 Unclassified 1624
1783 Ga0495658_0466973 3300046683 Bacteria 807
1784 Ga0495658_0526902 3300046683 Bacteria 756
1785 Ga0495658_1108712 3300046683 Bacteria 504
1786 Ga0495669_0025552 3300046684 Bacteria 2576
1787 Ga0495669_0047099 3300046684 Bacteria 1925
1788 Ga0495669_0120449 3300046684 Unclassified 1229
1789 Ga0495669_0142101 3300046684 Unclassified 1133
1790 Ga0495669_0346718 3300046684 Archaea 718
1791 Ga0495669_0410085 3300046684 Unclassified 657
1792 Ga0495613_0000720 3300046689 Bacteria 25918
1793 Ga0495670_0805391 3300046691 Unclassified 513
1794 Ga0495581_0465120 3300047315 Bacteria 736
1795 Ga0495581_0598379 3300047315 Bacteria 639
1796 Ga0495604_0390745 3300047317 Bacteria 917
1797 Ga0495636_0142362 3300047318 Unclassified 1071
1798 Ga0495674_0025567 3300047319 Bacteria 5412
1799 Ga0495674_0473940 3300047319 Bacteria 1004
1800 Ga0495674_0592575 3300047319 Bacteria 879
1801 Ga0495674_0612890 3300047319 Bacteria 861
1802 Ga0495672_0268271 3300047320 Bacteria 821
1803 Ga0495676_0036588 3300047321 Bacteria 4097
1804 Ga0495680_0393814 3300047322 Bacteria 957
1805 Ga0495685_033432 3300047447 Unclassified 1767
1806 Ga0495685_048797 3300047447 Bacteria 1439
1807 Ga0495684_0000613 3300047471 Bacteria 28669
1808 Ga0495684_0272083 3300047471 Unclassified 1225
1809 Ga0495593_0287864 3300047673 Bacteria 822
1810 Ga0495614_0537676 3300048089 Unclassified 558
1811 Ga0495614_0657688 3300048089 Bacteria 506
1812 Ga0496100_0243294 3300048903 Bacteria 1328
1813 Ga0496100_0811999 3300048903 Bacteria 733
1814 Ga0496100_0958564 3300048903 Bacteria 673
1815 Ga0496101_0000451 3300048904 Bacteria 26069
1816 Ga0496101_0821314 3300048904 Bacteria 733
1817 Ga0496101_1041627 3300048904 Bacteria 643
1818 Ga0496102_0944611 3300048905 Bacteria 783
1819 Ga0496103_0362131 3300048906 Bacteria 932
1820 Ga0496104_0309891 3300048907 Bacteria 1491
1821 Ga0496104_0333741 3300048907 Bacteria 1429
1822 Ga0496104_0355658 3300048907 Bacteria 1377
1823 Ga0496104_0423719 3300048907 Unclassified 1243
1824 Ga0496104_0812657 3300048907 Bacteria 841
1825 Ga0496104_1222041 3300048907 Bacteria 655
1826 Ga0496105_0265325 3300048908 Bacteria 1388
1827 Ga0496105_0675634 3300048908 Unclassified 795
1828 Ga0496105_0892135 3300048908 Unclassified 671
1829 Ga0496106_0045609 3300048909 Bacteria 3293
1830 Ga0496106_0222706 3300048909 Bacteria 1505
1831 Ga0496106_0639560 3300048909 Bacteria 850
1832 Ga0496106_0728760 3300048909 Unclassified 789
1833 Ga0496106_1513522 3300048909 Bacteria 516
1834 Ga0496106_1533206 3300048909 Unclassified 512
1835 Ga0496107_0345761 3300048910 Unclassified 1107
1836 Ga0496107_0609011 3300048910 Bacteria 807
1837 Ga0496107_1025492 3300048910 Bacteria 598
1838 Ga0496107_1272644 3300048910 Bacteria 527
1839 Ga0496108_0890607 3300048911 Bacteria 764
1840 Ga0496108_0992209 3300048911 Bacteria 718
1841 Ga0496108_1130085 3300048911 Unclassified 665
1842 Ga0496108_1268264 3300048911 Bacteria 621
1843 Ga0496109_0446343 3300048912 Unclassified 1222
1844 Ga0496109_0565345 3300048912 Unclassified 1072
1845 Ga0496109_0614112 3300048912 Bacteria 1024
1846 Ga0496110_0022673 3300048913 Bacteria 5335
1847 Ga0496110_0688733 3300048913 Bacteria 923
1848 Ga0496110_0906301 3300048913 Unclassified 788
1849 Ga0496111_0799130 3300048914 Bacteria 683
1850 Ga0496111_1072711 3300048914 Bacteria 575
1851 Ga0496112_0538464 3300048915 Bacteria 1102
1852 Ga0496112_1834331 3300048915 Bacteria 518
1853 Ga0496112_1864225 3300048915 Unclassified 513
1854 Ga0496113_0109187 3300048916 Bacteria 2151
1855 Ga0496113_0180028 3300048916 Bacteria 1676
1856 Ga0496113_0309279 3300048916 Unclassified 1266
1857 Ga0496113_0363076 3300048916 Bacteria 1162
1858 Ga0496114_0001764 3300048917 Bacteria 16428
1859 Ga0496114_0202676 3300048917 Bacteria 1738
1860 Ga0496114_0571906 3300048917 Unclassified 998
1861 Ga0496114_0590266 3300048917 Bacteria 980
1862 Ga0496115_0044293 3300048918 Bacteria 3549
1863 Ga0496115_0619922 3300048918 Bacteria 858
1864 Ga0496115_0936752 3300048918 Bacteria 666
1865 Ga0501292_058286 3300049515 Unclassified 696
1866 Ga0501292_140448 3300049515 Bacteria 505
1867 Ga0501294_058889 3300049517 Unclassified 504
1868 Ga0501295_131299 3300049518 Bacteria 608
1869 Ga0501298_079386 3300049521 Unclassified 720
1870 Ga0501298_088894 3300049521 Bacteria 690
1871 Ga0501298_148641 3300049521 Unclassified 571
1872 Ga0501299_092513 3300049522 Bacteria 689
1873 Ga0501299_193258 3300049522 Bacteria 537
1874 Ga0501299_231899 3300049522 Unclassified 502
1875 Ga0501320_051899 3300049536 Bacteria 560
1876 Ga0501031_0595084 3300049568 Bacteria 712
1877 Ga0501032_0948403 3300049569 Bacteria 541
1878 Ga0501033_0054566 3300049570 Bacteria 2956
1879 Ga0501033_0571682 3300049570 Bacteria 777
1880 Ga0501036_0481481 3300049572 Bacteria 1033
1881 Ga0501036_1246464 3300049572 Bacteria 605
1882 Ga0501039_0043088 3300049575 Bacteria 3487
1883 Ga0501039_0096051 3300049575 Bacteria 2311
1884 Ga0501039_0629160 3300049575 Bacteria 841
1885 Ga0501039_1144699 3300049575 Bacteria 602
1886 Ga0501040_0191871 3300049576 Bacteria 1450
1887 Ga0501040_0257776 3300049576 Bacteria 1244
1888 Ga0501040_0533565 3300049576 Bacteria 847
1889 Ga0501040_1183758 3300049576 Bacteria 555
1890 Ga0501040_1304737 3300049576 Bacteria 527
1891 Ga0501041_0021002 3300049577 Bacteria 3910
1892 Ga0501041_0027286 3300049577 Bacteria 3441
1893 Ga0501041_0360458 3300049577 Bacteria 919
1894 Ga0501041_0836681 3300049577 Bacteria 591
1895 Ga0501041_1078564 3300049577 Bacteria 517
1896 Ga0501042_0020313 3300049578 Bacteria 4622
1897 Ga0501042_0068209 3300049578 Bacteria 2543
1898 Ga0501042_0104599 3300049578 Bacteria 2037
1899 Ga0501042_0504033 3300049578 Bacteria 879
1900 Ga0501043_0380124 3300049579 Bacteria 1069
1901 Ga0501043_0558438 3300049579 Unclassified 850
1902 Ga0501046_0224520 3300049580 Bacteria 1390
1903 Ga0501046_0268583 3300049580 Bacteria 1251
1904 Ga0501046_0659307 3300049580 Bacteria 739
1905 Ga0501046_1028641 3300049580 Bacteria 571
1906 Ga0501048_0097317 3300049582 Bacteria 2076
1907 Ga0501048_0115376 3300049582 Bacteria 1897
1908 Ga0501048_0936448 3300049582 Unclassified 623
1909 Ga0501067_0084722 3300049583 Bacteria 1758
1910 Ga0501067_0415926 3300049583 Bacteria 750
1911 Ga0501068_0025829 3300049584 Bacteria 3457
1912 Ga0501068_0074051 3300049584 Bacteria 2081
1913 Ga0501068_0210604 3300049584 Bacteria 1234
1914 Ga0501069_0759198 3300049585 Bacteria 587
1915 Ga0501069_0796871 3300049585 Bacteria 572
1916 Ga0501071_0038926 3300049587 Bacteria 3400
1917 Ga0501071_0073892 3300049587 Bacteria 2488
1918 Ga0501071_0339443 3300049587 Bacteria 1142
1919 Ga0501071_1083652 3300049587 Bacteria 619
1920 Ga0501072_0059133 3300049588 Bacteria 3022
1921 Ga0501072_0082245 3300049588 Bacteria 2553
1922 Ga0501072_0377582 3300049588 Bacteria 1125
1923 Ga0501073_0752714 3300049589 Bacteria 672
1924 Ga0501073_1274585 3300049589 Unclassified 504
1925 Ga0501074_0216331 3300049590 Bacteria 1365
1926 Ga0501075_0011468 3300049591 Bacteria 6273
1927 Ga0501075_0014710 3300049591 Bacteria 5608
1928 Ga0501075_0027285 3300049591 Bacteria 4208
1929 Ga0501076_0000430 3300049592 Bacteria 26447
1930 Ga0501076_0029547 3300049592 Bacteria 4263
1931 Ga0501076_0071935 3300049592 Bacteria 2767
1932 Ga0501077_0007773 3300049593 Bacteria 6616
1933 Ga0501209_112598 3300049656 Unclassified 804
1934 Ga0501216_121502 3300049660 Bacteria 597
1935 Ga0501233_188554 3300049668 Unclassified 594
1936 Ga0501235_104846 3300049669 Unclassified 694
1937 Ga0501235_214227 3300049669 Bacteria 526
1938 Ga0501243_092603 3300049675 Unclassified 601
1939 Ga0501247_022900 3300049677 Bacteria 820
1940 Ga0501249_057078 3300049679 Bacteria 901
1941 Ga0501249_100971 3300049679 Bacteria 691
1942 Ga0501253_217053 3300049683 Bacteria 511
1943 Ga0501256_042155 3300049685 Unclassified 544
1944 Ga0501257_160822 3300049686 Unclassified 625
1945 Ga0501245_066289 3300049708 Bacteria 671
1946 Ga0501245_094182 3300049708 Unclassified 598
1947 Ga0501079_0023834 3300049741 Bacteria 4696
1948 Ga0501079_0032267 3300049741 Bacteria 4026
1949 Ga0501079_0130665 3300049741 Bacteria 1954
1950 Ga0501080_0225287 3300049742 Bacteria 1715
1951 Ga0501080_0238544 3300049742 Bacteria 1660
1952 Ga0501080_0597003 3300049742 Bacteria 980
1953 Ga0501081_0000588 3300049743 Bacteria 20670
1954 Ga0501081_0002533 3300049743 Bacteria 11520
1955 Ga0501081_0034421 3300049743 Bacteria 3447
1956 Ga0501081_0045103 3300049743 Bacteria 3027
1957 Ga0501081_0293922 3300049743 Bacteria 1191
1958 Ga0501081_1522869 3300049743 Unclassified 508
1959 Ga0501083_0013562 3300049744 Bacteria 5699
1960 Ga0501268_044925 3300049765 Bacteria 841
1961 Ga0501270_092061 3300049767 Bacteria 620
1962 Ga0501272_042658 3300049769 Unclassified 610
1963 Ga0501273_041202 3300049770 Unclassified 684
1964 Ga0501283_012511 3300049779 Unclassified 1276
1965 Ga0501283_056205 3300049779 Unclassified 705
1966 Ga0501045_0034751 3300049824 Bacteria 3660
1967 Ga0501045_0404199 3300049824 Bacteria 1016
1968 Ga0501045_0521338 3300049824 Bacteria 882
1969 Ga0501045_0597340 3300049824 Bacteria 817
1970 nmdc:mga05p37_11992_c1 3300050507 Bacteria 10342
1971 nmdc:mga05p37_126818_c1 3300050507 Bacteria 3134
1972 nmdc:mga05p37_138659_c1 3300050507 Bacteria 2981
1973 nmdc:mga05p37_142923_c1 3300050507 Bacteria 2931
1974 nmdc:mga05p37_1513676_c1 3300050507 Unclassified 667
1975 nmdc:mga05p37_1594_c1 3300050507 Bacteria 26335
1976 nmdc:mga05p37_16719_c1 3300050507 Bacteria 8842
1977 nmdc:mga05p37_180101_c1 3300050507 Bacteria 2572
1978 nmdc:mga05p37_20284_c1 3300050507 Bacteria 8043
1979 nmdc:mga05p37_23331_c1 3300050507 Bacteria 7507
1980 nmdc:mga05p37_234115_c1 3300050507 Bacteria 2212
1981 nmdc:mga05p37_251554_c1 3300050507 Bacteria 2119
1982 nmdc:mga05p37_311105_c1 3300050507 Bacteria 1867
1983 nmdc:mga05p37_311393_c1 3300050507 Bacteria 1866
1984 nmdc:mga05p37_312432_c1 3300050507 Bacteria 1862
1985 nmdc:mga05p37_41791_c1 3300050507 Bacteria 5630
1986 nmdc:mga05p37_49764_c1 3300050507 Bacteria 5155
1987 nmdc:mga05p37_798158_c1 3300050507 Bacteria 1033
1988 nmdc:mga05p37_915060_c1 3300050507 Bacteria 944
1989 nmdc:mga05p37_95613_c1 3300050507 Bacteria 3660
1990 nmdc:mga09592_116992_c1 3300050508 Bacteria 2288
1991 nmdc:mga09592_1600861_c1 3300050508 Bacteria 527
1992 nmdc:mga09592_164082_c1 3300050508 Bacteria 1920
1993 nmdc:mga09592_1654440_c1 3300050508 Unclassified 517
1994 nmdc:mga09592_344209_c1 3300050508 Unclassified 1291
1995 nmdc:mga09592_408004_c1 3300050508 Bacteria 1174
1996 nmdc:mga09592_50392_c1 3300050508 Bacteria 3512
1997 nmdc:mga09592_725034_c1 3300050508 Unclassified 845
1998 nmdc:mga09592_823574_c1 3300050508 Unclassified 784
1999 nmdc:mga09592_94175_c1 3300050508 Unclassified 2561
2000 nmdc:mga09592_952643_c1 3300050508 Bacteria 719
2001 nmdc:mga0qj67_205251_c1 3300050509 Bacteria 1601
2002 nmdc:mga0qj67_363910_c1 3300050509 Bacteria 1169
2003 nmdc:mga0qj67_45395_c1 3300050509 Bacteria 3467
2004 nmdc:mga0qj67_789939_c1 3300050509 Bacteria 752
2005 nmdc:mga0qj67_850976_c1 3300050509 Unclassified 720
2006 nmdc:mga06r32_102411_c1 3300050510 Bacteria 2811
2007 nmdc:mga06r32_1337435_c1 3300050510 Bacteria 660
2008 nmdc:mga06r32_143953_c1 3300050510 Unclassified 2361
2009 nmdc:mga06r32_20491_c1 3300050510 Bacteria 6089
2010 nmdc:mga06r32_53901_c1 3300050510 Bacteria 3855
2011 nmdc:mga06r32_558345_c1 3300050510 Unclassified 1118
2012 nmdc:mga06r32_718852_c1 3300050510 Unclassified 963
2013 nmdc:mga08y16_1005311_c1 3300050511 Unclassified 814
2014 nmdc:mga08y16_1020998_c1 3300050511 Bacteria 806
2015 nmdc:mga08y16_1480043_c1 3300050511 Unclassified 640
2016 nmdc:mga08y16_1740986_c1 3300050511 Unclassified 578
2017 nmdc:mga08y16_28149_c1 3300050511 Bacteria 5924
2018 nmdc:mga08y16_349_c1 3300050511 Bacteria 41563
2019 nmdc:mga08y16_365948_c1 3300050511 Bacteria 1480
2020 nmdc:mga08y16_38371_c1 3300050511 Bacteria 5030
2021 nmdc:mga08y16_427316_c1 3300050511 Unclassified 1353
2022 nmdc:mga08y16_4417_c1 3300050511 Bacteria 14700
2023 nmdc:mga08y16_55349_c1 3300050511 Bacteria 4146
2024 nmdc:mga08y16_6726_c1 3300050511 Bacteria 12051
2025 nmdc:mga08y16_718120_c1 3300050511 Bacteria 998
2026 nmdc:mga08y16_816436_c1 3300050511 Bacteria 924
2027 nmdc:mga08y16_967731_c1 3300050511 Bacteria 833
2028 nmdc:mga0n895_1217475_c1 3300050512 Bacteria 726
2029 nmdc:mga0n895_13192_c1 3300050512 Bacteria 7444
2030 nmdc:mga0n895_1368851_c1 3300050512 Bacteria 677
2031 nmdc:mga0n895_13752_c1 3300050512 Bacteria 7319
2032 nmdc:mga0n895_1429060_c1 3300050512 Unclassified 660
2033 nmdc:mga0n895_146142_c1 3300050512 Unclassified 2394
2034 nmdc:mga0n895_148627_c1 3300050512 Bacteria 2372
2035 nmdc:mga0n895_17933_c1 3300050512 Bacteria 6541
2036 nmdc:mga0n895_182794_c1 3300050512 Unclassified 2128
2037 nmdc:mga0n895_193415_c1 3300050512 Bacteria 2065
2038 nmdc:mga0n895_203557_c1 3300050512 Bacteria 2010
2039 nmdc:mga0n895_2068153_c1 3300050512 Bacteria 526
2040 nmdc:mga0n895_2142851_c1 3300050512 Unclassified 515
2041 nmdc:mga0n895_49792_c1 3300050512 Bacteria 4106
2042 nmdc:mga0n895_502727_c1 3300050512 Bacteria 1221
2043 nmdc:mga0n895_61181_c1 3300050512 Bacteria 3716
2044 nmdc:mga0n895_611894_c1 3300050512 Unclassified 1091
2045 nmdc:mga0n895_77585_c1 3300050512 Bacteria 3305
2046 nmdc:mga0n895_7906_c1 3300050512 Bacteria 9168
2047 nmdc:mga0n895_854671_c1 3300050512 Bacteria 897
2048 nmdc:mga0n895_892857_c1 3300050512 Unclassified 875
2049 nmdc:mga0n895_952906_c1 3300050512 Bacteria 841
2050 nmdc:mga0n895_98062_c1 3300050512 Bacteria 2938
2051 nmdc:mga0rr50_116480_c1 3300050513 Bacteria 2121
2052 nmdc:mga0rr50_136179_c1 3300050513 Bacteria 1971
2053 nmdc:mga0rr50_139327_c1 3300050513 Bacteria 1950
2054 nmdc:mga0rr50_1702203_c1 3300050513 Bacteria 531
2055 nmdc:mga0rr50_1712792_c1 3300050513 Unclassified 530
2056 nmdc:mga0rr50_177697_c1 3300050513 Bacteria 1739
2057 nmdc:mga0rr50_179124_c1 3300050513 Bacteria 1732
2058 nmdc:mga0rr50_342715_c1 3300050513 Bacteria 1256
2059 nmdc:mga0rr50_414_c1 3300050513 Bacteria 23130
2060 nmdc:mga0rr50_841396_c1 3300050513 Bacteria 783
2061 nmdc:mga0rr50_860872_c1 3300050513 Unclassified 773
2062 nmdc:mga0rr50_883594_c1 3300050513 Bacteria 762
2063 nmdc:mga0rr50_9355_c1 3300050513 Bacteria 6155
2064 nmdc:mga08x19_11381_c1 3300050514 Bacteria 5355
2065 nmdc:mga08x19_120066_c1 3300050514 Bacteria 1762
2066 nmdc:mga08x19_204388_c1 3300050514 Bacteria 1355
2067 nmdc:mga08x19_228795_c1 3300050514 Bacteria 917
2068 nmdc:mga08x19_51300_c1 3300050514 Bacteria 2650
2069 nmdc:mga08x19_639300_c1 3300050514 Bacteria 754
2070 nmdc:mga08x19_762954_c1 3300050514 Bacteria 687
2071 nmdc:mga0a205_120182_c1 3300050515 Bacteria 2527
2072 nmdc:mga0a205_1352021_c1 3300050515 Bacteria 560
2073 nmdc:mga0a205_158500_c1 3300050515 Bacteria 2161
2074 nmdc:mga0a205_176082_c1 3300050515 Bacteria 2035
2075 nmdc:mga0a205_265938_c1 3300050515 Unclassified 1592
2076 nmdc:mga0a205_29340_c1 3300050515 Bacteria 5264
2077 nmdc:mga0a205_33180_c1 3300050515 Bacteria 4950
2078 nmdc:mga0a205_506590_c1 3300050515 Bacteria 1064
2079 nmdc:mga0a205_532212_c1 3300050515 Unclassified 1031
2080 nmdc:mga0a205_58127_c1 3300050515 Bacteria 3735
2081 nmdc:mga0a205_6492_c1 3300050515 Bacteria 10574
2082 nmdc:mga0a205_652025_c1 3300050515 Bacteria 904
2083 nmdc:mga0a205_84748_c1 3300050515 Bacteria 3061
2084 Ga0495601_0048683 3300053077 Bacteria 2670
2085 Ga0495601_0361678 3300053077 Bacteria 943
2086 Ga0495601_0636841 3300053077 Bacteria 683
2087 Ga0495601_0788862 3300053077 Bacteria 603
2088 Ga0495612_0204082 3300053078 Unclassified 873
2089 Ga0495612_0402516 3300053078 Unclassified 622
2090 Ga0495655_0054240 3300053083 Bacteria 1072
2091 Ga0495655_0096664 3300053083 Bacteria 869
2092 Ga0495595_0150988 3300053084 Bacteria 1143
2093 Ga0495595_0251778 3300053084 Bacteria 884
2094 Ga0495595_0458141 3300053084 Bacteria 648
2095 Ga0495595_0682950 3300053084 Bacteria 526
2096 Ga0495619_0001542 3300053085 Bacteria 15176
2097 Ga0495619_0195727 3300053085 Unclassified 1399
2098 Ga0495619_0271918 3300053085 Bacteria 1174
2099 Ga0495619_0333392 3300053085 Unclassified 1050
2100 Ga0495619_0466073 3300053085 Bacteria 870
2101 Ga0495619_0757885 3300053085 Bacteria 658
2102 Ga0501084_0019884 3300054114 Bacteria 5597
2103 Ga0501084_0078604 3300054114 Bacteria 2765
2104 Ga0501084_0108923 3300054114 Bacteria 2327
2105 Ga0501084_0388198 3300054114 Bacteria 1180
2106 Ga0501084_0730286 3300054114 Unclassified 835
2107 Ga0590071_000382 3300059421 Bacteria 13013
2108 Ga0590071_000521 3300059421 Bacteria 11232
2109 Ga0590074_029475 3300059423 Unclassified 966
2110 Ga0590075_002497 3300059424 Bacteria 4397
2111 Ga0590075_026192 3300059424 Bacteria 1468
2112 Ga0590077_000003 3300059426 Bacteria 50145
2113 Ga0590077_000431 3300059426 Bacteria 11762
2114 Ga0590077_042093 3300059426 Bacteria 1016
2115 Ga0501082_0148948 3300060353 Bacteria 2032
2116 Ga0501082_0197894 3300060353 Bacteria 1748
2117 Ga0501082_1413822 3300060353 Bacteria 607
2118 Ga0466962_0534873 3300061719 Unclassified 595
2119 Ga0530510_0001508 3300061734 Bacteria 15655
2120 Ga0530510_0002012 3300061734 Bacteria 13952
2121 Ga0530510_0089323 3300061734 Bacteria 2247
2122 Ga0530510_0437834 3300061734 Bacteria 988
2123 Ga0530510_1593966 3300061734 Bacteria 501
2124 Ga0451576_0016435
2125 SwRhRL2b_contig_2148127
2126 JGI24744J21845_10081025
2127 JGI25406J46586_10002033
2128 JGI25406J46586_10004955
2129 Ga0058859_11225154
2130 Ga0058859_11833474
2131 Ga0058860_11509978
2132 Ga0058860_12001900
2133 Ga0058860_12034974
2134 Ga0058860_12173101
2135 Ga0058862_12398501
2136 Ga0065714_10095225
2137 Ga0065714_10333917
2138 Ga0065704_10135640
2139 Ga0065704_10730815
2140 Ga0065712_10002663
2141 Ga0065712_10017476
2142 Ga0065712_10162898
2143 Ga0065712_10184946
2144 Ga0065712_10315517
2145 Ga0065712_10566396
2146 Ga0065715_10023281
2147 Ga0065715_10069454
2148 Ga0065715_10095276
2149 Ga0065715_10106779
2150 Ga0065715_10114455
2151 Ga0065715_10132989
2152 Ga0065715_10194207
2153 Ga0065715_10308400
2154 Ga0065715_10328266
2155 Ga0065715_10527144
2156 Ga0065715_10666723
2157 Ga0065715_10800108
2158 Ga0065715_10871502
2159 Ga0065707_10002879
2160 Ga0065707_10023547
2161 Ga0065707_10026073
2162 Ga0065707_10100675
2163 Ga0065707_10132350
2164 Ga0065707_10194363
2165 Ga0065707_10226146
2166 Ga0065707_10227450
2167 Ga0065707_10511618
2168 Ga0065707_11156542
2169 Ga0070658_10127997
2170 Ga0070676_10024441
2171 Ga0070676_10074653
2172 Ga0070676_10122409
2173 Ga0070676_10245857
2174 Ga0070676_10390668
2175 Ga0070676_10560524
2176 Ga0070676_10756453
2177 Ga0070683_100005622
2178 Ga0070683_100327732
2179 Ga0070683_100700519
2180 Ga0070683_101587079
2181 Ga0070683_102359480
2182 Ga0070690_100010440
2183 Ga0070690_100013784
2184 Ga0070690_100067794
2185 Ga0070690_100238345
2186 Ga0070690_100470749
2187 Ga0070690_100521804
2188 Ga0070690_100537069
2189 Ga0070690_100737070
2190 Ga0070690_101648002
2191 Ga0070670_100007350
2192 Ga0070670_100019871
2193 Ga0070670_100046970
2194 Ga0070670_100047679
2195 Ga0070670_100233445
2196 Ga0070670_100261849
2197 Ga0070670_100303374
2198 Ga0070670_100392641
2199 Ga0070670_101027695
2200 Ga0070670_102243699
2201 Ga0070677_10048799
2202 Ga0070677_10099213
2203 Ga0070677_10297371
2204 Ga0070677_10460740
2205 Ga0070677_10505284
2206 Ga0068869_100009775
2207 Ga0068869_100108607
2208 Ga0068869_100374281
2209 Ga0068869_100398332
2210 Ga0068869_100615339
2211 Ga0068869_100650616
2212 Ga0068869_100661596
2213 Ga0068869_100703930
2214 Ga0068869_101095695
2215 Ga0068869_101313923
2216 Ga0068869_101659123
2217 Ga0068869_101664703
2218 Ga0070666_10039561
2219 Ga0070666_10120025
2220 Ga0070666_10307932
2221 Ga0070666_10310976
2222 Ga0070666_10370755
2223 Ga0070666_11107206
2224 Ga0070666_11205262
2225 Ga0070666_11484800
2226 Ga0070680_100412459
2227 Ga0070680_100497460
2228 Ga0070680_100844237
2229 Ga0070680_100934098
2230 Ga0070680_101275735
2231 Ga0070680_101480742
2232 Ga0070680_101506034
2233 Ga0070682_100453073
2234 Ga0070682_101171712
2235 Ga0068868_100076339
2236 Ga0068868_100211519
2237 Ga0068868_100462053
2238 Ga0068868_100488255
2239 Ga0068868_100884178
2240 Ga0068868_101838642
2241 Ga0070660_100161973
2242 Ga0070660_100933514
2243 Ga0070660_101089696
2244 Ga0070660_101108555
2245 Ga0070660_101369563
2246 Ga0070689_100005041
2247 Ga0070689_100011742
2248 Ga0070689_100051462
2249 Ga0070689_100060714
2250 Ga0070689_100137374
2251 Ga0070689_100292431
2252 Ga0070689_100306504
2253 Ga0070689_100395869
2254 Ga0070689_100582969
2255 Ga0070689_100735187
2256 Ga0070689_101219738
2257 Ga0070689_101329399
2258 Ga0070691_10188218
2259 Ga0070687_100002090
2260 Ga0070687_100950177
2261 Ga0070687_100977576
2262 Ga0070687_101269788
2263 Ga0070661_100217276
2264 Ga0070661_100241856
2265 Ga0070661_100266999
2266 Ga0070661_100891090
2267 Ga0070661_101493268
2268 Ga0070692_10189569
2269 Ga0070692_10200794
2270 Ga0070692_10277022
2271 Ga0070692_11212981
2272 Ga0070668_100067062
2273 Ga0070668_100196670
2274 Ga0070668_100224774
2275 Ga0070668_100676367
2276 Ga0070668_100982748
2277 Ga0070669_100005475
2278 Ga0070669_100015084
2279 Ga0070669_100037760
2280 Ga0070669_100061952
2281 Ga0070669_100072047
2282 Ga0070669_100106080
2283 Ga0070669_100126660
2284 Ga0070669_100230765
2285 Ga0070669_100660566
2286 Ga0070669_101064389
2287 Ga0070669_101292227
2288 Ga0070669_101570221
2289 Ga0070675_100000785
2290 Ga0070675_100006317
2291 Ga0070675_100015402
2292 Ga0070675_100021027
2293 Ga0070675_100023859
2294 Ga0070675_100031702
2295 Ga0070675_100035816
2296 Ga0070675_100054006
2297 Ga0070675_100121191
2298 Ga0070675_100171061
2299 Ga0070675_100183149
2300 Ga0070675_100303961
2301 Ga0070675_100369004
2302 Ga0070675_100525810
2303 Ga0070675_100660338
2304 Ga0070675_102200369
2305 Ga0070671_100008522
2306 Ga0070671_100520940
2307 Ga0070671_100580359
2308 Ga0070671_100917087
2309 Ga0070671_101167641
2310 Ga0070671_101682484
2311 Ga0070674_100005809
2312 Ga0070674_100105712
2313 Ga0070674_100213240
2314 Ga0070674_100567705
2315 Ga0070674_100892454
2316 Ga0070674_100982888
2317 Ga0070674_101008626
2318 Ga0070674_101164679
2319 Ga0070674_101226774
2320 Ga0070674_101241425
2321 Ga0070673_100006588
2322 Ga0070673_100008523
2323 Ga0070673_100047974
2324 Ga0070673_100188801
2325 Ga0070673_100198379
2326 Ga0070673_100276701
2327 Ga0070673_100283888
2328 Ga0070673_100297696
2329 Ga0070673_100312330
2330 Ga0070673_100460942
2331 Ga0070673_100522757
2332 Ga0070673_100564622
2333 Ga0070673_101282237
2334 Ga0070688_100008455
2335 Ga0070688_100049444
2336 Ga0070688_100070345
2337 Ga0070688_100124710
2338 Ga0070688_100178884
2339 Ga0070688_100186682
2340 Ga0070688_100279442
2341 Ga0070688_100449028
2342 Ga0070688_100609102
2343 Ga0070688_101726580
2344 Ga0070659_100125835
2345 Ga0070659_100171502
2346 Ga0070659_100240569
2347 Ga0070659_100337585
2348 Ga0070659_100344197
2349 Ga0070659_101111214
2350 Ga0070667_100028378
2351 Ga0070667_100094543
2352 Ga0070667_100240308
2353 Ga0070667_100405796
2354 Ga0070667_100416480
2355 Ga0070667_101767131
2356 Ga0070703_10233017
2357 Ga0070703_10572211
2358 Ga0070709_10014162
2359 Ga0070709_10518276
2360 Ga0070709_10621115
2361 Ga0070714_101191261
2362 Ga0070713_100343648
2363 Ga0070713_100386806
2364 Ga0070710_10374637
2365 Ga0070701_10007649
2366 Ga0070701_10015376
2367 Ga0070701_10623043
2368 Ga0070701_10879432
2369 Ga0070701_11181992
2370 Ga0070701_11197008
2371 Ga0070711_100414982
2372 Ga0070711_100500955
2373 Ga0070711_100851390
2374 Ga0070705_100001204
2375 Ga0070705_100019732
2376 Ga0070705_100160764
2377 Ga0070705_100174191
2378 Ga0070705_100234459
2379 Ga0070705_100544153
2380 Ga0070705_101063937
2381 Ga0070700_100093816
2382 Ga0070700_100232156
2383 Ga0070700_100247876
2384 Ga0070700_100251928
2385 Ga0070700_100457418
2386 Ga0070700_100496670
2387 Ga0070700_101092355
2388 Ga0070694_100000199
2389 Ga0070694_100039897
2390 Ga0070694_100047092
2391 Ga0070694_100135188
2392 Ga0070694_100203569
2393 Ga0070694_100249946
2394 Ga0070694_100261021
2395 Ga0070694_100291505
2396 Ga0070694_100487636
2397 Ga0070694_100507138
2398 Ga0070694_100588536
2399 Ga0070694_101138592
2400 Ga0070694_101411918
2401 Ga0070694_101778476
2402 Ga0070708_100015924
2403 Ga0070708_100073351
2404 Ga0070708_100650688
2405 Ga0070708_101067006
2406 Ga0070708_101363565
2407 Ga0070708_101676736
2408 Ga0070663_100018690
2409 Ga0070663_100348019
2410 Ga0070663_100724833
2411 Ga0070663_101890450
2412 Ga0070678_100007601
2413 Ga0070678_100028082
2414 Ga0070678_100073186
2415 Ga0070678_100167410
2416 Ga0070678_100246278
2417 Ga0070678_100411585
2418 Ga0070678_101356710
2419 Ga0070678_101477490
2420 Ga0070662_100051755
2421 Ga0070662_100169063
2422 Ga0070662_100190740
2423 Ga0070681_10014967
2424 Ga0070681_10032641
2425 Ga0070681_10086022
2426 Ga0070681_10357396
2427 Ga0068867_100001191
2428 Ga0068867_100002272
2429 Ga0068867_100013275
2430 Ga0068867_100158218
2431 Ga0068867_100478326
2432 Ga0068867_100714667
2433 Ga0068867_100773825
2434 Ga0068867_100878481
2435 Ga0068867_100928827
2436 Ga0070685_10018710
2437 Ga0070685_10262479
2438 Ga0070685_10410375
2439 Ga0070685_10575439
2440 Ga0070685_11313699
2441 Ga0070685_11393870
2442 Ga0070685_11608758
2443 Ga0070706_100124050
2444 Ga0070706_100221094
2445 Ga0070706_100769239
2446 Ga0070706_101336329
2447 Ga0070706_101437599
2448 Ga0070706_101823435
2449 Ga0070706_101903111
2450 Ga0070706_101928880
2451 Ga0070707_100062625
2452 Ga0070707_100084624
2453 Ga0070707_100092228
2454 Ga0070707_100290025
2455 Ga0070707_100412000
2456 Ga0070707_100667742
2457 Ga0070707_101340903
2458 Ga0070698_100002764
2459 Ga0070698_100004315
2460 Ga0070698_100024808
2461 Ga0070698_100086145
2462 Ga0070698_100283194
2463 Ga0070698_100572861
2464 Ga0070698_100677907
2465 Ga0070698_100693759
2466 Ga0070698_101075174
2467 Ga0070698_101164071
2468 Ga0070698_101860901
2469 Ga0070699_100000172
2470 Ga0070699_100008183
2471 Ga0070699_100045608
2472 Ga0070699_100065455
2473 Ga0070699_100161479
2474 Ga0070699_100186084
2475 Ga0070699_100212512
2476 Ga0070699_100837213
2477 Ga0070699_101003010
2478 Ga0070699_101750862
2479 Ga0070699_101847079
2480 Ga0070679_100305411
2481 Ga0070679_100332442
2482 Ga0070679_100611524
2483 Ga0070679_100694605
2484 Ga0070684_100042447
2485 Ga0070684_100196125
2486 Ga0070684_100654684
2487 Ga0070684_100840404
2488 Ga0070684_101515821
2489 Ga0070684_101872147
2490 Ga0070684_102328242
2491 Ga0070697_100099767
2492 Ga0070697_100130792
2493 Ga0070697_100263238
2494 Ga0070697_100807893
2495 Ga0070697_100830402
2496 Ga0070697_101035517
2497 Ga0070697_101288278
2498 Ga0070697_101636146
2499 Ga0070697_101703915
2500 Ga0068853_101468135
2501 Ga0068853_101601435
2502 Ga0070672_100031975
2503 Ga0070672_100058398
2504 Ga0070672_100060185
2505 Ga0070672_100074122
2506 Ga0070672_100091256
2507 Ga0070672_100099686
2508 Ga0070672_100160706
2509 Ga0070672_100326655
2510 Ga0070672_100502436
2511 Ga0070672_100624721
2512 Ga0070672_100891067
2513 Ga0070672_101056918
2514 Ga0070672_101078543
2515 Ga0070672_101113648
2516 Ga0070672_101267608
2517 Ga0070672_101504822
2518 Ga0070686_100007548
2519 Ga0070686_100012930
2520 Ga0070686_100058396
2521 Ga0070686_100151436
2522 Ga0070686_100199369
2523 Ga0070686_100350660
2524 Ga0070686_100490959
2525 Ga0070695_100000002
2526 Ga0070695_100001675
2527 Ga0070695_100015542
2528 Ga0070695_100043868
2529 Ga0070695_100073857
2530 Ga0070695_100258091
2531 Ga0070695_100423483
2532 Ga0070695_100457569
2533 Ga0070695_100671628
2534 Ga0070695_100753567
2535 Ga0070695_101209342
2536 Ga0070696_100018496
2537 Ga0070696_100025383
2538 Ga0070696_100098274
2539 Ga0070696_100102001
2540 Ga0070696_100188051
2541 Ga0070696_100511151
2542 Ga0070696_100580023
2543 Ga0070696_100850970
2544 Ga0070696_100898535
2545 Ga0070696_101101178
2546 Ga0070693_100146440
2547 Ga0070693_100169120
2548 Ga0070693_100212516
2549 Ga0070693_100848024
2550 Ga0070693_100995942
2551 Ga0070693_101527429
2552 Ga0070665_100002623
2553 Ga0070665_100028738
2554 Ga0070665_100091624
2555 Ga0070665_100601071
2556 Ga0070665_102195848
2557 Ga0070665_102255672
2558 Ga0070704_100000468
2559 Ga0070704_100002643
2560 Ga0070704_100007220
2561 Ga0070704_100022196
2562 Ga0070704_100073177
2563 Ga0070704_100192897
2564 Ga0070704_100296312
2565 Ga0070704_100665164
2566 Ga0070704_101158624
2567 Ga0070704_101266903
2568 Ga0070704_101330574
2569 Ga0070704_102070239
2570 Ga0070704_102234396
2571 Ga0070704_102280395
2572 Ga0068855_101152549
2573 Ga0068855_102093755
2574 Ga0070664_100002860
2575 Ga0070664_100045421
2576 Ga0070664_100069720
2577 Ga0070664_100105276
2578 Ga0070664_100126456
2579 Ga0070664_100127011
2580 Ga0070664_100177350
2581 Ga0070664_100182108
2582 Ga0070664_100564297
2583 Ga0070664_100826129
2584 Ga0070664_101013673
2585 Ga0070664_101092977
2586 Ga0070664_101262791
2587 Ga0070664_101813091
2588 Ga0070664_102126924
2589 Ga0068857_100077346
2590 Ga0068857_100093599
2591 Ga0068857_100486190
2592 Ga0068857_101087540
2593 Ga0068857_101773924
2594 Ga0068857_102090674
2595 Ga0068854_100127031
2596 Ga0068854_100247639
2597 Ga0068854_100267523
2598 Ga0068854_101027515
2599 Ga0068854_101588209
2600 Ga0068854_101826008
2601 Ga0070702_100103508
2602 Ga0070702_100129212
2603 Ga0070702_100207281
2604 Ga0070702_100245320
2605 Ga0070702_100256718
2606 Ga0070702_101535113
2607 Ga0068852_100482501
2608 Ga0068852_100835748
2609 Ga0068852_100934372
2610 Ga0068852_101103134
2611 Ga0068852_101734338
2612 Ga0068852_102515116
2613 Ga0068859_100001189
2614 Ga0068859_100007303
2615 Ga0068859_100057695
2616 Ga0068859_100057987
2617 Ga0068859_100084219
2618 Ga0068859_100085528
2619 Ga0068859_100088877
2620 Ga0068859_100131680
2621 Ga0068859_100179780
2622 Ga0068859_100209245
2623 Ga0068859_100267030
2624 Ga0068859_100672695
2625 Ga0068859_100714990
2626 Ga0068859_100871461
2627 Ga0068859_101168972
2628 Ga0068859_102132531
2629 Ga0068859_102234570
2630 Ga0068859_102585109
2631 Ga0068859_102855231
2632 Ga0068864_100010745
2633 Ga0068864_100013376
2634 Ga0068864_100029117
2635 Ga0068864_100037542
2636 Ga0068864_100124697
2637 Ga0068864_100347414
2638 Ga0068864_100371880
2639 Ga0068864_100405000
2640 Ga0068864_100425924
2641 Ga0068864_100553860
2642 Ga0068864_100929793
2643 Ga0068864_101714657
2644 Ga0068864_101771466
2645 Ga0068866_10018862
2646 Ga0068866_10029981
2647 Ga0068866_10179654
2648 Ga0068866_10257470
2649 Ga0068866_11303960
2650 Ga0068866_11443576
2651 Ga0068861_100003348
2652 Ga0068861_100007806
2653 Ga0068861_100052196
2654 Ga0068861_100093932
2655 Ga0068861_100130694
2656 Ga0068861_100328220
2657 Ga0068861_100401730
2658 Ga0068861_100595368
2659 Ga0068861_101734904
2660 Ga0068861_102053012
2661 Ga0068851_10017577
2662 Ga0068851_11073450
2663 Ga0068870_10002734
2664 Ga0068870_10007232
2665 Ga0068870_10008504
2666 Ga0068870_10025218
2667 Ga0068870_10071365
2668 Ga0068870_10119366
2669 Ga0068870_10154531
2670 Ga0068870_10516032
2671 Ga0068870_10655141
2672 Ga0068870_10749815
2673 Ga0068863_100001594
2674 Ga0068863_100029322
2675 Ga0068863_100042275
2676 Ga0068863_100148402
2677 Ga0068863_100184035
2678 Ga0068863_100455353
2679 Ga0068863_100616685
2680 Ga0068863_100872114
2681 Ga0068863_101241027
2682 Ga0068863_101343686
2683 Ga0068863_101992893
2684 Ga0068858_100003439
2685 Ga0068858_100015584
2686 Ga0068858_100031755
2687 Ga0068858_100048955
2688 Ga0068858_100057459
2689 Ga0068858_100225921
2690 Ga0068858_100371815
2691 Ga0068858_100507933
2692 Ga0068858_100622638
2693 Ga0068858_100832285
2694 Ga0068858_101665512
2695 Ga0068858_101979541
2696 Ga0068860_100002831
2697 Ga0068860_100038554
2698 Ga0068860_100087227
2699 Ga0068860_100340393
2700 Ga0068860_100355286
2701 Ga0068860_100880887
2702 Ga0068860_100982344
2703 Ga0068860_101080094
2704 Ga0068860_101251590
2705 Ga0068860_101441027
2706 Ga0068860_101640610
2707 Ga0068860_101710642
2708 Ga0068860_102087572
2709 Ga0068860_102428102
2710 Ga0068862_100001533
2711 Ga0068862_100001812
2712 Ga0068862_100107479
2713 Ga0068862_100129265
2714 Ga0068862_100306841
2715 Ga0068862_100307715
2716 Ga0068862_100323645
2717 Ga0068862_100502490
2718 Ga0068862_100762930
2719 Ga0068862_101075054
2720 Ga0068862_101126102
2721 Ga0068862_101775328
2722 Ga0068862_102108496
2723 Ga0068862_102494216
2724 Ga0081455_10081091
2725 Ga0081455_10194880
2726 Ga0081539_10000024
2727 Ga0081539_10000096
2728 Ga0081539_10028795
2729 Ga0081539_10258575
2730 Ga0081539_10268453
2731 Ga0081539_10272946
2732 Ga0070717_10230633
2733 Ga0070717_10850684
2734 Ga0075432_10029143
2735 Ga0075432_10363888
2736 Ga0070716_100984168
2737 Ga0070712_101809275
2738 Ga0070712_101849360
2739 Ga0075427_10025470
2740 Ga0097621_100000820
2741 Ga0097621_100010172
2742 Ga0097621_100019068
2743 Ga0097621_100035057
2744 Ga0097621_100133659
2745 Ga0097621_100232519
2746 Ga0097621_100247823
2747 Ga0097621_100259946
2748 Ga0097621_100305225
2749 Ga0097621_100311632
2750 Ga0097621_100717133
2751 Ga0097621_101323250
2752 Ga0068871_100000748
2753 Ga0068871_100007358
2754 Ga0068871_100019530
2755 Ga0068871_100100346
2756 Ga0068871_100471852
2757 Ga0068871_100485606
2758 Ga0068871_100808173
2759 Ga0068871_100825898
2760 Ga0068871_100996534
2761 Ga0068871_101583866
2762 Ga0075428_100012777
2763 Ga0075428_100030141
2764 Ga0075428_100061549
2765 Ga0075428_100092638
2766 Ga0075428_100121571
2767 Ga0075428_100219659
2768 Ga0075428_100226840
2769 Ga0075428_100374076
2770 Ga0075428_100520688
2771 Ga0075428_100842671
2772 Ga0075430_100009273
2773 Ga0075430_100017018
2774 Ga0075430_100058440
2775 Ga0075430_100591270
2776 Ga0075431_100051008
2777 Ga0075431_100076833
2778 Ga0075431_100248873
2779 Ga0075431_100589924
2780 Ga0075433_10026165
2781 Ga0075433_10044412
2782 Ga0075433_10115117
2783 Ga0075433_10165487
2784 Ga0075433_10205477
2785 Ga0075433_10244578
2786 Ga0075433_10273510
2787 Ga0075433_10319208
2788 Ga0075433_10395913
2789 Ga0075433_10455278
2790 Ga0075433_10830909
2791 Ga0075433_11045324
2792 Ga0075433_11677241
2793 Ga0075433_11927954
2794 Ga0075434_100000213
2795 Ga0075434_100007002
2796 Ga0075434_100046593
2797 Ga0075434_100083019
2798 Ga0075434_100123977
2799 Ga0075434_100170073
2800 Ga0075434_100170935
2801 Ga0075434_100208315
2802 Ga0075434_100247411
2803 Ga0075434_100251669
2804 Ga0075434_100367886
2805 Ga0075434_100579372
2806 Ga0075434_100669491
2807 Ga0075434_100706222
2808 Ga0075434_101209000
2809 Ga0075434_101240119
2810 Ga0075434_101254459
2811 Ga0075434_101689809
2812 Ga0075434_102278326
2813 Ga0075429_100021950
2814 Ga0075429_100051497
2815 Ga0075429_100154212
2816 Ga0075429_100179118
2817 Ga0075429_100313118
2818 Ga0075429_100765807
2819 Ga0075429_100948481
2820 Ga0068865_100004635
2821 Ga0068865_100028224
2822 Ga0068865_100034892
2823 Ga0068865_100035056
2824 Ga0068865_100178498
2825 Ga0068865_100399955
2826 Ga0068865_100427629
2827 Ga0068865_100519202
2828 Ga0068865_101558683
2829 Ga0068865_102089268
2830 Ga0068865_102175901
2831 Ga0075436_100004018
2832 Ga0075436_100065371
2833 Ga0075436_100117826
2834 Ga0075436_100545411
2835 Ga0075436_101090075
2836 Ga0075436_101130864
2837 Ga0097620_100001189
2838 Ga0097620_100007303
2839 Ga0097620_100057695
2840 Ga0097620_100057987
2841 Ga0097620_100084218
2842 Ga0097620_100085522
2843 Ga0097620_100088882
2844 Ga0097620_100131683
2845 Ga0097620_100179776
2846 Ga0097620_100209228
2847 Ga0097620_100267053
2848 Ga0097620_100672748
2849 Ga0097620_100715091
2850 Ga0097620_100871292
2851 Ga0097620_101169074
2852 Ga0097620_102132446
2853 Ga0097620_102234580
2854 Ga0097620_102584934
2855 Ga0097620_102855792
2856 Ga0075435_100002059
2857 Ga0075435_100002813
2858 Ga0075435_100003388
2859 Ga0075435_100015991
2860 Ga0075435_100028816
2861 Ga0075435_100053296
2862 Ga0075435_100103311
2863 Ga0075435_100618144
2864 Ga0075435_100901266
2865 Ga0099794_10572816
2866 Ga0105244_10456420
2867 Ga0105240_10171136
2868 Ga0105240_10234875
2869 Ga0105240_11652470
2870 Ga0105240_11988535
2871 Ga0111539_10002001
2872 Ga0111539_10002576
2873 Ga0111539_10010325
2874 Ga0111539_10011738
2875 Ga0111539_10046784
2876 Ga0111539_10115406
2877 Ga0111539_10359532
2878 Ga0111539_10390820
2879 Ga0111539_10470607
2880 Ga0111539_10555941
2881 Ga0111539_10594898
2882 Ga0111539_10699382
2883 Ga0111539_10750549
2884 Ga0111539_10750724
2885 Ga0111539_11087553
2886 Ga0111539_11128549
2887 Ga0111539_11812289
2888 Ga0111539_12952699
2889 Ga0111539_13244993
2890 Ga0105245_10021064
2891 Ga0105245_10025776
2892 Ga0105245_10253059
2893 Ga0105245_10407729
2894 Ga0105245_11264531
2895 Ga0105245_12203332
2896 Ga0105245_13114656
2897 Ga0105245_13279846
2898 Ga0105247_10034310
2899 Ga0105247_10047882
2900 Ga0105247_10098845
2901 Ga0105247_10657528
2902 Ga0114129_10001136
2903 Ga0114129_10002946
2904 Ga0114129_10004592
2905 Ga0114129_10020123
2906 Ga0114129_10022122
2907 Ga0114129_10027105
2908 Ga0114129_10028461
2909 Ga0114129_10037467
2910 Ga0114129_10040079
2911 Ga0114129_10057047
2912 Ga0114129_10078980
2913 Ga0114129_10115977
2914 Ga0114129_10117373
2915 Ga0114129_10117933
2916 Ga0114129_10157558
2917 Ga0114129_10171996
2918 Ga0114129_10277709
2919 Ga0114129_10661319
2920 Ga0114129_10897615
2921 Ga0114129_11017005
2922 Ga0114129_11065124
2923 Ga0114129_11154774
2924 Ga0114129_11550771
2925 Ga0114129_13127635
2926 Ga0105243_10026404
2927 Ga0105243_10028744
2928 Ga0105243_10032111
2929 Ga0105243_10436531
2930 Ga0105243_10736250
2931 Ga0105243_10739879
2932 Ga0105243_10776727
2933 Ga0105243_11440226
2934 Ga0105243_11560607
2935 Ga0105243_11648404
2936 Ga0105241_10582711
2937 Ga0105242_10012518
2938 Ga0105242_10013395
2939 Ga0105242_10068550
2940 Ga0105242_10104044
2941 Ga0105242_10131338
2942 Ga0105242_10132461
2943 Ga0105242_10325452
2944 Ga0105242_10329470
2945 Ga0105242_10381741
2946 Ga0105242_10524107
2947 Ga0105242_10551704
2948 Ga0105242_11343377
2949 Ga0105242_11413407
2950 Ga0105242_12500736
2951 Ga0105242_12795040
2952 Ga0105242_13147865
2953 Ga0105248_10043347
2954 Ga0105248_10127746
2955 Ga0105248_10188311
2956 Ga0105248_10197994
2957 Ga0105248_10401003
2958 Ga0105248_10416931
2959 Ga0105248_10515982
2960 Ga0105248_10516236
2961 Ga0105248_10544739
2962 Ga0105248_10651381
2963 Ga0105248_11201750
2964 Ga0105248_11853336
2965 Ga0105248_11872614
2966 Ga0105248_11923027
2967 Ga0105248_12202258
2968 Ga0105237_10455188
2969 Ga0105237_10706170
2970 Ga0105237_11028602
2971 Ga0105237_11291122
2972 Ga0105237_11593893
2973 Ga0105238_10013992
2974 Ga0105238_10174139
2975 Ga0105238_10547814
2976 Ga0105238_10825350
2977 Ga0105238_10847370
2978 Ga0105238_11344746
2979 Ga0105238_11641694
2980 Ga0105249_10038160
2981 Ga0105249_10112023
2982 Ga0105249_10377746
2983 Ga0105249_10396448
2984 Ga0105249_10966485
2985 Ga0105249_11296063
2986 Ga0105249_11683134
2987 Ga0099796_10437513
2988 Ga0099796_10586792
2989 Ga0105239_10884365
2990 Ga0105246_10279464
2991 Ga0105246_10386151
2992 Ga0105246_12007378
2993 Ga0157370_10315396
2994 Ga0157370_11773769
2995 Ga0157369_10694071
2996 Ga0157374_10019059
2997 Ga0157374_10021116
2998 Ga0157374_10158911
2999 Ga0157374_10248981
3000 Ga0157374_10388333
3001 Ga0157374_11910677
3002 Ga0157374_12131109
3003 Ga0157374_12271394
3004 Ga0157378_10116848
3005 Ga0157378_10122414
3006 Ga0157378_10144012
3007 Ga0157378_12250994
3008 Ga0157378_12536566
3009 Ga0157378_13029328
3010 Ga0157378_13160646
3011 Ga0157378_13217066
3012 Ga0163162_10023215
3013 Ga0163162_10085251
3014 Ga0163162_10366532
3015 Ga0163162_10821690
3016 Ga0163162_10859269
3017 Ga0163162_11043154
3018 Ga0163162_11114219
3019 Ga0163162_11130956
3020 Ga0163162_11172367
3021 Ga0163162_11246390
3022 Ga0163162_11766125
3023 Ga0163162_11993916
3024 Ga0163162_13185473
3025 Ga0163162_13269016
3026 Ga0157372_10190621
3027 Ga0157372_10568317
3028 Ga0157372_11432019
3029 Ga0157372_12182924
3030 Ga0157372_13370353
3031 Ga0157375_10002809
3032 Ga0157375_10195198
3033 Ga0157375_10267924
3034 Ga0157375_10965827
3035 Ga0157375_11406502
3036 Ga0157375_11577475
3037 Ga0157375_11854257
3038 Ga0157375_11863662
3039 Ga0157375_12107995
3040 Ga0157375_12321154
3041 Ga0157375_12609371
3042 Ga0157375_13606814
3043 Ga0163163_10019062
3044 Ga0163163_10029929
3045 Ga0163163_10034366
3046 Ga0163163_10035670
3047 Ga0163163_10131460
3048 Ga0163163_10152247
3049 Ga0163163_10212125
3050 Ga0163163_10404711
3051 Ga0163163_10718221
3052 Ga0163163_12579260
3053 Ga0163163_12625527
3054 Ga0157380_10033704
3055 Ga0157380_10043376
3056 Ga0157380_10073134
3057 Ga0157380_10078972
3058 Ga0157380_10089956
3059 Ga0157380_10295034
3060 Ga0157380_10301337
3061 Ga0157380_10315357
3062 Ga0157380_10320424
3063 Ga0157380_10820105
3064 Ga0157380_11160073
3065 Ga0157380_11654413
3066 Ga0157380_11861662
3067 Ga0157380_12090282
3068 Ga0157380_12516602
3069 Ga0157380_12781108
3070 Ga0157377_10049493
3071 Ga0157377_10097784
3072 Ga0157377_10108179
3073 Ga0157377_10202313
3074 Ga0157377_10396339
3075 Ga0157377_10437902
3076 Ga0157377_10790353
3077 Ga0157377_10938283
3078 Ga0157377_11327752
3079 Ga0157377_11425515
3080 Ga0157379_10003474
3081 Ga0157379_10075144
3082 Ga0157379_10117348
3083 Ga0157379_10191381
3084 Ga0157379_10249808
3085 Ga0157379_10378050
3086 Ga0157379_10472510
3087 Ga0157379_10512462
3088 Ga0157379_10553275
3089 Ga0157379_10945388
3090 Ga0157376_10008040
3091 Ga0157376_10017626
3092 Ga0157376_10018373
3093 Ga0157376_10069948
3094 Ga0157376_10200328
3095 Ga0157376_10264606
3096 Ga0157376_10301913
3097 Ga0157376_10411659
3098 Ga0157376_12620232
3099 Ga0163161_10437450
3100 Ga0163161_10497282
3101 Ga0163161_10537660
3102 Ga0163161_11833857
3103 Ga0206350_10273369
3104 Ga0213876_10130218
3105 Ga0207697_10049925
3106 Ga0207697_10064197
3107 Ga0207697_10159881
3108 Ga0207697_10222430
3109 Ga0207697_10353957
3110 Ga0207697_10465749
3111 Ga0207697_10470305
3112 Ga0207656_10084620
3113 Ga0207653_10043956
3114 Ga0207682_10014308
3115 Ga0207682_10056482
3116 Ga0207682_10352289
3117 Ga0207682_10479119
3118 Ga0207692_10286169
3119 Ga0207642_10049260
3120 Ga0207642_10091674
3121 Ga0207642_10153016
3122 Ga0207642_10355579
3123 Ga0207642_10418167
3124 Ga0207710_10019937
3125 Ga0207710_10027337
3126 Ga0207710_10029566
3127 Ga0207688_10184921
3128 Ga0207688_10589021
3129 Ga0207688_10715990
3130 Ga0207688_10962474
3131 Ga0207680_10067236
3132 Ga0207680_10176061
3133 Ga0207680_10248151
3134 Ga0207680_10398804
3135 Ga0207680_10472893
3136 Ga0207680_10830626
3137 Ga0207680_10909453
3138 Ga0207680_10955625
3139 Ga0207680_10996224
3140 Ga0207680_10997477
3141 Ga0207680_11212266
3142 Ga0207680_11221007
3143 Ga0207680_11306948
3144 Ga0207647_10782042
3145 Ga0207685_10053071
3146 Ga0207699_10010829
3147 Ga0207699_10091637
3148 Ga0207645_10014261
3149 Ga0207645_10242702
3150 Ga0207645_10250164
3151 Ga0207645_10360987
3152 Ga0207645_10364706
3153 Ga0207645_10648592
3154 Ga0207645_10696259
3155 Ga0207645_11191276
3156 Ga0207643_10004564
3157 Ga0207643_10008987
3158 Ga0207643_10035071
3159 Ga0207643_10065663
3160 Ga0207643_10136963
3161 Ga0207643_10154565
3162 Ga0207643_10156111
3163 Ga0207643_10193751
3164 Ga0207643_10306345
3165 Ga0207643_10537439
3166 Ga0207643_10947459
3167 Ga0207684_10257555
3168 Ga0207684_10381313
3169 Ga0207684_10622887
3170 Ga0207684_10812381
3171 Ga0207684_10912112
3172 Ga0207684_11163112
3173 Ga0207684_11426903
3174 Ga0207684_11557443
3175 Ga0207654_10177645
3176 Ga0207654_11070021
3177 Ga0207707_10024100
3178 Ga0207707_10032794
3179 Ga0207707_10279831
3180 Ga0207707_10601049
3181 Ga0207707_11121255
3182 Ga0207707_11520945
3183 Ga0207695_10529415
3184 Ga0207695_10788680
3185 Ga0207695_11164215
3186 Ga0207671_10523927
3187 Ga0207693_10950933
3188 Ga0207663_10094880
3189 Ga0207663_10266738
3190 Ga0207663_11135376
3191 Ga0207660_10225449
3192 Ga0207660_10265138
3193 Ga0207660_10272707
3194 Ga0207660_10431858
3195 Ga0207660_10622017
3196 Ga0207660_10921116
3197 Ga0207660_11551999
3198 Ga0207662_10002904
3199 Ga0207662_10011988
3200 Ga0207662_10017112
3201 Ga0207662_10110207
3202 Ga0207662_10141593
3203 Ga0207662_10356241
3204 Ga0207662_11183159
3205 Ga0207662_11370855
3206 Ga0207657_10188145
3207 Ga0207657_10542384
3208 Ga0207649_10152232
3209 Ga0207649_10292330
3210 Ga0207649_10827093
3211 Ga0207649_11098679
3212 Ga0207649_11450030
3213 Ga0207652_10119412
3214 Ga0207652_10121939
3215 Ga0207652_10625792
3216 Ga0207652_10886454
3217 Ga0207646_10038633
3218 Ga0207646_10072249
3219 Ga0207646_10121718
3220 Ga0207646_10242014
3221 Ga0207646_10965973
3222 Ga0207646_11039703
3223 Ga0207646_11777976
3224 Ga0207681_10018017
3225 Ga0207681_10030217
3226 Ga0207681_10033207
3227 Ga0207681_10043090
3228 Ga0207681_10060642
3229 Ga0207681_10060846
3230 Ga0207681_10084558
3231 Ga0207681_10129938
3232 Ga0207681_10158937
3233 Ga0207681_10226443
3234 Ga0207681_10515486
3235 Ga0207681_10834221
3236 Ga0207694_10013622
3237 Ga0207694_11132165
3238 Ga0207650_10028078
3239 Ga0207650_10064428
3240 Ga0207650_10076891
3241 Ga0207650_10171181
3242 Ga0207650_10214392
3243 Ga0207650_10276071
3244 Ga0207650_10868048
3245 Ga0207650_11001007
3246 Ga0207650_11004823
3247 Ga0207659_10000165
3248 Ga0207659_10014307
3249 Ga0207659_10014896
3250 Ga0207659_10045471
3251 Ga0207659_10065813
3252 Ga0207659_10067674
3253 Ga0207659_10089736
3254 Ga0207659_10270937
3255 Ga0207659_10274873
3256 Ga0207659_10301783
3257 Ga0207659_10324308
3258 Ga0207659_10369885
3259 Ga0207659_10615186
3260 Ga0207659_10832869
3261 Ga0207659_11162154
3262 Ga0207687_10034358
3263 Ga0207687_10096210
3264 Ga0207687_10162619
3265 Ga0207687_10290488
3266 Ga0207700_10086331
3267 Ga0207700_10359270
3268 Ga0207700_11587640
3269 Ga0207644_10022799
3270 Ga0207644_10240169
3271 Ga0207644_10250864
3272 Ga0207644_10318543
3273 Ga0207644_10706626
3274 Ga0207644_10723932
3275 Ga0207644_10768858
3276 Ga0207644_10967400
3277 Ga0207644_10974822
3278 Ga0207690_10215206
3279 Ga0207690_10449546
3280 Ga0207690_10460417
3281 Ga0207690_11181628
3282 Ga0207690_11802667
3283 Ga0207706_10015695
3284 Ga0207706_10068523
3285 Ga0207706_10077397
3286 Ga0207706_10096178
3287 Ga0207706_10250863
3288 Ga0207706_10357566
3289 Ga0207706_11035438
3290 Ga0207706_11172750
3291 Ga0207706_11582591
3292 Ga0207706_11680527
3293 Ga0207686_10031500
3294 Ga0207686_10048667
3295 Ga0207686_10193033
3296 Ga0207686_10205680
3297 Ga0207686_10213253
3298 Ga0207686_10279108
3299 Ga0207686_10306610
3300 Ga0207686_10414150
3301 Ga0207686_10626753
3302 Ga0207686_10758118
3303 Ga0207709_10003211
3304 Ga0207709_10019406
3305 Ga0207709_10023716
3306 Ga0207709_10034561
3307 Ga0207709_10155331
3308 Ga0207709_10570687
3309 Ga0207709_10584420
3310 Ga0207709_10678031
3311 Ga0207670_10009012
3312 Ga0207670_10139424
3313 Ga0207670_10226134
3314 Ga0207670_10318199
3315 Ga0207670_10496393
3316 Ga0207670_10537851
3317 Ga0207670_10635179
3318 Ga0207670_10727907
3319 Ga0207670_10740851
3320 Ga0207670_10946453
3321 Ga0207670_11167465
3322 Ga0207670_11797082
3323 Ga0207669_10008814
3324 Ga0207669_10369871
3325 Ga0207669_10400745
3326 Ga0207669_10575256
3327 Ga0207669_10749922
3328 Ga0207669_11085890
3329 Ga0207669_11677889
3330 Ga0207669_11918973
3331 Ga0207669_11928588
3332 Ga0207704_10009747
3333 Ga0207704_10022277
3334 Ga0207704_10068788
3335 Ga0207704_10197852
3336 Ga0207704_10369956
3337 Ga0207704_10405746
3338 Ga0207704_10603234
3339 Ga0207704_10646160
3340 Ga0207704_10963292
3341 Ga0207704_11535749
3342 Ga0207665_10069360
3343 Ga0207665_10352338
3344 Ga0207665_10441477
3345 Ga0207691_10015223
3346 Ga0207691_10028979
3347 Ga0207691_10034416
3348 Ga0207691_10042880
3349 Ga0207691_10045474
3350 Ga0207691_10057115
3351 Ga0207691_10072796
3352 Ga0207691_10164347
3353 Ga0207691_10588403
3354 Ga0207691_10769479
3355 Ga0207691_10962129
3356 Ga0207691_11056678
3357 Ga0207691_11172131
3358 Ga0207691_11526656
3359 Ga0207711_10049790
3360 Ga0207711_10091868
3361 Ga0207711_10131402
3362 Ga0207711_10245490
3363 Ga0207711_10308424
3364 Ga0207711_10334302
3365 Ga0207711_10688196
3366 Ga0207711_11090561
3367 Ga0207689_10000643
3368 Ga0207689_10012520
3369 Ga0207689_10027940
3370 Ga0207689_10112350
3371 Ga0207689_10307612
3372 Ga0207689_10403197
3373 Ga0207689_10595304
3374 Ga0207689_10693756
3375 Ga0207689_10699686
3376 Ga0207689_10965934
3377 Ga0207689_11224060
3378 Ga0207661_10024608
3379 Ga0207661_10163985
3380 Ga0207661_10876146
3381 Ga0207661_11404642
3382 Ga0207679_10005908
3383 Ga0207679_10031345
3384 Ga0207679_10065947
3385 Ga0207679_10088086
3386 Ga0207679_10092172
3387 Ga0207679_10430540
3388 Ga0207679_10439324
3389 Ga0207679_10594321
3390 Ga0207679_10598109
3391 Ga0207679_10689792
3392 Ga0207679_10799201
3393 Ga0207679_10825695
3394 Ga0207679_10919010
3395 Ga0207679_11153628
3396 Ga0207679_11525040
3397 Ga0207679_12005714
3398 Ga0207667_10309437
3399 Ga0207667_11210429
3400 Ga0207651_10007557
3401 Ga0207651_10016199
3402 Ga0207651_10041108
3403 Ga0207651_10046772
3404 Ga0207651_10052086
3405 Ga0207651_10166720
3406 Ga0207651_10167347
3407 Ga0207651_10278176
3408 Ga0207651_10449675
3409 Ga0207651_10674156
3410 Ga0207651_10744216
3411 Ga0207651_10894005
3412 Ga0207651_10927054
3413 Ga0207651_11071257
3414 Ga0207651_11119671
3415 Ga0207651_11147183
3416 Ga0207651_11545355
3417 Ga0207651_11982127
3418 Ga0207712_10017338
3419 Ga0207712_10200611
3420 Ga0207712_10319392
3421 Ga0207712_10445306
3422 Ga0207712_10665168
3423 Ga0207712_11546699
3424 Ga0207668_10023731
3425 Ga0207668_10106115
3426 Ga0207668_10251701
3427 Ga0207668_10670254
3428 Ga0207668_10832751
3429 Ga0207668_11029862
3430 Ga0207668_11210671
3431 Ga0207640_10026642
3432 Ga0207640_10103802
3433 Ga0207640_10591060
3434 Ga0207640_10826655
3435 Ga0207640_10869540
3436 Ga0207640_10947345
3437 Ga0207640_11397624
3438 Ga0207658_10069509
3439 Ga0207658_10095471
3440 Ga0207658_10226337
3441 Ga0207658_10314518
3442 Ga0207658_11660041
3443 Ga0207677_10169465
3444 Ga0207677_10668226
3445 Ga0207677_10900899
3446 Ga0207677_11093760
3447 Ga0207677_11235143
3448 Ga0207677_11403119
3449 Ga0207677_11760033
3450 Ga0207703_10006564
3451 Ga0207703_10012636
3452 Ga0207703_10016387
3453 Ga0207703_10045106
3454 Ga0207703_10100769
3455 Ga0207703_10148031
3456 Ga0207703_10162401
3457 Ga0207703_10285938
3458 Ga0207703_10314417
3459 Ga0207703_10428486
3460 Ga0207703_10664248
3461 Ga0207703_10950113
3462 Ga0207703_11114922
3463 Ga0207703_11396596
3464 Ga0207639_10338372
3465 Ga0207639_11101652
3466 Ga0207639_11295974
3467 Ga0207639_11299872
3468 Ga0207639_12260954
3469 Ga0207678_10025441
3470 Ga0207678_10362109
3471 Ga0207678_10731721
3472 Ga0207678_10897194
3473 Ga0207708_10018340
3474 Ga0207708_10040694
3475 Ga0207708_10096306
3476 Ga0207708_10128468
3477 Ga0207708_10133563
3478 Ga0207708_10200597
3479 Ga0207708_10422587
3480 Ga0207708_10525207
3481 Ga0207708_10734479
3482 Ga0207708_11328993
3483 Ga0207708_11626520
3484 Ga0207708_11988270
3485 Ga0207641_10000431
3486 Ga0207641_10031847
3487 Ga0207641_10036202
3488 Ga0207641_10206608
3489 Ga0207641_10252308
3490 Ga0207641_10264777
3491 Ga0207641_10441704
3492 Ga0207641_10468946
3493 Ga0207641_10645218
3494 Ga0207641_12167456
3495 Ga0207648_10002155
3496 Ga0207648_10018357
3497 Ga0207648_10026873
3498 Ga0207648_10030598
3499 Ga0207648_10031427
3500 Ga0207648_10087590
3501 Ga0207648_10156347
3502 Ga0207648_10277219
3503 Ga0207648_10360323
3504 Ga0207648_10362586
3505 Ga0207648_10851950
3506 Ga0207648_11751664
3507 Ga0207648_11949796
3508 Ga0207648_11989844
3509 Ga0207676_10030791
3510 Ga0207676_10032794
3511 Ga0207676_10055223
3512 Ga0207676_10067449
3513 Ga0207676_10070230
3514 Ga0207676_10090359
3515 Ga0207676_10132256
3516 Ga0207676_10211203
3517 Ga0207676_10322560
3518 Ga0207676_10409868
3519 Ga0207676_10823230
3520 Ga0207676_11198411
3521 Ga0207676_11809298
3522 Ga0207676_11883429
3523 Ga0207674_10006828
3524 Ga0207674_10091271
3525 Ga0207674_10142420
3526 Ga0207674_10161299
3527 Ga0207674_10187239
3528 Ga0207674_10257171
3529 Ga0207674_10374322
3530 Ga0207674_11130554
3531 Ga0207675_100004553
3532 Ga0207675_100009694
3533 Ga0207675_100014548
3534 Ga0207675_100197314
3535 Ga0207675_100210134
3536 Ga0207675_100239658
3537 Ga0207675_100447241
3538 Ga0207675_100687561
3539 Ga0207675_100920913
3540 Ga0207675_101042616
3541 Ga0207675_101207690
3542 Ga0207675_101627606
3543 Ga0207683_10008415
3544 Ga0207683_10010954
3545 Ga0207683_10142568
3546 Ga0207683_10179410
3547 Ga0207683_10256864
3548 Ga0207683_10379802
3549 Ga0207683_10486276
3550 Ga0207683_10549442
3551 Ga0207683_10552254
3552 Ga0207683_10577111
3553 Ga0207683_10837759
3554 Ga0207683_10859681
3555 Ga0207683_11922119
3556 Ga0207698_10147970
3557 Ga0207698_10255878
3558 Ga0207698_10679312
3559 Ga0207698_10717755
3560 Ga0207698_10930436
3561 Ga0209981_1071703
3562 Ga0209968_1088074
3563 Ga0209974_10319506
3564 Ga0209974_10320713
3565 Ga0207428_10000527
3566 Ga0207428_10004414
3567 Ga0207428_10017113
3568 Ga0207428_10142308
3569 Ga0207428_10150857
3570 Ga0207428_10241319
3571 Ga0207428_10294418
3572 Ga0207428_10321461
3573 Ga0207428_10402596
3574 Ga0207428_10491164
3575 Ga0207428_10494367
3576 Ga0207428_10734045
3577 Ga0207428_10914384
3578 Ga0268266_10009542
3579 Ga0268266_10130451
3580 Ga0268266_10726883
3581 Ga0268266_10927708
3582 Ga0268266_11027035
3583 Ga0268266_11314676
3584 Ga0268266_11389472
3585 Ga0268265_10001463
3586 Ga0268265_10009722
3587 Ga0268265_10077817
3588 Ga0268265_10144587
3589 Ga0268265_10146120
3590 Ga0268265_10223835
3591 Ga0268265_10483891
3592 Ga0268265_10985565
3593 Ga0268265_11108192
3594 Ga0268265_11196130
3595 Ga0268265_11263798
3596 Ga0268265_11294758
3597 Ga0268265_11297125
3598 Ga0268265_11440996
3599 Ga0268265_11643542
3600 Ga0268264_10011300
3601 Ga0268264_10064504
3602 Ga0268264_10145089
3603 Ga0268264_10259747
3604 Ga0268264_10427837
3605 Ga0268264_10429280
3606 Ga0268264_10446884
3607 Ga0268264_10570671
3608 Ga0268264_10715505
3609 Ga0268264_10743360
3610 Ga0268264_11101824
3611 Ga0268264_11109541
3612 Ga0268264_11544391
3613 Ga0268264_11783778
3614 Ga0265318_10401734
3615 Ga0307511_10228856
3616 Ga0316177_1067784
3617 Ga0307408_100065395
3618 Ga0307408_100335153
3619 Ga0307408_100340286
3620 Ga0307408_100613114
3621 Ga0307408_100690569
3622 Ga0307408_101565426
3623 Ga0307405_10020527
3624 Ga0307405_10046873
3625 Ga0307405_10103027
3626 Ga0307405_10731235
3627 Ga0307405_10843144
3628 Ga0307405_11458077
3629 Ga0307413_10024650
3630 Ga0307413_10148712
3631 Ga0307413_10450460
3632 Ga0307413_10702311
3633 Ga0307413_10808995
3634 Ga0307410_10002707
3635 Ga0307410_10018326
3636 Ga0307410_10320242
3637 Ga0307410_10780237
3638 Ga0307410_12030454
3639 Ga0307406_10084061
3640 Ga0307406_10188675
3641 Ga0307407_10005552
3642 Ga0307407_10162816
3643 Ga0307412_10046165
3644 Ga0307412_10068745
3645 Ga0307412_10092398
3646 Ga0307412_10112945
3647 Ga0307409_100142461
3648 Ga0307409_100178191
3649 Ga0307409_100640346
3650 Ga0307409_100684838
3651 Ga0307416_100018347
3652 Ga0307416_100037547
3653 Ga0307416_100049139
3654 Ga0307416_100057896
3655 Ga0307416_100834107
3656 Ga0307416_101458423
3657 Ga0307416_102673387
3658 Ga0307416_102931836
3659 Ga0307414_10014285
3660 Ga0307414_11737759
3661 Ga0307414_12311757
3662 Ga0307411_10003895
3663 Ga0307411_10007445
3664 Ga0307411_10041606
3665 Ga0307411_10080942
3666 Ga0307411_10196221
3667 Ga0307411_10518552
3668 Ga0307411_10715944
3669 Ga0307411_11534026
3670 Ga0307411_12039251
3671 Ga0307415_100010976
3672 Ga0307415_100076840
3673 Ga0307415_100204903
3674 Ga0307415_100827319
3675 Ga0307415_102546267
3676 Ga0373930_0004713
3677 Ga0373948_0005040
3678 Ga0373950_0000276
3679 Ga0373958_0076447
3680 Ga0373958_0082838
3681 Ga0373959_0001408
3682 Ga0373938_0023830
3683 Ga0373928_0001861
3684 Ga0373928_0060923
3685 Ga0373928_0224993
3686 Ga0373929_0001848
3687 Ga0373934_0068660
3688 Ga0373940_0010101
3689 Ga0373940_0010283
3690 Ga0373940_0317709
3691 Ga0373944_0129337
3692 Ga0373949_0005325
3693 Ga0373951_0000713
3694 Ga0373952_0015128
3695 Ga0373923_0066682
3696 Ga0373923_0354952
3697 Ga0373923_0624523
3698 Ga0373932_0000374
3699 Ga0373936_0097095
3700 Ga0373939_0007192
3701 Ga0373941_0000482
3702 Ga0373941_0072643
3703 Ga0373941_0143507
3704 Ga0373941_0392162
3705 Ga0373945_0108029
3706 Ga0373945_0334156
3707 Ga0373953_0125717
3708 Ga0373954_0264189
3709 Ga0373954_0283438
3710 Ga0373954_0472783
3711 Ga0373954_0564697
3712 Ga0373956_0235062
3713 Ga0373956_0385097
3714 Ga0373957_0264647
3715 Ga0373960_0000304
3716 Ga0373960_0037020
3717 Ga0373943_0008686
3718 Ga0373943_0166348
3719 Ga0373946_0004998
3720 Ga0373955_0051069
3721 Ga0373955_0152885
3722 Ga0373955_0194798
3723 Ga0373955_0339826
3724 Ga0373955_0582579
3725 Ga0373942_0002761
3726 Ga0373961_0003133
3727 Ga0373961_0145965
3728 Ga0373962_0000484
3729 Ga0373962_0154014
3730 Ga0373962_0167020
3731 Ga0373962_0190474
3732 Ga0373924_0104962
3733 Ga0373924_0189700
3734 Ga0373931_0002957
3735 Ga0373931_0226314
3736 Ga0373931_0506019
3737 Ga0373931_0718744
3738 Ga0373935_0090223
3739 Ga0373935_0223769
3740 Ga0373935_0275347
3741 Ga0373935_0677332
3742 Ga0373935_0691331
3743 Ga0373927_0178932
3744 Ga0373927_0277996
3745 Ga0373933_0203563
3746 Ga0373933_0414151
3747 Ga0373933_0418019
3748 Ga0373933_0580133
3749 Ga0373947_0008171
3750 Ga0373947_0359307
3751 Ga0373947_1091361
3752 Ga0373937_0009059
3753 Ga0373937_0080467
3754 Ga0373937_0186363
3755 Ga0373937_0371473
3756 Ga0373937_0575744
3757 Ga0373937_0853517
3758 Ga0373937_1105041
3759 Ga0373937_1809025
3760 Ga0373925_0015313
3761 Ga0373925_0379196
3762 Ga0373925_0669279
3763 Ga0373925_0826530
3764 Ga0373925_0863433
3765 Ga0373925_1007934
3766 Ga0242420_043178
3767 Ga0436365_0974042
3768 Ga0436363_0695528
3769 Ga0436362_1204701
3770 Ga0439436_0155822
3771 Ga0439439_0150124
3772 Ga0439453_0106445
3773 Ga0451800_1099042
3774 Ga0451807_0514159
3775 Ga0451807_1968602
3776 Ga0451845_0428115
3777 Ga0451853_0326641
3778 Ga0451853_1148563
3779 Ga0439448_0315695
3780 Ga0439450_091565
3781 Ga0439462_0086984
3782 Ga0450923_067636
3783 Ga0450923_117699
3784 Ga0439446_0217893
3785 Ga0439446_0227777
3786 Ga0450908_108368
3787 Ga0439434_0128720
3788 Ga0439435_0024756
3789 Ga0439464_0291688
3790 Ga0451577_0952727
3791 Ga0451577_1132996
3792 Ga0439440_0151667
3793 Ga0453683_0430943
3794 Ga0453683_0481647
3795 Ga0466963_0026043
3796 Ga0466964_0370735
3797 Ga0453684_0530056
3798 Ga0466968_0431886
3799 Ga0466957_0492813
3800 Ga0451576_0036825
3801 Ga0451576_0069886
3802 Ga0451576_0074874
3803 Ga0451576_0282376
3804 Ga0451576_0782165
3805 Ga0451576_1114216
3806 Ga0451576_2124176
3807 Ga0451576_2201159
3808 Ga0451576_2296737
3809 Ga0451576_2492645
3810 Ga0451576_2718879
3811 Ga0466958_0436147
3812 Ga0466967_0489595
3813 Ga0466967_0583039
3814 Ga0466967_0609524
3815 Ga0466967_1760039
3816 Ga0466967_2467962
3817 Ga0495603_0107715
3818 Ga0495591_179204
3819 Ga0495629_0026452
3820 Ga0495629_0211359
3821 Ga0495629_0892849
3822 Ga0495629_0966855
3823 Ga0495651_0136250
3824 Ga0495580_0031838
3825 Ga0495580_0037989
3826 Ga0495580_0302143
3827 Ga0495580_0455137
3828 Ga0495580_0479049
3829 Ga0495580_0798990
3830 Ga0495582_0311273
3831 Ga0495582_0387856
3832 Ga0495582_0628807
3833 Ga0495582_0711689
3834 Ga0495639_0425853
3835 Ga0495584_0050641
3836 Ga0495584_0263799
3837 Ga0495594_0016304
3838 Ga0495594_0068088
3839 Ga0495594_0447550
3840 Ga0495608_0010373
3841 Ga0495618_0100511
3842 Ga0495618_0252638
3843 Ga0495628_0197372
3844 Ga0495628_0831276
3845 Ga0495630_0021167
3846 Ga0495630_0475789
3847 Ga0495630_0500145
3848 Ga0495630_0501930
3849 Ga0495643_0011009
3850 Ga0495644_0230447
3851 Ga0495663_0134568
3852 Ga0495663_0159732
3853 Ga0495663_0161489
3854 Ga0495642_0005763
3855 Ga0495642_0344802
3856 Ga0495652_0036799
3857 Ga0495652_0211056
3858 Ga0495665_0056144
3859 Ga0495640_0106328
3860 Ga0495640_0366047
3861 Ga0495640_0732195
3862 Ga0495586_0260109
3863 Ga0495586_0429547
3864 Ga0495587_0046585
3865 Ga0495598_0018119
3866 Ga0495598_0050984
3867 Ga0495598_0059865
3868 Ga0495598_0079003
3869 Ga0495598_0171509
3870 Ga0495598_0199497
3871 Ga0495598_0215782
3872 Ga0495598_0444409
3873 Ga0495609_0108794
3874 Ga0495621_0000734
3875 Ga0495621_0002328
3876 Ga0495621_0004301
3877 Ga0495621_0104597
3878 Ga0495645_0110321
3879 Ga0495633_0018310
3880 Ga0495667_0434609
3881 Ga0495656_0007731
3882 Ga0495656_0541895
3883 Ga0495668_0774921
3884 Ga0495634_0185935
3885 Ga0495634_0822900
3886 Ga0495659_0005213
3887 Ga0495659_0006176
3888 Ga0495659_0043745
3889 Ga0495659_0099457
3890 Ga0495659_0143842
3891 Ga0495659_0226285
3892 Ga0495659_0246536
3893 Ga0495659_0395920
3894 Ga0495659_0418048
3895 Ga0495659_0536433
3896 Ga0495588_0154419
3897 Ga0495588_0571087
3898 Ga0495588_0631335
3899 Ga0495657_0275115
3900 Ga0495623_0609141
3901 Ga0495646_0459353
3902 Ga0495647_0046635
3903 Ga0495647_0187730
3904 Ga0495658_0085033
3905 Ga0495658_0114637
3906 Ga0495658_0466973
3907 Ga0495658_0526902
3908 Ga0495658_1108712
3909 Ga0495669_0025552
3910 Ga0495669_0047099
3911 Ga0495669_0120449
3912 Ga0495669_0142101
3913 Ga0495669_0346718
3914 Ga0495669_0410085
3915 Ga0495613_0000720
3916 Ga0495670_0805391
3917 Ga0495581_0465120
3918 Ga0495581_0598379
3919 Ga0495604_0390745
3920 Ga0495636_0142362
3921 Ga0495674_0025567
3922 Ga0495674_0473940
3923 Ga0495674_0592575
3924 Ga0495674_0612890
3925 Ga0495672_0268271
3926 Ga0495676_0036588
3927 Ga0495680_0393814
3928 Ga0495685_033432
3929 Ga0495685_048797
3930 Ga0495684_0000613
3931 Ga0495684_0272083
3932 Ga0495593_0287864
3933 Ga0495614_0537676
3934 Ga0495614_0657688
3935 Ga0496100_0243294
3936 Ga0496100_0811999
3937 Ga0496100_0958564
3938 Ga0496101_0000451
3939 Ga0496101_0821314
3940 Ga0496101_1041627
3941 Ga0496102_0944611
3942 Ga0496103_0362131
3943 Ga0496104_0309891
3944 Ga0496104_0333741
3945 Ga0496104_0355658
3946 Ga0496104_0423719
3947 Ga0496104_0812657
3948 Ga0496104_1222041
3949 Ga0496105_0265325
3950 Ga0496105_0675634
3951 Ga0496105_0892135
3952 Ga0496106_0045609
3953 Ga0496106_0222706
3954 Ga0496106_0639560
3955 Ga0496106_0728760
3956 Ga0496106_1513522
3957 Ga0496106_1533206
3958 Ga0496107_0345761
3959 Ga0496107_0609011
3960 Ga0496107_1025492
3961 Ga0496107_1272644
3962 Ga0496108_0890607
3963 Ga0496108_0992209
3964 Ga0496108_1130085
3965 Ga0496108_1268264
3966 Ga0496109_0446343
3967 Ga0496109_0565345
3968 Ga0496109_0614112
3969 Ga0496110_0022673
3970 Ga0496110_0688733
3971 Ga0496110_0906301
3972 Ga0496111_0799130
3973 Ga0496111_1072711
3974 Ga0496112_0538464
3975 Ga0496112_1834331
3976 Ga0496112_1864225
3977 Ga0496113_0109187
3978 Ga0496113_0180028
3979 Ga0496113_0309279
3980 Ga0496113_0363076
3981 Ga0496114_0001764
3982 Ga0496114_0202676
3983 Ga0496114_0571906
3984 Ga0496114_0590266
3985 Ga0496115_0044293
3986 Ga0496115_0619922
3987 Ga0496115_0936752
3988 Ga0501292_058286
3989 Ga0501292_140448
3990 Ga0501294_058889
3991 Ga0501295_131299
3992 Ga0501298_079386
3993 Ga0501298_088894
3994 Ga0501298_148641
3995 Ga0501299_092513
3996 Ga0501299_193258
3997 Ga0501299_231899
3998 Ga0501320_051899
3999 Ga0501031_0595084
4000 Ga0501032_0948403
4001 Ga0501033_0054566
4002 Ga0501033_0571682
4003 Ga0501036_0481481
4004 Ga0501036_1246464
4005 Ga0501039_0043088
4006 Ga0501039_0096051
4007 Ga0501039_0629160
4008 Ga0501039_1144699
4009 Ga0501040_0191871
4010 Ga0501040_0257776
4011 Ga0501040_0533565
4012 Ga0501040_1183758
4013 Ga0501040_1304737
4014 Ga0501041_0021002
4015 Ga0501041_0027286
4016 Ga0501041_0360458
4017 Ga0501041_0836681
4018 Ga0501041_1078564
4019 Ga0501042_0020313
4020 Ga0501042_0068209
4021 Ga0501042_0104599
4022 Ga0501042_0504033
4023 Ga0501043_0380124
4024 Ga0501043_0558438
4025 Ga0501046_0224520
4026 Ga0501046_0268583
4027 Ga0501046_0659307
4028 Ga0501046_1028641
4029 Ga0501048_0097317
4030 Ga0501048_0115376
4031 Ga0501048_0936448
4032 Ga0501067_0084722
4033 Ga0501067_0415926
4034 Ga0501068_0025829
4035 Ga0501068_0074051
4036 Ga0501068_0210604
4037 Ga0501069_0759198
4038 Ga0501069_0796871
4039 Ga0501071_0038926
4040 Ga0501071_0073892
4041 Ga0501071_0339443
4042 Ga0501071_1083652
4043 Ga0501072_0059133
4044 Ga0501072_0082245
4045 Ga0501072_0377582
4046 Ga0501073_0752714
4047 Ga0501073_1274585
4048 Ga0501074_0216331
4049 Ga0501075_0011468
4050 Ga0501075_0014710
4051 Ga0501075_0027285
4052 Ga0501076_0000430
4053 Ga0501076_0029547
4054 Ga0501076_0071935
4055 Ga0501077_0007773
4056 Ga0501209_112598
4057 Ga0501216_121502
4058 Ga0501233_188554
4059 Ga0501235_104846
4060 Ga0501235_214227
4061 Ga0501243_092603
4062 Ga0501247_022900
4063 Ga0501249_057078
4064 Ga0501249_100971
4065 Ga0501253_217053
4066 Ga0501256_042155
4067 Ga0501257_160822
4068 Ga0501245_066289
4069 Ga0501245_094182
4070 Ga0501079_0023834
4071 Ga0501079_0032267
4072 Ga0501079_0130665
4073 Ga0501080_0225287
4074 Ga0501080_0238544
4075 Ga0501080_0597003
4076 Ga0501081_0000588
4077 Ga0501081_0002533
4078 Ga0501081_0034421
4079 Ga0501081_0045103
4080 Ga0501081_0293922
4081 Ga0501081_1522869
4082 Ga0501083_0013562
4083 Ga0501268_044925
4084 Ga0501270_092061
4085 Ga0501272_042658
4086 Ga0501273_041202
4087 Ga0501283_012511
4088 Ga0501283_056205
4089 Ga0501045_0034751
4090 Ga0501045_0404199
4091 Ga0501045_0521338
4092 Ga0501045_0597340
4093 nmdc:mga05p37_11992_c1
4094 nmdc:mga05p37_126818_c1
4095 nmdc:mga05p37_138659_c1
4096 nmdc:mga05p37_142923_c1
4097 nmdc:mga05p37_1513676_c1
4098 nmdc:mga05p37_1594_c1
4099 nmdc:mga05p37_16719_c1
4100 nmdc:mga05p37_180101_c1
4101 nmdc:mga05p37_20284_c1
4102 nmdc:mga05p37_23331_c1
4103 nmdc:mga05p37_234115_c1
4104 nmdc:mga05p37_251554_c1
4105 nmdc:mga05p37_311105_c1
4106 nmdc:mga05p37_311393_c1
4107 nmdc:mga05p37_312432_c1
4108 nmdc:mga05p37_41791_c1
4109 nmdc:mga05p37_49764_c1
4110 nmdc:mga05p37_798158_c1
4111 nmdc:mga05p37_915060_c1
4112 nmdc:mga05p37_95613_c1
4113 nmdc:mga09592_116992_c1
4114 nmdc:mga09592_1600861_c1
4115 nmdc:mga09592_164082_c1
4116 nmdc:mga09592_1654440_c1
4117 nmdc:mga09592_344209_c1
4118 nmdc:mga09592_408004_c1
4119 nmdc:mga09592_50392_c1
4120 nmdc:mga09592_725034_c1
4121 nmdc:mga09592_823574_c1
4122 nmdc:mga09592_94175_c1
4123 nmdc:mga09592_952643_c1
4124 nmdc:mga0qj67_205251_c1
4125 nmdc:mga0qj67_363910_c1
4126 nmdc:mga0qj67_45395_c1
4127 nmdc:mga0qj67_789939_c1
4128 nmdc:mga0qj67_850976_c1
4129 nmdc:mga06r32_102411_c1
4130 nmdc:mga06r32_1337435_c1
4131 nmdc:mga06r32_143953_c1
4132 nmdc:mga06r32_20491_c1
4133 nmdc:mga06r32_53901_c1
4134 nmdc:mga06r32_558345_c1
4135 nmdc:mga06r32_718852_c1
4136 nmdc:mga08y16_1005311_c1
4137 nmdc:mga08y16_1020998_c1
4138 nmdc:mga08y16_1480043_c1
4139 nmdc:mga08y16_1740986_c1
4140 nmdc:mga08y16_28149_c1
4141 nmdc:mga08y16_349_c1
4142 nmdc:mga08y16_365948_c1
4143 nmdc:mga08y16_38371_c1
4144 nmdc:mga08y16_427316_c1
4145 nmdc:mga08y16_4417_c1
4146 nmdc:mga08y16_55349_c1
4147 nmdc:mga08y16_6726_c1
4148 nmdc:mga08y16_718120_c1
4149 nmdc:mga08y16_816436_c1
4150 nmdc:mga08y16_967731_c1
4151 nmdc:mga0n895_1217475_c1
4152 nmdc:mga0n895_13192_c1
4153 nmdc:mga0n895_1368851_c1
4154 nmdc:mga0n895_13752_c1
4155 nmdc:mga0n895_1429060_c1
4156 nmdc:mga0n895_146142_c1
4157 nmdc:mga0n895_148627_c1
4158 nmdc:mga0n895_17933_c1
4159 nmdc:mga0n895_182794_c1
4160 nmdc:mga0n895_193415_c1
4161 nmdc:mga0n895_203557_c1
4162 nmdc:mga0n895_2068153_c1
4163 nmdc:mga0n895_2142851_c1
4164 nmdc:mga0n895_49792_c1
4165 nmdc:mga0n895_502727_c1
4166 nmdc:mga0n895_61181_c1
4167 nmdc:mga0n895_611894_c1
4168 nmdc:mga0n895_77585_c1
4169 nmdc:mga0n895_7906_c1
4170 nmdc:mga0n895_854671_c1
4171 nmdc:mga0n895_892857_c1
4172 nmdc:mga0n895_952906_c1
4173 nmdc:mga0n895_98062_c1
4174 nmdc:mga0rr50_116480_c1
4175 nmdc:mga0rr50_136179_c1
4176 nmdc:mga0rr50_139327_c1
4177 nmdc:mga0rr50_1702203_c1
4178 nmdc:mga0rr50_1712792_c1
4179 nmdc:mga0rr50_177697_c1
4180 nmdc:mga0rr50_179124_c1
4181 nmdc:mga0rr50_342715_c1
4182 nmdc:mga0rr50_414_c1
4183 nmdc:mga0rr50_841396_c1
4184 nmdc:mga0rr50_860872_c1
4185 nmdc:mga0rr50_883594_c1
4186 nmdc:mga0rr50_9355_c1
4187 nmdc:mga08x19_11381_c1
4188 nmdc:mga08x19_120066_c1
4189 nmdc:mga08x19_204388_c1
4190 nmdc:mga08x19_228795_c1
4191 nmdc:mga08x19_51300_c1
4192 nmdc:mga08x19_639300_c1
4193 nmdc:mga08x19_762954_c1
4194 nmdc:mga0a205_120182_c1
4195 nmdc:mga0a205_1352021_c1
4196 nmdc:mga0a205_158500_c1
4197 nmdc:mga0a205_176082_c1
4198 nmdc:mga0a205_265938_c1
4199 nmdc:mga0a205_29340_c1
4200 nmdc:mga0a205_33180_c1
4201 nmdc:mga0a205_506590_c1
4202 nmdc:mga0a205_532212_c1
4203 nmdc:mga0a205_58127_c1
4204 nmdc:mga0a205_6492_c1
4205 nmdc:mga0a205_652025_c1
4206 nmdc:mga0a205_84748_c1
4207 Ga0495601_0048683
4208 Ga0495601_0361678
4209 Ga0495601_0636841
4210 Ga0495601_0788862
4211 Ga0495612_0204082
4212 Ga0495612_0402516
4213 Ga0495655_0054240
4214 Ga0495655_0096664
4215 Ga0495595_0150988
4216 Ga0495595_0251778
4217 Ga0495595_0458141
4218 Ga0495595_0682950
4219 Ga0495619_0001542
4220 Ga0495619_0195727
4221 Ga0495619_0271918
4222 Ga0495619_0333392
4223 Ga0495619_0466073
4224 Ga0495619_0757885
4225 Ga0501084_0019884
4226 Ga0501084_0078604
4227 Ga0501084_0108923
4228 Ga0501084_0388198
4229 Ga0501084_0730286
4230 Ga0590071_000382
4231 Ga0590071_000521
4232 Ga0590074_029475
4233 Ga0590075_002497
4234 Ga0590075_026192
4235 Ga0590077_000003
4236 Ga0590077_000431
4237 Ga0590077_042093
4238 Ga0501082_0148948
4239 Ga0501082_0197894
4240 Ga0501082_1413822
4241 Ga0466962_0534873
4242 Ga0530510_0001508
4243 Ga0530510_0002012
4244 Ga0530510_0089323
4245 Ga0530510_0437834
4246 Ga0530510_1593966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04384

Fe-S_assembly

Iron-sulphur cluster assembly

1

64

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.9902 1 62
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.9547 1 63
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.9038 1 62
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.9003 1 63
7qca-assembly1.cif.gz_SR0 spraguea lophii ribosome 0.5313 6 64
ID Description Score Start End Superfamily
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9902 1 62 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9547 1 63 1.10.10.600
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9038 1 62 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9003 1 63 1.10.10.600
af_O02254_189_310_1.20.80.10 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.5606 6 67 1.20.80.10
ID Description Score Start End GO Terms
AF-A0A1F2R3X3-F1-model_v4 Fe-S assembly protein IscX 1.01 1 67 GO:0005829
GO:0008198
GO:0016226
AF-A0A2V8FCK3-F1-model_v4 Fe-S assembly protein IscX 1.01 1 64 GO:0005829
GO:0008198
GO:0016226
AF-A0A2V6U3E9-F1-model_v4 Fe-S assembly protein IscX 1.004 1 65 GO:0005829
GO:0008198
GO:0016226
AF-A0A2V9YC42-F1-model_v4 Fe-S assembly protein IscX 1.004 1 65 GO:0005829
GO:0008198
GO:0016226
AF-A0A521KAZ6-F1-model_v4 Fe-S assembly protein IscX 1.001 1 63 GO:0005829
GO:0008198
GO:0016226

Map