F496436
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2123 | 431 | 4246 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0016435|Ga0451576_0016435_5512_5733 |
| Length | 73 |
| Sequence | VKWIDAEDIGIALSEKFPEIDPLTVRFTDLRERVLQLDEFDDDPKTSNEPKLEAIQMAWYEEWKENHRDSSDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 268 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 269 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 270 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 271 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 276 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 277 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 278 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 283 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 289 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 290 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 363 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 364 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 365 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 366 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 367 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 390 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 391 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 392 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 394 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 395 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 396 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 397 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 398 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 399 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 405 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 408 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 409 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 426 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 427 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 428 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 96.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0016435 | 3300045051 | Bacteria | 8169 |
| 2 | SwRhRL2b_contig_2148127 | 2162886007 | Bacteria | 1046 |
| 3 | JGI24744J21845_10081025 | 3300002077 | Bacteria | 593 |
| 4 | JGI25406J46586_10002033 | 3300003203 | Bacteria | 9551 |
| 5 | JGI25406J46586_10004955 | 3300003203 | Bacteria | 6185 |
| 6 | Ga0058859_11225154 | 3300004798 | Bacteria | 666 |
| 7 | Ga0058859_11833474 | 3300004798 | Unclassified | 1434 |
| 8 | Ga0058860_11509978 | 3300004801 | Unclassified | 505 |
| 9 | Ga0058860_12001900 | 3300004801 | Unclassified | 705 |
| 10 | Ga0058860_12034974 | 3300004801 | Unclassified | 756 |
| 11 | Ga0058860_12173101 | 3300004801 | Unclassified | 753 |
| 12 | Ga0058862_12398501 | 3300004803 | Bacteria | 1161 |
| 13 | Ga0065714_10095225 | 3300005288 | Bacteria | 1792 |
| 14 | Ga0065714_10333917 | 3300005288 | Unclassified | 654 |
| 15 | Ga0065704_10135640 | 3300005289 | Bacteria | 1575 |
| 16 | Ga0065704_10730815 | 3300005289 | Unclassified | 549 |
| 17 | Ga0065712_10002663 | 3300005290 | Bacteria | 5248 |
| 18 | Ga0065712_10017476 | 3300005290 | Bacteria | 5332 |
| 19 | Ga0065712_10162898 | 3300005290 | Bacteria | 1290 |
| 20 | Ga0065712_10184946 | 3300005290 | Unclassified | 1174 |
| 21 | Ga0065712_10315517 | 3300005290 | Bacteria | 830 |
| 22 | Ga0065712_10566396 | 3300005290 | Bacteria | 609 |
| 23 | Ga0065715_10023281 | 3300005293 | Bacteria | 2316 |
| 24 | Ga0065715_10069454 | 3300005293 | Unclassified | 778 |
| 25 | Ga0065715_10095276 | 3300005293 | Bacteria | 4121 |
| 26 | Ga0065715_10106779 | 3300005293 | Bacteria | 2809 |
| 27 | Ga0065715_10114455 | 3300005293 | Bacteria | 2438 |
| 28 | Ga0065715_10132989 | 3300005293 | Bacteria | 1975 |
| 29 | Ga0065715_10194207 | 3300005293 | Unclassified | 1394 |
| 30 | Ga0065715_10308400 | 3300005293 | Bacteria | 1026 |
| 31 | Ga0065715_10328266 | 3300005293 | Unclassified | 989 |
| 32 | Ga0065715_10527144 | 3300005293 | Unclassified | 759 |
| 33 | Ga0065715_10666723 | 3300005293 | Bacteria | 670 |
| 34 | Ga0065715_10800108 | 3300005293 | Unclassified | 610 |
| 35 | Ga0065715_10871502 | 3300005293 | Bacteria | 573 |
| 36 | Ga0065707_10002879 | 3300005295 | Bacteria | 9391 |
| 37 | Ga0065707_10023547 | 3300005295 | Bacteria | 1747 |
| 38 | Ga0065707_10026073 | 3300005295 | Unclassified | 1173 |
| 39 | Ga0065707_10100675 | 3300005295 | Bacteria | 2912 |
| 40 | Ga0065707_10132350 | 3300005295 | Bacteria | 1898 |
| 41 | Ga0065707_10194363 | 3300005295 | Unclassified | 1343 |
| 42 | Ga0065707_10226146 | 3300005295 | Bacteria | 1206 |
| 43 | Ga0065707_10227450 | 3300005295 | Bacteria | 1164 |
| 44 | Ga0065707_10511618 | 3300005295 | Bacteria | 749 |
| 45 | Ga0065707_11156542 | 3300005295 | Unclassified | 503 |
| 46 | Ga0070658_10127997 | 3300005327 | Bacteria | 2115 |
| 47 | Ga0070676_10024441 | 3300005328 | Bacteria | 3403 |
| 48 | Ga0070676_10074653 | 3300005328 | Bacteria | 2043 |
| 49 | Ga0070676_10122409 | 3300005328 | Bacteria | 1635 |
| 50 | Ga0070676_10245857 | 3300005328 | Bacteria | 1192 |
| 51 | Ga0070676_10390668 | 3300005328 | Unclassified | 966 |
| 52 | Ga0070676_10560524 | 3300005328 | Bacteria | 819 |
| 53 | Ga0070676_10756453 | 3300005328 | Unclassified | 714 |
| 54 | Ga0070683_100005622 | 3300005329 | Bacteria | 10477 |
| 55 | Ga0070683_100327732 | 3300005329 | Bacteria | 1458 |
| 56 | Ga0070683_100700519 | 3300005329 | Bacteria | 970 |
| 57 | Ga0070683_101587079 | 3300005329 | Unclassified | 629 |
| 58 | Ga0070683_102359480 | 3300005329 | Bacteria | 510 |
| 59 | Ga0070690_100010440 | 3300005330 | Bacteria | 5406 |
| 60 | Ga0070690_100013784 | 3300005330 | Bacteria | 4788 |
| 61 | Ga0070690_100067794 | 3300005330 | Bacteria | 2313 |
| 62 | Ga0070690_100238345 | 3300005330 | Bacteria | 1282 |
| 63 | Ga0070690_100470749 | 3300005330 | Bacteria | 935 |
| 64 | Ga0070690_100521804 | 3300005330 | Unclassified | 892 |
| 65 | Ga0070690_100537069 | 3300005330 | Unclassified | 880 |
| 66 | Ga0070690_100737070 | 3300005330 | Unclassified | 760 |
| 67 | Ga0070690_101648002 | 3300005330 | Bacteria | 521 |
| 68 | Ga0070670_100007350 | 3300005331 | Bacteria | 9350 |
| 69 | Ga0070670_100019871 | 3300005331 | Bacteria | 5767 |
| 70 | Ga0070670_100046970 | 3300005331 | Bacteria | 3715 |
| 71 | Ga0070670_100047679 | 3300005331 | Bacteria | 3686 |
| 72 | Ga0070670_100233445 | 3300005331 | Bacteria | 1601 |
| 73 | Ga0070670_100261849 | 3300005331 | Bacteria | 1508 |
| 74 | Ga0070670_100303374 | 3300005331 | Bacteria | 1397 |
| 75 | Ga0070670_100392641 | 3300005331 | Unclassified | 1224 |
| 76 | Ga0070670_101027695 | 3300005331 | Bacteria | 750 |
| 77 | Ga0070670_102243699 | 3300005331 | Unclassified | 503 |
| 78 | Ga0070677_10048799 | 3300005333 | Unclassified | 1703 |
| 79 | Ga0070677_10099213 | 3300005333 | Bacteria | 1281 |
| 80 | Ga0070677_10297371 | 3300005333 | Bacteria | 819 |
| 81 | Ga0070677_10460740 | 3300005333 | Unclassified | 682 |
| 82 | Ga0070677_10505284 | 3300005333 | Unclassified | 656 |
| 83 | Ga0068869_100009775 | 3300005334 | Bacteria | 6228 |
| 84 | Ga0068869_100108607 | 3300005334 | Bacteria | 2108 |
| 85 | Ga0068869_100374281 | 3300005334 | Unclassified | 1166 |
| 86 | Ga0068869_100398332 | 3300005334 | Bacteria | 1132 |
| 87 | Ga0068869_100615339 | 3300005334 | Unclassified | 919 |
| 88 | Ga0068869_100650616 | 3300005334 | Bacteria | 895 |
| 89 | Ga0068869_100661596 | 3300005334 | Bacteria | 888 |
| 90 | Ga0068869_100703930 | 3300005334 | Unclassified | 862 |
| 91 | Ga0068869_101095695 | 3300005334 | Bacteria | 697 |
| 92 | Ga0068869_101313923 | 3300005334 | Unclassified | 638 |
| 93 | Ga0068869_101659123 | 3300005334 | Bacteria | 570 |
| 94 | Ga0068869_101664703 | 3300005334 | Bacteria | 569 |
| 95 | Ga0070666_10039561 | 3300005335 | Bacteria | 3144 |
| 96 | Ga0070666_10120025 | 3300005335 | Bacteria | 1823 |
| 97 | Ga0070666_10307932 | 3300005335 | Unclassified | 1129 |
| 98 | Ga0070666_10310976 | 3300005335 | Bacteria | 1123 |
| 99 | Ga0070666_10370755 | 3300005335 | Bacteria | 1027 |
| 100 | Ga0070666_11107206 | 3300005335 | Unclassified | 589 |
| 101 | Ga0070666_11205262 | 3300005335 | Bacteria | 564 |
| 102 | Ga0070666_11484800 | 3300005335 | Unclassified | 507 |
| 103 | Ga0070680_100412459 | 3300005336 | Unclassified | 1152 |
| 104 | Ga0070680_100497460 | 3300005336 | Unclassified | 1043 |
| 105 | Ga0070680_100844237 | 3300005336 | Bacteria | 790 |
| 106 | Ga0070680_100934098 | 3300005336 | Bacteria | 749 |
| 107 | Ga0070680_101275735 | 3300005336 | Unclassified | 636 |
| 108 | Ga0070680_101480742 | 3300005336 | Unclassified | 588 |
| 109 | Ga0070680_101506034 | 3300005336 | Bacteria | 583 |
| 110 | Ga0070682_100453073 | 3300005337 | Unclassified | 983 |
| 111 | Ga0070682_101171712 | 3300005337 | Unclassified | 647 |
| 112 | Ga0068868_100076339 | 3300005338 | Bacteria | 2679 |
| 113 | Ga0068868_100211519 | 3300005338 | Bacteria | 1621 |
| 114 | Ga0068868_100462053 | 3300005338 | Bacteria | 1106 |
| 115 | Ga0068868_100488255 | 3300005338 | Bacteria | 1077 |
| 116 | Ga0068868_100884178 | 3300005338 | Bacteria | 811 |
| 117 | Ga0068868_101838642 | 3300005338 | Unclassified | 573 |
| 118 | Ga0070660_100161973 | 3300005339 | Bacteria | 1803 |
| 119 | Ga0070660_100933514 | 3300005339 | Unclassified | 732 |
| 120 | Ga0070660_101089696 | 3300005339 | Unclassified | 676 |
| 121 | Ga0070660_101108555 | 3300005339 | Unclassified | 670 |
| 122 | Ga0070660_101369563 | 3300005339 | Bacteria | 601 |
| 123 | Ga0070689_100005041 | 3300005340 | Bacteria | 8977 |
| 124 | Ga0070689_100011742 | 3300005340 | Bacteria | 6283 |
| 125 | Ga0070689_100051462 | 3300005340 | Bacteria | 3184 |
| 126 | Ga0070689_100060714 | 3300005340 | Bacteria | 2940 |
| 127 | Ga0070689_100137374 | 3300005340 | Bacteria | 1964 |
| 128 | Ga0070689_100292431 | 3300005340 | Unclassified | 1354 |
| 129 | Ga0070689_100306504 | 3300005340 | Bacteria | 1323 |
| 130 | Ga0070689_100395869 | 3300005340 | Bacteria | 1167 |
| 131 | Ga0070689_100582969 | 3300005340 | Bacteria | 967 |
| 132 | Ga0070689_100735187 | 3300005340 | Unclassified | 864 |
| 133 | Ga0070689_101219738 | 3300005340 | Unclassified | 676 |
| 134 | Ga0070689_101329399 | 3300005340 | Bacteria | 648 |
| 135 | Ga0070691_10188218 | 3300005341 | Unclassified | 1078 |
| 136 | Ga0070687_100002090 | 3300005343 | Bacteria | 7356 |
| 137 | Ga0070687_100950177 | 3300005343 | Unclassified | 620 |
| 138 | Ga0070687_100977576 | 3300005343 | Bacteria | 612 |
| 139 | Ga0070687_101269788 | 3300005343 | Bacteria | 546 |
| 140 | Ga0070661_100217276 | 3300005344 | Bacteria | 1465 |
| 141 | Ga0070661_100241856 | 3300005344 | Bacteria | 1390 |
| 142 | Ga0070661_100266999 | 3300005344 | Bacteria | 1324 |
| 143 | Ga0070661_100891090 | 3300005344 | Bacteria | 734 |
| 144 | Ga0070661_101493268 | 3300005344 | Unclassified | 570 |
| 145 | Ga0070692_10189569 | 3300005345 | Bacteria | 1197 |
| 146 | Ga0070692_10200794 | 3300005345 | Unclassified | 1168 |
| 147 | Ga0070692_10277022 | 3300005345 | Bacteria | 1015 |
| 148 | Ga0070692_11212981 | 3300005345 | Unclassified | 538 |
| 149 | Ga0070668_100067062 | 3300005347 | Bacteria | 2786 |
| 150 | Ga0070668_100196670 | 3300005347 | Bacteria | 1654 |
| 151 | Ga0070668_100224774 | 3300005347 | Unclassified | 1550 |
| 152 | Ga0070668_100676367 | 3300005347 | Unclassified | 909 |
| 153 | Ga0070668_100982748 | 3300005347 | Bacteria | 758 |
| 154 | Ga0070669_100005475 | 3300005353 | Bacteria | 9166 |
| 155 | Ga0070669_100015084 | 3300005353 | Bacteria | 5506 |
| 156 | Ga0070669_100037760 | 3300005353 | Bacteria | 3504 |
| 157 | Ga0070669_100061952 | 3300005353 | Bacteria | 2750 |
| 158 | Ga0070669_100072047 | 3300005353 | Bacteria | 2557 |
| 159 | Ga0070669_100106080 | 3300005353 | Bacteria | 2126 |
| 160 | Ga0070669_100126660 | 3300005353 | Unclassified | 1955 |
| 161 | Ga0070669_100230765 | 3300005353 | Unclassified | 1467 |
| 162 | Ga0070669_100660566 | 3300005353 | Bacteria | 880 |
| 163 | Ga0070669_101064389 | 3300005353 | Bacteria | 696 |
| 164 | Ga0070669_101292227 | 3300005353 | Unclassified | 632 |
| 165 | Ga0070669_101570221 | 3300005353 | Bacteria | 573 |
| 166 | Ga0070675_100000785 | 3300005354 | Bacteria | 22225 |
| 167 | Ga0070675_100006317 | 3300005354 | Bacteria | 9097 |
| 168 | Ga0070675_100015402 | 3300005354 | Bacteria | 6044 |
| 169 | Ga0070675_100021027 | 3300005354 | Bacteria | 5211 |
| 170 | Ga0070675_100023859 | 3300005354 | Unclassified | 4896 |
| 171 | Ga0070675_100031702 | 3300005354 | Bacteria | 4274 |
| 172 | Ga0070675_100035816 | 3300005354 | Bacteria | 4036 |
| 173 | Ga0070675_100054006 | 3300005354 | Bacteria | 3305 |
| 174 | Ga0070675_100121191 | 3300005354 | Bacteria | 2222 |
| 175 | Ga0070675_100171061 | 3300005354 | Bacteria | 1873 |
| 176 | Ga0070675_100183149 | 3300005354 | Bacteria | 1812 |
| 177 | Ga0070675_100303961 | 3300005354 | Bacteria | 1406 |
| 178 | Ga0070675_100369004 | 3300005354 | Bacteria | 1276 |
| 179 | Ga0070675_100525810 | 3300005354 | Unclassified | 1068 |
| 180 | Ga0070675_100660338 | 3300005354 | Bacteria | 951 |
| 181 | Ga0070675_102200369 | 3300005354 | Unclassified | 508 |
| 182 | Ga0070671_100008522 | 3300005355 | Bacteria | 8218 |
| 183 | Ga0070671_100520940 | 3300005355 | Unclassified | 1024 |
| 184 | Ga0070671_100580359 | 3300005355 | Bacteria | 968 |
| 185 | Ga0070671_100917087 | 3300005355 | Unclassified | 766 |
| 186 | Ga0070671_101167641 | 3300005355 | Bacteria | 677 |
| 187 | Ga0070671_101682484 | 3300005355 | Bacteria | 563 |
| 188 | Ga0070674_100005809 | 3300005356 | Bacteria | 7166 |
| 189 | Ga0070674_100105712 | 3300005356 | Bacteria | 2059 |
| 190 | Ga0070674_100213240 | 3300005356 | Bacteria | 1498 |
| 191 | Ga0070674_100567705 | 3300005356 | Unclassified | 954 |
| 192 | Ga0070674_100892454 | 3300005356 | Unclassified | 774 |
| 193 | Ga0070674_100982888 | 3300005356 | Unclassified | 740 |
| 194 | Ga0070674_101008626 | 3300005356 | Unclassified | 731 |
| 195 | Ga0070674_101164679 | 3300005356 | Unclassified | 683 |
| 196 | Ga0070674_101226774 | 3300005356 | Bacteria | 667 |
| 197 | Ga0070674_101241425 | 3300005356 | Unclassified | 663 |
| 198 | Ga0070673_100006588 | 3300005364 | Bacteria | 7559 |
| 199 | Ga0070673_100008523 | 3300005364 | Bacteria | 6820 |
| 200 | Ga0070673_100047974 | 3300005364 | Bacteria | 3327 |
| 201 | Ga0070673_100188801 | 3300005364 | Bacteria | 1769 |
| 202 | Ga0070673_100198379 | 3300005364 | Bacteria | 1727 |
| 203 | Ga0070673_100276701 | 3300005364 | Bacteria | 1471 |
| 204 | Ga0070673_100283888 | 3300005364 | Bacteria | 1453 |
| 205 | Ga0070673_100297696 | 3300005364 | Unclassified | 1419 |
| 206 | Ga0070673_100312330 | 3300005364 | Unclassified | 1387 |
| 207 | Ga0070673_100460942 | 3300005364 | Bacteria | 1144 |
| 208 | Ga0070673_100522757 | 3300005364 | Bacteria | 1075 |
| 209 | Ga0070673_100564622 | 3300005364 | Bacteria | 1035 |
| 210 | Ga0070673_101282237 | 3300005364 | Unclassified | 688 |
| 211 | Ga0070688_100008455 | 3300005365 | Bacteria | 5586 |
| 212 | Ga0070688_100049444 | 3300005365 | Bacteria | 2616 |
| 213 | Ga0070688_100070345 | 3300005365 | Unclassified | 2237 |
| 214 | Ga0070688_100124710 | 3300005365 | Bacteria | 1730 |
| 215 | Ga0070688_100178884 | 3300005365 | Bacteria | 1470 |
| 216 | Ga0070688_100186682 | 3300005365 | Bacteria | 1441 |
| 217 | Ga0070688_100279442 | 3300005365 | Bacteria | 1199 |
| 218 | Ga0070688_100449028 | 3300005365 | Bacteria | 963 |
| 219 | Ga0070688_100609102 | 3300005365 | Bacteria | 837 |
| 220 | Ga0070688_101726580 | 3300005365 | Bacteria | 513 |
| 221 | Ga0070659_100125835 | 3300005366 | Bacteria | 2079 |
| 222 | Ga0070659_100171502 | 3300005366 | Bacteria | 1777 |
| 223 | Ga0070659_100240569 | 3300005366 | Bacteria | 1498 |
| 224 | Ga0070659_100337585 | 3300005366 | Bacteria | 1262 |
| 225 | Ga0070659_100344197 | 3300005366 | Unclassified | 1250 |
| 226 | Ga0070659_101111214 | 3300005366 | Bacteria | 697 |
| 227 | Ga0070667_100028378 | 3300005367 | Bacteria | 4659 |
| 228 | Ga0070667_100094543 | 3300005367 | Bacteria | 2576 |
| 229 | Ga0070667_100240308 | 3300005367 | Unclassified | 1617 |
| 230 | Ga0070667_100405796 | 3300005367 | Bacteria | 1241 |
| 231 | Ga0070667_100416480 | 3300005367 | Unclassified | 1224 |
| 232 | Ga0070667_101767131 | 3300005367 | Unclassified | 582 |
| 233 | Ga0070703_10233017 | 3300005406 | Unclassified | 739 |
| 234 | Ga0070703_10572211 | 3300005406 | Bacteria | 518 |
| 235 | Ga0070709_10014162 | 3300005434 | Bacteria | 4505 |
| 236 | Ga0070709_10518276 | 3300005434 | Bacteria | 908 |
| 237 | Ga0070709_10621115 | 3300005434 | Bacteria | 834 |
| 238 | Ga0070714_101191261 | 3300005435 | Bacteria | 743 |
| 239 | Ga0070713_100343648 | 3300005436 | Unclassified | 1383 |
| 240 | Ga0070713_100386806 | 3300005436 | Bacteria | 1304 |
| 241 | Ga0070710_10374637 | 3300005437 | Bacteria | 948 |
| 242 | Ga0070701_10007649 | 3300005438 | Bacteria | 4632 |
| 243 | Ga0070701_10015376 | 3300005438 | Bacteria | 3533 |
| 244 | Ga0070701_10623043 | 3300005438 | Unclassified | 717 |
| 245 | Ga0070701_10879432 | 3300005438 | Unclassified | 617 |
| 246 | Ga0070701_11181992 | 3300005438 | Bacteria | 542 |
| 247 | Ga0070701_11197008 | 3300005438 | Bacteria | 539 |
| 248 | Ga0070711_100414982 | 3300005439 | Unclassified | 1096 |
| 249 | Ga0070711_100500955 | 3300005439 | Unclassified | 1001 |
| 250 | Ga0070711_100851390 | 3300005439 | Unclassified | 776 |
| 251 | Ga0070705_100001204 | 3300005440 | Bacteria | 14089 |
| 252 | Ga0070705_100019732 | 3300005440 | Bacteria | 3552 |
| 253 | Ga0070705_100160764 | 3300005440 | Bacteria | 1501 |
| 254 | Ga0070705_100174191 | 3300005440 | Bacteria | 1451 |
| 255 | Ga0070705_100234459 | 3300005440 | Unclassified | 1279 |
| 256 | Ga0070705_100544153 | 3300005440 | Bacteria | 889 |
| 257 | Ga0070705_101063937 | 3300005440 | Bacteria | 660 |
| 258 | Ga0070700_100093816 | 3300005441 | Unclassified | 1964 |
| 259 | Ga0070700_100232156 | 3300005441 | Bacteria | 1314 |
| 260 | Ga0070700_100247876 | 3300005441 | Bacteria | 1276 |
| 261 | Ga0070700_100251928 | 3300005441 | Unclassified | 1267 |
| 262 | Ga0070700_100457418 | 3300005441 | Unclassified | 972 |
| 263 | Ga0070700_100496670 | 3300005441 | Bacteria | 938 |
| 264 | Ga0070700_101092355 | 3300005441 | Unclassified | 661 |
| 265 | Ga0070694_100000199 | 3300005444 | Bacteria | 31924 |
| 266 | Ga0070694_100039897 | 3300005444 | Bacteria | 3127 |
| 267 | Ga0070694_100047092 | 3300005444 | Bacteria | 2896 |
| 268 | Ga0070694_100135188 | 3300005444 | Unclassified | 1786 |
| 269 | Ga0070694_100203569 | 3300005444 | Unclassified | 1477 |
| 270 | Ga0070694_100249946 | 3300005444 | Unclassified | 1341 |
| 271 | Ga0070694_100261021 | 3300005444 | Bacteria | 1314 |
| 272 | Ga0070694_100291505 | 3300005444 | Bacteria | 1247 |
| 273 | Ga0070694_100487636 | 3300005444 | Bacteria | 979 |
| 274 | Ga0070694_100507138 | 3300005444 | Bacteria | 961 |
| 275 | Ga0070694_100588536 | 3300005444 | Unclassified | 895 |
| 276 | Ga0070694_101138592 | 3300005444 | Unclassified | 652 |
| 277 | Ga0070694_101411918 | 3300005444 | Bacteria | 588 |
| 278 | Ga0070694_101778476 | 3300005444 | Bacteria | 525 |
| 279 | Ga0070708_100015924 | 3300005445 | Bacteria | 6223 |
| 280 | Ga0070708_100073351 | 3300005445 | Bacteria | 3085 |
| 281 | Ga0070708_100650688 | 3300005445 | Unclassified | 993 |
| 282 | Ga0070708_101067006 | 3300005445 | Unclassified | 757 |
| 283 | Ga0070708_101363565 | 3300005445 | Bacteria | 662 |
| 284 | Ga0070708_101676736 | 3300005445 | Bacteria | 591 |
| 285 | Ga0070663_100018690 | 3300005455 | Bacteria | 4550 |
| 286 | Ga0070663_100348019 | 3300005455 | Unclassified | 1199 |
| 287 | Ga0070663_100724833 | 3300005455 | Bacteria | 847 |
| 288 | Ga0070663_101890450 | 3300005455 | Bacteria | 536 |
| 289 | Ga0070678_100007601 | 3300005456 | Bacteria | 6438 |
| 290 | Ga0070678_100028082 | 3300005456 | Bacteria | 3831 |
| 291 | Ga0070678_100073186 | 3300005456 | Bacteria | 2571 |
| 292 | Ga0070678_100167410 | 3300005456 | Bacteria | 1786 |
| 293 | Ga0070678_100246278 | 3300005456 | Bacteria | 1497 |
| 294 | Ga0070678_100411585 | 3300005456 | Unclassified | 1177 |
| 295 | Ga0070678_101356710 | 3300005456 | Bacteria | 663 |
| 296 | Ga0070678_101477490 | 3300005456 | Bacteria | 636 |
| 297 | Ga0070662_100051755 | 3300005457 | Bacteria | 2967 |
| 298 | Ga0070662_100169063 | 3300005457 | Unclassified | 1716 |
| 299 | Ga0070662_100190740 | 3300005457 | Bacteria | 1621 |
| 300 | Ga0070681_10014967 | 3300005458 | Bacteria | 7713 |
| 301 | Ga0070681_10032641 | 3300005458 | Bacteria | 5226 |
| 302 | Ga0070681_10086022 | 3300005458 | Bacteria | 3097 |
| 303 | Ga0070681_10357396 | 3300005458 | Bacteria | 1371 |
| 304 | Ga0068867_100001191 | 3300005459 | Bacteria | 17832 |
| 305 | Ga0068867_100002272 | 3300005459 | Bacteria | 13511 |
| 306 | Ga0068867_100013275 | 3300005459 | Bacteria | 5835 |
| 307 | Ga0068867_100158218 | 3300005459 | Bacteria | 1785 |
| 308 | Ga0068867_100478326 | 3300005459 | Unclassified | 1067 |
| 309 | Ga0068867_100714667 | 3300005459 | Bacteria | 885 |
| 310 | Ga0068867_100773825 | 3300005459 | Unclassified | 854 |
| 311 | Ga0068867_100878481 | 3300005459 | Bacteria | 805 |
| 312 | Ga0068867_100928827 | 3300005459 | Unclassified | 785 |
| 313 | Ga0070685_10018710 | 3300005466 | Bacteria | 3729 |
| 314 | Ga0070685_10262479 | 3300005466 | Bacteria | 1149 |
| 315 | Ga0070685_10410375 | 3300005466 | Bacteria | 940 |
| 316 | Ga0070685_10575439 | 3300005466 | Bacteria | 807 |
| 317 | Ga0070685_11313699 | 3300005466 | Unclassified | 553 |
| 318 | Ga0070685_11393870 | 3300005466 | Bacteria | 538 |
| 319 | Ga0070685_11608758 | 3300005466 | Bacteria | 503 |
| 320 | Ga0070706_100124050 | 3300005467 | Bacteria | 2408 |
| 321 | Ga0070706_100221094 | 3300005467 | Bacteria | 1768 |
| 322 | Ga0070706_100769239 | 3300005467 | Unclassified | 892 |
| 323 | Ga0070706_101336329 | 3300005467 | Bacteria | 657 |
| 324 | Ga0070706_101437599 | 3300005467 | Unclassified | 631 |
| 325 | Ga0070706_101823435 | 3300005467 | Unclassified | 553 |
| 326 | Ga0070706_101903111 | 3300005467 | Bacteria | 540 |
| 327 | Ga0070706_101928880 | 3300005467 | Unclassified | 536 |
| 328 | Ga0070707_100062625 | 3300005468 | Bacteria | 3569 |
| 329 | Ga0070707_100084624 | 3300005468 | Bacteria | 3064 |
| 330 | Ga0070707_100092228 | 3300005468 | Bacteria | 2933 |
| 331 | Ga0070707_100290025 | 3300005468 | Bacteria | 1590 |
| 332 | Ga0070707_100412000 | 3300005468 | Bacteria | 1312 |
| 333 | Ga0070707_100667742 | 3300005468 | Bacteria | 1002 |
| 334 | Ga0070707_101340903 | 3300005468 | Bacteria | 682 |
| 335 | Ga0070698_100002764 | 3300005471 | Bacteria | 19294 |
| 336 | Ga0070698_100004315 | 3300005471 | Bacteria | 15640 |
| 337 | Ga0070698_100024808 | 3300005471 | Bacteria | 6252 |
| 338 | Ga0070698_100086145 | 3300005471 | Bacteria | 3127 |
| 339 | Ga0070698_100283194 | 3300005471 | Bacteria | 1589 |
| 340 | Ga0070698_100572861 | 3300005471 | Unclassified | 1069 |
| 341 | Ga0070698_100677907 | 3300005471 | Bacteria | 972 |
| 342 | Ga0070698_100693759 | 3300005471 | Bacteria | 960 |
| 343 | Ga0070698_101075174 | 3300005471 | Bacteria | 753 |
| 344 | Ga0070698_101164071 | 3300005471 | Bacteria | 720 |
| 345 | Ga0070698_101860901 | 3300005471 | Bacteria | 555 |
| 346 | Ga0070699_100000172 | 3300005518 | Bacteria | 62043 |
| 347 | Ga0070699_100008183 | 3300005518 | Bacteria | 9073 |
| 348 | Ga0070699_100045608 | 3300005518 | Bacteria | 3794 |
| 349 | Ga0070699_100065455 | 3300005518 | Bacteria | 3155 |
| 350 | Ga0070699_100161479 | 3300005518 | Bacteria | 1983 |
| 351 | Ga0070699_100186084 | 3300005518 | Unclassified | 1844 |
| 352 | Ga0070699_100212512 | 3300005518 | Bacteria | 1722 |
| 353 | Ga0070699_100837213 | 3300005518 | Unclassified | 842 |
| 354 | Ga0070699_101003010 | 3300005518 | Bacteria | 766 |
| 355 | Ga0070699_101750862 | 3300005518 | Bacteria | 569 |
| 356 | Ga0070699_101847079 | 3300005518 | Unclassified | 553 |
| 357 | Ga0070679_100305411 | 3300005530 | Bacteria | 1541 |
| 358 | Ga0070679_100332442 | 3300005530 | Bacteria | 1468 |
| 359 | Ga0070679_100611524 | 3300005530 | Bacteria | 1033 |
| 360 | Ga0070679_100694605 | 3300005530 | Bacteria | 960 |
| 361 | Ga0070684_100042447 | 3300005535 | Bacteria | 3926 |
| 362 | Ga0070684_100196125 | 3300005535 | Bacteria | 1839 |
| 363 | Ga0070684_100654684 | 3300005535 | Bacteria | 978 |
| 364 | Ga0070684_100840404 | 3300005535 | Unclassified | 859 |
| 365 | Ga0070684_101515821 | 3300005535 | Bacteria | 632 |
| 366 | Ga0070684_101872147 | 3300005535 | Bacteria | 566 |
| 367 | Ga0070684_102328242 | 3300005535 | Unclassified | 505 |
| 368 | Ga0070697_100099767 | 3300005536 | Bacteria | 2411 |
| 369 | Ga0070697_100130792 | 3300005536 | Unclassified | 2105 |
| 370 | Ga0070697_100263238 | 3300005536 | Bacteria | 1477 |
| 371 | Ga0070697_100807893 | 3300005536 | Bacteria | 830 |
| 372 | Ga0070697_100830402 | 3300005536 | Bacteria | 818 |
| 373 | Ga0070697_101035517 | 3300005536 | Bacteria | 730 |
| 374 | Ga0070697_101288278 | 3300005536 | Bacteria | 652 |
| 375 | Ga0070697_101636146 | 3300005536 | Unclassified | 576 |
| 376 | Ga0070697_101703915 | 3300005536 | Unclassified | 564 |
| 377 | Ga0068853_101468135 | 3300005539 | Bacteria | 660 |
| 378 | Ga0068853_101601435 | 3300005539 | Bacteria | 631 |
| 379 | Ga0070672_100031975 | 3300005543 | Bacteria | 3967 |
| 380 | Ga0070672_100058398 | 3300005543 | Bacteria | 3032 |
| 381 | Ga0070672_100060185 | 3300005543 | Bacteria | 2990 |
| 382 | Ga0070672_100074122 | 3300005543 | Bacteria | 2715 |
| 383 | Ga0070672_100091256 | 3300005543 | Bacteria | 2458 |
| 384 | Ga0070672_100099686 | 3300005543 | Unclassified | 2355 |
| 385 | Ga0070672_100160706 | 3300005543 | Bacteria | 1864 |
| 386 | Ga0070672_100326655 | 3300005543 | Bacteria | 1305 |
| 387 | Ga0070672_100502436 | 3300005543 | Unclassified | 1049 |
| 388 | Ga0070672_100624721 | 3300005543 | Bacteria | 940 |
| 389 | Ga0070672_100891067 | 3300005543 | Bacteria | 786 |
| 390 | Ga0070672_101056918 | 3300005543 | Unclassified | 721 |
| 391 | Ga0070672_101078543 | 3300005543 | Unclassified | 713 |
| 392 | Ga0070672_101113648 | 3300005543 | Bacteria | 702 |
| 393 | Ga0070672_101267608 | 3300005543 | Bacteria | 657 |
| 394 | Ga0070672_101504822 | 3300005543 | Bacteria | 603 |
| 395 | Ga0070686_100007548 | 3300005544 | Bacteria | 6072 |
| 396 | Ga0070686_100012930 | 3300005544 | Bacteria | 4766 |
| 397 | Ga0070686_100058396 | 3300005544 | Bacteria | 2482 |
| 398 | Ga0070686_100151436 | 3300005544 | Unclassified | 1625 |
| 399 | Ga0070686_100199369 | 3300005544 | Unclassified | 1434 |
| 400 | Ga0070686_100350660 | 3300005544 | Bacteria | 1109 |
| 401 | Ga0070686_100490959 | 3300005544 | Unclassified | 951 |
| 402 | Ga0070695_100000002 | 3300005545 | Bacteria | 128335 |
| 403 | Ga0070695_100001675 | 3300005545 | Bacteria | 12485 |
| 404 | Ga0070695_100015542 | 3300005545 | Bacteria | 4597 |
| 405 | Ga0070695_100043868 | 3300005545 | Bacteria | 2845 |
| 406 | Ga0070695_100073857 | 3300005545 | Bacteria | 2239 |
| 407 | Ga0070695_100258091 | 3300005545 | Bacteria | 1271 |
| 408 | Ga0070695_100423483 | 3300005545 | Bacteria | 1014 |
| 409 | Ga0070695_100457569 | 3300005545 | Unclassified | 979 |
| 410 | Ga0070695_100671628 | 3300005545 | Unclassified | 820 |
| 411 | Ga0070695_100753567 | 3300005545 | Unclassified | 777 |
| 412 | Ga0070695_101209342 | 3300005545 | Unclassified | 622 |
| 413 | Ga0070696_100018496 | 3300005546 | Bacteria | 4709 |
| 414 | Ga0070696_100025383 | 3300005546 | Bacteria | 4029 |
| 415 | Ga0070696_100098274 | 3300005546 | Bacteria | 2094 |
| 416 | Ga0070696_100102001 | 3300005546 | Bacteria | 2057 |
| 417 | Ga0070696_100188051 | 3300005546 | Bacteria | 1536 |
| 418 | Ga0070696_100511151 | 3300005546 | Bacteria | 957 |
| 419 | Ga0070696_100580023 | 3300005546 | Unclassified | 902 |
| 420 | Ga0070696_100850970 | 3300005546 | Bacteria | 754 |
| 421 | Ga0070696_100898535 | 3300005546 | Unclassified | 735 |
| 422 | Ga0070696_101101178 | 3300005546 | Bacteria | 668 |
| 423 | Ga0070693_100146440 | 3300005547 | Bacteria | 1492 |
| 424 | Ga0070693_100169120 | 3300005547 | Unclassified | 1398 |
| 425 | Ga0070693_100212516 | 3300005547 | Bacteria | 1263 |
| 426 | Ga0070693_100848024 | 3300005547 | Bacteria | 681 |
| 427 | Ga0070693_100995942 | 3300005547 | Bacteria | 634 |
| 428 | Ga0070693_101527429 | 3300005547 | Bacteria | 522 |
| 429 | Ga0070665_100002623 | 3300005548 | Bacteria | 19608 |
| 430 | Ga0070665_100028738 | 3300005548 | Bacteria | 5598 |
| 431 | Ga0070665_100091624 | 3300005548 | Bacteria | 3044 |
| 432 | Ga0070665_100601071 | 3300005548 | Bacteria | 1113 |
| 433 | Ga0070665_102195848 | 3300005548 | Bacteria | 556 |
| 434 | Ga0070665_102255672 | 3300005548 | Bacteria | 548 |
| 435 | Ga0070704_100000468 | 3300005549 | Bacteria | 19028 |
| 436 | Ga0070704_100002643 | 3300005549 | Bacteria | 10113 |
| 437 | Ga0070704_100007220 | 3300005549 | Bacteria | 6606 |
| 438 | Ga0070704_100022196 | 3300005549 | Bacteria | 4127 |
| 439 | Ga0070704_100073177 | 3300005549 | Bacteria | 2496 |
| 440 | Ga0070704_100192897 | 3300005549 | Bacteria | 1639 |
| 441 | Ga0070704_100296312 | 3300005549 | Bacteria | 1346 |
| 442 | Ga0070704_100665164 | 3300005549 | Unclassified | 921 |
| 443 | Ga0070704_101158624 | 3300005549 | Unclassified | 704 |
| 444 | Ga0070704_101266903 | 3300005549 | Unclassified | 674 |
| 445 | Ga0070704_101330574 | 3300005549 | Unclassified | 658 |
| 446 | Ga0070704_102070239 | 3300005549 | Bacteria | 529 |
| 447 | Ga0070704_102234396 | 3300005549 | Unclassified | 509 |
| 448 | Ga0070704_102280395 | 3300005549 | Bacteria | 504 |
| 449 | Ga0068855_101152549 | 3300005563 | Bacteria | 808 |
| 450 | Ga0068855_102093755 | 3300005563 | Bacteria | 570 |
| 451 | Ga0070664_100002860 | 3300005564 | Bacteria | 13977 |
| 452 | Ga0070664_100045421 | 3300005564 | Bacteria | 3710 |
| 453 | Ga0070664_100069720 | 3300005564 | Bacteria | 3009 |
| 454 | Ga0070664_100105276 | 3300005564 | Bacteria | 2457 |
| 455 | Ga0070664_100126456 | 3300005564 | Bacteria | 2243 |
| 456 | Ga0070664_100127011 | 3300005564 | Bacteria | 2238 |
| 457 | Ga0070664_100177350 | 3300005564 | Bacteria | 1892 |
| 458 | Ga0070664_100182108 | 3300005564 | Unclassified | 1867 |
| 459 | Ga0070664_100564297 | 3300005564 | Unclassified | 1053 |
| 460 | Ga0070664_100826129 | 3300005564 | Bacteria | 867 |
| 461 | Ga0070664_101013673 | 3300005564 | Bacteria | 780 |
| 462 | Ga0070664_101092977 | 3300005564 | Bacteria | 751 |
| 463 | Ga0070664_101262791 | 3300005564 | Unclassified | 697 |
| 464 | Ga0070664_101813091 | 3300005564 | Unclassified | 579 |
| 465 | Ga0070664_102126924 | 3300005564 | Bacteria | 533 |
| 466 | Ga0068857_100077346 | 3300005577 | Bacteria | 2969 |
| 467 | Ga0068857_100093599 | 3300005577 | Bacteria | 2691 |
| 468 | Ga0068857_100486190 | 3300005577 | Bacteria | 1157 |
| 469 | Ga0068857_101087540 | 3300005577 | Bacteria | 772 |
| 470 | Ga0068857_101773924 | 3300005577 | Unclassified | 604 |
| 471 | Ga0068857_102090674 | 3300005577 | Unclassified | 556 |
| 472 | Ga0068854_100127031 | 3300005578 | Bacteria | 1943 |
| 473 | Ga0068854_100247639 | 3300005578 | Bacteria | 1422 |
| 474 | Ga0068854_100267523 | 3300005578 | Bacteria | 1371 |
| 475 | Ga0068854_101027515 | 3300005578 | Unclassified | 731 |
| 476 | Ga0068854_101588209 | 3300005578 | Bacteria | 596 |
| 477 | Ga0068854_101826008 | 3300005578 | Unclassified | 558 |
| 478 | Ga0070702_100103508 | 3300005615 | Bacteria | 1751 |
| 479 | Ga0070702_100129212 | 3300005615 | Unclassified | 1593 |
| 480 | Ga0070702_100207281 | 3300005615 | Bacteria | 1302 |
| 481 | Ga0070702_100245320 | 3300005615 | Bacteria | 1211 |
| 482 | Ga0070702_100256718 | 3300005615 | Unclassified | 1188 |
| 483 | Ga0070702_101535113 | 3300005615 | Unclassified | 549 |
| 484 | Ga0068852_100482501 | 3300005616 | Unclassified | 1232 |
| 485 | Ga0068852_100835748 | 3300005616 | Bacteria | 936 |
| 486 | Ga0068852_100934372 | 3300005616 | Bacteria | 885 |
| 487 | Ga0068852_101103134 | 3300005616 | Bacteria | 814 |
| 488 | Ga0068852_101734338 | 3300005616 | Unclassified | 647 |
| 489 | Ga0068852_102515116 | 3300005616 | Bacteria | 535 |
| 490 | Ga0068859_100001189 | 3300005617 | Bacteria | 26592 |
| 491 | Ga0068859_100007303 | 3300005617 | Bacteria | 11207 |
| 492 | Ga0068859_100057695 | 3300005617 | Bacteria | 3910 |
| 493 | Ga0068859_100057987 | 3300005617 | Bacteria | 3900 |
| 494 | Ga0068859_100084219 | 3300005617 | Bacteria | 3224 |
| 495 | Ga0068859_100085528 | 3300005617 | Bacteria | 3199 |
| 496 | Ga0068859_100088877 | 3300005617 | Bacteria | 3139 |
| 497 | Ga0068859_100131680 | 3300005617 | Bacteria | 2573 |
| 498 | Ga0068859_100179780 | 3300005617 | Bacteria | 2198 |
| 499 | Ga0068859_100209245 | 3300005617 | Unclassified | 2037 |
| 500 | Ga0068859_100267030 | 3300005617 | Bacteria | 1803 |
| 501 | Ga0068859_100672695 | 3300005617 | Bacteria | 1127 |
| 502 | Ga0068859_100714990 | 3300005617 | Bacteria | 1092 |
| 503 | Ga0068859_100871461 | 3300005617 | Bacteria | 986 |
| 504 | Ga0068859_101168972 | 3300005617 | Bacteria | 847 |
| 505 | Ga0068859_102132531 | 3300005617 | Bacteria | 619 |
| 506 | Ga0068859_102234570 | 3300005617 | Bacteria | 603 |
| 507 | Ga0068859_102585109 | 3300005617 | Bacteria | 559 |
| 508 | Ga0068859_102855231 | 3300005617 | Unclassified | 530 |
| 509 | Ga0068864_100010745 | 3300005618 | Bacteria | 7568 |
| 510 | Ga0068864_100013376 | 3300005618 | Bacteria | 6801 |
| 511 | Ga0068864_100029117 | 3300005618 | Bacteria | 4673 |
| 512 | Ga0068864_100037542 | 3300005618 | Bacteria | 4134 |
| 513 | Ga0068864_100124697 | 3300005618 | Bacteria | 2307 |
| 514 | Ga0068864_100347414 | 3300005618 | Bacteria | 1399 |
| 515 | Ga0068864_100371880 | 3300005618 | Bacteria | 1353 |
| 516 | Ga0068864_100405000 | 3300005618 | Bacteria | 1297 |
| 517 | Ga0068864_100425924 | 3300005618 | Bacteria | 1265 |
| 518 | Ga0068864_100553860 | 3300005618 | Bacteria | 1112 |
| 519 | Ga0068864_100929793 | 3300005618 | Unclassified | 860 |
| 520 | Ga0068864_101714657 | 3300005618 | Bacteria | 633 |
| 521 | Ga0068864_101771466 | 3300005618 | Unclassified | 623 |
| 522 | Ga0068866_10018862 | 3300005718 | Bacteria | 3129 |
| 523 | Ga0068866_10029981 | 3300005718 | Unclassified | 2606 |
| 524 | Ga0068866_10179654 | 3300005718 | Bacteria | 1249 |
| 525 | Ga0068866_10257470 | 3300005718 | Bacteria | 1071 |
| 526 | Ga0068866_11303960 | 3300005718 | Bacteria | 528 |
| 527 | Ga0068866_11443576 | 3300005718 | Bacteria | 504 |
| 528 | Ga0068861_100003348 | 3300005719 | Bacteria | 10619 |
| 529 | Ga0068861_100007806 | 3300005719 | Bacteria | 7354 |
| 530 | Ga0068861_100052196 | 3300005719 | Bacteria | 3107 |
| 531 | Ga0068861_100093932 | 3300005719 | Bacteria | 2372 |
| 532 | Ga0068861_100130694 | 3300005719 | Bacteria | 2038 |
| 533 | Ga0068861_100328220 | 3300005719 | Unclassified | 1335 |
| 534 | Ga0068861_100401730 | 3300005719 | Bacteria | 1216 |
| 535 | Ga0068861_100595368 | 3300005719 | Bacteria | 1014 |
| 536 | Ga0068861_101734904 | 3300005719 | Unclassified | 618 |
| 537 | Ga0068861_102053012 | 3300005719 | Unclassified | 571 |
| 538 | Ga0068851_10017577 | 3300005834 | Bacteria | 3437 |
| 539 | Ga0068851_11073450 | 3300005834 | Bacteria | 510 |
| 540 | Ga0068870_10002734 | 3300005840 | Bacteria | 7404 |
| 541 | Ga0068870_10007232 | 3300005840 | Bacteria | 4943 |
| 542 | Ga0068870_10008504 | 3300005840 | Bacteria | 4621 |
| 543 | Ga0068870_10025218 | 3300005840 | Bacteria | 2949 |
| 544 | Ga0068870_10071365 | 3300005840 | Bacteria | 1895 |
| 545 | Ga0068870_10119366 | 3300005840 | Bacteria | 1517 |
| 546 | Ga0068870_10154531 | 3300005840 | Bacteria | 1355 |
| 547 | Ga0068870_10516032 | 3300005840 | Bacteria | 799 |
| 548 | Ga0068870_10655141 | 3300005840 | Bacteria | 720 |
| 549 | Ga0068870_10749815 | 3300005840 | Unclassified | 678 |
| 550 | Ga0068863_100001594 | 3300005841 | Bacteria | 22409 |
| 551 | Ga0068863_100029322 | 3300005841 | Bacteria | 5252 |
| 552 | Ga0068863_100042275 | 3300005841 | Bacteria | 4330 |
| 553 | Ga0068863_100148402 | 3300005841 | Bacteria | 2243 |
| 554 | Ga0068863_100184035 | 3300005841 | Bacteria | 2006 |
| 555 | Ga0068863_100455353 | 3300005841 | Bacteria | 1256 |
| 556 | Ga0068863_100616685 | 3300005841 | Unclassified | 1074 |
| 557 | Ga0068863_100872114 | 3300005841 | Unclassified | 900 |
| 558 | Ga0068863_101241027 | 3300005841 | Unclassified | 752 |
| 559 | Ga0068863_101343686 | 3300005841 | Unclassified | 722 |
| 560 | Ga0068863_101992893 | 3300005841 | Unclassified | 591 |
| 561 | Ga0068858_100003439 | 3300005842 | Bacteria | 15721 |
| 562 | Ga0068858_100015584 | 3300005842 | Bacteria | 7150 |
| 563 | Ga0068858_100031755 | 3300005842 | Bacteria | 4908 |
| 564 | Ga0068858_100048955 | 3300005842 | Bacteria | 3915 |
| 565 | Ga0068858_100057459 | 3300005842 | Bacteria | 3596 |
| 566 | Ga0068858_100225921 | 3300005842 | Bacteria | 1774 |
| 567 | Ga0068858_100371815 | 3300005842 | Unclassified | 1371 |
| 568 | Ga0068858_100507933 | 3300005842 | Bacteria | 1165 |
| 569 | Ga0068858_100622638 | 3300005842 | Bacteria | 1048 |
| 570 | Ga0068858_100832285 | 3300005842 | Bacteria | 901 |
| 571 | Ga0068858_101665512 | 3300005842 | Bacteria | 630 |
| 572 | Ga0068858_101979541 | 3300005842 | Bacteria | 576 |
| 573 | Ga0068860_100002831 | 3300005843 | Bacteria | 18044 |
| 574 | Ga0068860_100038554 | 3300005843 | Bacteria | 4571 |
| 575 | Ga0068860_100087227 | 3300005843 | Bacteria | 2971 |
| 576 | Ga0068860_100340393 | 3300005843 | Bacteria | 1475 |
| 577 | Ga0068860_100355286 | 3300005843 | Unclassified | 1443 |
| 578 | Ga0068860_100880887 | 3300005843 | Unclassified | 911 |
| 579 | Ga0068860_100982344 | 3300005843 | Bacteria | 862 |
| 580 | Ga0068860_101080094 | 3300005843 | Bacteria | 822 |
| 581 | Ga0068860_101251590 | 3300005843 | Unclassified | 763 |
| 582 | Ga0068860_101441027 | 3300005843 | Bacteria | 710 |
| 583 | Ga0068860_101640610 | 3300005843 | Bacteria | 665 |
| 584 | Ga0068860_101710642 | 3300005843 | Unclassified | 651 |
| 585 | Ga0068860_102087572 | 3300005843 | Unclassified | 588 |
| 586 | Ga0068860_102428102 | 3300005843 | Unclassified | 544 |
| 587 | Ga0068862_100001533 | 3300005844 | Bacteria | 21121 |
| 588 | Ga0068862_100001812 | 3300005844 | Bacteria | 19342 |
| 589 | Ga0068862_100107479 | 3300005844 | Bacteria | 2446 |
| 590 | Ga0068862_100129265 | 3300005844 | Bacteria | 2233 |
| 591 | Ga0068862_100306841 | 3300005844 | Unclassified | 1462 |
| 592 | Ga0068862_100307715 | 3300005844 | Unclassified | 1460 |
| 593 | Ga0068862_100323645 | 3300005844 | Unclassified | 1424 |
| 594 | Ga0068862_100502490 | 3300005844 | Unclassified | 1151 |
| 595 | Ga0068862_100762930 | 3300005844 | Unclassified | 942 |
| 596 | Ga0068862_101075054 | 3300005844 | Unclassified | 799 |
| 597 | Ga0068862_101126102 | 3300005844 | Bacteria | 781 |
| 598 | Ga0068862_101775328 | 3300005844 | Unclassified | 626 |
| 599 | Ga0068862_102108496 | 3300005844 | Unclassified | 575 |
| 600 | Ga0068862_102494216 | 3300005844 | Bacteria | 529 |
| 601 | Ga0081455_10081091 | 3300005937 | Bacteria | 2658 |
| 602 | Ga0081455_10194880 | 3300005937 | Bacteria | 1522 |
| 603 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 604 | Ga0081539_10000096 | 3300005985 | Bacteria | 204059 |
| 605 | Ga0081539_10028795 | 3300005985 | Unclassified | 3486 |
| 606 | Ga0081539_10258575 | 3300005985 | Bacteria | 769 |
| 607 | Ga0081539_10268453 | 3300005985 | Bacteria | 749 |
| 608 | Ga0081539_10272946 | 3300005985 | Bacteria | 740 |
| 609 | Ga0070717_10230633 | 3300006028 | Unclassified | 1630 |
| 610 | Ga0070717_10850684 | 3300006028 | Bacteria | 830 |
| 611 | Ga0075432_10029143 | 3300006058 | Bacteria | 1905 |
| 612 | Ga0075432_10363888 | 3300006058 | Unclassified | 616 |
| 613 | Ga0070716_100984168 | 3300006173 | Bacteria | 666 |
| 614 | Ga0070712_101809275 | 3300006175 | Unclassified | 535 |
| 615 | Ga0070712_101849360 | 3300006175 | Unclassified | 529 |
| 616 | Ga0075427_10025470 | 3300006194 | Bacteria | 954 |
| 617 | Ga0097621_100000820 | 3300006237 | Bacteria | 21967 |
| 618 | Ga0097621_100010172 | 3300006237 | Bacteria | 6867 |
| 619 | Ga0097621_100019068 | 3300006237 | Bacteria | 5259 |
| 620 | Ga0097621_100035057 | 3300006237 | Unclassified | 4007 |
| 621 | Ga0097621_100133659 | 3300006237 | Bacteria | 2114 |
| 622 | Ga0097621_100232519 | 3300006237 | Bacteria | 1610 |
| 623 | Ga0097621_100247823 | 3300006237 | Unclassified | 1559 |
| 624 | Ga0097621_100259946 | 3300006237 | Unclassified | 1523 |
| 625 | Ga0097621_100305225 | 3300006237 | Bacteria | 1407 |
| 626 | Ga0097621_100311632 | 3300006237 | Unclassified | 1392 |
| 627 | Ga0097621_100717133 | 3300006237 | Bacteria | 922 |
| 628 | Ga0097621_101323250 | 3300006237 | Unclassified | 681 |
| 629 | Ga0068871_100000748 | 3300006358 | Bacteria | 22005 |
| 630 | Ga0068871_100007358 | 3300006358 | Bacteria | 7855 |
| 631 | Ga0068871_100019530 | 3300006358 | Bacteria | 5175 |
| 632 | Ga0068871_100100346 | 3300006358 | Bacteria | 2424 |
| 633 | Ga0068871_100471852 | 3300006358 | Bacteria | 1127 |
| 634 | Ga0068871_100485606 | 3300006358 | Bacteria | 1112 |
| 635 | Ga0068871_100808173 | 3300006358 | Bacteria | 865 |
| 636 | Ga0068871_100825898 | 3300006358 | Bacteria | 856 |
| 637 | Ga0068871_100996534 | 3300006358 | Unclassified | 780 |
| 638 | Ga0068871_101583866 | 3300006358 | Bacteria | 620 |
| 639 | Ga0075428_100012777 | 3300006844 | Bacteria | 9336 |
| 640 | Ga0075428_100030141 | 3300006844 | Bacteria | 6001 |
| 641 | Ga0075428_100061549 | 3300006844 | Bacteria | 4111 |
| 642 | Ga0075428_100092638 | 3300006844 | Bacteria | 3295 |
| 643 | Ga0075428_100121571 | 3300006844 | Bacteria | 2843 |
| 644 | Ga0075428_100219659 | 3300006844 | Bacteria | 2052 |
| 645 | Ga0075428_100226840 | 3300006844 | Bacteria | 2016 |
| 646 | Ga0075428_100374076 | 3300006844 | Bacteria | 1527 |
| 647 | Ga0075428_100520688 | 3300006844 | Bacteria | 1272 |
| 648 | Ga0075428_100842671 | 3300006844 | Bacteria | 974 |
| 649 | Ga0075430_100009273 | 3300006846 | Bacteria | 8315 |
| 650 | Ga0075430_100017018 | 3300006846 | Bacteria | 6192 |
| 651 | Ga0075430_100058440 | 3300006846 | Bacteria | 3242 |
| 652 | Ga0075430_100591270 | 3300006846 | Bacteria | 916 |
| 653 | Ga0075431_100051008 | 3300006847 | Bacteria | 4267 |
| 654 | Ga0075431_100076833 | 3300006847 | Bacteria | 3446 |
| 655 | Ga0075431_100248873 | 3300006847 | Bacteria | 1806 |
| 656 | Ga0075431_100589924 | 3300006847 | Bacteria | 1096 |
| 657 | Ga0075433_10026165 | 3300006852 | Bacteria | 4937 |
| 658 | Ga0075433_10044412 | 3300006852 | Bacteria | 3860 |
| 659 | Ga0075433_10115117 | 3300006852 | Bacteria | 2386 |
| 660 | Ga0075433_10165487 | 3300006852 | Unclassified | 1968 |
| 661 | Ga0075433_10205477 | 3300006852 | Bacteria | 1751 |
| 662 | Ga0075433_10244578 | 3300006852 | Bacteria | 1593 |
| 663 | Ga0075433_10273510 | 3300006852 | Bacteria | 1497 |
| 664 | Ga0075433_10319208 | 3300006852 | Bacteria | 1374 |
| 665 | Ga0075433_10395913 | 3300006852 | Bacteria | 1219 |
| 666 | Ga0075433_10455278 | 3300006852 | Bacteria | 1128 |
| 667 | Ga0075433_10830909 | 3300006852 | Unclassified | 807 |
| 668 | Ga0075433_11045324 | 3300006852 | Unclassified | 711 |
| 669 | Ga0075433_11677241 | 3300006852 | Unclassified | 547 |
| 670 | Ga0075433_11927954 | 3300006852 | Unclassified | 507 |
| 671 | Ga0075434_100000213 | 3300006871 | Bacteria | 39624 |
| 672 | Ga0075434_100007002 | 3300006871 | Bacteria | 10399 |
| 673 | Ga0075434_100046593 | 3300006871 | Bacteria | 4302 |
| 674 | Ga0075434_100083019 | 3300006871 | Bacteria | 3201 |
| 675 | Ga0075434_100123977 | 3300006871 | Bacteria | 2600 |
| 676 | Ga0075434_100170073 | 3300006871 | Bacteria | 2199 |
| 677 | Ga0075434_100170935 | 3300006871 | Bacteria | 2193 |
| 678 | Ga0075434_100208315 | 3300006871 | Bacteria | 1976 |
| 679 | Ga0075434_100247411 | 3300006871 | Unclassified | 1802 |
| 680 | Ga0075434_100251669 | 3300006871 | Bacteria | 1786 |
| 681 | Ga0075434_100367886 | 3300006871 | Unclassified | 1459 |
| 682 | Ga0075434_100579372 | 3300006871 | Unclassified | 1141 |
| 683 | Ga0075434_100669491 | 3300006871 | Bacteria | 1056 |
| 684 | Ga0075434_100706222 | 3300006871 | Unclassified | 1026 |
| 685 | Ga0075434_101209000 | 3300006871 | Bacteria | 768 |
| 686 | Ga0075434_101240119 | 3300006871 | Bacteria | 757 |
| 687 | Ga0075434_101254459 | 3300006871 | Bacteria | 752 |
| 688 | Ga0075434_101689809 | 3300006871 | Bacteria | 641 |
| 689 | Ga0075434_102278326 | 3300006871 | Bacteria | 545 |
| 690 | Ga0075429_100021950 | 3300006880 | Bacteria | 5535 |
| 691 | Ga0075429_100051497 | 3300006880 | Bacteria | 3583 |
| 692 | Ga0075429_100154212 | 3300006880 | Bacteria | 2011 |
| 693 | Ga0075429_100179118 | 3300006880 | Bacteria | 1857 |
| 694 | Ga0075429_100313118 | 3300006880 | Unclassified | 1374 |
| 695 | Ga0075429_100765807 | 3300006880 | Unclassified | 846 |
| 696 | Ga0075429_100948481 | 3300006880 | Bacteria | 752 |
| 697 | Ga0068865_100004635 | 3300006881 | Bacteria | 8301 |
| 698 | Ga0068865_100028224 | 3300006881 | Unclassified | 3715 |
| 699 | Ga0068865_100034892 | 3300006881 | Bacteria | 3379 |
| 700 | Ga0068865_100035056 | 3300006881 | Bacteria | 3372 |
| 701 | Ga0068865_100178498 | 3300006881 | Bacteria | 1634 |
| 702 | Ga0068865_100399955 | 3300006881 | Unclassified | 1125 |
| 703 | Ga0068865_100427629 | 3300006881 | Bacteria | 1090 |
| 704 | Ga0068865_100519202 | 3300006881 | Bacteria | 996 |
| 705 | Ga0068865_101558683 | 3300006881 | Unclassified | 593 |
| 706 | Ga0068865_102089268 | 3300006881 | Unclassified | 515 |
| 707 | Ga0068865_102175901 | 3300006881 | Unclassified | 505 |
| 708 | Ga0075436_100004018 | 3300006914 | Bacteria | 10094 |
| 709 | Ga0075436_100065371 | 3300006914 | Bacteria | 2514 |
| 710 | Ga0075436_100117826 | 3300006914 | Bacteria | 1856 |
| 711 | Ga0075436_100545411 | 3300006914 | Bacteria | 851 |
| 712 | Ga0075436_101090075 | 3300006914 | Bacteria | 601 |
| 713 | Ga0075436_101130864 | 3300006914 | Bacteria | 590 |
| 714 | Ga0097620_100001189 | 3300006931 | Bacteria | 26592 |
| 715 | Ga0097620_100007303 | 3300006931 | Bacteria | 11207 |
| 716 | Ga0097620_100057695 | 3300006931 | Bacteria | 3910 |
| 717 | Ga0097620_100057987 | 3300006931 | Bacteria | 3900 |
| 718 | Ga0097620_100084218 | 3300006931 | Bacteria | 3224 |
| 719 | Ga0097620_100085522 | 3300006931 | Bacteria | 3199 |
| 720 | Ga0097620_100088882 | 3300006931 | Bacteria | 3139 |
| 721 | Ga0097620_100131683 | 3300006931 | Bacteria | 2573 |
| 722 | Ga0097620_100179776 | 3300006931 | Bacteria | 2198 |
| 723 | Ga0097620_100209228 | 3300006931 | Unclassified | 2037 |
| 724 | Ga0097620_100267053 | 3300006931 | Bacteria | 1803 |
| 725 | Ga0097620_100672748 | 3300006931 | Bacteria | 1127 |
| 726 | Ga0097620_100715091 | 3300006931 | Bacteria | 1092 |
| 727 | Ga0097620_100871292 | 3300006931 | Bacteria | 986 |
| 728 | Ga0097620_101169074 | 3300006931 | Bacteria | 847 |
| 729 | Ga0097620_102132446 | 3300006931 | Bacteria | 619 |
| 730 | Ga0097620_102234580 | 3300006931 | Bacteria | 603 |
| 731 | Ga0097620_102584934 | 3300006931 | Bacteria | 559 |
| 732 | Ga0097620_102855792 | 3300006931 | Unclassified | 530 |
| 733 | Ga0075435_100002059 | 3300007076 | Bacteria | 13182 |
| 734 | Ga0075435_100002813 | 3300007076 | Bacteria | 11639 |
| 735 | Ga0075435_100003388 | 3300007076 | Bacteria | 10812 |
| 736 | Ga0075435_100015991 | 3300007076 | Bacteria | 5649 |
| 737 | Ga0075435_100028816 | 3300007076 | Bacteria | 4356 |
| 738 | Ga0075435_100053296 | 3300007076 | Bacteria | 3262 |
| 739 | Ga0075435_100103311 | 3300007076 | Bacteria | 2363 |
| 740 | Ga0075435_100618144 | 3300007076 | Bacteria | 940 |
| 741 | Ga0075435_100901266 | 3300007076 | Bacteria | 771 |
| 742 | Ga0099794_10572816 | 3300007265 | Unclassified | 597 |
| 743 | Ga0105244_10456420 | 3300009036 | Unclassified | 588 |
| 744 | Ga0105240_10171136 | 3300009093 | Bacteria | 2572 |
| 745 | Ga0105240_10234875 | 3300009093 | Bacteria | 2128 |
| 746 | Ga0105240_11652470 | 3300009093 | Bacteria | 669 |
| 747 | Ga0105240_11988535 | 3300009093 | Bacteria | 604 |
| 748 | Ga0111539_10002001 | 3300009094 | Bacteria | 27198 |
| 749 | Ga0111539_10002576 | 3300009094 | Bacteria | 24001 |
| 750 | Ga0111539_10010325 | 3300009094 | Bacteria | 11757 |
| 751 | Ga0111539_10011738 | 3300009094 | Bacteria | 10990 |
| 752 | Ga0111539_10046784 | 3300009094 | Bacteria | 5174 |
| 753 | Ga0111539_10115406 | 3300009094 | Bacteria | 3149 |
| 754 | Ga0111539_10359532 | 3300009094 | Unclassified | 1695 |
| 755 | Ga0111539_10390820 | 3300009094 | Bacteria | 1620 |
| 756 | Ga0111539_10470607 | 3300009094 | Bacteria | 1463 |
| 757 | Ga0111539_10555941 | 3300009094 | Bacteria | 1336 |
| 758 | Ga0111539_10594898 | 3300009094 | Bacteria | 1288 |
| 759 | Ga0111539_10699382 | 3300009094 | Bacteria | 1180 |
| 760 | Ga0111539_10750549 | 3300009094 | Bacteria | 1136 |
| 761 | Ga0111539_10750724 | 3300009094 | Bacteria | 1136 |
| 762 | Ga0111539_11087553 | 3300009094 | Bacteria | 929 |
| 763 | Ga0111539_11128549 | 3300009094 | Unclassified | 911 |
| 764 | Ga0111539_11812289 | 3300009094 | Bacteria | 708 |
| 765 | Ga0111539_12952699 | 3300009094 | Unclassified | 550 |
| 766 | Ga0111539_13244993 | 3300009094 | Unclassified | 524 |
| 767 | Ga0105245_10021064 | 3300009098 | Bacteria | 5719 |
| 768 | Ga0105245_10025776 | 3300009098 | Bacteria | 5170 |
| 769 | Ga0105245_10253059 | 3300009098 | Bacteria | 1712 |
| 770 | Ga0105245_10407729 | 3300009098 | Bacteria | 1360 |
| 771 | Ga0105245_11264531 | 3300009098 | Unclassified | 787 |
| 772 | Ga0105245_12203332 | 3300009098 | Unclassified | 605 |
| 773 | Ga0105245_13114656 | 3300009098 | Unclassified | 514 |
| 774 | Ga0105245_13279846 | 3300009098 | Bacteria | 501 |
| 775 | Ga0105247_10034310 | 3300009101 | Bacteria | 3090 |
| 776 | Ga0105247_10047882 | 3300009101 | Bacteria | 2626 |
| 777 | Ga0105247_10098845 | 3300009101 | Bacteria | 1863 |
| 778 | Ga0105247_10657528 | 3300009101 | Bacteria | 784 |
| 779 | Ga0114129_10001136 | 3300009147 | Bacteria | 35167 |
| 780 | Ga0114129_10002946 | 3300009147 | Bacteria | 23809 |
| 781 | Ga0114129_10004592 | 3300009147 | Bacteria | 19487 |
| 782 | Ga0114129_10020123 | 3300009147 | Bacteria | 9497 |
| 783 | Ga0114129_10022122 | 3300009147 | Bacteria | 9023 |
| 784 | Ga0114129_10027105 | 3300009147 | Bacteria | 8113 |
| 785 | Ga0114129_10028461 | 3300009147 | Bacteria | 7918 |
| 786 | Ga0114129_10037467 | 3300009147 | Bacteria | 6845 |
| 787 | Ga0114129_10040079 | 3300009147 | Bacteria | 6604 |
| 788 | Ga0114129_10057047 | 3300009147 | Bacteria | 5468 |
| 789 | Ga0114129_10078980 | 3300009147 | Bacteria | 4576 |
| 790 | Ga0114129_10115977 | 3300009147 | Bacteria | 3690 |
| 791 | Ga0114129_10117373 | 3300009147 | Bacteria | 3667 |
| 792 | Ga0114129_10117933 | 3300009147 | Bacteria | 3656 |
| 793 | Ga0114129_10157558 | 3300009147 | Bacteria | 3104 |
| 794 | Ga0114129_10171996 | 3300009147 | Bacteria | 2952 |
| 795 | Ga0114129_10277709 | 3300009147 | Bacteria | 2239 |
| 796 | Ga0114129_10661319 | 3300009147 | Unclassified | 1347 |
| 797 | Ga0114129_10897615 | 3300009147 | Unclassified | 1123 |
| 798 | Ga0114129_11017005 | 3300009147 | Unclassified | 1043 |
| 799 | Ga0114129_11065124 | 3300009147 | Bacteria | 1014 |
| 800 | Ga0114129_11154774 | 3300009147 | Bacteria | 967 |
| 801 | Ga0114129_11550771 | 3300009147 | Unclassified | 812 |
| 802 | Ga0114129_13127635 | 3300009147 | Unclassified | 540 |
| 803 | Ga0105243_10026404 | 3300009148 | Bacteria | 4444 |
| 804 | Ga0105243_10028744 | 3300009148 | Bacteria | 4270 |
| 805 | Ga0105243_10032111 | 3300009148 | Bacteria | 4053 |
| 806 | Ga0105243_10436531 | 3300009148 | Unclassified | 1225 |
| 807 | Ga0105243_10736250 | 3300009148 | Unclassified | 965 |
| 808 | Ga0105243_10739879 | 3300009148 | Bacteria | 963 |
| 809 | Ga0105243_10776727 | 3300009148 | Unclassified | 942 |
| 810 | Ga0105243_11440226 | 3300009148 | Bacteria | 711 |
| 811 | Ga0105243_11560607 | 3300009148 | Unclassified | 686 |
| 812 | Ga0105243_11648404 | 3300009148 | Bacteria | 669 |
| 813 | Ga0105241_10582711 | 3300009174 | Unclassified | 1008 |
| 814 | Ga0105242_10012518 | 3300009176 | Bacteria | 6530 |
| 815 | Ga0105242_10013395 | 3300009176 | Bacteria | 6336 |
| 816 | Ga0105242_10068550 | 3300009176 | Bacteria | 2935 |
| 817 | Ga0105242_10104044 | 3300009176 | Bacteria | 2409 |
| 818 | Ga0105242_10131338 | 3300009176 | Bacteria | 2162 |
| 819 | Ga0105242_10132461 | 3300009176 | Unclassified | 2154 |
| 820 | Ga0105242_10325452 | 3300009176 | Bacteria | 1411 |
| 821 | Ga0105242_10329470 | 3300009176 | Unclassified | 1403 |
| 822 | Ga0105242_10381741 | 3300009176 | Unclassified | 1310 |
| 823 | Ga0105242_10524107 | 3300009176 | Bacteria | 1131 |
| 824 | Ga0105242_10551704 | 3300009176 | Bacteria | 1105 |
| 825 | Ga0105242_11343377 | 3300009176 | Unclassified | 740 |
| 826 | Ga0105242_11413407 | 3300009176 | Unclassified | 724 |
| 827 | Ga0105242_12500736 | 3300009176 | Bacteria | 565 |
| 828 | Ga0105242_12795040 | 3300009176 | Unclassified | 538 |
| 829 | Ga0105242_13147865 | 3300009176 | Unclassified | 512 |
| 830 | Ga0105248_10043347 | 3300009177 | Bacteria | 5044 |
| 831 | Ga0105248_10127746 | 3300009177 | Bacteria | 2868 |
| 832 | Ga0105248_10188311 | 3300009177 | Unclassified | 2325 |
| 833 | Ga0105248_10197994 | 3300009177 | Bacteria | 2264 |
| 834 | Ga0105248_10401003 | 3300009177 | Bacteria | 1544 |
| 835 | Ga0105248_10416931 | 3300009177 | Bacteria | 1512 |
| 836 | Ga0105248_10515982 | 3300009177 | Bacteria | 1348 |
| 837 | Ga0105248_10516236 | 3300009177 | Bacteria | 1347 |
| 838 | Ga0105248_10544739 | 3300009177 | Unclassified | 1309 |
| 839 | Ga0105248_10651381 | 3300009177 | Unclassified | 1188 |
| 840 | Ga0105248_11201750 | 3300009177 | Bacteria | 857 |
| 841 | Ga0105248_11853336 | 3300009177 | Bacteria | 684 |
| 842 | Ga0105248_11872614 | 3300009177 | Bacteria | 681 |
| 843 | Ga0105248_11923027 | 3300009177 | Bacteria | 671 |
| 844 | Ga0105248_12202258 | 3300009177 | Bacteria | 627 |
| 845 | Ga0105237_10455188 | 3300009545 | Bacteria | 1286 |
| 846 | Ga0105237_10706170 | 3300009545 | Bacteria | 1015 |
| 847 | Ga0105237_11028602 | 3300009545 | Bacteria | 831 |
| 848 | Ga0105237_11291122 | 3300009545 | Bacteria | 736 |
| 849 | Ga0105237_11593893 | 3300009545 | Bacteria | 660 |
| 850 | Ga0105238_10013992 | 3300009551 | Bacteria | 8114 |
| 851 | Ga0105238_10174139 | 3300009551 | Bacteria | 2128 |
| 852 | Ga0105238_10547814 | 3300009551 | Unclassified | 1161 |
| 853 | Ga0105238_10825350 | 3300009551 | Bacteria | 943 |
| 854 | Ga0105238_10847370 | 3300009551 | Bacteria | 931 |
| 855 | Ga0105238_11344746 | 3300009551 | Unclassified | 741 |
| 856 | Ga0105238_11641694 | 3300009551 | Bacteria | 673 |
| 857 | Ga0105249_10038160 | 3300009553 | Bacteria | 4358 |
| 858 | Ga0105249_10112023 | 3300009553 | Bacteria | 2580 |
| 859 | Ga0105249_10377746 | 3300009553 | Bacteria | 1442 |
| 860 | Ga0105249_10396448 | 3300009553 | Bacteria | 1409 |
| 861 | Ga0105249_10966485 | 3300009553 | Bacteria | 920 |
| 862 | Ga0105249_11296063 | 3300009553 | Unclassified | 800 |
| 863 | Ga0105249_11683134 | 3300009553 | Bacteria | 707 |
| 864 | Ga0099796_10437513 | 3300010159 | Bacteria | 580 |
| 865 | Ga0099796_10586792 | 3300010159 | Bacteria | 502 |
| 866 | Ga0105239_10884365 | 3300010375 | Unclassified | 1025 |
| 867 | Ga0105246_10279464 | 3300011119 | Bacteria | 1338 |
| 868 | Ga0105246_10386151 | 3300011119 | Bacteria | 1158 |
| 869 | Ga0105246_12007378 | 3300011119 | Unclassified | 558 |
| 870 | Ga0157370_10315396 | 3300013104 | Bacteria | 1443 |
| 871 | Ga0157370_11773769 | 3300013104 | Bacteria | 554 |
| 872 | Ga0157369_10694071 | 3300013105 | Unclassified | 1048 |
| 873 | Ga0157374_10019059 | 3300013296 | Bacteria | 6070 |
| 874 | Ga0157374_10021116 | 3300013296 | Bacteria | 5787 |
| 875 | Ga0157374_10158911 | 3300013296 | Bacteria | 2201 |
| 876 | Ga0157374_10248981 | 3300013296 | Bacteria | 1748 |
| 877 | Ga0157374_10388333 | 3300013296 | Bacteria | 1391 |
| 878 | Ga0157374_11910677 | 3300013296 | Unclassified | 619 |
| 879 | Ga0157374_12131109 | 3300013296 | Bacteria | 587 |
| 880 | Ga0157374_12271394 | 3300013296 | Bacteria | 570 |
| 881 | Ga0157378_10116848 | 3300013297 | Bacteria | 2453 |
| 882 | Ga0157378_10122414 | 3300013297 | Bacteria | 2400 |
| 883 | Ga0157378_10144012 | 3300013297 | Bacteria | 2215 |
| 884 | Ga0157378_12250994 | 3300013297 | Bacteria | 596 |
| 885 | Ga0157378_12536566 | 3300013297 | Bacteria | 565 |
| 886 | Ga0157378_13029328 | 3300013297 | Bacteria | 521 |
| 887 | Ga0157378_13160646 | 3300013297 | Bacteria | 511 |
| 888 | Ga0157378_13217066 | 3300013297 | Bacteria | 507 |
| 889 | Ga0163162_10023215 | 3300013306 | Bacteria | 6119 |
| 890 | Ga0163162_10085251 | 3300013306 | Bacteria | 3236 |
| 891 | Ga0163162_10366532 | 3300013306 | Bacteria | 1574 |
| 892 | Ga0163162_10821690 | 3300013306 | Bacteria | 1046 |
| 893 | Ga0163162_10859269 | 3300013306 | Unclassified | 1022 |
| 894 | Ga0163162_11043154 | 3300013306 | Bacteria | 925 |
| 895 | Ga0163162_11114219 | 3300013306 | Bacteria | 894 |
| 896 | Ga0163162_11130956 | 3300013306 | Bacteria | 888 |
| 897 | Ga0163162_11172367 | 3300013306 | Unclassified | 871 |
| 898 | Ga0163162_11246390 | 3300013306 | Bacteria | 844 |
| 899 | Ga0163162_11766125 | 3300013306 | Unclassified | 707 |
| 900 | Ga0163162_11993916 | 3300013306 | Bacteria | 665 |
| 901 | Ga0163162_13185473 | 3300013306 | Bacteria | 526 |
| 902 | Ga0163162_13269016 | 3300013306 | Unclassified | 519 |
| 903 | Ga0157372_10190621 | 3300013307 | Bacteria | 2375 |
| 904 | Ga0157372_10568317 | 3300013307 | Bacteria | 1322 |
| 905 | Ga0157372_11432019 | 3300013307 | Bacteria | 796 |
| 906 | Ga0157372_12182924 | 3300013307 | Bacteria | 636 |
| 907 | Ga0157372_13370353 | 3300013307 | Bacteria | 509 |
| 908 | Ga0157375_10002809 | 3300013308 | Bacteria | 15073 |
| 909 | Ga0157375_10195198 | 3300013308 | Bacteria | 2179 |
| 910 | Ga0157375_10267924 | 3300013308 | Bacteria | 1870 |
| 911 | Ga0157375_10965827 | 3300013308 | Unclassified | 993 |
| 912 | Ga0157375_11406502 | 3300013308 | Unclassified | 822 |
| 913 | Ga0157375_11577475 | 3300013308 | Bacteria | 776 |
| 914 | Ga0157375_11854257 | 3300013308 | Bacteria | 715 |
| 915 | Ga0157375_11863662 | 3300013308 | Unclassified | 713 |
| 916 | Ga0157375_12107995 | 3300013308 | Unclassified | 671 |
| 917 | Ga0157375_12321154 | 3300013308 | Bacteria | 640 |
| 918 | Ga0157375_12609371 | 3300013308 | Unclassified | 604 |
| 919 | Ga0157375_13606814 | 3300013308 | Unclassified | 515 |
| 920 | Ga0163163_10019062 | 3300014325 | Bacteria | 6437 |
| 921 | Ga0163163_10029929 | 3300014325 | Bacteria | 5241 |
| 922 | Ga0163163_10034366 | 3300014325 | Bacteria | 4909 |
| 923 | Ga0163163_10035670 | 3300014325 | Unclassified | 4826 |
| 924 | Ga0163163_10131460 | 3300014325 | Bacteria | 2543 |
| 925 | Ga0163163_10152247 | 3300014325 | Bacteria | 2356 |
| 926 | Ga0163163_10212125 | 3300014325 | Bacteria | 1986 |
| 927 | Ga0163163_10404711 | 3300014325 | Bacteria | 1423 |
| 928 | Ga0163163_10718221 | 3300014325 | Bacteria | 1063 |
| 929 | Ga0163163_12579260 | 3300014325 | Unclassified | 566 |
| 930 | Ga0163163_12625527 | 3300014325 | Bacteria | 561 |
| 931 | Ga0157380_10033704 | 3300014326 | Bacteria | 3945 |
| 932 | Ga0157380_10043376 | 3300014326 | Bacteria | 3522 |
| 933 | Ga0157380_10073134 | 3300014326 | Bacteria | 2778 |
| 934 | Ga0157380_10078972 | 3300014326 | Bacteria | 2686 |
| 935 | Ga0157380_10089956 | 3300014326 | Bacteria | 2531 |
| 936 | Ga0157380_10295034 | 3300014326 | Unclassified | 1490 |
| 937 | Ga0157380_10301337 | 3300014326 | Bacteria | 1476 |
| 938 | Ga0157380_10315357 | 3300014326 | Bacteria | 1447 |
| 939 | Ga0157380_10320424 | 3300014326 | Bacteria | 1437 |
| 940 | Ga0157380_10820105 | 3300014326 | Unclassified | 949 |
| 941 | Ga0157380_11160073 | 3300014326 | Unclassified | 814 |
| 942 | Ga0157380_11654413 | 3300014326 | Unclassified | 697 |
| 943 | Ga0157380_11861662 | 3300014326 | Unclassified | 662 |
| 944 | Ga0157380_12090282 | 3300014326 | Unclassified | 629 |
| 945 | Ga0157380_12516602 | 3300014326 | Bacteria | 580 |
| 946 | Ga0157380_12781108 | 3300014326 | Unclassified | 556 |
| 947 | Ga0157377_10049493 | 3300014745 | Bacteria | 2363 |
| 948 | Ga0157377_10097784 | 3300014745 | Bacteria | 1744 |
| 949 | Ga0157377_10108179 | 3300014745 | Bacteria | 1667 |
| 950 | Ga0157377_10202313 | 3300014745 | Bacteria | 1261 |
| 951 | Ga0157377_10396339 | 3300014745 | Bacteria | 939 |
| 952 | Ga0157377_10437902 | 3300014745 | Unclassified | 899 |
| 953 | Ga0157377_10790353 | 3300014745 | Bacteria | 699 |
| 954 | Ga0157377_10938283 | 3300014745 | Unclassified | 650 |
| 955 | Ga0157377_11327752 | 3300014745 | Unclassified | 563 |
| 956 | Ga0157377_11425515 | 3300014745 | Unclassified | 547 |
| 957 | Ga0157379_10003474 | 3300014968 | Bacteria | 13338 |
| 958 | Ga0157379_10075144 | 3300014968 | Unclassified | 3025 |
| 959 | Ga0157379_10117348 | 3300014968 | Bacteria | 2394 |
| 960 | Ga0157379_10191381 | 3300014968 | Bacteria | 1849 |
| 961 | Ga0157379_10249808 | 3300014968 | Unclassified | 1610 |
| 962 | Ga0157379_10378050 | 3300014968 | Bacteria | 1299 |
| 963 | Ga0157379_10472510 | 3300014968 | Bacteria | 1160 |
| 964 | Ga0157379_10512462 | 3300014968 | Bacteria | 1113 |
| 965 | Ga0157379_10553275 | 3300014968 | Unclassified | 1071 |
| 966 | Ga0157379_10945388 | 3300014968 | Unclassified | 819 |
| 967 | Ga0157376_10008040 | 3300014969 | Bacteria | 7576 |
| 968 | Ga0157376_10017626 | 3300014969 | Bacteria | 5454 |
| 969 | Ga0157376_10018373 | 3300014969 | Bacteria | 5359 |
| 970 | Ga0157376_10069948 | 3300014969 | Bacteria | 2978 |
| 971 | Ga0157376_10200328 | 3300014969 | Bacteria | 1836 |
| 972 | Ga0157376_10264606 | 3300014969 | Bacteria | 1613 |
| 973 | Ga0157376_10301913 | 3300014969 | Bacteria | 1516 |
| 974 | Ga0157376_10411659 | 3300014969 | Bacteria | 1310 |
| 975 | Ga0157376_12620232 | 3300014969 | Bacteria | 544 |
| 976 | Ga0163161_10437450 | 3300017792 | Bacteria | 1055 |
| 977 | Ga0163161_10497282 | 3300017792 | Bacteria | 992 |
| 978 | Ga0163161_10537660 | 3300017792 | Bacteria | 956 |
| 979 | Ga0163161_11833857 | 3300017792 | Bacteria | 540 |
| 980 | Ga0206350_10273369 | 3300020080 | Unclassified | 1044 |
| 981 | Ga0213876_10130218 | 3300021384 | Bacteria | 1337 |
| 982 | Ga0207697_10049925 | 3300025315 | Bacteria | 1727 |
| 983 | Ga0207697_10064197 | 3300025315 | Unclassified | 1531 |
| 984 | Ga0207697_10159881 | 3300025315 | Unclassified | 982 |
| 985 | Ga0207697_10222430 | 3300025315 | Bacteria | 833 |
| 986 | Ga0207697_10353957 | 3300025315 | Bacteria | 652 |
| 987 | Ga0207697_10465749 | 3300025315 | Unclassified | 560 |
| 988 | Ga0207697_10470305 | 3300025315 | Bacteria | 557 |
| 989 | Ga0207656_10084620 | 3300025321 | Unclassified | 1431 |
| 990 | Ga0207653_10043956 | 3300025885 | Bacteria | 1472 |
| 991 | Ga0207682_10014308 | 3300025893 | Bacteria | 3090 |
| 992 | Ga0207682_10056482 | 3300025893 | Bacteria | 1634 |
| 993 | Ga0207682_10352289 | 3300025893 | Unclassified | 694 |
| 994 | Ga0207682_10479119 | 3300025893 | Unclassified | 589 |
| 995 | Ga0207692_10286169 | 3300025898 | Bacteria | 999 |
| 996 | Ga0207642_10049260 | 3300025899 | Bacteria | 1893 |
| 997 | Ga0207642_10091674 | 3300025899 | Bacteria | 1502 |
| 998 | Ga0207642_10153016 | 3300025899 | Bacteria | 1230 |
| 999 | Ga0207642_10355579 | 3300025899 | Bacteria | 865 |
| 1000 | Ga0207642_10418167 | 3300025899 | Unclassified | 806 |
| 1001 | Ga0207710_10019937 | 3300025900 | Bacteria | 2864 |
| 1002 | Ga0207710_10027337 | 3300025900 | Bacteria | 2469 |
| 1003 | Ga0207710_10029566 | 3300025900 | Unclassified | 2386 |
| 1004 | Ga0207688_10184921 | 3300025901 | Bacteria | 1244 |
| 1005 | Ga0207688_10589021 | 3300025901 | Bacteria | 700 |
| 1006 | Ga0207688_10715990 | 3300025901 | Unclassified | 633 |
| 1007 | Ga0207688_10962474 | 3300025901 | Bacteria | 540 |
| 1008 | Ga0207680_10067236 | 3300025903 | Bacteria | 2207 |
| 1009 | Ga0207680_10176061 | 3300025903 | Bacteria | 1444 |
| 1010 | Ga0207680_10248151 | 3300025903 | Unclassified | 1229 |
| 1011 | Ga0207680_10398804 | 3300025903 | Bacteria | 972 |
| 1012 | Ga0207680_10472893 | 3300025903 | Bacteria | 891 |
| 1013 | Ga0207680_10830626 | 3300025903 | Unclassified | 662 |
| 1014 | Ga0207680_10909453 | 3300025903 | Unclassified | 631 |
| 1015 | Ga0207680_10955625 | 3300025903 | Bacteria | 614 |
| 1016 | Ga0207680_10996224 | 3300025903 | Unclassified | 600 |
| 1017 | Ga0207680_10997477 | 3300025903 | Bacteria | 600 |
| 1018 | Ga0207680_11212266 | 3300025903 | Unclassified | 538 |
| 1019 | Ga0207680_11221007 | 3300025903 | Unclassified | 536 |
| 1020 | Ga0207680_11306948 | 3300025903 | Unclassified | 516 |
| 1021 | Ga0207647_10782042 | 3300025904 | Unclassified | 514 |
| 1022 | Ga0207685_10053071 | 3300025905 | Bacteria | 1573 |
| 1023 | Ga0207699_10010829 | 3300025906 | Bacteria | 4591 |
| 1024 | Ga0207699_10091637 | 3300025906 | Bacteria | 1909 |
| 1025 | Ga0207645_10014261 | 3300025907 | Bacteria | 5322 |
| 1026 | Ga0207645_10242702 | 3300025907 | Bacteria | 1190 |
| 1027 | Ga0207645_10250164 | 3300025907 | Bacteria | 1172 |
| 1028 | Ga0207645_10360987 | 3300025907 | Unclassified | 973 |
| 1029 | Ga0207645_10364706 | 3300025907 | Bacteria | 968 |
| 1030 | Ga0207645_10648592 | 3300025907 | Unclassified | 717 |
| 1031 | Ga0207645_10696259 | 3300025907 | Unclassified | 691 |
| 1032 | Ga0207645_11191276 | 3300025907 | Unclassified | 512 |
| 1033 | Ga0207643_10004564 | 3300025908 | Bacteria | 7442 |
| 1034 | Ga0207643_10008987 | 3300025908 | Bacteria | 5364 |
| 1035 | Ga0207643_10035071 | 3300025908 | Bacteria | 2812 |
| 1036 | Ga0207643_10065663 | 3300025908 | Bacteria | 2079 |
| 1037 | Ga0207643_10136963 | 3300025908 | Bacteria | 1460 |
| 1038 | Ga0207643_10154565 | 3300025908 | Unclassified | 1377 |
| 1039 | Ga0207643_10156111 | 3300025908 | Bacteria | 1371 |
| 1040 | Ga0207643_10193751 | 3300025908 | Bacteria | 1235 |
| 1041 | Ga0207643_10306345 | 3300025908 | Bacteria | 989 |
| 1042 | Ga0207643_10537439 | 3300025908 | Unclassified | 749 |
| 1043 | Ga0207643_10947459 | 3300025908 | Unclassified | 557 |
| 1044 | Ga0207684_10257555 | 3300025910 | Bacteria | 1505 |
| 1045 | Ga0207684_10381313 | 3300025910 | Bacteria | 1213 |
| 1046 | Ga0207684_10622887 | 3300025910 | Unclassified | 920 |
| 1047 | Ga0207684_10812381 | 3300025910 | Bacteria | 790 |
| 1048 | Ga0207684_10912112 | 3300025910 | Bacteria | 738 |
| 1049 | Ga0207684_11163112 | 3300025910 | Bacteria | 640 |
| 1050 | Ga0207684_11426903 | 3300025910 | Unclassified | 566 |
| 1051 | Ga0207684_11557443 | 3300025910 | Bacteria | 536 |
| 1052 | Ga0207654_10177645 | 3300025911 | Unclassified | 1387 |
| 1053 | Ga0207654_11070021 | 3300025911 | Bacteria | 587 |
| 1054 | Ga0207707_10024100 | 3300025912 | Bacteria | 5322 |
| 1055 | Ga0207707_10032794 | 3300025912 | Bacteria | 4546 |
| 1056 | Ga0207707_10279831 | 3300025912 | Unclassified | 1445 |
| 1057 | Ga0207707_10601049 | 3300025912 | Bacteria | 931 |
| 1058 | Ga0207707_11121255 | 3300025912 | Bacteria | 640 |
| 1059 | Ga0207707_11520945 | 3300025912 | Bacteria | 530 |
| 1060 | Ga0207695_10529415 | 3300025913 | Bacteria | 1060 |
| 1061 | Ga0207695_10788680 | 3300025913 | Bacteria | 830 |
| 1062 | Ga0207695_11164215 | 3300025913 | Unclassified | 651 |
| 1063 | Ga0207671_10523927 | 3300025914 | Bacteria | 945 |
| 1064 | Ga0207693_10950933 | 3300025915 | Unclassified | 658 |
| 1065 | Ga0207663_10094880 | 3300025916 | Bacteria | 1989 |
| 1066 | Ga0207663_10266738 | 3300025916 | Unclassified | 1267 |
| 1067 | Ga0207663_11135376 | 3300025916 | Bacteria | 628 |
| 1068 | Ga0207660_10225449 | 3300025917 | Unclassified | 1472 |
| 1069 | Ga0207660_10265138 | 3300025917 | Unclassified | 1359 |
| 1070 | Ga0207660_10272707 | 3300025917 | Bacteria | 1340 |
| 1071 | Ga0207660_10431858 | 3300025917 | Unclassified | 1063 |
| 1072 | Ga0207660_10622017 | 3300025917 | Unclassified | 880 |
| 1073 | Ga0207660_10921116 | 3300025917 | Unclassified | 713 |
| 1074 | Ga0207660_11551999 | 3300025917 | Bacteria | 534 |
| 1075 | Ga0207662_10002904 | 3300025918 | Bacteria | 8689 |
| 1076 | Ga0207662_10011988 | 3300025918 | Bacteria | 4821 |
| 1077 | Ga0207662_10017112 | 3300025918 | Bacteria | 4098 |
| 1078 | Ga0207662_10110207 | 3300025918 | Unclassified | 1715 |
| 1079 | Ga0207662_10141593 | 3300025918 | Bacteria | 1524 |
| 1080 | Ga0207662_10356241 | 3300025918 | Unclassified | 984 |
| 1081 | Ga0207662_11183159 | 3300025918 | Unclassified | 543 |
| 1082 | Ga0207662_11370855 | 3300025918 | Unclassified | 502 |
| 1083 | Ga0207657_10188145 | 3300025919 | Bacteria | 1667 |
| 1084 | Ga0207657_10542384 | 3300025919 | Bacteria | 910 |
| 1085 | Ga0207649_10152232 | 3300025920 | Bacteria | 1594 |
| 1086 | Ga0207649_10292330 | 3300025920 | Bacteria | 1188 |
| 1087 | Ga0207649_10827093 | 3300025920 | Unclassified | 724 |
| 1088 | Ga0207649_11098679 | 3300025920 | Bacteria | 627 |
| 1089 | Ga0207649_11450030 | 3300025920 | Bacteria | 543 |
| 1090 | Ga0207652_10119412 | 3300025921 | Bacteria | 2345 |
| 1091 | Ga0207652_10121939 | 3300025921 | Bacteria | 2320 |
| 1092 | Ga0207652_10625792 | 3300025921 | Unclassified | 964 |
| 1093 | Ga0207652_10886454 | 3300025921 | Unclassified | 789 |
| 1094 | Ga0207646_10038633 | 3300025922 | Bacteria | 4298 |
| 1095 | Ga0207646_10072249 | 3300025922 | Bacteria | 3082 |
| 1096 | Ga0207646_10121718 | 3300025922 | Bacteria | 2344 |
| 1097 | Ga0207646_10242014 | 3300025922 | Unclassified | 1630 |
| 1098 | Ga0207646_10965973 | 3300025922 | Bacteria | 754 |
| 1099 | Ga0207646_11039703 | 3300025922 | Bacteria | 723 |
| 1100 | Ga0207646_11777976 | 3300025922 | Unclassified | 528 |
| 1101 | Ga0207681_10018017 | 3300025923 | Bacteria | 4443 |
| 1102 | Ga0207681_10030217 | 3300025923 | Bacteria | 3530 |
| 1103 | Ga0207681_10033207 | 3300025923 | Bacteria | 3381 |
| 1104 | Ga0207681_10043090 | 3300025923 | Bacteria | 3019 |
| 1105 | Ga0207681_10060642 | 3300025923 | Bacteria | 2597 |
| 1106 | Ga0207681_10060846 | 3300025923 | Bacteria | 2594 |
| 1107 | Ga0207681_10084558 | 3300025923 | Bacteria | 2249 |
| 1108 | Ga0207681_10129938 | 3300025923 | Bacteria | 1861 |
| 1109 | Ga0207681_10158937 | 3300025923 | Bacteria | 1701 |
| 1110 | Ga0207681_10226443 | 3300025923 | Bacteria | 1449 |
| 1111 | Ga0207681_10515486 | 3300025923 | Bacteria | 981 |
| 1112 | Ga0207681_10834221 | 3300025923 | Bacteria | 771 |
| 1113 | Ga0207694_10013622 | 3300025924 | Bacteria | 6130 |
| 1114 | Ga0207694_11132165 | 3300025924 | Bacteria | 662 |
| 1115 | Ga0207650_10028078 | 3300025925 | Bacteria | 4032 |
| 1116 | Ga0207650_10064428 | 3300025925 | Bacteria | 2743 |
| 1117 | Ga0207650_10076891 | 3300025925 | Bacteria | 2522 |
| 1118 | Ga0207650_10171181 | 3300025925 | Bacteria | 1726 |
| 1119 | Ga0207650_10214392 | 3300025925 | Bacteria | 1547 |
| 1120 | Ga0207650_10276071 | 3300025925 | Bacteria | 1367 |
| 1121 | Ga0207650_10868048 | 3300025925 | Bacteria | 766 |
| 1122 | Ga0207650_11001007 | 3300025925 | Unclassified | 711 |
| 1123 | Ga0207650_11004823 | 3300025925 | Bacteria | 709 |
| 1124 | Ga0207659_10000165 | 3300025926 | Bacteria | 39413 |
| 1125 | Ga0207659_10014307 | 3300025926 | Bacteria | 5112 |
| 1126 | Ga0207659_10014896 | 3300025926 | Bacteria | 5027 |
| 1127 | Ga0207659_10045471 | 3300025926 | Bacteria | 3095 |
| 1128 | Ga0207659_10065813 | 3300025926 | Bacteria | 2628 |
| 1129 | Ga0207659_10067674 | 3300025926 | Bacteria | 2595 |
| 1130 | Ga0207659_10089736 | 3300025926 | Bacteria | 2293 |
| 1131 | Ga0207659_10270937 | 3300025926 | Bacteria | 1385 |
| 1132 | Ga0207659_10274873 | 3300025926 | Bacteria | 1375 |
| 1133 | Ga0207659_10301783 | 3300025926 | Bacteria | 1315 |
| 1134 | Ga0207659_10324308 | 3300025926 | Unclassified | 1271 |
| 1135 | Ga0207659_10369885 | 3300025926 | Unclassified | 1193 |
| 1136 | Ga0207659_10615186 | 3300025926 | Bacteria | 927 |
| 1137 | Ga0207659_10832869 | 3300025926 | Bacteria | 793 |
| 1138 | Ga0207659_11162154 | 3300025926 | Bacteria | 664 |
| 1139 | Ga0207687_10034358 | 3300025927 | Bacteria | 3442 |
| 1140 | Ga0207687_10096210 | 3300025927 | Bacteria | 2170 |
| 1141 | Ga0207687_10162619 | 3300025927 | Bacteria | 1715 |
| 1142 | Ga0207687_10290488 | 3300025927 | Bacteria | 1314 |
| 1143 | Ga0207700_10086331 | 3300025928 | Unclassified | 2466 |
| 1144 | Ga0207700_10359270 | 3300025928 | Unclassified | 1270 |
| 1145 | Ga0207700_11587640 | 3300025928 | Bacteria | 579 |
| 1146 | Ga0207644_10022799 | 3300025931 | Bacteria | 4280 |
| 1147 | Ga0207644_10240169 | 3300025931 | Unclassified | 1442 |
| 1148 | Ga0207644_10250864 | 3300025931 | Bacteria | 1412 |
| 1149 | Ga0207644_10318543 | 3300025931 | Bacteria | 1257 |
| 1150 | Ga0207644_10706626 | 3300025931 | Bacteria | 841 |
| 1151 | Ga0207644_10723932 | 3300025931 | Bacteria | 830 |
| 1152 | Ga0207644_10768858 | 3300025931 | Bacteria | 805 |
| 1153 | Ga0207644_10967400 | 3300025931 | Bacteria | 714 |
| 1154 | Ga0207644_10974822 | 3300025931 | Bacteria | 711 |
| 1155 | Ga0207690_10215206 | 3300025932 | Bacteria | 1467 |
| 1156 | Ga0207690_10449546 | 3300025932 | Bacteria | 1035 |
| 1157 | Ga0207690_10460417 | 3300025932 | Unclassified | 1023 |
| 1158 | Ga0207690_11181628 | 3300025932 | Bacteria | 638 |
| 1159 | Ga0207690_11802667 | 3300025932 | Unclassified | 511 |
| 1160 | Ga0207706_10015695 | 3300025933 | Bacteria | 6847 |
| 1161 | Ga0207706_10068523 | 3300025933 | Bacteria | 3122 |
| 1162 | Ga0207706_10077397 | 3300025933 | Bacteria | 2925 |
| 1163 | Ga0207706_10096178 | 3300025933 | Unclassified | 2604 |
| 1164 | Ga0207706_10250863 | 3300025933 | Bacteria | 1546 |
| 1165 | Ga0207706_10357566 | 3300025933 | Unclassified | 1269 |
| 1166 | Ga0207706_11035438 | 3300025933 | Bacteria | 688 |
| 1167 | Ga0207706_11172750 | 3300025933 | Unclassified | 639 |
| 1168 | Ga0207706_11582591 | 3300025933 | Unclassified | 532 |
| 1169 | Ga0207706_11680527 | 3300025933 | Bacteria | 512 |
| 1170 | Ga0207686_10031500 | 3300025934 | Bacteria | 3150 |
| 1171 | Ga0207686_10048667 | 3300025934 | Bacteria | 2627 |
| 1172 | Ga0207686_10193033 | 3300025934 | Bacteria | 1453 |
| 1173 | Ga0207686_10205680 | 3300025934 | Unclassified | 1412 |
| 1174 | Ga0207686_10213253 | 3300025934 | Unclassified | 1389 |
| 1175 | Ga0207686_10279108 | 3300025934 | Unclassified | 1232 |
| 1176 | Ga0207686_10306610 | 3300025934 | Bacteria | 1181 |
| 1177 | Ga0207686_10414150 | 3300025934 | Bacteria | 1029 |
| 1178 | Ga0207686_10626753 | 3300025934 | Unclassified | 849 |
| 1179 | Ga0207686_10758118 | 3300025934 | Bacteria | 775 |
| 1180 | Ga0207709_10003211 | 3300025935 | Bacteria | 9827 |
| 1181 | Ga0207709_10019406 | 3300025935 | Bacteria | 3822 |
| 1182 | Ga0207709_10023716 | 3300025935 | Bacteria | 3495 |
| 1183 | Ga0207709_10034561 | 3300025935 | Bacteria | 2980 |
| 1184 | Ga0207709_10155331 | 3300025935 | Bacteria | 1589 |
| 1185 | Ga0207709_10570687 | 3300025935 | Bacteria | 892 |
| 1186 | Ga0207709_10584420 | 3300025935 | Bacteria | 882 |
| 1187 | Ga0207709_10678031 | 3300025935 | Unclassified | 823 |
| 1188 | Ga0207670_10009012 | 3300025936 | Bacteria | 5664 |
| 1189 | Ga0207670_10139424 | 3300025936 | Bacteria | 1786 |
| 1190 | Ga0207670_10226134 | 3300025936 | Unclassified | 1435 |
| 1191 | Ga0207670_10318199 | 3300025936 | Unclassified | 1224 |
| 1192 | Ga0207670_10496393 | 3300025936 | Unclassified | 990 |
| 1193 | Ga0207670_10537851 | 3300025936 | Bacteria | 953 |
| 1194 | Ga0207670_10635179 | 3300025936 | Bacteria | 879 |
| 1195 | Ga0207670_10727907 | 3300025936 | Unclassified | 823 |
| 1196 | Ga0207670_10740851 | 3300025936 | Bacteria | 816 |
| 1197 | Ga0207670_10946453 | 3300025936 | Bacteria | 723 |
| 1198 | Ga0207670_11167465 | 3300025936 | Unclassified | 651 |
| 1199 | Ga0207670_11797082 | 3300025936 | Bacteria | 521 |
| 1200 | Ga0207669_10008814 | 3300025937 | Bacteria | 4758 |
| 1201 | Ga0207669_10369871 | 3300025937 | Unclassified | 1114 |
| 1202 | Ga0207669_10400745 | 3300025937 | Unclassified | 1075 |
| 1203 | Ga0207669_10575256 | 3300025937 | Bacteria | 912 |
| 1204 | Ga0207669_10749922 | 3300025937 | Unclassified | 806 |
| 1205 | Ga0207669_11085890 | 3300025937 | Unclassified | 675 |
| 1206 | Ga0207669_11677889 | 3300025937 | Bacteria | 543 |
| 1207 | Ga0207669_11918973 | 3300025937 | Unclassified | 506 |
| 1208 | Ga0207669_11928588 | 3300025937 | Unclassified | 505 |
| 1209 | Ga0207704_10009747 | 3300025938 | Bacteria | 4651 |
| 1210 | Ga0207704_10022277 | 3300025938 | Bacteria | 3391 |
| 1211 | Ga0207704_10068788 | 3300025938 | Bacteria | 2234 |
| 1212 | Ga0207704_10197852 | 3300025938 | Bacteria | 1468 |
| 1213 | Ga0207704_10369956 | 3300025938 | Bacteria | 1122 |
| 1214 | Ga0207704_10405746 | 3300025938 | Unclassified | 1077 |
| 1215 | Ga0207704_10603234 | 3300025938 | Bacteria | 899 |
| 1216 | Ga0207704_10646160 | 3300025938 | Bacteria | 871 |
| 1217 | Ga0207704_10963292 | 3300025938 | Bacteria | 720 |
| 1218 | Ga0207704_11535749 | 3300025938 | Unclassified | 572 |
| 1219 | Ga0207665_10069360 | 3300025939 | Bacteria | 2404 |
| 1220 | Ga0207665_10352338 | 3300025939 | Bacteria | 1111 |
| 1221 | Ga0207665_10441477 | 3300025939 | Bacteria | 997 |
| 1222 | Ga0207691_10015223 | 3300025940 | Bacteria | 7318 |
| 1223 | Ga0207691_10028979 | 3300025940 | Bacteria | 5181 |
| 1224 | Ga0207691_10034416 | 3300025940 | Bacteria | 4710 |
| 1225 | Ga0207691_10042880 | 3300025940 | Bacteria | 4170 |
| 1226 | Ga0207691_10045474 | 3300025940 | Bacteria | 4035 |
| 1227 | Ga0207691_10057115 | 3300025940 | Bacteria | 3553 |
| 1228 | Ga0207691_10072796 | 3300025940 | Bacteria | 3100 |
| 1229 | Ga0207691_10164347 | 3300025940 | Bacteria | 1946 |
| 1230 | Ga0207691_10588403 | 3300025940 | Bacteria | 942 |
| 1231 | Ga0207691_10769479 | 3300025940 | Bacteria | 810 |
| 1232 | Ga0207691_10962129 | 3300025940 | Unclassified | 713 |
| 1233 | Ga0207691_11056678 | 3300025940 | Bacteria | 676 |
| 1234 | Ga0207691_11172131 | 3300025940 | Bacteria | 638 |
| 1235 | Ga0207691_11526656 | 3300025940 | Bacteria | 545 |
| 1236 | Ga0207711_10049790 | 3300025941 | Bacteria | 3587 |
| 1237 | Ga0207711_10091868 | 3300025941 | Bacteria | 2670 |
| 1238 | Ga0207711_10131402 | 3300025941 | Bacteria | 2245 |
| 1239 | Ga0207711_10245490 | 3300025941 | Bacteria | 1643 |
| 1240 | Ga0207711_10308424 | 3300025941 | Bacteria | 1461 |
| 1241 | Ga0207711_10334302 | 3300025941 | Bacteria | 1401 |
| 1242 | Ga0207711_10688196 | 3300025941 | Bacteria | 954 |
| 1243 | Ga0207711_11090561 | 3300025941 | Bacteria | 739 |
| 1244 | Ga0207689_10000643 | 3300025942 | Bacteria | 33304 |
| 1245 | Ga0207689_10012520 | 3300025942 | Bacteria | 7247 |
| 1246 | Ga0207689_10027940 | 3300025942 | Bacteria | 4720 |
| 1247 | Ga0207689_10112350 | 3300025942 | Bacteria | 2240 |
| 1248 | Ga0207689_10307612 | 3300025942 | Unclassified | 1314 |
| 1249 | Ga0207689_10403197 | 3300025942 | Bacteria | 1140 |
| 1250 | Ga0207689_10595304 | 3300025942 | Unclassified | 930 |
| 1251 | Ga0207689_10693756 | 3300025942 | Unclassified | 858 |
| 1252 | Ga0207689_10699686 | 3300025942 | Unclassified | 855 |
| 1253 | Ga0207689_10965934 | 3300025942 | Unclassified | 719 |
| 1254 | Ga0207689_11224060 | 3300025942 | Bacteria | 632 |
| 1255 | Ga0207661_10024608 | 3300025944 | Bacteria | 4565 |
| 1256 | Ga0207661_10163985 | 3300025944 | Bacteria | 1930 |
| 1257 | Ga0207661_10876146 | 3300025944 | Unclassified | 827 |
| 1258 | Ga0207661_11404642 | 3300025944 | Bacteria | 641 |
| 1259 | Ga0207679_10005908 | 3300025945 | Bacteria | 7696 |
| 1260 | Ga0207679_10031345 | 3300025945 | Bacteria | 3720 |
| 1261 | Ga0207679_10065947 | 3300025945 | Bacteria | 2711 |
| 1262 | Ga0207679_10088086 | 3300025945 | Bacteria | 2392 |
| 1263 | Ga0207679_10092172 | 3300025945 | Unclassified | 2347 |
| 1264 | Ga0207679_10430540 | 3300025945 | Unclassified | 1166 |
| 1265 | Ga0207679_10439324 | 3300025945 | Unclassified | 1155 |
| 1266 | Ga0207679_10594321 | 3300025945 | Unclassified | 997 |
| 1267 | Ga0207679_10598109 | 3300025945 | Unclassified | 994 |
| 1268 | Ga0207679_10689792 | 3300025945 | Bacteria | 926 |
| 1269 | Ga0207679_10799201 | 3300025945 | Bacteria | 860 |
| 1270 | Ga0207679_10825695 | 3300025945 | Bacteria | 846 |
| 1271 | Ga0207679_10919010 | 3300025945 | Bacteria | 801 |
| 1272 | Ga0207679_11153628 | 3300025945 | Bacteria | 711 |
| 1273 | Ga0207679_11525040 | 3300025945 | Unclassified | 613 |
| 1274 | Ga0207679_12005714 | 3300025945 | Bacteria | 527 |
| 1275 | Ga0207667_10309437 | 3300025949 | Unclassified | 1614 |
| 1276 | Ga0207667_11210429 | 3300025949 | Bacteria | 735 |
| 1277 | Ga0207651_10007557 | 3300025960 | Bacteria | 5797 |
| 1278 | Ga0207651_10016199 | 3300025960 | Bacteria | 4358 |
| 1279 | Ga0207651_10041108 | 3300025960 | Bacteria | 3066 |
| 1280 | Ga0207651_10046772 | 3300025960 | Unclassified | 2913 |
| 1281 | Ga0207651_10052086 | 3300025960 | Bacteria | 2789 |
| 1282 | Ga0207651_10166720 | 3300025960 | Bacteria | 1733 |
| 1283 | Ga0207651_10167347 | 3300025960 | Bacteria | 1730 |
| 1284 | Ga0207651_10278176 | 3300025960 | Bacteria | 1382 |
| 1285 | Ga0207651_10449675 | 3300025960 | Unclassified | 1105 |
| 1286 | Ga0207651_10674156 | 3300025960 | Bacteria | 909 |
| 1287 | Ga0207651_10744216 | 3300025960 | Bacteria | 866 |
| 1288 | Ga0207651_10894005 | 3300025960 | Bacteria | 791 |
| 1289 | Ga0207651_10927054 | 3300025960 | Unclassified | 776 |
| 1290 | Ga0207651_11071257 | 3300025960 | Bacteria | 722 |
| 1291 | Ga0207651_11119671 | 3300025960 | Bacteria | 706 |
| 1292 | Ga0207651_11147183 | 3300025960 | Bacteria | 697 |
| 1293 | Ga0207651_11545355 | 3300025960 | Unclassified | 598 |
| 1294 | Ga0207651_11982127 | 3300025960 | Bacteria | 523 |
| 1295 | Ga0207712_10017338 | 3300025961 | Bacteria | 4676 |
| 1296 | Ga0207712_10200611 | 3300025961 | Bacteria | 1582 |
| 1297 | Ga0207712_10319392 | 3300025961 | Bacteria | 1281 |
| 1298 | Ga0207712_10445306 | 3300025961 | Bacteria | 1097 |
| 1299 | Ga0207712_10665168 | 3300025961 | Bacteria | 906 |
| 1300 | Ga0207712_11546699 | 3300025961 | Unclassified | 594 |
| 1301 | Ga0207668_10023731 | 3300025972 | Bacteria | 3948 |
| 1302 | Ga0207668_10106115 | 3300025972 | Bacteria | 2098 |
| 1303 | Ga0207668_10251701 | 3300025972 | Unclassified | 1435 |
| 1304 | Ga0207668_10670254 | 3300025972 | Unclassified | 909 |
| 1305 | Ga0207668_10832751 | 3300025972 | Bacteria | 818 |
| 1306 | Ga0207668_11029862 | 3300025972 | Bacteria | 736 |
| 1307 | Ga0207668_11210671 | 3300025972 | Bacteria | 679 |
| 1308 | Ga0207640_10026642 | 3300025981 | Bacteria | 3513 |
| 1309 | Ga0207640_10103802 | 3300025981 | Bacteria | 1999 |
| 1310 | Ga0207640_10591060 | 3300025981 | Unclassified | 938 |
| 1311 | Ga0207640_10826655 | 3300025981 | Bacteria | 804 |
| 1312 | Ga0207640_10869540 | 3300025981 | Bacteria | 785 |
| 1313 | Ga0207640_10947345 | 3300025981 | Bacteria | 754 |
| 1314 | Ga0207640_11397624 | 3300025981 | Unclassified | 627 |
| 1315 | Ga0207658_10069509 | 3300025986 | Bacteria | 2661 |
| 1316 | Ga0207658_10095471 | 3300025986 | Bacteria | 2317 |
| 1317 | Ga0207658_10226337 | 3300025986 | Unclassified | 1576 |
| 1318 | Ga0207658_10314518 | 3300025986 | Bacteria | 1354 |
| 1319 | Ga0207658_11660041 | 3300025986 | Unclassified | 584 |
| 1320 | Ga0207677_10169465 | 3300026023 | Unclassified | 1706 |
| 1321 | Ga0207677_10668226 | 3300026023 | Bacteria | 919 |
| 1322 | Ga0207677_10900899 | 3300026023 | Unclassified | 797 |
| 1323 | Ga0207677_11093760 | 3300026023 | Bacteria | 726 |
| 1324 | Ga0207677_11235143 | 3300026023 | Bacteria | 685 |
| 1325 | Ga0207677_11403119 | 3300026023 | Bacteria | 643 |
| 1326 | Ga0207677_11760033 | 3300026023 | Bacteria | 575 |
| 1327 | Ga0207703_10006564 | 3300026035 | Bacteria | 9281 |
| 1328 | Ga0207703_10012636 | 3300026035 | Bacteria | 6583 |
| 1329 | Ga0207703_10016387 | 3300026035 | Bacteria | 5777 |
| 1330 | Ga0207703_10045106 | 3300026035 | Bacteria | 3545 |
| 1331 | Ga0207703_10100769 | 3300026035 | Bacteria | 2448 |
| 1332 | Ga0207703_10148031 | 3300026035 | Bacteria | 2044 |
| 1333 | Ga0207703_10162401 | 3300026035 | Bacteria | 1957 |
| 1334 | Ga0207703_10285938 | 3300026035 | Unclassified | 1499 |
| 1335 | Ga0207703_10314417 | 3300026035 | Bacteria | 1432 |
| 1336 | Ga0207703_10428486 | 3300026035 | Bacteria | 1232 |
| 1337 | Ga0207703_10664248 | 3300026035 | Bacteria | 989 |
| 1338 | Ga0207703_10950113 | 3300026035 | Unclassified | 824 |
| 1339 | Ga0207703_11114922 | 3300026035 | Unclassified | 758 |
| 1340 | Ga0207703_11396596 | 3300026035 | Bacteria | 673 |
| 1341 | Ga0207639_10338372 | 3300026041 | Bacteria | 1341 |
| 1342 | Ga0207639_11101652 | 3300026041 | Bacteria | 745 |
| 1343 | Ga0207639_11295974 | 3300026041 | Bacteria | 684 |
| 1344 | Ga0207639_11299872 | 3300026041 | Bacteria | 683 |
| 1345 | Ga0207639_12260954 | 3300026041 | Unclassified | 505 |
| 1346 | Ga0207678_10025441 | 3300026067 | Bacteria | 5166 |
| 1347 | Ga0207678_10362109 | 3300026067 | Unclassified | 1252 |
| 1348 | Ga0207678_10731721 | 3300026067 | Bacteria | 872 |
| 1349 | Ga0207678_10897194 | 3300026067 | Bacteria | 784 |
| 1350 | Ga0207708_10018340 | 3300026075 | Bacteria | 5271 |
| 1351 | Ga0207708_10040694 | 3300026075 | Bacteria | 3543 |
| 1352 | Ga0207708_10096306 | 3300026075 | Unclassified | 2287 |
| 1353 | Ga0207708_10128468 | 3300026075 | Unclassified | 1980 |
| 1354 | Ga0207708_10133563 | 3300026075 | Bacteria | 1942 |
| 1355 | Ga0207708_10200597 | 3300026075 | Bacteria | 1592 |
| 1356 | Ga0207708_10422587 | 3300026075 | Bacteria | 1105 |
| 1357 | Ga0207708_10525207 | 3300026075 | Unclassified | 995 |
| 1358 | Ga0207708_10734479 | 3300026075 | Unclassified | 846 |
| 1359 | Ga0207708_11328993 | 3300026075 | Unclassified | 630 |
| 1360 | Ga0207708_11626520 | 3300026075 | Unclassified | 567 |
| 1361 | Ga0207708_11988270 | 3300026075 | Bacteria | 509 |
| 1362 | Ga0207641_10000431 | 3300026088 | Bacteria | 48383 |
| 1363 | Ga0207641_10031847 | 3300026088 | Bacteria | 4375 |
| 1364 | Ga0207641_10036202 | 3300026088 | Bacteria | 4119 |
| 1365 | Ga0207641_10206608 | 3300026088 | Bacteria | 1814 |
| 1366 | Ga0207641_10252308 | 3300026088 | Unclassified | 1648 |
| 1367 | Ga0207641_10264777 | 3300026088 | Bacteria | 1611 |
| 1368 | Ga0207641_10441704 | 3300026088 | Bacteria | 1256 |
| 1369 | Ga0207641_10468946 | 3300026088 | Bacteria | 1219 |
| 1370 | Ga0207641_10645218 | 3300026088 | Unclassified | 1039 |
| 1371 | Ga0207641_12167456 | 3300026088 | Bacteria | 556 |
| 1372 | Ga0207648_10002155 | 3300026089 | Bacteria | 21410 |
| 1373 | Ga0207648_10018357 | 3300026089 | Bacteria | 6336 |
| 1374 | Ga0207648_10026873 | 3300026089 | Bacteria | 5111 |
| 1375 | Ga0207648_10030598 | 3300026089 | Bacteria | 4765 |
| 1376 | Ga0207648_10031427 | 3300026089 | Bacteria | 4695 |
| 1377 | Ga0207648_10087590 | 3300026089 | Bacteria | 2717 |
| 1378 | Ga0207648_10156347 | 3300026089 | Bacteria | 2013 |
| 1379 | Ga0207648_10277219 | 3300026089 | Bacteria | 1499 |
| 1380 | Ga0207648_10360323 | 3300026089 | Bacteria | 1312 |
| 1381 | Ga0207648_10362586 | 3300026089 | Bacteria | 1308 |
| 1382 | Ga0207648_10851950 | 3300026089 | Bacteria | 850 |
| 1383 | Ga0207648_11751664 | 3300026089 | Bacteria | 583 |
| 1384 | Ga0207648_11949796 | 3300026089 | Unclassified | 549 |
| 1385 | Ga0207648_11989844 | 3300026089 | Unclassified | 542 |
| 1386 | Ga0207676_10030791 | 3300026095 | Bacteria | 4031 |
| 1387 | Ga0207676_10032794 | 3300026095 | Bacteria | 3918 |
| 1388 | Ga0207676_10055223 | 3300026095 | Bacteria | 3117 |
| 1389 | Ga0207676_10067449 | 3300026095 | Unclassified | 2858 |
| 1390 | Ga0207676_10070230 | 3300026095 | Bacteria | 2808 |
| 1391 | Ga0207676_10090359 | 3300026095 | Unclassified | 2513 |
| 1392 | Ga0207676_10132256 | 3300026095 | Bacteria | 2123 |
| 1393 | Ga0207676_10211203 | 3300026095 | Bacteria | 1722 |
| 1394 | Ga0207676_10322560 | 3300026095 | Bacteria | 1418 |
| 1395 | Ga0207676_10409868 | 3300026095 | Unclassified | 1269 |
| 1396 | Ga0207676_10823230 | 3300026095 | Bacteria | 907 |
| 1397 | Ga0207676_11198411 | 3300026095 | Bacteria | 752 |
| 1398 | Ga0207676_11809298 | 3300026095 | Unclassified | 609 |
| 1399 | Ga0207676_11883429 | 3300026095 | Unclassified | 597 |
| 1400 | Ga0207674_10006828 | 3300026116 | Bacteria | 13385 |
| 1401 | Ga0207674_10091271 | 3300026116 | Bacteria | 3036 |
| 1402 | Ga0207674_10142420 | 3300026116 | Bacteria | 2357 |
| 1403 | Ga0207674_10161299 | 3300026116 | Bacteria | 2196 |
| 1404 | Ga0207674_10187239 | 3300026116 | Bacteria | 2020 |
| 1405 | Ga0207674_10257171 | 3300026116 | Unclassified | 1693 |
| 1406 | Ga0207674_10374322 | 3300026116 | Bacteria | 1377 |
| 1407 | Ga0207674_11130554 | 3300026116 | Bacteria | 753 |
| 1408 | Ga0207675_100004553 | 3300026118 | Bacteria | 13372 |
| 1409 | Ga0207675_100009694 | 3300026118 | Bacteria | 9010 |
| 1410 | Ga0207675_100014548 | 3300026118 | Bacteria | 7335 |
| 1411 | Ga0207675_100197314 | 3300026118 | Unclassified | 1932 |
| 1412 | Ga0207675_100210134 | 3300026118 | Unclassified | 1871 |
| 1413 | Ga0207675_100239658 | 3300026118 | Bacteria | 1752 |
| 1414 | Ga0207675_100447241 | 3300026118 | Bacteria | 1280 |
| 1415 | Ga0207675_100687561 | 3300026118 | Unclassified | 1031 |
| 1416 | Ga0207675_100920913 | 3300026118 | Bacteria | 891 |
| 1417 | Ga0207675_101042616 | 3300026118 | Bacteria | 837 |
| 1418 | Ga0207675_101207690 | 3300026118 | Unclassified | 776 |
| 1419 | Ga0207675_101627606 | 3300026118 | Bacteria | 666 |
| 1420 | Ga0207683_10008415 | 3300026121 | Bacteria | 8830 |
| 1421 | Ga0207683_10010954 | 3300026121 | Bacteria | 7733 |
| 1422 | Ga0207683_10142568 | 3300026121 | Bacteria | 2159 |
| 1423 | Ga0207683_10179410 | 3300026121 | Unclassified | 1920 |
| 1424 | Ga0207683_10256864 | 3300026121 | Bacteria | 1595 |
| 1425 | Ga0207683_10379802 | 3300026121 | Bacteria | 1299 |
| 1426 | Ga0207683_10486276 | 3300026121 | Unclassified | 1139 |
| 1427 | Ga0207683_10549442 | 3300026121 | Bacteria | 1068 |
| 1428 | Ga0207683_10552254 | 3300026121 | Bacteria | 1065 |
| 1429 | Ga0207683_10577111 | 3300026121 | Bacteria | 1040 |
| 1430 | Ga0207683_10837759 | 3300026121 | Unclassified | 854 |
| 1431 | Ga0207683_10859681 | 3300026121 | Unclassified | 842 |
| 1432 | Ga0207683_11922119 | 3300026121 | Bacteria | 540 |
| 1433 | Ga0207698_10147970 | 3300026142 | Bacteria | 2034 |
| 1434 | Ga0207698_10255878 | 3300026142 | Bacteria | 1605 |
| 1435 | Ga0207698_10679312 | 3300026142 | Bacteria | 1023 |
| 1436 | Ga0207698_10717755 | 3300026142 | Bacteria | 996 |
| 1437 | Ga0207698_10930436 | 3300026142 | Bacteria | 878 |
| 1438 | Ga0209981_1071703 | 3300027378 | Bacteria | 535 |
| 1439 | Ga0209968_1088074 | 3300027526 | Unclassified | 562 |
| 1440 | Ga0209974_10319506 | 3300027876 | Unclassified | 597 |
| 1441 | Ga0209974_10320713 | 3300027876 | Unclassified | 596 |
| 1442 | Ga0207428_10000527 | 3300027907 | Bacteria | 45656 |
| 1443 | Ga0207428_10004414 | 3300027907 | Bacteria | 13390 |
| 1444 | Ga0207428_10017113 | 3300027907 | Bacteria | 6228 |
| 1445 | Ga0207428_10142308 | 3300027907 | Bacteria | 1829 |
| 1446 | Ga0207428_10150857 | 3300027907 | Bacteria | 1769 |
| 1447 | Ga0207428_10241319 | 3300027907 | Unclassified | 1350 |
| 1448 | Ga0207428_10294418 | 3300027907 | Unclassified | 1202 |
| 1449 | Ga0207428_10321461 | 3300027907 | Bacteria | 1143 |
| 1450 | Ga0207428_10402596 | 3300027907 | Unclassified | 1002 |
| 1451 | Ga0207428_10491164 | 3300027907 | Unclassified | 892 |
| 1452 | Ga0207428_10494367 | 3300027907 | Unclassified | 889 |
| 1453 | Ga0207428_10734045 | 3300027907 | Unclassified | 705 |
| 1454 | Ga0207428_10914384 | 3300027907 | Bacteria | 619 |
| 1455 | Ga0268266_10009542 | 3300028379 | Bacteria | 8540 |
| 1456 | Ga0268266_10130451 | 3300028379 | Bacteria | 2247 |
| 1457 | Ga0268266_10726883 | 3300028379 | Bacteria | 958 |
| 1458 | Ga0268266_10927708 | 3300028379 | Bacteria | 842 |
| 1459 | Ga0268266_11027035 | 3300028379 | Bacteria | 798 |
| 1460 | Ga0268266_11314676 | 3300028379 | Unclassified | 698 |
| 1461 | Ga0268266_11389472 | 3300028379 | Unclassified | 678 |
| 1462 | Ga0268265_10001463 | 3300028380 | Bacteria | 19839 |
| 1463 | Ga0268265_10009722 | 3300028380 | Bacteria | 6491 |
| 1464 | Ga0268265_10077817 | 3300028380 | Bacteria | 2606 |
| 1465 | Ga0268265_10144587 | 3300028380 | Bacteria | 1996 |
| 1466 | Ga0268265_10146120 | 3300028380 | Bacteria | 1987 |
| 1467 | Ga0268265_10223835 | 3300028380 | Unclassified | 1648 |
| 1468 | Ga0268265_10483891 | 3300028380 | Bacteria | 1163 |
| 1469 | Ga0268265_10985565 | 3300028380 | Bacteria | 832 |
| 1470 | Ga0268265_11108192 | 3300028380 | Unclassified | 786 |
| 1471 | Ga0268265_11196130 | 3300028380 | Unclassified | 757 |
| 1472 | Ga0268265_11263798 | 3300028380 | Unclassified | 737 |
| 1473 | Ga0268265_11294758 | 3300028380 | Unclassified | 729 |
| 1474 | Ga0268265_11297125 | 3300028380 | Unclassified | 728 |
| 1475 | Ga0268265_11440996 | 3300028380 | Unclassified | 691 |
| 1476 | Ga0268265_11643542 | 3300028380 | Bacteria | 648 |
| 1477 | Ga0268264_10011300 | 3300028381 | Bacteria | 7376 |
| 1478 | Ga0268264_10064504 | 3300028381 | Bacteria | 3083 |
| 1479 | Ga0268264_10145089 | 3300028381 | Bacteria | 2121 |
| 1480 | Ga0268264_10259747 | 3300028381 | Bacteria | 1617 |
| 1481 | Ga0268264_10427837 | 3300028381 | Bacteria | 1278 |
| 1482 | Ga0268264_10429280 | 3300028381 | Bacteria | 1276 |
| 1483 | Ga0268264_10446884 | 3300028381 | Unclassified | 1252 |
| 1484 | Ga0268264_10570671 | 3300028381 | Unclassified | 1112 |
| 1485 | Ga0268264_10715505 | 3300028381 | Bacteria | 995 |
| 1486 | Ga0268264_10743360 | 3300028381 | Bacteria | 977 |
| 1487 | Ga0268264_11101824 | 3300028381 | Unclassified | 802 |
| 1488 | Ga0268264_11109541 | 3300028381 | Bacteria | 800 |
| 1489 | Ga0268264_11544391 | 3300028381 | Unclassified | 674 |
| 1490 | Ga0268264_11783778 | 3300028381 | Bacteria | 625 |
| 1491 | Ga0265318_10401734 | 3300028577 | Unclassified | 501 |
| 1492 | Ga0307511_10228856 | 3300030521 | Unclassified | 923 |
| 1493 | Ga0316177_1067784 | 3300030731 | Bacteria | 741 |
| 1494 | Ga0307408_100065395 | 3300031548 | Unclassified | 2667 |
| 1495 | Ga0307408_100335153 | 3300031548 | Unclassified | 1279 |
| 1496 | Ga0307408_100340286 | 3300031548 | Unclassified | 1270 |
| 1497 | Ga0307408_100613114 | 3300031548 | Unclassified | 968 |
| 1498 | Ga0307408_100690569 | 3300031548 | Unclassified | 916 |
| 1499 | Ga0307408_101565426 | 3300031548 | Bacteria | 625 |
| 1500 | Ga0307405_10020527 | 3300031731 | Bacteria | 3694 |
| 1501 | Ga0307405_10046873 | 3300031731 | Bacteria | 2659 |
| 1502 | Ga0307405_10103027 | 3300031731 | Unclassified | 1918 |
| 1503 | Ga0307405_10731235 | 3300031731 | Bacteria | 823 |
| 1504 | Ga0307405_10843144 | 3300031731 | Bacteria | 771 |
| 1505 | Ga0307405_11458077 | 3300031731 | Unclassified | 600 |
| 1506 | Ga0307413_10024650 | 3300031824 | Bacteria | 3283 |
| 1507 | Ga0307413_10148712 | 3300031824 | Bacteria | 1629 |
| 1508 | Ga0307413_10450460 | 3300031824 | Bacteria | 1021 |
| 1509 | Ga0307413_10702311 | 3300031824 | Bacteria | 840 |
| 1510 | Ga0307413_10808995 | 3300031824 | Bacteria | 788 |
| 1511 | Ga0307410_10002707 | 3300031852 | Bacteria | 8651 |
| 1512 | Ga0307410_10018326 | 3300031852 | Bacteria | 4229 |
| 1513 | Ga0307410_10320242 | 3300031852 | Bacteria | 1230 |
| 1514 | Ga0307410_10780237 | 3300031852 | Unclassified | 811 |
| 1515 | Ga0307410_12030454 | 3300031852 | Bacteria | 513 |
| 1516 | Ga0307406_10084061 | 3300031901 | Bacteria | 2124 |
| 1517 | Ga0307406_10188675 | 3300031901 | Bacteria | 1507 |
| 1518 | Ga0307407_10005552 | 3300031903 | Bacteria | 5488 |
| 1519 | Ga0307407_10162816 | 3300031903 | Bacteria | 1461 |
| 1520 | Ga0307412_10046165 | 3300031911 | Bacteria | 2853 |
| 1521 | Ga0307412_10068745 | 3300031911 | Bacteria | 2409 |
| 1522 | Ga0307412_10092398 | 3300031911 | Unclassified | 2120 |
| 1523 | Ga0307412_10112945 | 3300031911 | Bacteria | 1943 |
| 1524 | Ga0307409_100142461 | 3300031995 | Bacteria | 2067 |
| 1525 | Ga0307409_100178191 | 3300031995 | Bacteria | 1878 |
| 1526 | Ga0307409_100640346 | 3300031995 | Unclassified | 1056 |
| 1527 | Ga0307409_100684838 | 3300031995 | Unclassified | 1023 |
| 1528 | Ga0307416_100018347 | 3300032002 | Bacteria | 4926 |
| 1529 | Ga0307416_100037547 | 3300032002 | Bacteria | 3728 |
| 1530 | Ga0307416_100049139 | 3300032002 | Bacteria | 3352 |
| 1531 | Ga0307416_100057896 | 3300032002 | Bacteria | 3138 |
| 1532 | Ga0307416_100834107 | 3300032002 | Bacteria | 1019 |
| 1533 | Ga0307416_101458423 | 3300032002 | Unclassified | 790 |
| 1534 | Ga0307416_102673387 | 3300032002 | Unclassified | 596 |
| 1535 | Ga0307416_102931836 | 3300032002 | Bacteria | 571 |
| 1536 | Ga0307414_10014285 | 3300032004 | Bacteria | 4755 |
| 1537 | Ga0307414_11737759 | 3300032004 | Bacteria | 582 |
| 1538 | Ga0307414_12311757 | 3300032004 | Unclassified | 502 |
| 1539 | Ga0307411_10003895 | 3300032005 | Bacteria | 7037 |
| 1540 | Ga0307411_10007445 | 3300032005 | Bacteria | 5577 |
| 1541 | Ga0307411_10041606 | 3300032005 | Unclassified | 2925 |
| 1542 | Ga0307411_10080942 | 3300032005 | Bacteria | 2235 |
| 1543 | Ga0307411_10196221 | 3300032005 | Bacteria | 1546 |
| 1544 | Ga0307411_10518552 | 3300032005 | Unclassified | 1011 |
| 1545 | Ga0307411_10715944 | 3300032005 | Bacteria | 873 |
| 1546 | Ga0307411_11534026 | 3300032005 | Bacteria | 613 |
| 1547 | Ga0307411_12039251 | 3300032005 | Bacteria | 536 |
| 1548 | Ga0307415_100010976 | 3300032126 | Bacteria | 5158 |
| 1549 | Ga0307415_100076840 | 3300032126 | Bacteria | 2369 |
| 1550 | Ga0307415_100204903 | 3300032126 | Bacteria | 1568 |
| 1551 | Ga0307415_100827319 | 3300032126 | Unclassified | 848 |
| 1552 | Ga0307415_102546267 | 3300032126 | Bacteria | 504 |
| 1553 | Ga0373930_0004713 | 3300034816 | Unclassified | 2234 |
| 1554 | Ga0373948_0005040 | 3300034817 | Bacteria | 2118 |
| 1555 | Ga0373950_0000276 | 3300034818 | Bacteria | 6482 |
| 1556 | Ga0373958_0076447 | 3300034819 | Bacteria | 751 |
| 1557 | Ga0373958_0082838 | 3300034819 | Bacteria | 729 |
| 1558 | Ga0373959_0001408 | 3300034820 | Bacteria | 3844 |
| 1559 | Ga0373938_0023830 | 3300034957 | Unclassified | 1261 |
| 1560 | Ga0373928_0001861 | 3300035084 | Bacteria | 4118 |
| 1561 | Ga0373928_0060923 | 3300035084 | Bacteria | 913 |
| 1562 | Ga0373928_0224993 | 3300035084 | Unclassified | 550 |
| 1563 | Ga0373929_0001848 | 3300035085 | Bacteria | 3967 |
| 1564 | Ga0373934_0068660 | 3300035086 | Unclassified | 1416 |
| 1565 | Ga0373940_0010101 | 3300035088 | Unclassified | 2211 |
| 1566 | Ga0373940_0010283 | 3300035088 | Bacteria | 2196 |
| 1567 | Ga0373940_0317709 | 3300035088 | Bacteria | 540 |
| 1568 | Ga0373944_0129337 | 3300035089 | Bacteria | 877 |
| 1569 | Ga0373949_0005325 | 3300035090 | Bacteria | 2874 |
| 1570 | Ga0373951_0000713 | 3300035091 | Bacteria | 9122 |
| 1571 | Ga0373952_0015128 | 3300035092 | Bacteria | 1554 |
| 1572 | Ga0373923_0066682 | 3300035111 | Bacteria | 1538 |
| 1573 | Ga0373923_0354952 | 3300035111 | Bacteria | 701 |
| 1574 | Ga0373923_0624523 | 3300035111 | Unclassified | 532 |
| 1575 | Ga0373932_0000374 | 3300035112 | Bacteria | 13771 |
| 1576 | Ga0373936_0097095 | 3300035113 | Unclassified | 1240 |
| 1577 | Ga0373939_0007192 | 3300035114 | Bacteria | 2699 |
| 1578 | Ga0373941_0000482 | 3300035115 | Bacteria | 7964 |
| 1579 | Ga0373941_0072643 | 3300035115 | Bacteria | 1145 |
| 1580 | Ga0373941_0143507 | 3300035115 | Bacteria | 870 |
| 1581 | Ga0373941_0392162 | 3300035115 | Bacteria | 573 |
| 1582 | Ga0373945_0108029 | 3300035116 | Bacteria | 1095 |
| 1583 | Ga0373945_0334156 | 3300035116 | Bacteria | 654 |
| 1584 | Ga0373953_0125717 | 3300035117 | Unclassified | 1091 |
| 1585 | Ga0373954_0264189 | 3300035118 | Bacteria | 848 |
| 1586 | Ga0373954_0283438 | 3300035118 | Bacteria | 817 |
| 1587 | Ga0373954_0472783 | 3300035118 | Unclassified | 621 |
| 1588 | Ga0373954_0564697 | 3300035118 | Unclassified | 564 |
| 1589 | Ga0373956_0235062 | 3300035119 | Bacteria | 871 |
| 1590 | Ga0373956_0385097 | 3300035119 | Unclassified | 669 |
| 1591 | Ga0373957_0264647 | 3300035120 | Unclassified | 725 |
| 1592 | Ga0373960_0000304 | 3300035121 | Bacteria | 9361 |
| 1593 | Ga0373960_0037020 | 3300035121 | Bacteria | 1393 |
| 1594 | Ga0373943_0008686 | 3300035170 | Bacteria | 4555 |
| 1595 | Ga0373943_0166348 | 3300035170 | Unclassified | 1204 |
| 1596 | Ga0373946_0004998 | 3300035171 | Bacteria | 4775 |
| 1597 | Ga0373955_0051069 | 3300035172 | Bacteria | 2251 |
| 1598 | Ga0373955_0152885 | 3300035172 | Unclassified | 1359 |
| 1599 | Ga0373955_0194798 | 3300035172 | Bacteria | 1206 |
| 1600 | Ga0373955_0339826 | 3300035172 | Unclassified | 908 |
| 1601 | Ga0373955_0582579 | 3300035172 | Unclassified | 685 |
| 1602 | Ga0373942_0002761 | 3300035207 | Bacteria | 4191 |
| 1603 | Ga0373961_0003133 | 3300035241 | Bacteria | 4132 |
| 1604 | Ga0373961_0145965 | 3300035241 | Bacteria | 803 |
| 1605 | Ga0373962_0000484 | 3300035242 | Bacteria | 8817 |
| 1606 | Ga0373962_0154014 | 3300035242 | Bacteria | 754 |
| 1607 | Ga0373962_0167020 | 3300035242 | Bacteria | 729 |
| 1608 | Ga0373962_0190474 | 3300035242 | Unclassified | 690 |
| 1609 | Ga0373924_0104962 | 3300035410 | Unclassified | 1218 |
| 1610 | Ga0373924_0189700 | 3300035410 | Unclassified | 905 |
| 1611 | Ga0373931_0002957 | 3300035691 | Bacteria | 7585 |
| 1612 | Ga0373931_0226314 | 3300035691 | Bacteria | 1128 |
| 1613 | Ga0373931_0506019 | 3300035691 | Bacteria | 780 |
| 1614 | Ga0373931_0718744 | 3300035691 | Unclassified | 661 |
| 1615 | Ga0373935_0090223 | 3300035692 | Bacteria | 2005 |
| 1616 | Ga0373935_0223769 | 3300035692 | Bacteria | 1308 |
| 1617 | Ga0373935_0275347 | 3300035692 | Unclassified | 1184 |
| 1618 | Ga0373935_0677332 | 3300035692 | Bacteria | 758 |
| 1619 | Ga0373935_0691331 | 3300035692 | Bacteria | 750 |
| 1620 | Ga0373927_0178932 | 3300035695 | Bacteria | 1391 |
| 1621 | Ga0373927_0277996 | 3300035695 | Unclassified | 1101 |
| 1622 | Ga0373933_0203563 | 3300035724 | Unclassified | 1267 |
| 1623 | Ga0373933_0414151 | 3300035724 | Unclassified | 880 |
| 1624 | Ga0373933_0418019 | 3300035724 | Unclassified | 876 |
| 1625 | Ga0373933_0580133 | 3300035724 | Bacteria | 736 |
| 1626 | Ga0373947_0008171 | 3300035725 | Bacteria | 6033 |
| 1627 | Ga0373947_0359307 | 3300035725 | Bacteria | 978 |
| 1628 | Ga0373947_1091361 | 3300035725 | Bacteria | 544 |
| 1629 | Ga0373937_0009059 | 3300036401 | Bacteria | 8638 |
| 1630 | Ga0373937_0080467 | 3300036401 | Bacteria | 3013 |
| 1631 | Ga0373937_0186363 | 3300036401 | Bacteria | 1949 |
| 1632 | Ga0373937_0371473 | 3300036401 | Unclassified | 1356 |
| 1633 | Ga0373937_0575744 | 3300036401 | Unclassified | 1069 |
| 1634 | Ga0373937_0853517 | 3300036401 | Bacteria | 859 |
| 1635 | Ga0373937_1105041 | 3300036401 | Bacteria | 741 |
| 1636 | Ga0373937_1809025 | 3300036401 | Unclassified | 557 |
| 1637 | Ga0373925_0015313 | 3300037068 | Bacteria | 5546 |
| 1638 | Ga0373925_0379196 | 3300037068 | Bacteria | 1151 |
| 1639 | Ga0373925_0669279 | 3300037068 | Bacteria | 856 |
| 1640 | Ga0373925_0826530 | 3300037068 | Unclassified | 764 |
| 1641 | Ga0373925_0863433 | 3300037068 | Bacteria | 746 |
| 1642 | Ga0373925_1007934 | 3300037068 | Bacteria | 686 |
| 1643 | Ga0242420_043178 | 3300038996 | Unclassified | 866 |
| 1644 | Ga0436365_0974042 | 3300039437 | Bacteria | 7230 |
| 1645 | Ga0436363_0695528 | 3300039450 | Bacteria | 666 |
| 1646 | Ga0436362_1204701 | 3300039453 | Unclassified | 507 |
| 1647 | Ga0439436_0155822 | 3300041404 | Unclassified | 645 |
| 1648 | Ga0439439_0150124 | 3300041406 | Bacteria | 661 |
| 1649 | Ga0439453_0106445 | 3300041408 | Unclassified | 630 |
| 1650 | Ga0451800_1099042 | 3300041459 | Bacteria | 899 |
| 1651 | Ga0451807_0514159 | 3300041486 | Bacteria | 720 |
| 1652 | Ga0451807_1968602 | 3300041486 | Bacteria | 1957 |
| 1653 | Ga0451845_0428115 | 3300041501 | Bacteria | 607 |
| 1654 | Ga0451853_0326641 | 3300041512 | Bacteria | 649 |
| 1655 | Ga0451853_1148563 | 3300041512 | Bacteria | 1251 |
| 1656 | Ga0439448_0315695 | 3300042005 | Bacteria | 556 |
| 1657 | Ga0439450_091565 | 3300042008 | Unclassified | 764 |
| 1658 | Ga0439462_0086984 | 3300042015 | Bacteria | 856 |
| 1659 | Ga0450923_067636 | 3300042125 | Unclassified | 788 |
| 1660 | Ga0450923_117699 | 3300042125 | Unclassified | 625 |
| 1661 | Ga0439446_0217893 | 3300042156 | Unclassified | 649 |
| 1662 | Ga0439446_0227777 | 3300042156 | Bacteria | 637 |
| 1663 | Ga0450908_108368 | 3300042184 | Unclassified | 512 |
| 1664 | Ga0439434_0128720 | 3300042435 | Bacteria | 829 |
| 1665 | Ga0439435_0024756 | 3300042436 | Unclassified | 1586 |
| 1666 | Ga0439464_0291688 | 3300042439 | Unclassified | 532 |
| 1667 | Ga0451577_0952727 | 3300042876 | Bacteria | 772 |
| 1668 | Ga0451577_1132996 | 3300042876 | Unclassified | 699 |
| 1669 | Ga0439440_0151667 | 3300042993 | Unclassified | 664 |
| 1670 | Ga0453683_0430943 | 3300044673 | Bacteria | 852 |
| 1671 | Ga0453683_0481647 | 3300044673 | Unclassified | 804 |
| 1672 | Ga0466963_0026043 | 3300044694 | Bacteria | 3738 |
| 1673 | Ga0466964_0370735 | 3300044706 | Bacteria | 741 |
| 1674 | Ga0453684_0530056 | 3300044712 | Unclassified | 1300 |
| 1675 | Ga0466968_0431886 | 3300044735 | Bacteria | 649 |
| 1676 | Ga0466957_0492813 | 3300044842 | Bacteria | 849 |
| 1677 | Ga0451576_0036825 | 3300045051 | Bacteria | 5184 |
| 1678 | Ga0451576_0069886 | 3300045051 | Bacteria | 3654 |
| 1679 | Ga0451576_0074874 | 3300045051 | Bacteria | 3522 |
| 1680 | Ga0451576_0282376 | 3300045051 | Unclassified | 1736 |
| 1681 | Ga0451576_0782165 | 3300045051 | Bacteria | 1002 |
| 1682 | Ga0451576_1114216 | 3300045051 | Bacteria | 826 |
| 1683 | Ga0451576_2124176 | 3300045051 | Unclassified | 577 |
| 1684 | Ga0451576_2201159 | 3300045051 | Unclassified | 566 |
| 1685 | Ga0451576_2296737 | 3300045051 | Bacteria | 553 |
| 1686 | Ga0451576_2492645 | 3300045051 | Bacteria | 528 |
| 1687 | Ga0451576_2718879 | 3300045051 | Bacteria | 504 |
| 1688 | Ga0466958_0436147 | 3300045836 | Bacteria | 848 |
| 1689 | Ga0466967_0489595 | 3300045976 | Bacteria | 1206 |
| 1690 | Ga0466967_0583039 | 3300045976 | Unclassified | 1103 |
| 1691 | Ga0466967_0609524 | 3300045976 | Bacteria | 1078 |
| 1692 | Ga0466967_1760039 | 3300045976 | Bacteria | 617 |
| 1693 | Ga0466967_2467962 | 3300045976 | Bacteria | 515 |
| 1694 | Ga0495603_0107715 | 3300046455 | Bacteria | 1626 |
| 1695 | Ga0495591_179204 | 3300046458 | Unclassified | 505 |
| 1696 | Ga0495629_0026452 | 3300046459 | Unclassified | 4121 |
| 1697 | Ga0495629_0211359 | 3300046459 | Unclassified | 1340 |
| 1698 | Ga0495629_0892849 | 3300046459 | Unclassified | 583 |
| 1699 | Ga0495629_0966855 | 3300046459 | Unclassified | 556 |
| 1700 | Ga0495651_0136250 | 3300046462 | Unclassified | 1786 |
| 1701 | Ga0495580_0031838 | 3300046472 | Bacteria | 3809 |
| 1702 | Ga0495580_0037989 | 3300046472 | Bacteria | 3452 |
| 1703 | Ga0495580_0302143 | 3300046472 | Bacteria | 1090 |
| 1704 | Ga0495580_0455137 | 3300046472 | Unclassified | 858 |
| 1705 | Ga0495580_0479049 | 3300046472 | Bacteria | 833 |
| 1706 | Ga0495580_0798990 | 3300046472 | Bacteria | 612 |
| 1707 | Ga0495582_0311273 | 3300046473 | Unclassified | 906 |
| 1708 | Ga0495582_0387856 | 3300046473 | Bacteria | 805 |
| 1709 | Ga0495582_0628807 | 3300046473 | Unclassified | 621 |
| 1710 | Ga0495582_0711689 | 3300046473 | Unclassified | 581 |
| 1711 | Ga0495639_0425853 | 3300046475 | Bacteria | 672 |
| 1712 | Ga0495584_0050641 | 3300046491 | Unclassified | 2091 |
| 1713 | Ga0495584_0263799 | 3300046491 | Bacteria | 876 |
| 1714 | Ga0495594_0016304 | 3300046499 | Bacteria | 3914 |
| 1715 | Ga0495594_0068088 | 3300046499 | Bacteria | 1977 |
| 1716 | Ga0495594_0447550 | 3300046499 | Bacteria | 734 |
| 1717 | Ga0495608_0010373 | 3300046511 | Bacteria | 6503 |
| 1718 | Ga0495618_0100511 | 3300046514 | Bacteria | 1851 |
| 1719 | Ga0495618_0252638 | 3300046514 | Bacteria | 1106 |
| 1720 | Ga0495628_0197372 | 3300046516 | Bacteria | 1517 |
| 1721 | Ga0495628_0831276 | 3300046516 | Bacteria | 645 |
| 1722 | Ga0495630_0021167 | 3300046517 | Bacteria | 4802 |
| 1723 | Ga0495630_0475789 | 3300046517 | Bacteria | 958 |
| 1724 | Ga0495630_0500145 | 3300046517 | Bacteria | 932 |
| 1725 | Ga0495630_0501930 | 3300046517 | Bacteria | 930 |
| 1726 | Ga0495643_0011009 | 3300046522 | Bacteria | 5532 |
| 1727 | Ga0495644_0230447 | 3300046523 | Unclassified | 717 |
| 1728 | Ga0495663_0134568 | 3300046525 | Bacteria | 836 |
| 1729 | Ga0495663_0159732 | 3300046525 | Unclassified | 773 |
| 1730 | Ga0495663_0161489 | 3300046525 | Bacteria | 769 |
| 1731 | Ga0495642_0005763 | 3300046528 | Bacteria | 4752 |
| 1732 | Ga0495642_0344802 | 3300046528 | Bacteria | 654 |
| 1733 | Ga0495652_0036799 | 3300046529 | Bacteria | 4252 |
| 1734 | Ga0495652_0211056 | 3300046529 | Unclassified | 1466 |
| 1735 | Ga0495665_0056144 | 3300046531 | Unclassified | 2079 |
| 1736 | Ga0495640_0106328 | 3300046533 | Unclassified | 1838 |
| 1737 | Ga0495640_0366047 | 3300046533 | Bacteria | 888 |
| 1738 | Ga0495640_0732195 | 3300046533 | Bacteria | 592 |
| 1739 | Ga0495586_0260109 | 3300046535 | Unclassified | 991 |
| 1740 | Ga0495586_0429547 | 3300046535 | Bacteria | 761 |
| 1741 | Ga0495587_0046585 | 3300046536 | Bacteria | 2573 |
| 1742 | Ga0495598_0018119 | 3300046537 | Bacteria | 1825 |
| 1743 | Ga0495598_0050984 | 3300046537 | Unclassified | 1246 |
| 1744 | Ga0495598_0059865 | 3300046537 | Bacteria | 1172 |
| 1745 | Ga0495598_0079003 | 3300046537 | Bacteria | 1052 |
| 1746 | Ga0495598_0171509 | 3300046537 | Bacteria | 769 |
| 1747 | Ga0495598_0199497 | 3300046537 | Bacteria | 722 |
| 1748 | Ga0495598_0215782 | 3300046537 | Bacteria | 698 |
| 1749 | Ga0495598_0444409 | 3300046537 | Bacteria | 513 |
| 1750 | Ga0495609_0108794 | 3300046538 | Bacteria | 1197 |
| 1751 | Ga0495621_0000734 | 3300046539 | Bacteria | 8310 |
| 1752 | Ga0495621_0002328 | 3300046539 | Bacteria | 5100 |
| 1753 | Ga0495621_0004301 | 3300046539 | Bacteria | 3992 |
| 1754 | Ga0495621_0104597 | 3300046539 | Bacteria | 1080 |
| 1755 | Ga0495645_0110321 | 3300046543 | Bacteria | 1947 |
| 1756 | Ga0495633_0018310 | 3300046558 | Bacteria | 3559 |
| 1757 | Ga0495667_0434609 | 3300046559 | Bacteria | 825 |
| 1758 | Ga0495656_0007731 | 3300046615 | Bacteria | 3813 |
| 1759 | Ga0495656_0541895 | 3300046615 | Bacteria | 620 |
| 1760 | Ga0495668_0774921 | 3300046616 | Bacteria | 531 |
| 1761 | Ga0495634_0185935 | 3300046642 | Bacteria | 1298 |
| 1762 | Ga0495634_0822900 | 3300046642 | Bacteria | 529 |
| 1763 | Ga0495659_0005213 | 3300046664 | Bacteria | 4086 |
| 1764 | Ga0495659_0006176 | 3300046664 | Bacteria | 3786 |
| 1765 | Ga0495659_0043745 | 3300046664 | Bacteria | 1608 |
| 1766 | Ga0495659_0099457 | 3300046664 | Bacteria | 1125 |
| 1767 | Ga0495659_0143842 | 3300046664 | Bacteria | 954 |
| 1768 | Ga0495659_0226285 | 3300046664 | Bacteria | 774 |
| 1769 | Ga0495659_0246536 | 3300046664 | Bacteria | 743 |
| 1770 | Ga0495659_0395920 | 3300046664 | Bacteria | 595 |
| 1771 | Ga0495659_0418048 | 3300046664 | Unclassified | 580 |
| 1772 | Ga0495659_0536433 | 3300046664 | Bacteria | 515 |
| 1773 | Ga0495588_0154419 | 3300046674 | Bacteria | 1213 |
| 1774 | Ga0495588_0571087 | 3300046674 | Unclassified | 593 |
| 1775 | Ga0495588_0631335 | 3300046674 | Bacteria | 561 |
| 1776 | Ga0495657_0275115 | 3300046675 | Bacteria | 1009 |
| 1777 | Ga0495623_0609141 | 3300046679 | Bacteria | 567 |
| 1778 | Ga0495646_0459353 | 3300046680 | Unclassified | 657 |
| 1779 | Ga0495647_0046635 | 3300046681 | Bacteria | 1670 |
| 1780 | Ga0495647_0187730 | 3300046681 | Bacteria | 902 |
| 1781 | Ga0495658_0085033 | 3300046683 | Unclassified | 1864 |
| 1782 | Ga0495658_0114637 | 3300046683 | Unclassified | 1624 |
| 1783 | Ga0495658_0466973 | 3300046683 | Bacteria | 807 |
| 1784 | Ga0495658_0526902 | 3300046683 | Bacteria | 756 |
| 1785 | Ga0495658_1108712 | 3300046683 | Bacteria | 504 |
| 1786 | Ga0495669_0025552 | 3300046684 | Bacteria | 2576 |
| 1787 | Ga0495669_0047099 | 3300046684 | Bacteria | 1925 |
| 1788 | Ga0495669_0120449 | 3300046684 | Unclassified | 1229 |
| 1789 | Ga0495669_0142101 | 3300046684 | Unclassified | 1133 |
| 1790 | Ga0495669_0346718 | 3300046684 | Archaea | 718 |
| 1791 | Ga0495669_0410085 | 3300046684 | Unclassified | 657 |
| 1792 | Ga0495613_0000720 | 3300046689 | Bacteria | 25918 |
| 1793 | Ga0495670_0805391 | 3300046691 | Unclassified | 513 |
| 1794 | Ga0495581_0465120 | 3300047315 | Bacteria | 736 |
| 1795 | Ga0495581_0598379 | 3300047315 | Bacteria | 639 |
| 1796 | Ga0495604_0390745 | 3300047317 | Bacteria | 917 |
| 1797 | Ga0495636_0142362 | 3300047318 | Unclassified | 1071 |
| 1798 | Ga0495674_0025567 | 3300047319 | Bacteria | 5412 |
| 1799 | Ga0495674_0473940 | 3300047319 | Bacteria | 1004 |
| 1800 | Ga0495674_0592575 | 3300047319 | Bacteria | 879 |
| 1801 | Ga0495674_0612890 | 3300047319 | Bacteria | 861 |
| 1802 | Ga0495672_0268271 | 3300047320 | Bacteria | 821 |
| 1803 | Ga0495676_0036588 | 3300047321 | Bacteria | 4097 |
| 1804 | Ga0495680_0393814 | 3300047322 | Bacteria | 957 |
| 1805 | Ga0495685_033432 | 3300047447 | Unclassified | 1767 |
| 1806 | Ga0495685_048797 | 3300047447 | Bacteria | 1439 |
| 1807 | Ga0495684_0000613 | 3300047471 | Bacteria | 28669 |
| 1808 | Ga0495684_0272083 | 3300047471 | Unclassified | 1225 |
| 1809 | Ga0495593_0287864 | 3300047673 | Bacteria | 822 |
| 1810 | Ga0495614_0537676 | 3300048089 | Unclassified | 558 |
| 1811 | Ga0495614_0657688 | 3300048089 | Bacteria | 506 |
| 1812 | Ga0496100_0243294 | 3300048903 | Bacteria | 1328 |
| 1813 | Ga0496100_0811999 | 3300048903 | Bacteria | 733 |
| 1814 | Ga0496100_0958564 | 3300048903 | Bacteria | 673 |
| 1815 | Ga0496101_0000451 | 3300048904 | Bacteria | 26069 |
| 1816 | Ga0496101_0821314 | 3300048904 | Bacteria | 733 |
| 1817 | Ga0496101_1041627 | 3300048904 | Bacteria | 643 |
| 1818 | Ga0496102_0944611 | 3300048905 | Bacteria | 783 |
| 1819 | Ga0496103_0362131 | 3300048906 | Bacteria | 932 |
| 1820 | Ga0496104_0309891 | 3300048907 | Bacteria | 1491 |
| 1821 | Ga0496104_0333741 | 3300048907 | Bacteria | 1429 |
| 1822 | Ga0496104_0355658 | 3300048907 | Bacteria | 1377 |
| 1823 | Ga0496104_0423719 | 3300048907 | Unclassified | 1243 |
| 1824 | Ga0496104_0812657 | 3300048907 | Bacteria | 841 |
| 1825 | Ga0496104_1222041 | 3300048907 | Bacteria | 655 |
| 1826 | Ga0496105_0265325 | 3300048908 | Bacteria | 1388 |
| 1827 | Ga0496105_0675634 | 3300048908 | Unclassified | 795 |
| 1828 | Ga0496105_0892135 | 3300048908 | Unclassified | 671 |
| 1829 | Ga0496106_0045609 | 3300048909 | Bacteria | 3293 |
| 1830 | Ga0496106_0222706 | 3300048909 | Bacteria | 1505 |
| 1831 | Ga0496106_0639560 | 3300048909 | Bacteria | 850 |
| 1832 | Ga0496106_0728760 | 3300048909 | Unclassified | 789 |
| 1833 | Ga0496106_1513522 | 3300048909 | Bacteria | 516 |
| 1834 | Ga0496106_1533206 | 3300048909 | Unclassified | 512 |
| 1835 | Ga0496107_0345761 | 3300048910 | Unclassified | 1107 |
| 1836 | Ga0496107_0609011 | 3300048910 | Bacteria | 807 |
| 1837 | Ga0496107_1025492 | 3300048910 | Bacteria | 598 |
| 1838 | Ga0496107_1272644 | 3300048910 | Bacteria | 527 |
| 1839 | Ga0496108_0890607 | 3300048911 | Bacteria | 764 |
| 1840 | Ga0496108_0992209 | 3300048911 | Bacteria | 718 |
| 1841 | Ga0496108_1130085 | 3300048911 | Unclassified | 665 |
| 1842 | Ga0496108_1268264 | 3300048911 | Bacteria | 621 |
| 1843 | Ga0496109_0446343 | 3300048912 | Unclassified | 1222 |
| 1844 | Ga0496109_0565345 | 3300048912 | Unclassified | 1072 |
| 1845 | Ga0496109_0614112 | 3300048912 | Bacteria | 1024 |
| 1846 | Ga0496110_0022673 | 3300048913 | Bacteria | 5335 |
| 1847 | Ga0496110_0688733 | 3300048913 | Bacteria | 923 |
| 1848 | Ga0496110_0906301 | 3300048913 | Unclassified | 788 |
| 1849 | Ga0496111_0799130 | 3300048914 | Bacteria | 683 |
| 1850 | Ga0496111_1072711 | 3300048914 | Bacteria | 575 |
| 1851 | Ga0496112_0538464 | 3300048915 | Bacteria | 1102 |
| 1852 | Ga0496112_1834331 | 3300048915 | Bacteria | 518 |
| 1853 | Ga0496112_1864225 | 3300048915 | Unclassified | 513 |
| 1854 | Ga0496113_0109187 | 3300048916 | Bacteria | 2151 |
| 1855 | Ga0496113_0180028 | 3300048916 | Bacteria | 1676 |
| 1856 | Ga0496113_0309279 | 3300048916 | Unclassified | 1266 |
| 1857 | Ga0496113_0363076 | 3300048916 | Bacteria | 1162 |
| 1858 | Ga0496114_0001764 | 3300048917 | Bacteria | 16428 |
| 1859 | Ga0496114_0202676 | 3300048917 | Bacteria | 1738 |
| 1860 | Ga0496114_0571906 | 3300048917 | Unclassified | 998 |
| 1861 | Ga0496114_0590266 | 3300048917 | Bacteria | 980 |
| 1862 | Ga0496115_0044293 | 3300048918 | Bacteria | 3549 |
| 1863 | Ga0496115_0619922 | 3300048918 | Bacteria | 858 |
| 1864 | Ga0496115_0936752 | 3300048918 | Bacteria | 666 |
| 1865 | Ga0501292_058286 | 3300049515 | Unclassified | 696 |
| 1866 | Ga0501292_140448 | 3300049515 | Bacteria | 505 |
| 1867 | Ga0501294_058889 | 3300049517 | Unclassified | 504 |
| 1868 | Ga0501295_131299 | 3300049518 | Bacteria | 608 |
| 1869 | Ga0501298_079386 | 3300049521 | Unclassified | 720 |
| 1870 | Ga0501298_088894 | 3300049521 | Bacteria | 690 |
| 1871 | Ga0501298_148641 | 3300049521 | Unclassified | 571 |
| 1872 | Ga0501299_092513 | 3300049522 | Bacteria | 689 |
| 1873 | Ga0501299_193258 | 3300049522 | Bacteria | 537 |
| 1874 | Ga0501299_231899 | 3300049522 | Unclassified | 502 |
| 1875 | Ga0501320_051899 | 3300049536 | Bacteria | 560 |
| 1876 | Ga0501031_0595084 | 3300049568 | Bacteria | 712 |
| 1877 | Ga0501032_0948403 | 3300049569 | Bacteria | 541 |
| 1878 | Ga0501033_0054566 | 3300049570 | Bacteria | 2956 |
| 1879 | Ga0501033_0571682 | 3300049570 | Bacteria | 777 |
| 1880 | Ga0501036_0481481 | 3300049572 | Bacteria | 1033 |
| 1881 | Ga0501036_1246464 | 3300049572 | Bacteria | 605 |
| 1882 | Ga0501039_0043088 | 3300049575 | Bacteria | 3487 |
| 1883 | Ga0501039_0096051 | 3300049575 | Bacteria | 2311 |
| 1884 | Ga0501039_0629160 | 3300049575 | Bacteria | 841 |
| 1885 | Ga0501039_1144699 | 3300049575 | Bacteria | 602 |
| 1886 | Ga0501040_0191871 | 3300049576 | Bacteria | 1450 |
| 1887 | Ga0501040_0257776 | 3300049576 | Bacteria | 1244 |
| 1888 | Ga0501040_0533565 | 3300049576 | Bacteria | 847 |
| 1889 | Ga0501040_1183758 | 3300049576 | Bacteria | 555 |
| 1890 | Ga0501040_1304737 | 3300049576 | Bacteria | 527 |
| 1891 | Ga0501041_0021002 | 3300049577 | Bacteria | 3910 |
| 1892 | Ga0501041_0027286 | 3300049577 | Bacteria | 3441 |
| 1893 | Ga0501041_0360458 | 3300049577 | Bacteria | 919 |
| 1894 | Ga0501041_0836681 | 3300049577 | Bacteria | 591 |
| 1895 | Ga0501041_1078564 | 3300049577 | Bacteria | 517 |
| 1896 | Ga0501042_0020313 | 3300049578 | Bacteria | 4622 |
| 1897 | Ga0501042_0068209 | 3300049578 | Bacteria | 2543 |
| 1898 | Ga0501042_0104599 | 3300049578 | Bacteria | 2037 |
| 1899 | Ga0501042_0504033 | 3300049578 | Bacteria | 879 |
| 1900 | Ga0501043_0380124 | 3300049579 | Bacteria | 1069 |
| 1901 | Ga0501043_0558438 | 3300049579 | Unclassified | 850 |
| 1902 | Ga0501046_0224520 | 3300049580 | Bacteria | 1390 |
| 1903 | Ga0501046_0268583 | 3300049580 | Bacteria | 1251 |
| 1904 | Ga0501046_0659307 | 3300049580 | Bacteria | 739 |
| 1905 | Ga0501046_1028641 | 3300049580 | Bacteria | 571 |
| 1906 | Ga0501048_0097317 | 3300049582 | Bacteria | 2076 |
| 1907 | Ga0501048_0115376 | 3300049582 | Bacteria | 1897 |
| 1908 | Ga0501048_0936448 | 3300049582 | Unclassified | 623 |
| 1909 | Ga0501067_0084722 | 3300049583 | Bacteria | 1758 |
| 1910 | Ga0501067_0415926 | 3300049583 | Bacteria | 750 |
| 1911 | Ga0501068_0025829 | 3300049584 | Bacteria | 3457 |
| 1912 | Ga0501068_0074051 | 3300049584 | Bacteria | 2081 |
| 1913 | Ga0501068_0210604 | 3300049584 | Bacteria | 1234 |
| 1914 | Ga0501069_0759198 | 3300049585 | Bacteria | 587 |
| 1915 | Ga0501069_0796871 | 3300049585 | Bacteria | 572 |
| 1916 | Ga0501071_0038926 | 3300049587 | Bacteria | 3400 |
| 1917 | Ga0501071_0073892 | 3300049587 | Bacteria | 2488 |
| 1918 | Ga0501071_0339443 | 3300049587 | Bacteria | 1142 |
| 1919 | Ga0501071_1083652 | 3300049587 | Bacteria | 619 |
| 1920 | Ga0501072_0059133 | 3300049588 | Bacteria | 3022 |
| 1921 | Ga0501072_0082245 | 3300049588 | Bacteria | 2553 |
| 1922 | Ga0501072_0377582 | 3300049588 | Bacteria | 1125 |
| 1923 | Ga0501073_0752714 | 3300049589 | Bacteria | 672 |
| 1924 | Ga0501073_1274585 | 3300049589 | Unclassified | 504 |
| 1925 | Ga0501074_0216331 | 3300049590 | Bacteria | 1365 |
| 1926 | Ga0501075_0011468 | 3300049591 | Bacteria | 6273 |
| 1927 | Ga0501075_0014710 | 3300049591 | Bacteria | 5608 |
| 1928 | Ga0501075_0027285 | 3300049591 | Bacteria | 4208 |
| 1929 | Ga0501076_0000430 | 3300049592 | Bacteria | 26447 |
| 1930 | Ga0501076_0029547 | 3300049592 | Bacteria | 4263 |
| 1931 | Ga0501076_0071935 | 3300049592 | Bacteria | 2767 |
| 1932 | Ga0501077_0007773 | 3300049593 | Bacteria | 6616 |
| 1933 | Ga0501209_112598 | 3300049656 | Unclassified | 804 |
| 1934 | Ga0501216_121502 | 3300049660 | Bacteria | 597 |
| 1935 | Ga0501233_188554 | 3300049668 | Unclassified | 594 |
| 1936 | Ga0501235_104846 | 3300049669 | Unclassified | 694 |
| 1937 | Ga0501235_214227 | 3300049669 | Bacteria | 526 |
| 1938 | Ga0501243_092603 | 3300049675 | Unclassified | 601 |
| 1939 | Ga0501247_022900 | 3300049677 | Bacteria | 820 |
| 1940 | Ga0501249_057078 | 3300049679 | Bacteria | 901 |
| 1941 | Ga0501249_100971 | 3300049679 | Bacteria | 691 |
| 1942 | Ga0501253_217053 | 3300049683 | Bacteria | 511 |
| 1943 | Ga0501256_042155 | 3300049685 | Unclassified | 544 |
| 1944 | Ga0501257_160822 | 3300049686 | Unclassified | 625 |
| 1945 | Ga0501245_066289 | 3300049708 | Bacteria | 671 |
| 1946 | Ga0501245_094182 | 3300049708 | Unclassified | 598 |
| 1947 | Ga0501079_0023834 | 3300049741 | Bacteria | 4696 |
| 1948 | Ga0501079_0032267 | 3300049741 | Bacteria | 4026 |
| 1949 | Ga0501079_0130665 | 3300049741 | Bacteria | 1954 |
| 1950 | Ga0501080_0225287 | 3300049742 | Bacteria | 1715 |
| 1951 | Ga0501080_0238544 | 3300049742 | Bacteria | 1660 |
| 1952 | Ga0501080_0597003 | 3300049742 | Bacteria | 980 |
| 1953 | Ga0501081_0000588 | 3300049743 | Bacteria | 20670 |
| 1954 | Ga0501081_0002533 | 3300049743 | Bacteria | 11520 |
| 1955 | Ga0501081_0034421 | 3300049743 | Bacteria | 3447 |
| 1956 | Ga0501081_0045103 | 3300049743 | Bacteria | 3027 |
| 1957 | Ga0501081_0293922 | 3300049743 | Bacteria | 1191 |
| 1958 | Ga0501081_1522869 | 3300049743 | Unclassified | 508 |
| 1959 | Ga0501083_0013562 | 3300049744 | Bacteria | 5699 |
| 1960 | Ga0501268_044925 | 3300049765 | Bacteria | 841 |
| 1961 | Ga0501270_092061 | 3300049767 | Bacteria | 620 |
| 1962 | Ga0501272_042658 | 3300049769 | Unclassified | 610 |
| 1963 | Ga0501273_041202 | 3300049770 | Unclassified | 684 |
| 1964 | Ga0501283_012511 | 3300049779 | Unclassified | 1276 |
| 1965 | Ga0501283_056205 | 3300049779 | Unclassified | 705 |
| 1966 | Ga0501045_0034751 | 3300049824 | Bacteria | 3660 |
| 1967 | Ga0501045_0404199 | 3300049824 | Bacteria | 1016 |
| 1968 | Ga0501045_0521338 | 3300049824 | Bacteria | 882 |
| 1969 | Ga0501045_0597340 | 3300049824 | Bacteria | 817 |
| 1970 | nmdc:mga05p37_11992_c1 | 3300050507 | Bacteria | 10342 |
| 1971 | nmdc:mga05p37_126818_c1 | 3300050507 | Bacteria | 3134 |
| 1972 | nmdc:mga05p37_138659_c1 | 3300050507 | Bacteria | 2981 |
| 1973 | nmdc:mga05p37_142923_c1 | 3300050507 | Bacteria | 2931 |
| 1974 | nmdc:mga05p37_1513676_c1 | 3300050507 | Unclassified | 667 |
| 1975 | nmdc:mga05p37_1594_c1 | 3300050507 | Bacteria | 26335 |
| 1976 | nmdc:mga05p37_16719_c1 | 3300050507 | Bacteria | 8842 |
| 1977 | nmdc:mga05p37_180101_c1 | 3300050507 | Bacteria | 2572 |
| 1978 | nmdc:mga05p37_20284_c1 | 3300050507 | Bacteria | 8043 |
| 1979 | nmdc:mga05p37_23331_c1 | 3300050507 | Bacteria | 7507 |
| 1980 | nmdc:mga05p37_234115_c1 | 3300050507 | Bacteria | 2212 |
| 1981 | nmdc:mga05p37_251554_c1 | 3300050507 | Bacteria | 2119 |
| 1982 | nmdc:mga05p37_311105_c1 | 3300050507 | Bacteria | 1867 |
| 1983 | nmdc:mga05p37_311393_c1 | 3300050507 | Bacteria | 1866 |
| 1984 | nmdc:mga05p37_312432_c1 | 3300050507 | Bacteria | 1862 |
| 1985 | nmdc:mga05p37_41791_c1 | 3300050507 | Bacteria | 5630 |
| 1986 | nmdc:mga05p37_49764_c1 | 3300050507 | Bacteria | 5155 |
| 1987 | nmdc:mga05p37_798158_c1 | 3300050507 | Bacteria | 1033 |
| 1988 | nmdc:mga05p37_915060_c1 | 3300050507 | Bacteria | 944 |
| 1989 | nmdc:mga05p37_95613_c1 | 3300050507 | Bacteria | 3660 |
| 1990 | nmdc:mga09592_116992_c1 | 3300050508 | Bacteria | 2288 |
| 1991 | nmdc:mga09592_1600861_c1 | 3300050508 | Bacteria | 527 |
| 1992 | nmdc:mga09592_164082_c1 | 3300050508 | Bacteria | 1920 |
| 1993 | nmdc:mga09592_1654440_c1 | 3300050508 | Unclassified | 517 |
| 1994 | nmdc:mga09592_344209_c1 | 3300050508 | Unclassified | 1291 |
| 1995 | nmdc:mga09592_408004_c1 | 3300050508 | Bacteria | 1174 |
| 1996 | nmdc:mga09592_50392_c1 | 3300050508 | Bacteria | 3512 |
| 1997 | nmdc:mga09592_725034_c1 | 3300050508 | Unclassified | 845 |
| 1998 | nmdc:mga09592_823574_c1 | 3300050508 | Unclassified | 784 |
| 1999 | nmdc:mga09592_94175_c1 | 3300050508 | Unclassified | 2561 |
| 2000 | nmdc:mga09592_952643_c1 | 3300050508 | Bacteria | 719 |
| 2001 | nmdc:mga0qj67_205251_c1 | 3300050509 | Bacteria | 1601 |
| 2002 | nmdc:mga0qj67_363910_c1 | 3300050509 | Bacteria | 1169 |
| 2003 | nmdc:mga0qj67_45395_c1 | 3300050509 | Bacteria | 3467 |
| 2004 | nmdc:mga0qj67_789939_c1 | 3300050509 | Bacteria | 752 |
| 2005 | nmdc:mga0qj67_850976_c1 | 3300050509 | Unclassified | 720 |
| 2006 | nmdc:mga06r32_102411_c1 | 3300050510 | Bacteria | 2811 |
| 2007 | nmdc:mga06r32_1337435_c1 | 3300050510 | Bacteria | 660 |
| 2008 | nmdc:mga06r32_143953_c1 | 3300050510 | Unclassified | 2361 |
| 2009 | nmdc:mga06r32_20491_c1 | 3300050510 | Bacteria | 6089 |
| 2010 | nmdc:mga06r32_53901_c1 | 3300050510 | Bacteria | 3855 |
| 2011 | nmdc:mga06r32_558345_c1 | 3300050510 | Unclassified | 1118 |
| 2012 | nmdc:mga06r32_718852_c1 | 3300050510 | Unclassified | 963 |
| 2013 | nmdc:mga08y16_1005311_c1 | 3300050511 | Unclassified | 814 |
| 2014 | nmdc:mga08y16_1020998_c1 | 3300050511 | Bacteria | 806 |
| 2015 | nmdc:mga08y16_1480043_c1 | 3300050511 | Unclassified | 640 |
| 2016 | nmdc:mga08y16_1740986_c1 | 3300050511 | Unclassified | 578 |
| 2017 | nmdc:mga08y16_28149_c1 | 3300050511 | Bacteria | 5924 |
| 2018 | nmdc:mga08y16_349_c1 | 3300050511 | Bacteria | 41563 |
| 2019 | nmdc:mga08y16_365948_c1 | 3300050511 | Bacteria | 1480 |
| 2020 | nmdc:mga08y16_38371_c1 | 3300050511 | Bacteria | 5030 |
| 2021 | nmdc:mga08y16_427316_c1 | 3300050511 | Unclassified | 1353 |
| 2022 | nmdc:mga08y16_4417_c1 | 3300050511 | Bacteria | 14700 |
| 2023 | nmdc:mga08y16_55349_c1 | 3300050511 | Bacteria | 4146 |
| 2024 | nmdc:mga08y16_6726_c1 | 3300050511 | Bacteria | 12051 |
| 2025 | nmdc:mga08y16_718120_c1 | 3300050511 | Bacteria | 998 |
| 2026 | nmdc:mga08y16_816436_c1 | 3300050511 | Bacteria | 924 |
| 2027 | nmdc:mga08y16_967731_c1 | 3300050511 | Bacteria | 833 |
| 2028 | nmdc:mga0n895_1217475_c1 | 3300050512 | Bacteria | 726 |
| 2029 | nmdc:mga0n895_13192_c1 | 3300050512 | Bacteria | 7444 |
| 2030 | nmdc:mga0n895_1368851_c1 | 3300050512 | Bacteria | 677 |
| 2031 | nmdc:mga0n895_13752_c1 | 3300050512 | Bacteria | 7319 |
| 2032 | nmdc:mga0n895_1429060_c1 | 3300050512 | Unclassified | 660 |
| 2033 | nmdc:mga0n895_146142_c1 | 3300050512 | Unclassified | 2394 |
| 2034 | nmdc:mga0n895_148627_c1 | 3300050512 | Bacteria | 2372 |
| 2035 | nmdc:mga0n895_17933_c1 | 3300050512 | Bacteria | 6541 |
| 2036 | nmdc:mga0n895_182794_c1 | 3300050512 | Unclassified | 2128 |
| 2037 | nmdc:mga0n895_193415_c1 | 3300050512 | Bacteria | 2065 |
| 2038 | nmdc:mga0n895_203557_c1 | 3300050512 | Bacteria | 2010 |
| 2039 | nmdc:mga0n895_2068153_c1 | 3300050512 | Bacteria | 526 |
| 2040 | nmdc:mga0n895_2142851_c1 | 3300050512 | Unclassified | 515 |
| 2041 | nmdc:mga0n895_49792_c1 | 3300050512 | Bacteria | 4106 |
| 2042 | nmdc:mga0n895_502727_c1 | 3300050512 | Bacteria | 1221 |
| 2043 | nmdc:mga0n895_61181_c1 | 3300050512 | Bacteria | 3716 |
| 2044 | nmdc:mga0n895_611894_c1 | 3300050512 | Unclassified | 1091 |
| 2045 | nmdc:mga0n895_77585_c1 | 3300050512 | Bacteria | 3305 |
| 2046 | nmdc:mga0n895_7906_c1 | 3300050512 | Bacteria | 9168 |
| 2047 | nmdc:mga0n895_854671_c1 | 3300050512 | Bacteria | 897 |
| 2048 | nmdc:mga0n895_892857_c1 | 3300050512 | Unclassified | 875 |
| 2049 | nmdc:mga0n895_952906_c1 | 3300050512 | Bacteria | 841 |
| 2050 | nmdc:mga0n895_98062_c1 | 3300050512 | Bacteria | 2938 |
| 2051 | nmdc:mga0rr50_116480_c1 | 3300050513 | Bacteria | 2121 |
| 2052 | nmdc:mga0rr50_136179_c1 | 3300050513 | Bacteria | 1971 |
| 2053 | nmdc:mga0rr50_139327_c1 | 3300050513 | Bacteria | 1950 |
| 2054 | nmdc:mga0rr50_1702203_c1 | 3300050513 | Bacteria | 531 |
| 2055 | nmdc:mga0rr50_1712792_c1 | 3300050513 | Unclassified | 530 |
| 2056 | nmdc:mga0rr50_177697_c1 | 3300050513 | Bacteria | 1739 |
| 2057 | nmdc:mga0rr50_179124_c1 | 3300050513 | Bacteria | 1732 |
| 2058 | nmdc:mga0rr50_342715_c1 | 3300050513 | Bacteria | 1256 |
| 2059 | nmdc:mga0rr50_414_c1 | 3300050513 | Bacteria | 23130 |
| 2060 | nmdc:mga0rr50_841396_c1 | 3300050513 | Bacteria | 783 |
| 2061 | nmdc:mga0rr50_860872_c1 | 3300050513 | Unclassified | 773 |
| 2062 | nmdc:mga0rr50_883594_c1 | 3300050513 | Bacteria | 762 |
| 2063 | nmdc:mga0rr50_9355_c1 | 3300050513 | Bacteria | 6155 |
| 2064 | nmdc:mga08x19_11381_c1 | 3300050514 | Bacteria | 5355 |
| 2065 | nmdc:mga08x19_120066_c1 | 3300050514 | Bacteria | 1762 |
| 2066 | nmdc:mga08x19_204388_c1 | 3300050514 | Bacteria | 1355 |
| 2067 | nmdc:mga08x19_228795_c1 | 3300050514 | Bacteria | 917 |
| 2068 | nmdc:mga08x19_51300_c1 | 3300050514 | Bacteria | 2650 |
| 2069 | nmdc:mga08x19_639300_c1 | 3300050514 | Bacteria | 754 |
| 2070 | nmdc:mga08x19_762954_c1 | 3300050514 | Bacteria | 687 |
| 2071 | nmdc:mga0a205_120182_c1 | 3300050515 | Bacteria | 2527 |
| 2072 | nmdc:mga0a205_1352021_c1 | 3300050515 | Bacteria | 560 |
| 2073 | nmdc:mga0a205_158500_c1 | 3300050515 | Bacteria | 2161 |
| 2074 | nmdc:mga0a205_176082_c1 | 3300050515 | Bacteria | 2035 |
| 2075 | nmdc:mga0a205_265938_c1 | 3300050515 | Unclassified | 1592 |
| 2076 | nmdc:mga0a205_29340_c1 | 3300050515 | Bacteria | 5264 |
| 2077 | nmdc:mga0a205_33180_c1 | 3300050515 | Bacteria | 4950 |
| 2078 | nmdc:mga0a205_506590_c1 | 3300050515 | Bacteria | 1064 |
| 2079 | nmdc:mga0a205_532212_c1 | 3300050515 | Unclassified | 1031 |
| 2080 | nmdc:mga0a205_58127_c1 | 3300050515 | Bacteria | 3735 |
| 2081 | nmdc:mga0a205_6492_c1 | 3300050515 | Bacteria | 10574 |
| 2082 | nmdc:mga0a205_652025_c1 | 3300050515 | Bacteria | 904 |
| 2083 | nmdc:mga0a205_84748_c1 | 3300050515 | Bacteria | 3061 |
| 2084 | Ga0495601_0048683 | 3300053077 | Bacteria | 2670 |
| 2085 | Ga0495601_0361678 | 3300053077 | Bacteria | 943 |
| 2086 | Ga0495601_0636841 | 3300053077 | Bacteria | 683 |
| 2087 | Ga0495601_0788862 | 3300053077 | Bacteria | 603 |
| 2088 | Ga0495612_0204082 | 3300053078 | Unclassified | 873 |
| 2089 | Ga0495612_0402516 | 3300053078 | Unclassified | 622 |
| 2090 | Ga0495655_0054240 | 3300053083 | Bacteria | 1072 |
| 2091 | Ga0495655_0096664 | 3300053083 | Bacteria | 869 |
| 2092 | Ga0495595_0150988 | 3300053084 | Bacteria | 1143 |
| 2093 | Ga0495595_0251778 | 3300053084 | Bacteria | 884 |
| 2094 | Ga0495595_0458141 | 3300053084 | Bacteria | 648 |
| 2095 | Ga0495595_0682950 | 3300053084 | Bacteria | 526 |
| 2096 | Ga0495619_0001542 | 3300053085 | Bacteria | 15176 |
| 2097 | Ga0495619_0195727 | 3300053085 | Unclassified | 1399 |
| 2098 | Ga0495619_0271918 | 3300053085 | Bacteria | 1174 |
| 2099 | Ga0495619_0333392 | 3300053085 | Unclassified | 1050 |
| 2100 | Ga0495619_0466073 | 3300053085 | Bacteria | 870 |
| 2101 | Ga0495619_0757885 | 3300053085 | Bacteria | 658 |
| 2102 | Ga0501084_0019884 | 3300054114 | Bacteria | 5597 |
| 2103 | Ga0501084_0078604 | 3300054114 | Bacteria | 2765 |
| 2104 | Ga0501084_0108923 | 3300054114 | Bacteria | 2327 |
| 2105 | Ga0501084_0388198 | 3300054114 | Bacteria | 1180 |
| 2106 | Ga0501084_0730286 | 3300054114 | Unclassified | 835 |
| 2107 | Ga0590071_000382 | 3300059421 | Bacteria | 13013 |
| 2108 | Ga0590071_000521 | 3300059421 | Bacteria | 11232 |
| 2109 | Ga0590074_029475 | 3300059423 | Unclassified | 966 |
| 2110 | Ga0590075_002497 | 3300059424 | Bacteria | 4397 |
| 2111 | Ga0590075_026192 | 3300059424 | Bacteria | 1468 |
| 2112 | Ga0590077_000003 | 3300059426 | Bacteria | 50145 |
| 2113 | Ga0590077_000431 | 3300059426 | Bacteria | 11762 |
| 2114 | Ga0590077_042093 | 3300059426 | Bacteria | 1016 |
| 2115 | Ga0501082_0148948 | 3300060353 | Bacteria | 2032 |
| 2116 | Ga0501082_0197894 | 3300060353 | Bacteria | 1748 |
| 2117 | Ga0501082_1413822 | 3300060353 | Bacteria | 607 |
| 2118 | Ga0466962_0534873 | 3300061719 | Unclassified | 595 |
| 2119 | Ga0530510_0001508 | 3300061734 | Bacteria | 15655 |
| 2120 | Ga0530510_0002012 | 3300061734 | Bacteria | 13952 |
| 2121 | Ga0530510_0089323 | 3300061734 | Bacteria | 2247 |
| 2122 | Ga0530510_0437834 | 3300061734 | Bacteria | 988 |
| 2123 | Ga0530510_1593966 | 3300061734 | Bacteria | 501 |
| 2124 | Ga0451576_0016435 | |||
| 2125 | SwRhRL2b_contig_2148127 | |||
| 2126 | JGI24744J21845_10081025 | |||
| 2127 | JGI25406J46586_10002033 | |||
| 2128 | JGI25406J46586_10004955 | |||
| 2129 | Ga0058859_11225154 | |||
| 2130 | Ga0058859_11833474 | |||
| 2131 | Ga0058860_11509978 | |||
| 2132 | Ga0058860_12001900 | |||
| 2133 | Ga0058860_12034974 | |||
| 2134 | Ga0058860_12173101 | |||
| 2135 | Ga0058862_12398501 | |||
| 2136 | Ga0065714_10095225 | |||
| 2137 | Ga0065714_10333917 | |||
| 2138 | Ga0065704_10135640 | |||
| 2139 | Ga0065704_10730815 | |||
| 2140 | Ga0065712_10002663 | |||
| 2141 | Ga0065712_10017476 | |||
| 2142 | Ga0065712_10162898 | |||
| 2143 | Ga0065712_10184946 | |||
| 2144 | Ga0065712_10315517 | |||
| 2145 | Ga0065712_10566396 | |||
| 2146 | Ga0065715_10023281 | |||
| 2147 | Ga0065715_10069454 | |||
| 2148 | Ga0065715_10095276 | |||
| 2149 | Ga0065715_10106779 | |||
| 2150 | Ga0065715_10114455 | |||
| 2151 | Ga0065715_10132989 | |||
| 2152 | Ga0065715_10194207 | |||
| 2153 | Ga0065715_10308400 | |||
| 2154 | Ga0065715_10328266 | |||
| 2155 | Ga0065715_10527144 | |||
| 2156 | Ga0065715_10666723 | |||
| 2157 | Ga0065715_10800108 | |||
| 2158 | Ga0065715_10871502 | |||
| 2159 | Ga0065707_10002879 | |||
| 2160 | Ga0065707_10023547 | |||
| 2161 | Ga0065707_10026073 | |||
| 2162 | Ga0065707_10100675 | |||
| 2163 | Ga0065707_10132350 | |||
| 2164 | Ga0065707_10194363 | |||
| 2165 | Ga0065707_10226146 | |||
| 2166 | Ga0065707_10227450 | |||
| 2167 | Ga0065707_10511618 | |||
| 2168 | Ga0065707_11156542 | |||
| 2169 | Ga0070658_10127997 | |||
| 2170 | Ga0070676_10024441 | |||
| 2171 | Ga0070676_10074653 | |||
| 2172 | Ga0070676_10122409 | |||
| 2173 | Ga0070676_10245857 | |||
| 2174 | Ga0070676_10390668 | |||
| 2175 | Ga0070676_10560524 | |||
| 2176 | Ga0070676_10756453 | |||
| 2177 | Ga0070683_100005622 | |||
| 2178 | Ga0070683_100327732 | |||
| 2179 | Ga0070683_100700519 | |||
| 2180 | Ga0070683_101587079 | |||
| 2181 | Ga0070683_102359480 | |||
| 2182 | Ga0070690_100010440 | |||
| 2183 | Ga0070690_100013784 | |||
| 2184 | Ga0070690_100067794 | |||
| 2185 | Ga0070690_100238345 | |||
| 2186 | Ga0070690_100470749 | |||
| 2187 | Ga0070690_100521804 | |||
| 2188 | Ga0070690_100537069 | |||
| 2189 | Ga0070690_100737070 | |||
| 2190 | Ga0070690_101648002 | |||
| 2191 | Ga0070670_100007350 | |||
| 2192 | Ga0070670_100019871 | |||
| 2193 | Ga0070670_100046970 | |||
| 2194 | Ga0070670_100047679 | |||
| 2195 | Ga0070670_100233445 | |||
| 2196 | Ga0070670_100261849 | |||
| 2197 | Ga0070670_100303374 | |||
| 2198 | Ga0070670_100392641 | |||
| 2199 | Ga0070670_101027695 | |||
| 2200 | Ga0070670_102243699 | |||
| 2201 | Ga0070677_10048799 | |||
| 2202 | Ga0070677_10099213 | |||
| 2203 | Ga0070677_10297371 | |||
| 2204 | Ga0070677_10460740 | |||
| 2205 | Ga0070677_10505284 | |||
| 2206 | Ga0068869_100009775 | |||
| 2207 | Ga0068869_100108607 | |||
| 2208 | Ga0068869_100374281 | |||
| 2209 | Ga0068869_100398332 | |||
| 2210 | Ga0068869_100615339 | |||
| 2211 | Ga0068869_100650616 | |||
| 2212 | Ga0068869_100661596 | |||
| 2213 | Ga0068869_100703930 | |||
| 2214 | Ga0068869_101095695 | |||
| 2215 | Ga0068869_101313923 | |||
| 2216 | Ga0068869_101659123 | |||
| 2217 | Ga0068869_101664703 | |||
| 2218 | Ga0070666_10039561 | |||
| 2219 | Ga0070666_10120025 | |||
| 2220 | Ga0070666_10307932 | |||
| 2221 | Ga0070666_10310976 | |||
| 2222 | Ga0070666_10370755 | |||
| 2223 | Ga0070666_11107206 | |||
| 2224 | Ga0070666_11205262 | |||
| 2225 | Ga0070666_11484800 | |||
| 2226 | Ga0070680_100412459 | |||
| 2227 | Ga0070680_100497460 | |||
| 2228 | Ga0070680_100844237 | |||
| 2229 | Ga0070680_100934098 | |||
| 2230 | Ga0070680_101275735 | |||
| 2231 | Ga0070680_101480742 | |||
| 2232 | Ga0070680_101506034 | |||
| 2233 | Ga0070682_100453073 | |||
| 2234 | Ga0070682_101171712 | |||
| 2235 | Ga0068868_100076339 | |||
| 2236 | Ga0068868_100211519 | |||
| 2237 | Ga0068868_100462053 | |||
| 2238 | Ga0068868_100488255 | |||
| 2239 | Ga0068868_100884178 | |||
| 2240 | Ga0068868_101838642 | |||
| 2241 | Ga0070660_100161973 | |||
| 2242 | Ga0070660_100933514 | |||
| 2243 | Ga0070660_101089696 | |||
| 2244 | Ga0070660_101108555 | |||
| 2245 | Ga0070660_101369563 | |||
| 2246 | Ga0070689_100005041 | |||
| 2247 | Ga0070689_100011742 | |||
| 2248 | Ga0070689_100051462 | |||
| 2249 | Ga0070689_100060714 | |||
| 2250 | Ga0070689_100137374 | |||
| 2251 | Ga0070689_100292431 | |||
| 2252 | Ga0070689_100306504 | |||
| 2253 | Ga0070689_100395869 | |||
| 2254 | Ga0070689_100582969 | |||
| 2255 | Ga0070689_100735187 | |||
| 2256 | Ga0070689_101219738 | |||
| 2257 | Ga0070689_101329399 | |||
| 2258 | Ga0070691_10188218 | |||
| 2259 | Ga0070687_100002090 | |||
| 2260 | Ga0070687_100950177 | |||
| 2261 | Ga0070687_100977576 | |||
| 2262 | Ga0070687_101269788 | |||
| 2263 | Ga0070661_100217276 | |||
| 2264 | Ga0070661_100241856 | |||
| 2265 | Ga0070661_100266999 | |||
| 2266 | Ga0070661_100891090 | |||
| 2267 | Ga0070661_101493268 | |||
| 2268 | Ga0070692_10189569 | |||
| 2269 | Ga0070692_10200794 | |||
| 2270 | Ga0070692_10277022 | |||
| 2271 | Ga0070692_11212981 | |||
| 2272 | Ga0070668_100067062 | |||
| 2273 | Ga0070668_100196670 | |||
| 2274 | Ga0070668_100224774 | |||
| 2275 | Ga0070668_100676367 | |||
| 2276 | Ga0070668_100982748 | |||
| 2277 | Ga0070669_100005475 | |||
| 2278 | Ga0070669_100015084 | |||
| 2279 | Ga0070669_100037760 | |||
| 2280 | Ga0070669_100061952 | |||
| 2281 | Ga0070669_100072047 | |||
| 2282 | Ga0070669_100106080 | |||
| 2283 | Ga0070669_100126660 | |||
| 2284 | Ga0070669_100230765 | |||
| 2285 | Ga0070669_100660566 | |||
| 2286 | Ga0070669_101064389 | |||
| 2287 | Ga0070669_101292227 | |||
| 2288 | Ga0070669_101570221 | |||
| 2289 | Ga0070675_100000785 | |||
| 2290 | Ga0070675_100006317 | |||
| 2291 | Ga0070675_100015402 | |||
| 2292 | Ga0070675_100021027 | |||
| 2293 | Ga0070675_100023859 | |||
| 2294 | Ga0070675_100031702 | |||
| 2295 | Ga0070675_100035816 | |||
| 2296 | Ga0070675_100054006 | |||
| 2297 | Ga0070675_100121191 | |||
| 2298 | Ga0070675_100171061 | |||
| 2299 | Ga0070675_100183149 | |||
| 2300 | Ga0070675_100303961 | |||
| 2301 | Ga0070675_100369004 | |||
| 2302 | Ga0070675_100525810 | |||
| 2303 | Ga0070675_100660338 | |||
| 2304 | Ga0070675_102200369 | |||
| 2305 | Ga0070671_100008522 | |||
| 2306 | Ga0070671_100520940 | |||
| 2307 | Ga0070671_100580359 | |||
| 2308 | Ga0070671_100917087 | |||
| 2309 | Ga0070671_101167641 | |||
| 2310 | Ga0070671_101682484 | |||
| 2311 | Ga0070674_100005809 | |||
| 2312 | Ga0070674_100105712 | |||
| 2313 | Ga0070674_100213240 | |||
| 2314 | Ga0070674_100567705 | |||
| 2315 | Ga0070674_100892454 | |||
| 2316 | Ga0070674_100982888 | |||
| 2317 | Ga0070674_101008626 | |||
| 2318 | Ga0070674_101164679 | |||
| 2319 | Ga0070674_101226774 | |||
| 2320 | Ga0070674_101241425 | |||
| 2321 | Ga0070673_100006588 | |||
| 2322 | Ga0070673_100008523 | |||
| 2323 | Ga0070673_100047974 | |||
| 2324 | Ga0070673_100188801 | |||
| 2325 | Ga0070673_100198379 | |||
| 2326 | Ga0070673_100276701 | |||
| 2327 | Ga0070673_100283888 | |||
| 2328 | Ga0070673_100297696 | |||
| 2329 | Ga0070673_100312330 | |||
| 2330 | Ga0070673_100460942 | |||
| 2331 | Ga0070673_100522757 | |||
| 2332 | Ga0070673_100564622 | |||
| 2333 | Ga0070673_101282237 | |||
| 2334 | Ga0070688_100008455 | |||
| 2335 | Ga0070688_100049444 | |||
| 2336 | Ga0070688_100070345 | |||
| 2337 | Ga0070688_100124710 | |||
| 2338 | Ga0070688_100178884 | |||
| 2339 | Ga0070688_100186682 | |||
| 2340 | Ga0070688_100279442 | |||
| 2341 | Ga0070688_100449028 | |||
| 2342 | Ga0070688_100609102 | |||
| 2343 | Ga0070688_101726580 | |||
| 2344 | Ga0070659_100125835 | |||
| 2345 | Ga0070659_100171502 | |||
| 2346 | Ga0070659_100240569 | |||
| 2347 | Ga0070659_100337585 | |||
| 2348 | Ga0070659_100344197 | |||
| 2349 | Ga0070659_101111214 | |||
| 2350 | Ga0070667_100028378 | |||
| 2351 | Ga0070667_100094543 | |||
| 2352 | Ga0070667_100240308 | |||
| 2353 | Ga0070667_100405796 | |||
| 2354 | Ga0070667_100416480 | |||
| 2355 | Ga0070667_101767131 | |||
| 2356 | Ga0070703_10233017 | |||
| 2357 | Ga0070703_10572211 | |||
| 2358 | Ga0070709_10014162 | |||
| 2359 | Ga0070709_10518276 | |||
| 2360 | Ga0070709_10621115 | |||
| 2361 | Ga0070714_101191261 | |||
| 2362 | Ga0070713_100343648 | |||
| 2363 | Ga0070713_100386806 | |||
| 2364 | Ga0070710_10374637 | |||
| 2365 | Ga0070701_10007649 | |||
| 2366 | Ga0070701_10015376 | |||
| 2367 | Ga0070701_10623043 | |||
| 2368 | Ga0070701_10879432 | |||
| 2369 | Ga0070701_11181992 | |||
| 2370 | Ga0070701_11197008 | |||
| 2371 | Ga0070711_100414982 | |||
| 2372 | Ga0070711_100500955 | |||
| 2373 | Ga0070711_100851390 | |||
| 2374 | Ga0070705_100001204 | |||
| 2375 | Ga0070705_100019732 | |||
| 2376 | Ga0070705_100160764 | |||
| 2377 | Ga0070705_100174191 | |||
| 2378 | Ga0070705_100234459 | |||
| 2379 | Ga0070705_100544153 | |||
| 2380 | Ga0070705_101063937 | |||
| 2381 | Ga0070700_100093816 | |||
| 2382 | Ga0070700_100232156 | |||
| 2383 | Ga0070700_100247876 | |||
| 2384 | Ga0070700_100251928 | |||
| 2385 | Ga0070700_100457418 | |||
| 2386 | Ga0070700_100496670 | |||
| 2387 | Ga0070700_101092355 | |||
| 2388 | Ga0070694_100000199 | |||
| 2389 | Ga0070694_100039897 | |||
| 2390 | Ga0070694_100047092 | |||
| 2391 | Ga0070694_100135188 | |||
| 2392 | Ga0070694_100203569 | |||
| 2393 | Ga0070694_100249946 | |||
| 2394 | Ga0070694_100261021 | |||
| 2395 | Ga0070694_100291505 | |||
| 2396 | Ga0070694_100487636 | |||
| 2397 | Ga0070694_100507138 | |||
| 2398 | Ga0070694_100588536 | |||
| 2399 | Ga0070694_101138592 | |||
| 2400 | Ga0070694_101411918 | |||
| 2401 | Ga0070694_101778476 | |||
| 2402 | Ga0070708_100015924 | |||
| 2403 | Ga0070708_100073351 | |||
| 2404 | Ga0070708_100650688 | |||
| 2405 | Ga0070708_101067006 | |||
| 2406 | Ga0070708_101363565 | |||
| 2407 | Ga0070708_101676736 | |||
| 2408 | Ga0070663_100018690 | |||
| 2409 | Ga0070663_100348019 | |||
| 2410 | Ga0070663_100724833 | |||
| 2411 | Ga0070663_101890450 | |||
| 2412 | Ga0070678_100007601 | |||
| 2413 | Ga0070678_100028082 | |||
| 2414 | Ga0070678_100073186 | |||
| 2415 | Ga0070678_100167410 | |||
| 2416 | Ga0070678_100246278 | |||
| 2417 | Ga0070678_100411585 | |||
| 2418 | Ga0070678_101356710 | |||
| 2419 | Ga0070678_101477490 | |||
| 2420 | Ga0070662_100051755 | |||
| 2421 | Ga0070662_100169063 | |||
| 2422 | Ga0070662_100190740 | |||
| 2423 | Ga0070681_10014967 | |||
| 2424 | Ga0070681_10032641 | |||
| 2425 | Ga0070681_10086022 | |||
| 2426 | Ga0070681_10357396 | |||
| 2427 | Ga0068867_100001191 | |||
| 2428 | Ga0068867_100002272 | |||
| 2429 | Ga0068867_100013275 | |||
| 2430 | Ga0068867_100158218 | |||
| 2431 | Ga0068867_100478326 | |||
| 2432 | Ga0068867_100714667 | |||
| 2433 | Ga0068867_100773825 | |||
| 2434 | Ga0068867_100878481 | |||
| 2435 | Ga0068867_100928827 | |||
| 2436 | Ga0070685_10018710 | |||
| 2437 | Ga0070685_10262479 | |||
| 2438 | Ga0070685_10410375 | |||
| 2439 | Ga0070685_10575439 | |||
| 2440 | Ga0070685_11313699 | |||
| 2441 | Ga0070685_11393870 | |||
| 2442 | Ga0070685_11608758 | |||
| 2443 | Ga0070706_100124050 | |||
| 2444 | Ga0070706_100221094 | |||
| 2445 | Ga0070706_100769239 | |||
| 2446 | Ga0070706_101336329 | |||
| 2447 | Ga0070706_101437599 | |||
| 2448 | Ga0070706_101823435 | |||
| 2449 | Ga0070706_101903111 | |||
| 2450 | Ga0070706_101928880 | |||
| 2451 | Ga0070707_100062625 | |||
| 2452 | Ga0070707_100084624 | |||
| 2453 | Ga0070707_100092228 | |||
| 2454 | Ga0070707_100290025 | |||
| 2455 | Ga0070707_100412000 | |||
| 2456 | Ga0070707_100667742 | |||
| 2457 | Ga0070707_101340903 | |||
| 2458 | Ga0070698_100002764 | |||
| 2459 | Ga0070698_100004315 | |||
| 2460 | Ga0070698_100024808 | |||
| 2461 | Ga0070698_100086145 | |||
| 2462 | Ga0070698_100283194 | |||
| 2463 | Ga0070698_100572861 | |||
| 2464 | Ga0070698_100677907 | |||
| 2465 | Ga0070698_100693759 | |||
| 2466 | Ga0070698_101075174 | |||
| 2467 | Ga0070698_101164071 | |||
| 2468 | Ga0070698_101860901 | |||
| 2469 | Ga0070699_100000172 | |||
| 2470 | Ga0070699_100008183 | |||
| 2471 | Ga0070699_100045608 | |||
| 2472 | Ga0070699_100065455 | |||
| 2473 | Ga0070699_100161479 | |||
| 2474 | Ga0070699_100186084 | |||
| 2475 | Ga0070699_100212512 | |||
| 2476 | Ga0070699_100837213 | |||
| 2477 | Ga0070699_101003010 | |||
| 2478 | Ga0070699_101750862 | |||
| 2479 | Ga0070699_101847079 | |||
| 2480 | Ga0070679_100305411 | |||
| 2481 | Ga0070679_100332442 | |||
| 2482 | Ga0070679_100611524 | |||
| 2483 | Ga0070679_100694605 | |||
| 2484 | Ga0070684_100042447 | |||
| 2485 | Ga0070684_100196125 | |||
| 2486 | Ga0070684_100654684 | |||
| 2487 | Ga0070684_100840404 | |||
| 2488 | Ga0070684_101515821 | |||
| 2489 | Ga0070684_101872147 | |||
| 2490 | Ga0070684_102328242 | |||
| 2491 | Ga0070697_100099767 | |||
| 2492 | Ga0070697_100130792 | |||
| 2493 | Ga0070697_100263238 | |||
| 2494 | Ga0070697_100807893 | |||
| 2495 | Ga0070697_100830402 | |||
| 2496 | Ga0070697_101035517 | |||
| 2497 | Ga0070697_101288278 | |||
| 2498 | Ga0070697_101636146 | |||
| 2499 | Ga0070697_101703915 | |||
| 2500 | Ga0068853_101468135 | |||
| 2501 | Ga0068853_101601435 | |||
| 2502 | Ga0070672_100031975 | |||
| 2503 | Ga0070672_100058398 | |||
| 2504 | Ga0070672_100060185 | |||
| 2505 | Ga0070672_100074122 | |||
| 2506 | Ga0070672_100091256 | |||
| 2507 | Ga0070672_100099686 | |||
| 2508 | Ga0070672_100160706 | |||
| 2509 | Ga0070672_100326655 | |||
| 2510 | Ga0070672_100502436 | |||
| 2511 | Ga0070672_100624721 | |||
| 2512 | Ga0070672_100891067 | |||
| 2513 | Ga0070672_101056918 | |||
| 2514 | Ga0070672_101078543 | |||
| 2515 | Ga0070672_101113648 | |||
| 2516 | Ga0070672_101267608 | |||
| 2517 | Ga0070672_101504822 | |||
| 2518 | Ga0070686_100007548 | |||
| 2519 | Ga0070686_100012930 | |||
| 2520 | Ga0070686_100058396 | |||
| 2521 | Ga0070686_100151436 | |||
| 2522 | Ga0070686_100199369 | |||
| 2523 | Ga0070686_100350660 | |||
| 2524 | Ga0070686_100490959 | |||
| 2525 | Ga0070695_100000002 | |||
| 2526 | Ga0070695_100001675 | |||
| 2527 | Ga0070695_100015542 | |||
| 2528 | Ga0070695_100043868 | |||
| 2529 | Ga0070695_100073857 | |||
| 2530 | Ga0070695_100258091 | |||
| 2531 | Ga0070695_100423483 | |||
| 2532 | Ga0070695_100457569 | |||
| 2533 | Ga0070695_100671628 | |||
| 2534 | Ga0070695_100753567 | |||
| 2535 | Ga0070695_101209342 | |||
| 2536 | Ga0070696_100018496 | |||
| 2537 | Ga0070696_100025383 | |||
| 2538 | Ga0070696_100098274 | |||
| 2539 | Ga0070696_100102001 | |||
| 2540 | Ga0070696_100188051 | |||
| 2541 | Ga0070696_100511151 | |||
| 2542 | Ga0070696_100580023 | |||
| 2543 | Ga0070696_100850970 | |||
| 2544 | Ga0070696_100898535 | |||
| 2545 | Ga0070696_101101178 | |||
| 2546 | Ga0070693_100146440 | |||
| 2547 | Ga0070693_100169120 | |||
| 2548 | Ga0070693_100212516 | |||
| 2549 | Ga0070693_100848024 | |||
| 2550 | Ga0070693_100995942 | |||
| 2551 | Ga0070693_101527429 | |||
| 2552 | Ga0070665_100002623 | |||
| 2553 | Ga0070665_100028738 | |||
| 2554 | Ga0070665_100091624 | |||
| 2555 | Ga0070665_100601071 | |||
| 2556 | Ga0070665_102195848 | |||
| 2557 | Ga0070665_102255672 | |||
| 2558 | Ga0070704_100000468 | |||
| 2559 | Ga0070704_100002643 | |||
| 2560 | Ga0070704_100007220 | |||
| 2561 | Ga0070704_100022196 | |||
| 2562 | Ga0070704_100073177 | |||
| 2563 | Ga0070704_100192897 | |||
| 2564 | Ga0070704_100296312 | |||
| 2565 | Ga0070704_100665164 | |||
| 2566 | Ga0070704_101158624 | |||
| 2567 | Ga0070704_101266903 | |||
| 2568 | Ga0070704_101330574 | |||
| 2569 | Ga0070704_102070239 | |||
| 2570 | Ga0070704_102234396 | |||
| 2571 | Ga0070704_102280395 | |||
| 2572 | Ga0068855_101152549 | |||
| 2573 | Ga0068855_102093755 | |||
| 2574 | Ga0070664_100002860 | |||
| 2575 | Ga0070664_100045421 | |||
| 2576 | Ga0070664_100069720 | |||
| 2577 | Ga0070664_100105276 | |||
| 2578 | Ga0070664_100126456 | |||
| 2579 | Ga0070664_100127011 | |||
| 2580 | Ga0070664_100177350 | |||
| 2581 | Ga0070664_100182108 | |||
| 2582 | Ga0070664_100564297 | |||
| 2583 | Ga0070664_100826129 | |||
| 2584 | Ga0070664_101013673 | |||
| 2585 | Ga0070664_101092977 | |||
| 2586 | Ga0070664_101262791 | |||
| 2587 | Ga0070664_101813091 | |||
| 2588 | Ga0070664_102126924 | |||
| 2589 | Ga0068857_100077346 | |||
| 2590 | Ga0068857_100093599 | |||
| 2591 | Ga0068857_100486190 | |||
| 2592 | Ga0068857_101087540 | |||
| 2593 | Ga0068857_101773924 | |||
| 2594 | Ga0068857_102090674 | |||
| 2595 | Ga0068854_100127031 | |||
| 2596 | Ga0068854_100247639 | |||
| 2597 | Ga0068854_100267523 | |||
| 2598 | Ga0068854_101027515 | |||
| 2599 | Ga0068854_101588209 | |||
| 2600 | Ga0068854_101826008 | |||
| 2601 | Ga0070702_100103508 | |||
| 2602 | Ga0070702_100129212 | |||
| 2603 | Ga0070702_100207281 | |||
| 2604 | Ga0070702_100245320 | |||
| 2605 | Ga0070702_100256718 | |||
| 2606 | Ga0070702_101535113 | |||
| 2607 | Ga0068852_100482501 | |||
| 2608 | Ga0068852_100835748 | |||
| 2609 | Ga0068852_100934372 | |||
| 2610 | Ga0068852_101103134 | |||
| 2611 | Ga0068852_101734338 | |||
| 2612 | Ga0068852_102515116 | |||
| 2613 | Ga0068859_100001189 | |||
| 2614 | Ga0068859_100007303 | |||
| 2615 | Ga0068859_100057695 | |||
| 2616 | Ga0068859_100057987 | |||
| 2617 | Ga0068859_100084219 | |||
| 2618 | Ga0068859_100085528 | |||
| 2619 | Ga0068859_100088877 | |||
| 2620 | Ga0068859_100131680 | |||
| 2621 | Ga0068859_100179780 | |||
| 2622 | Ga0068859_100209245 | |||
| 2623 | Ga0068859_100267030 | |||
| 2624 | Ga0068859_100672695 | |||
| 2625 | Ga0068859_100714990 | |||
| 2626 | Ga0068859_100871461 | |||
| 2627 | Ga0068859_101168972 | |||
| 2628 | Ga0068859_102132531 | |||
| 2629 | Ga0068859_102234570 | |||
| 2630 | Ga0068859_102585109 | |||
| 2631 | Ga0068859_102855231 | |||
| 2632 | Ga0068864_100010745 | |||
| 2633 | Ga0068864_100013376 | |||
| 2634 | Ga0068864_100029117 | |||
| 2635 | Ga0068864_100037542 | |||
| 2636 | Ga0068864_100124697 | |||
| 2637 | Ga0068864_100347414 | |||
| 2638 | Ga0068864_100371880 | |||
| 2639 | Ga0068864_100405000 | |||
| 2640 | Ga0068864_100425924 | |||
| 2641 | Ga0068864_100553860 | |||
| 2642 | Ga0068864_100929793 | |||
| 2643 | Ga0068864_101714657 | |||
| 2644 | Ga0068864_101771466 | |||
| 2645 | Ga0068866_10018862 | |||
| 2646 | Ga0068866_10029981 | |||
| 2647 | Ga0068866_10179654 | |||
| 2648 | Ga0068866_10257470 | |||
| 2649 | Ga0068866_11303960 | |||
| 2650 | Ga0068866_11443576 | |||
| 2651 | Ga0068861_100003348 | |||
| 2652 | Ga0068861_100007806 | |||
| 2653 | Ga0068861_100052196 | |||
| 2654 | Ga0068861_100093932 | |||
| 2655 | Ga0068861_100130694 | |||
| 2656 | Ga0068861_100328220 | |||
| 2657 | Ga0068861_100401730 | |||
| 2658 | Ga0068861_100595368 | |||
| 2659 | Ga0068861_101734904 | |||
| 2660 | Ga0068861_102053012 | |||
| 2661 | Ga0068851_10017577 | |||
| 2662 | Ga0068851_11073450 | |||
| 2663 | Ga0068870_10002734 | |||
| 2664 | Ga0068870_10007232 | |||
| 2665 | Ga0068870_10008504 | |||
| 2666 | Ga0068870_10025218 | |||
| 2667 | Ga0068870_10071365 | |||
| 2668 | Ga0068870_10119366 | |||
| 2669 | Ga0068870_10154531 | |||
| 2670 | Ga0068870_10516032 | |||
| 2671 | Ga0068870_10655141 | |||
| 2672 | Ga0068870_10749815 | |||
| 2673 | Ga0068863_100001594 | |||
| 2674 | Ga0068863_100029322 | |||
| 2675 | Ga0068863_100042275 | |||
| 2676 | Ga0068863_100148402 | |||
| 2677 | Ga0068863_100184035 | |||
| 2678 | Ga0068863_100455353 | |||
| 2679 | Ga0068863_100616685 | |||
| 2680 | Ga0068863_100872114 | |||
| 2681 | Ga0068863_101241027 | |||
| 2682 | Ga0068863_101343686 | |||
| 2683 | Ga0068863_101992893 | |||
| 2684 | Ga0068858_100003439 | |||
| 2685 | Ga0068858_100015584 | |||
| 2686 | Ga0068858_100031755 | |||
| 2687 | Ga0068858_100048955 | |||
| 2688 | Ga0068858_100057459 | |||
| 2689 | Ga0068858_100225921 | |||
| 2690 | Ga0068858_100371815 | |||
| 2691 | Ga0068858_100507933 | |||
| 2692 | Ga0068858_100622638 | |||
| 2693 | Ga0068858_100832285 | |||
| 2694 | Ga0068858_101665512 | |||
| 2695 | Ga0068858_101979541 | |||
| 2696 | Ga0068860_100002831 | |||
| 2697 | Ga0068860_100038554 | |||
| 2698 | Ga0068860_100087227 | |||
| 2699 | Ga0068860_100340393 | |||
| 2700 | Ga0068860_100355286 | |||
| 2701 | Ga0068860_100880887 | |||
| 2702 | Ga0068860_100982344 | |||
| 2703 | Ga0068860_101080094 | |||
| 2704 | Ga0068860_101251590 | |||
| 2705 | Ga0068860_101441027 | |||
| 2706 | Ga0068860_101640610 | |||
| 2707 | Ga0068860_101710642 | |||
| 2708 | Ga0068860_102087572 | |||
| 2709 | Ga0068860_102428102 | |||
| 2710 | Ga0068862_100001533 | |||
| 2711 | Ga0068862_100001812 | |||
| 2712 | Ga0068862_100107479 | |||
| 2713 | Ga0068862_100129265 | |||
| 2714 | Ga0068862_100306841 | |||
| 2715 | Ga0068862_100307715 | |||
| 2716 | Ga0068862_100323645 | |||
| 2717 | Ga0068862_100502490 | |||
| 2718 | Ga0068862_100762930 | |||
| 2719 | Ga0068862_101075054 | |||
| 2720 | Ga0068862_101126102 | |||
| 2721 | Ga0068862_101775328 | |||
| 2722 | Ga0068862_102108496 | |||
| 2723 | Ga0068862_102494216 | |||
| 2724 | Ga0081455_10081091 | |||
| 2725 | Ga0081455_10194880 | |||
| 2726 | Ga0081539_10000024 | |||
| 2727 | Ga0081539_10000096 | |||
| 2728 | Ga0081539_10028795 | |||
| 2729 | Ga0081539_10258575 | |||
| 2730 | Ga0081539_10268453 | |||
| 2731 | Ga0081539_10272946 | |||
| 2732 | Ga0070717_10230633 | |||
| 2733 | Ga0070717_10850684 | |||
| 2734 | Ga0075432_10029143 | |||
| 2735 | Ga0075432_10363888 | |||
| 2736 | Ga0070716_100984168 | |||
| 2737 | Ga0070712_101809275 | |||
| 2738 | Ga0070712_101849360 | |||
| 2739 | Ga0075427_10025470 | |||
| 2740 | Ga0097621_100000820 | |||
| 2741 | Ga0097621_100010172 | |||
| 2742 | Ga0097621_100019068 | |||
| 2743 | Ga0097621_100035057 | |||
| 2744 | Ga0097621_100133659 | |||
| 2745 | Ga0097621_100232519 | |||
| 2746 | Ga0097621_100247823 | |||
| 2747 | Ga0097621_100259946 | |||
| 2748 | Ga0097621_100305225 | |||
| 2749 | Ga0097621_100311632 | |||
| 2750 | Ga0097621_100717133 | |||
| 2751 | Ga0097621_101323250 | |||
| 2752 | Ga0068871_100000748 | |||
| 2753 | Ga0068871_100007358 | |||
| 2754 | Ga0068871_100019530 | |||
| 2755 | Ga0068871_100100346 | |||
| 2756 | Ga0068871_100471852 | |||
| 2757 | Ga0068871_100485606 | |||
| 2758 | Ga0068871_100808173 | |||
| 2759 | Ga0068871_100825898 | |||
| 2760 | Ga0068871_100996534 | |||
| 2761 | Ga0068871_101583866 | |||
| 2762 | Ga0075428_100012777 | |||
| 2763 | Ga0075428_100030141 | |||
| 2764 | Ga0075428_100061549 | |||
| 2765 | Ga0075428_100092638 | |||
| 2766 | Ga0075428_100121571 | |||
| 2767 | Ga0075428_100219659 | |||
| 2768 | Ga0075428_100226840 | |||
| 2769 | Ga0075428_100374076 | |||
| 2770 | Ga0075428_100520688 | |||
| 2771 | Ga0075428_100842671 | |||
| 2772 | Ga0075430_100009273 | |||
| 2773 | Ga0075430_100017018 | |||
| 2774 | Ga0075430_100058440 | |||
| 2775 | Ga0075430_100591270 | |||
| 2776 | Ga0075431_100051008 | |||
| 2777 | Ga0075431_100076833 | |||
| 2778 | Ga0075431_100248873 | |||
| 2779 | Ga0075431_100589924 | |||
| 2780 | Ga0075433_10026165 | |||
| 2781 | Ga0075433_10044412 | |||
| 2782 | Ga0075433_10115117 | |||
| 2783 | Ga0075433_10165487 | |||
| 2784 | Ga0075433_10205477 | |||
| 2785 | Ga0075433_10244578 | |||
| 2786 | Ga0075433_10273510 | |||
| 2787 | Ga0075433_10319208 | |||
| 2788 | Ga0075433_10395913 | |||
| 2789 | Ga0075433_10455278 | |||
| 2790 | Ga0075433_10830909 | |||
| 2791 | Ga0075433_11045324 | |||
| 2792 | Ga0075433_11677241 | |||
| 2793 | Ga0075433_11927954 | |||
| 2794 | Ga0075434_100000213 | |||
| 2795 | Ga0075434_100007002 | |||
| 2796 | Ga0075434_100046593 | |||
| 2797 | Ga0075434_100083019 | |||
| 2798 | Ga0075434_100123977 | |||
| 2799 | Ga0075434_100170073 | |||
| 2800 | Ga0075434_100170935 | |||
| 2801 | Ga0075434_100208315 | |||
| 2802 | Ga0075434_100247411 | |||
| 2803 | Ga0075434_100251669 | |||
| 2804 | Ga0075434_100367886 | |||
| 2805 | Ga0075434_100579372 | |||
| 2806 | Ga0075434_100669491 | |||
| 2807 | Ga0075434_100706222 | |||
| 2808 | Ga0075434_101209000 | |||
| 2809 | Ga0075434_101240119 | |||
| 2810 | Ga0075434_101254459 | |||
| 2811 | Ga0075434_101689809 | |||
| 2812 | Ga0075434_102278326 | |||
| 2813 | Ga0075429_100021950 | |||
| 2814 | Ga0075429_100051497 | |||
| 2815 | Ga0075429_100154212 | |||
| 2816 | Ga0075429_100179118 | |||
| 2817 | Ga0075429_100313118 | |||
| 2818 | Ga0075429_100765807 | |||
| 2819 | Ga0075429_100948481 | |||
| 2820 | Ga0068865_100004635 | |||
| 2821 | Ga0068865_100028224 | |||
| 2822 | Ga0068865_100034892 | |||
| 2823 | Ga0068865_100035056 | |||
| 2824 | Ga0068865_100178498 | |||
| 2825 | Ga0068865_100399955 | |||
| 2826 | Ga0068865_100427629 | |||
| 2827 | Ga0068865_100519202 | |||
| 2828 | Ga0068865_101558683 | |||
| 2829 | Ga0068865_102089268 | |||
| 2830 | Ga0068865_102175901 | |||
| 2831 | Ga0075436_100004018 | |||
| 2832 | Ga0075436_100065371 | |||
| 2833 | Ga0075436_100117826 | |||
| 2834 | Ga0075436_100545411 | |||
| 2835 | Ga0075436_101090075 | |||
| 2836 | Ga0075436_101130864 | |||
| 2837 | Ga0097620_100001189 | |||
| 2838 | Ga0097620_100007303 | |||
| 2839 | Ga0097620_100057695 | |||
| 2840 | Ga0097620_100057987 | |||
| 2841 | Ga0097620_100084218 | |||
| 2842 | Ga0097620_100085522 | |||
| 2843 | Ga0097620_100088882 | |||
| 2844 | Ga0097620_100131683 | |||
| 2845 | Ga0097620_100179776 | |||
| 2846 | Ga0097620_100209228 | |||
| 2847 | Ga0097620_100267053 | |||
| 2848 | Ga0097620_100672748 | |||
| 2849 | Ga0097620_100715091 | |||
| 2850 | Ga0097620_100871292 | |||
| 2851 | Ga0097620_101169074 | |||
| 2852 | Ga0097620_102132446 | |||
| 2853 | Ga0097620_102234580 | |||
| 2854 | Ga0097620_102584934 | |||
| 2855 | Ga0097620_102855792 | |||
| 2856 | Ga0075435_100002059 | |||
| 2857 | Ga0075435_100002813 | |||
| 2858 | Ga0075435_100003388 | |||
| 2859 | Ga0075435_100015991 | |||
| 2860 | Ga0075435_100028816 | |||
| 2861 | Ga0075435_100053296 | |||
| 2862 | Ga0075435_100103311 | |||
| 2863 | Ga0075435_100618144 | |||
| 2864 | Ga0075435_100901266 | |||
| 2865 | Ga0099794_10572816 | |||
| 2866 | Ga0105244_10456420 | |||
| 2867 | Ga0105240_10171136 | |||
| 2868 | Ga0105240_10234875 | |||
| 2869 | Ga0105240_11652470 | |||
| 2870 | Ga0105240_11988535 | |||
| 2871 | Ga0111539_10002001 | |||
| 2872 | Ga0111539_10002576 | |||
| 2873 | Ga0111539_10010325 | |||
| 2874 | Ga0111539_10011738 | |||
| 2875 | Ga0111539_10046784 | |||
| 2876 | Ga0111539_10115406 | |||
| 2877 | Ga0111539_10359532 | |||
| 2878 | Ga0111539_10390820 | |||
| 2879 | Ga0111539_10470607 | |||
| 2880 | Ga0111539_10555941 | |||
| 2881 | Ga0111539_10594898 | |||
| 2882 | Ga0111539_10699382 | |||
| 2883 | Ga0111539_10750549 | |||
| 2884 | Ga0111539_10750724 | |||
| 2885 | Ga0111539_11087553 | |||
| 2886 | Ga0111539_11128549 | |||
| 2887 | Ga0111539_11812289 | |||
| 2888 | Ga0111539_12952699 | |||
| 2889 | Ga0111539_13244993 | |||
| 2890 | Ga0105245_10021064 | |||
| 2891 | Ga0105245_10025776 | |||
| 2892 | Ga0105245_10253059 | |||
| 2893 | Ga0105245_10407729 | |||
| 2894 | Ga0105245_11264531 | |||
| 2895 | Ga0105245_12203332 | |||
| 2896 | Ga0105245_13114656 | |||
| 2897 | Ga0105245_13279846 | |||
| 2898 | Ga0105247_10034310 | |||
| 2899 | Ga0105247_10047882 | |||
| 2900 | Ga0105247_10098845 | |||
| 2901 | Ga0105247_10657528 | |||
| 2902 | Ga0114129_10001136 | |||
| 2903 | Ga0114129_10002946 | |||
| 2904 | Ga0114129_10004592 | |||
| 2905 | Ga0114129_10020123 | |||
| 2906 | Ga0114129_10022122 | |||
| 2907 | Ga0114129_10027105 | |||
| 2908 | Ga0114129_10028461 | |||
| 2909 | Ga0114129_10037467 | |||
| 2910 | Ga0114129_10040079 | |||
| 2911 | Ga0114129_10057047 | |||
| 2912 | Ga0114129_10078980 | |||
| 2913 | Ga0114129_10115977 | |||
| 2914 | Ga0114129_10117373 | |||
| 2915 | Ga0114129_10117933 | |||
| 2916 | Ga0114129_10157558 | |||
| 2917 | Ga0114129_10171996 | |||
| 2918 | Ga0114129_10277709 | |||
| 2919 | Ga0114129_10661319 | |||
| 2920 | Ga0114129_10897615 | |||
| 2921 | Ga0114129_11017005 | |||
| 2922 | Ga0114129_11065124 | |||
| 2923 | Ga0114129_11154774 | |||
| 2924 | Ga0114129_11550771 | |||
| 2925 | Ga0114129_13127635 | |||
| 2926 | Ga0105243_10026404 | |||
| 2927 | Ga0105243_10028744 | |||
| 2928 | Ga0105243_10032111 | |||
| 2929 | Ga0105243_10436531 | |||
| 2930 | Ga0105243_10736250 | |||
| 2931 | Ga0105243_10739879 | |||
| 2932 | Ga0105243_10776727 | |||
| 2933 | Ga0105243_11440226 | |||
| 2934 | Ga0105243_11560607 | |||
| 2935 | Ga0105243_11648404 | |||
| 2936 | Ga0105241_10582711 | |||
| 2937 | Ga0105242_10012518 | |||
| 2938 | Ga0105242_10013395 | |||
| 2939 | Ga0105242_10068550 | |||
| 2940 | Ga0105242_10104044 | |||
| 2941 | Ga0105242_10131338 | |||
| 2942 | Ga0105242_10132461 | |||
| 2943 | Ga0105242_10325452 | |||
| 2944 | Ga0105242_10329470 | |||
| 2945 | Ga0105242_10381741 | |||
| 2946 | Ga0105242_10524107 | |||
| 2947 | Ga0105242_10551704 | |||
| 2948 | Ga0105242_11343377 | |||
| 2949 | Ga0105242_11413407 | |||
| 2950 | Ga0105242_12500736 | |||
| 2951 | Ga0105242_12795040 | |||
| 2952 | Ga0105242_13147865 | |||
| 2953 | Ga0105248_10043347 | |||
| 2954 | Ga0105248_10127746 | |||
| 2955 | Ga0105248_10188311 | |||
| 2956 | Ga0105248_10197994 | |||
| 2957 | Ga0105248_10401003 | |||
| 2958 | Ga0105248_10416931 | |||
| 2959 | Ga0105248_10515982 | |||
| 2960 | Ga0105248_10516236 | |||
| 2961 | Ga0105248_10544739 | |||
| 2962 | Ga0105248_10651381 | |||
| 2963 | Ga0105248_11201750 | |||
| 2964 | Ga0105248_11853336 | |||
| 2965 | Ga0105248_11872614 | |||
| 2966 | Ga0105248_11923027 | |||
| 2967 | Ga0105248_12202258 | |||
| 2968 | Ga0105237_10455188 | |||
| 2969 | Ga0105237_10706170 | |||
| 2970 | Ga0105237_11028602 | |||
| 2971 | Ga0105237_11291122 | |||
| 2972 | Ga0105237_11593893 | |||
| 2973 | Ga0105238_10013992 | |||
| 2974 | Ga0105238_10174139 | |||
| 2975 | Ga0105238_10547814 | |||
| 2976 | Ga0105238_10825350 | |||
| 2977 | Ga0105238_10847370 | |||
| 2978 | Ga0105238_11344746 | |||
| 2979 | Ga0105238_11641694 | |||
| 2980 | Ga0105249_10038160 | |||
| 2981 | Ga0105249_10112023 | |||
| 2982 | Ga0105249_10377746 | |||
| 2983 | Ga0105249_10396448 | |||
| 2984 | Ga0105249_10966485 | |||
| 2985 | Ga0105249_11296063 | |||
| 2986 | Ga0105249_11683134 | |||
| 2987 | Ga0099796_10437513 | |||
| 2988 | Ga0099796_10586792 | |||
| 2989 | Ga0105239_10884365 | |||
| 2990 | Ga0105246_10279464 | |||
| 2991 | Ga0105246_10386151 | |||
| 2992 | Ga0105246_12007378 | |||
| 2993 | Ga0157370_10315396 | |||
| 2994 | Ga0157370_11773769 | |||
| 2995 | Ga0157369_10694071 | |||
| 2996 | Ga0157374_10019059 | |||
| 2997 | Ga0157374_10021116 | |||
| 2998 | Ga0157374_10158911 | |||
| 2999 | Ga0157374_10248981 | |||
| 3000 | Ga0157374_10388333 | |||
| 3001 | Ga0157374_11910677 | |||
| 3002 | Ga0157374_12131109 | |||
| 3003 | Ga0157374_12271394 | |||
| 3004 | Ga0157378_10116848 | |||
| 3005 | Ga0157378_10122414 | |||
| 3006 | Ga0157378_10144012 | |||
| 3007 | Ga0157378_12250994 | |||
| 3008 | Ga0157378_12536566 | |||
| 3009 | Ga0157378_13029328 | |||
| 3010 | Ga0157378_13160646 | |||
| 3011 | Ga0157378_13217066 | |||
| 3012 | Ga0163162_10023215 | |||
| 3013 | Ga0163162_10085251 | |||
| 3014 | Ga0163162_10366532 | |||
| 3015 | Ga0163162_10821690 | |||
| 3016 | Ga0163162_10859269 | |||
| 3017 | Ga0163162_11043154 | |||
| 3018 | Ga0163162_11114219 | |||
| 3019 | Ga0163162_11130956 | |||
| 3020 | Ga0163162_11172367 | |||
| 3021 | Ga0163162_11246390 | |||
| 3022 | Ga0163162_11766125 | |||
| 3023 | Ga0163162_11993916 | |||
| 3024 | Ga0163162_13185473 | |||
| 3025 | Ga0163162_13269016 | |||
| 3026 | Ga0157372_10190621 | |||
| 3027 | Ga0157372_10568317 | |||
| 3028 | Ga0157372_11432019 | |||
| 3029 | Ga0157372_12182924 | |||
| 3030 | Ga0157372_13370353 | |||
| 3031 | Ga0157375_10002809 | |||
| 3032 | Ga0157375_10195198 | |||
| 3033 | Ga0157375_10267924 | |||
| 3034 | Ga0157375_10965827 | |||
| 3035 | Ga0157375_11406502 | |||
| 3036 | Ga0157375_11577475 | |||
| 3037 | Ga0157375_11854257 | |||
| 3038 | Ga0157375_11863662 | |||
| 3039 | Ga0157375_12107995 | |||
| 3040 | Ga0157375_12321154 | |||
| 3041 | Ga0157375_12609371 | |||
| 3042 | Ga0157375_13606814 | |||
| 3043 | Ga0163163_10019062 | |||
| 3044 | Ga0163163_10029929 | |||
| 3045 | Ga0163163_10034366 | |||
| 3046 | Ga0163163_10035670 | |||
| 3047 | Ga0163163_10131460 | |||
| 3048 | Ga0163163_10152247 | |||
| 3049 | Ga0163163_10212125 | |||
| 3050 | Ga0163163_10404711 | |||
| 3051 | Ga0163163_10718221 | |||
| 3052 | Ga0163163_12579260 | |||
| 3053 | Ga0163163_12625527 | |||
| 3054 | Ga0157380_10033704 | |||
| 3055 | Ga0157380_10043376 | |||
| 3056 | Ga0157380_10073134 | |||
| 3057 | Ga0157380_10078972 | |||
| 3058 | Ga0157380_10089956 | |||
| 3059 | Ga0157380_10295034 | |||
| 3060 | Ga0157380_10301337 | |||
| 3061 | Ga0157380_10315357 | |||
| 3062 | Ga0157380_10320424 | |||
| 3063 | Ga0157380_10820105 | |||
| 3064 | Ga0157380_11160073 | |||
| 3065 | Ga0157380_11654413 | |||
| 3066 | Ga0157380_11861662 | |||
| 3067 | Ga0157380_12090282 | |||
| 3068 | Ga0157380_12516602 | |||
| 3069 | Ga0157380_12781108 | |||
| 3070 | Ga0157377_10049493 | |||
| 3071 | Ga0157377_10097784 | |||
| 3072 | Ga0157377_10108179 | |||
| 3073 | Ga0157377_10202313 | |||
| 3074 | Ga0157377_10396339 | |||
| 3075 | Ga0157377_10437902 | |||
| 3076 | Ga0157377_10790353 | |||
| 3077 | Ga0157377_10938283 | |||
| 3078 | Ga0157377_11327752 | |||
| 3079 | Ga0157377_11425515 | |||
| 3080 | Ga0157379_10003474 | |||
| 3081 | Ga0157379_10075144 | |||
| 3082 | Ga0157379_10117348 | |||
| 3083 | Ga0157379_10191381 | |||
| 3084 | Ga0157379_10249808 | |||
| 3085 | Ga0157379_10378050 | |||
| 3086 | Ga0157379_10472510 | |||
| 3087 | Ga0157379_10512462 | |||
| 3088 | Ga0157379_10553275 | |||
| 3089 | Ga0157379_10945388 | |||
| 3090 | Ga0157376_10008040 | |||
| 3091 | Ga0157376_10017626 | |||
| 3092 | Ga0157376_10018373 | |||
| 3093 | Ga0157376_10069948 | |||
| 3094 | Ga0157376_10200328 | |||
| 3095 | Ga0157376_10264606 | |||
| 3096 | Ga0157376_10301913 | |||
| 3097 | Ga0157376_10411659 | |||
| 3098 | Ga0157376_12620232 | |||
| 3099 | Ga0163161_10437450 | |||
| 3100 | Ga0163161_10497282 | |||
| 3101 | Ga0163161_10537660 | |||
| 3102 | Ga0163161_11833857 | |||
| 3103 | Ga0206350_10273369 | |||
| 3104 | Ga0213876_10130218 | |||
| 3105 | Ga0207697_10049925 | |||
| 3106 | Ga0207697_10064197 | |||
| 3107 | Ga0207697_10159881 | |||
| 3108 | Ga0207697_10222430 | |||
| 3109 | Ga0207697_10353957 | |||
| 3110 | Ga0207697_10465749 | |||
| 3111 | Ga0207697_10470305 | |||
| 3112 | Ga0207656_10084620 | |||
| 3113 | Ga0207653_10043956 | |||
| 3114 | Ga0207682_10014308 | |||
| 3115 | Ga0207682_10056482 | |||
| 3116 | Ga0207682_10352289 | |||
| 3117 | Ga0207682_10479119 | |||
| 3118 | Ga0207692_10286169 | |||
| 3119 | Ga0207642_10049260 | |||
| 3120 | Ga0207642_10091674 | |||
| 3121 | Ga0207642_10153016 | |||
| 3122 | Ga0207642_10355579 | |||
| 3123 | Ga0207642_10418167 | |||
| 3124 | Ga0207710_10019937 | |||
| 3125 | Ga0207710_10027337 | |||
| 3126 | Ga0207710_10029566 | |||
| 3127 | Ga0207688_10184921 | |||
| 3128 | Ga0207688_10589021 | |||
| 3129 | Ga0207688_10715990 | |||
| 3130 | Ga0207688_10962474 | |||
| 3131 | Ga0207680_10067236 | |||
| 3132 | Ga0207680_10176061 | |||
| 3133 | Ga0207680_10248151 | |||
| 3134 | Ga0207680_10398804 | |||
| 3135 | Ga0207680_10472893 | |||
| 3136 | Ga0207680_10830626 | |||
| 3137 | Ga0207680_10909453 | |||
| 3138 | Ga0207680_10955625 | |||
| 3139 | Ga0207680_10996224 | |||
| 3140 | Ga0207680_10997477 | |||
| 3141 | Ga0207680_11212266 | |||
| 3142 | Ga0207680_11221007 | |||
| 3143 | Ga0207680_11306948 | |||
| 3144 | Ga0207647_10782042 | |||
| 3145 | Ga0207685_10053071 | |||
| 3146 | Ga0207699_10010829 | |||
| 3147 | Ga0207699_10091637 | |||
| 3148 | Ga0207645_10014261 | |||
| 3149 | Ga0207645_10242702 | |||
| 3150 | Ga0207645_10250164 | |||
| 3151 | Ga0207645_10360987 | |||
| 3152 | Ga0207645_10364706 | |||
| 3153 | Ga0207645_10648592 | |||
| 3154 | Ga0207645_10696259 | |||
| 3155 | Ga0207645_11191276 | |||
| 3156 | Ga0207643_10004564 | |||
| 3157 | Ga0207643_10008987 | |||
| 3158 | Ga0207643_10035071 | |||
| 3159 | Ga0207643_10065663 | |||
| 3160 | Ga0207643_10136963 | |||
| 3161 | Ga0207643_10154565 | |||
| 3162 | Ga0207643_10156111 | |||
| 3163 | Ga0207643_10193751 | |||
| 3164 | Ga0207643_10306345 | |||
| 3165 | Ga0207643_10537439 | |||
| 3166 | Ga0207643_10947459 | |||
| 3167 | Ga0207684_10257555 | |||
| 3168 | Ga0207684_10381313 | |||
| 3169 | Ga0207684_10622887 | |||
| 3170 | Ga0207684_10812381 | |||
| 3171 | Ga0207684_10912112 | |||
| 3172 | Ga0207684_11163112 | |||
| 3173 | Ga0207684_11426903 | |||
| 3174 | Ga0207684_11557443 | |||
| 3175 | Ga0207654_10177645 | |||
| 3176 | Ga0207654_11070021 | |||
| 3177 | Ga0207707_10024100 | |||
| 3178 | Ga0207707_10032794 | |||
| 3179 | Ga0207707_10279831 | |||
| 3180 | Ga0207707_10601049 | |||
| 3181 | Ga0207707_11121255 | |||
| 3182 | Ga0207707_11520945 | |||
| 3183 | Ga0207695_10529415 | |||
| 3184 | Ga0207695_10788680 | |||
| 3185 | Ga0207695_11164215 | |||
| 3186 | Ga0207671_10523927 | |||
| 3187 | Ga0207693_10950933 | |||
| 3188 | Ga0207663_10094880 | |||
| 3189 | Ga0207663_10266738 | |||
| 3190 | Ga0207663_11135376 | |||
| 3191 | Ga0207660_10225449 | |||
| 3192 | Ga0207660_10265138 | |||
| 3193 | Ga0207660_10272707 | |||
| 3194 | Ga0207660_10431858 | |||
| 3195 | Ga0207660_10622017 | |||
| 3196 | Ga0207660_10921116 | |||
| 3197 | Ga0207660_11551999 | |||
| 3198 | Ga0207662_10002904 | |||
| 3199 | Ga0207662_10011988 | |||
| 3200 | Ga0207662_10017112 | |||
| 3201 | Ga0207662_10110207 | |||
| 3202 | Ga0207662_10141593 | |||
| 3203 | Ga0207662_10356241 | |||
| 3204 | Ga0207662_11183159 | |||
| 3205 | Ga0207662_11370855 | |||
| 3206 | Ga0207657_10188145 | |||
| 3207 | Ga0207657_10542384 | |||
| 3208 | Ga0207649_10152232 | |||
| 3209 | Ga0207649_10292330 | |||
| 3210 | Ga0207649_10827093 | |||
| 3211 | Ga0207649_11098679 | |||
| 3212 | Ga0207649_11450030 | |||
| 3213 | Ga0207652_10119412 | |||
| 3214 | Ga0207652_10121939 | |||
| 3215 | Ga0207652_10625792 | |||
| 3216 | Ga0207652_10886454 | |||
| 3217 | Ga0207646_10038633 | |||
| 3218 | Ga0207646_10072249 | |||
| 3219 | Ga0207646_10121718 | |||
| 3220 | Ga0207646_10242014 | |||
| 3221 | Ga0207646_10965973 | |||
| 3222 | Ga0207646_11039703 | |||
| 3223 | Ga0207646_11777976 | |||
| 3224 | Ga0207681_10018017 | |||
| 3225 | Ga0207681_10030217 | |||
| 3226 | Ga0207681_10033207 | |||
| 3227 | Ga0207681_10043090 | |||
| 3228 | Ga0207681_10060642 | |||
| 3229 | Ga0207681_10060846 | |||
| 3230 | Ga0207681_10084558 | |||
| 3231 | Ga0207681_10129938 | |||
| 3232 | Ga0207681_10158937 | |||
| 3233 | Ga0207681_10226443 | |||
| 3234 | Ga0207681_10515486 | |||
| 3235 | Ga0207681_10834221 | |||
| 3236 | Ga0207694_10013622 | |||
| 3237 | Ga0207694_11132165 | |||
| 3238 | Ga0207650_10028078 | |||
| 3239 | Ga0207650_10064428 | |||
| 3240 | Ga0207650_10076891 | |||
| 3241 | Ga0207650_10171181 | |||
| 3242 | Ga0207650_10214392 | |||
| 3243 | Ga0207650_10276071 | |||
| 3244 | Ga0207650_10868048 | |||
| 3245 | Ga0207650_11001007 | |||
| 3246 | Ga0207650_11004823 | |||
| 3247 | Ga0207659_10000165 | |||
| 3248 | Ga0207659_10014307 | |||
| 3249 | Ga0207659_10014896 | |||
| 3250 | Ga0207659_10045471 | |||
| 3251 | Ga0207659_10065813 | |||
| 3252 | Ga0207659_10067674 | |||
| 3253 | Ga0207659_10089736 | |||
| 3254 | Ga0207659_10270937 | |||
| 3255 | Ga0207659_10274873 | |||
| 3256 | Ga0207659_10301783 | |||
| 3257 | Ga0207659_10324308 | |||
| 3258 | Ga0207659_10369885 | |||
| 3259 | Ga0207659_10615186 | |||
| 3260 | Ga0207659_10832869 | |||
| 3261 | Ga0207659_11162154 | |||
| 3262 | Ga0207687_10034358 | |||
| 3263 | Ga0207687_10096210 | |||
| 3264 | Ga0207687_10162619 | |||
| 3265 | Ga0207687_10290488 | |||
| 3266 | Ga0207700_10086331 | |||
| 3267 | Ga0207700_10359270 | |||
| 3268 | Ga0207700_11587640 | |||
| 3269 | Ga0207644_10022799 | |||
| 3270 | Ga0207644_10240169 | |||
| 3271 | Ga0207644_10250864 | |||
| 3272 | Ga0207644_10318543 | |||
| 3273 | Ga0207644_10706626 | |||
| 3274 | Ga0207644_10723932 | |||
| 3275 | Ga0207644_10768858 | |||
| 3276 | Ga0207644_10967400 | |||
| 3277 | Ga0207644_10974822 | |||
| 3278 | Ga0207690_10215206 | |||
| 3279 | Ga0207690_10449546 | |||
| 3280 | Ga0207690_10460417 | |||
| 3281 | Ga0207690_11181628 | |||
| 3282 | Ga0207690_11802667 | |||
| 3283 | Ga0207706_10015695 | |||
| 3284 | Ga0207706_10068523 | |||
| 3285 | Ga0207706_10077397 | |||
| 3286 | Ga0207706_10096178 | |||
| 3287 | Ga0207706_10250863 | |||
| 3288 | Ga0207706_10357566 | |||
| 3289 | Ga0207706_11035438 | |||
| 3290 | Ga0207706_11172750 | |||
| 3291 | Ga0207706_11582591 | |||
| 3292 | Ga0207706_11680527 | |||
| 3293 | Ga0207686_10031500 | |||
| 3294 | Ga0207686_10048667 | |||
| 3295 | Ga0207686_10193033 | |||
| 3296 | Ga0207686_10205680 | |||
| 3297 | Ga0207686_10213253 | |||
| 3298 | Ga0207686_10279108 | |||
| 3299 | Ga0207686_10306610 | |||
| 3300 | Ga0207686_10414150 | |||
| 3301 | Ga0207686_10626753 | |||
| 3302 | Ga0207686_10758118 | |||
| 3303 | Ga0207709_10003211 | |||
| 3304 | Ga0207709_10019406 | |||
| 3305 | Ga0207709_10023716 | |||
| 3306 | Ga0207709_10034561 | |||
| 3307 | Ga0207709_10155331 | |||
| 3308 | Ga0207709_10570687 | |||
| 3309 | Ga0207709_10584420 | |||
| 3310 | Ga0207709_10678031 | |||
| 3311 | Ga0207670_10009012 | |||
| 3312 | Ga0207670_10139424 | |||
| 3313 | Ga0207670_10226134 | |||
| 3314 | Ga0207670_10318199 | |||
| 3315 | Ga0207670_10496393 | |||
| 3316 | Ga0207670_10537851 | |||
| 3317 | Ga0207670_10635179 | |||
| 3318 | Ga0207670_10727907 | |||
| 3319 | Ga0207670_10740851 | |||
| 3320 | Ga0207670_10946453 | |||
| 3321 | Ga0207670_11167465 | |||
| 3322 | Ga0207670_11797082 | |||
| 3323 | Ga0207669_10008814 | |||
| 3324 | Ga0207669_10369871 | |||
| 3325 | Ga0207669_10400745 | |||
| 3326 | Ga0207669_10575256 | |||
| 3327 | Ga0207669_10749922 | |||
| 3328 | Ga0207669_11085890 | |||
| 3329 | Ga0207669_11677889 | |||
| 3330 | Ga0207669_11918973 | |||
| 3331 | Ga0207669_11928588 | |||
| 3332 | Ga0207704_10009747 | |||
| 3333 | Ga0207704_10022277 | |||
| 3334 | Ga0207704_10068788 | |||
| 3335 | Ga0207704_10197852 | |||
| 3336 | Ga0207704_10369956 | |||
| 3337 | Ga0207704_10405746 | |||
| 3338 | Ga0207704_10603234 | |||
| 3339 | Ga0207704_10646160 | |||
| 3340 | Ga0207704_10963292 | |||
| 3341 | Ga0207704_11535749 | |||
| 3342 | Ga0207665_10069360 | |||
| 3343 | Ga0207665_10352338 | |||
| 3344 | Ga0207665_10441477 | |||
| 3345 | Ga0207691_10015223 | |||
| 3346 | Ga0207691_10028979 | |||
| 3347 | Ga0207691_10034416 | |||
| 3348 | Ga0207691_10042880 | |||
| 3349 | Ga0207691_10045474 | |||
| 3350 | Ga0207691_10057115 | |||
| 3351 | Ga0207691_10072796 | |||
| 3352 | Ga0207691_10164347 | |||
| 3353 | Ga0207691_10588403 | |||
| 3354 | Ga0207691_10769479 | |||
| 3355 | Ga0207691_10962129 | |||
| 3356 | Ga0207691_11056678 | |||
| 3357 | Ga0207691_11172131 | |||
| 3358 | Ga0207691_11526656 | |||
| 3359 | Ga0207711_10049790 | |||
| 3360 | Ga0207711_10091868 | |||
| 3361 | Ga0207711_10131402 | |||
| 3362 | Ga0207711_10245490 | |||
| 3363 | Ga0207711_10308424 | |||
| 3364 | Ga0207711_10334302 | |||
| 3365 | Ga0207711_10688196 | |||
| 3366 | Ga0207711_11090561 | |||
| 3367 | Ga0207689_10000643 | |||
| 3368 | Ga0207689_10012520 | |||
| 3369 | Ga0207689_10027940 | |||
| 3370 | Ga0207689_10112350 | |||
| 3371 | Ga0207689_10307612 | |||
| 3372 | Ga0207689_10403197 | |||
| 3373 | Ga0207689_10595304 | |||
| 3374 | Ga0207689_10693756 | |||
| 3375 | Ga0207689_10699686 | |||
| 3376 | Ga0207689_10965934 | |||
| 3377 | Ga0207689_11224060 | |||
| 3378 | Ga0207661_10024608 | |||
| 3379 | Ga0207661_10163985 | |||
| 3380 | Ga0207661_10876146 | |||
| 3381 | Ga0207661_11404642 | |||
| 3382 | Ga0207679_10005908 | |||
| 3383 | Ga0207679_10031345 | |||
| 3384 | Ga0207679_10065947 | |||
| 3385 | Ga0207679_10088086 | |||
| 3386 | Ga0207679_10092172 | |||
| 3387 | Ga0207679_10430540 | |||
| 3388 | Ga0207679_10439324 | |||
| 3389 | Ga0207679_10594321 | |||
| 3390 | Ga0207679_10598109 | |||
| 3391 | Ga0207679_10689792 | |||
| 3392 | Ga0207679_10799201 | |||
| 3393 | Ga0207679_10825695 | |||
| 3394 | Ga0207679_10919010 | |||
| 3395 | Ga0207679_11153628 | |||
| 3396 | Ga0207679_11525040 | |||
| 3397 | Ga0207679_12005714 | |||
| 3398 | Ga0207667_10309437 | |||
| 3399 | Ga0207667_11210429 | |||
| 3400 | Ga0207651_10007557 | |||
| 3401 | Ga0207651_10016199 | |||
| 3402 | Ga0207651_10041108 | |||
| 3403 | Ga0207651_10046772 | |||
| 3404 | Ga0207651_10052086 | |||
| 3405 | Ga0207651_10166720 | |||
| 3406 | Ga0207651_10167347 | |||
| 3407 | Ga0207651_10278176 | |||
| 3408 | Ga0207651_10449675 | |||
| 3409 | Ga0207651_10674156 | |||
| 3410 | Ga0207651_10744216 | |||
| 3411 | Ga0207651_10894005 | |||
| 3412 | Ga0207651_10927054 | |||
| 3413 | Ga0207651_11071257 | |||
| 3414 | Ga0207651_11119671 | |||
| 3415 | Ga0207651_11147183 | |||
| 3416 | Ga0207651_11545355 | |||
| 3417 | Ga0207651_11982127 | |||
| 3418 | Ga0207712_10017338 | |||
| 3419 | Ga0207712_10200611 | |||
| 3420 | Ga0207712_10319392 | |||
| 3421 | Ga0207712_10445306 | |||
| 3422 | Ga0207712_10665168 | |||
| 3423 | Ga0207712_11546699 | |||
| 3424 | Ga0207668_10023731 | |||
| 3425 | Ga0207668_10106115 | |||
| 3426 | Ga0207668_10251701 | |||
| 3427 | Ga0207668_10670254 | |||
| 3428 | Ga0207668_10832751 | |||
| 3429 | Ga0207668_11029862 | |||
| 3430 | Ga0207668_11210671 | |||
| 3431 | Ga0207640_10026642 | |||
| 3432 | Ga0207640_10103802 | |||
| 3433 | Ga0207640_10591060 | |||
| 3434 | Ga0207640_10826655 | |||
| 3435 | Ga0207640_10869540 | |||
| 3436 | Ga0207640_10947345 | |||
| 3437 | Ga0207640_11397624 | |||
| 3438 | Ga0207658_10069509 | |||
| 3439 | Ga0207658_10095471 | |||
| 3440 | Ga0207658_10226337 | |||
| 3441 | Ga0207658_10314518 | |||
| 3442 | Ga0207658_11660041 | |||
| 3443 | Ga0207677_10169465 | |||
| 3444 | Ga0207677_10668226 | |||
| 3445 | Ga0207677_10900899 | |||
| 3446 | Ga0207677_11093760 | |||
| 3447 | Ga0207677_11235143 | |||
| 3448 | Ga0207677_11403119 | |||
| 3449 | Ga0207677_11760033 | |||
| 3450 | Ga0207703_10006564 | |||
| 3451 | Ga0207703_10012636 | |||
| 3452 | Ga0207703_10016387 | |||
| 3453 | Ga0207703_10045106 | |||
| 3454 | Ga0207703_10100769 | |||
| 3455 | Ga0207703_10148031 | |||
| 3456 | Ga0207703_10162401 | |||
| 3457 | Ga0207703_10285938 | |||
| 3458 | Ga0207703_10314417 | |||
| 3459 | Ga0207703_10428486 | |||
| 3460 | Ga0207703_10664248 | |||
| 3461 | Ga0207703_10950113 | |||
| 3462 | Ga0207703_11114922 | |||
| 3463 | Ga0207703_11396596 | |||
| 3464 | Ga0207639_10338372 | |||
| 3465 | Ga0207639_11101652 | |||
| 3466 | Ga0207639_11295974 | |||
| 3467 | Ga0207639_11299872 | |||
| 3468 | Ga0207639_12260954 | |||
| 3469 | Ga0207678_10025441 | |||
| 3470 | Ga0207678_10362109 | |||
| 3471 | Ga0207678_10731721 | |||
| 3472 | Ga0207678_10897194 | |||
| 3473 | Ga0207708_10018340 | |||
| 3474 | Ga0207708_10040694 | |||
| 3475 | Ga0207708_10096306 | |||
| 3476 | Ga0207708_10128468 | |||
| 3477 | Ga0207708_10133563 | |||
| 3478 | Ga0207708_10200597 | |||
| 3479 | Ga0207708_10422587 | |||
| 3480 | Ga0207708_10525207 | |||
| 3481 | Ga0207708_10734479 | |||
| 3482 | Ga0207708_11328993 | |||
| 3483 | Ga0207708_11626520 | |||
| 3484 | Ga0207708_11988270 | |||
| 3485 | Ga0207641_10000431 | |||
| 3486 | Ga0207641_10031847 | |||
| 3487 | Ga0207641_10036202 | |||
| 3488 | Ga0207641_10206608 | |||
| 3489 | Ga0207641_10252308 | |||
| 3490 | Ga0207641_10264777 | |||
| 3491 | Ga0207641_10441704 | |||
| 3492 | Ga0207641_10468946 | |||
| 3493 | Ga0207641_10645218 | |||
| 3494 | Ga0207641_12167456 | |||
| 3495 | Ga0207648_10002155 | |||
| 3496 | Ga0207648_10018357 | |||
| 3497 | Ga0207648_10026873 | |||
| 3498 | Ga0207648_10030598 | |||
| 3499 | Ga0207648_10031427 | |||
| 3500 | Ga0207648_10087590 | |||
| 3501 | Ga0207648_10156347 | |||
| 3502 | Ga0207648_10277219 | |||
| 3503 | Ga0207648_10360323 | |||
| 3504 | Ga0207648_10362586 | |||
| 3505 | Ga0207648_10851950 | |||
| 3506 | Ga0207648_11751664 | |||
| 3507 | Ga0207648_11949796 | |||
| 3508 | Ga0207648_11989844 | |||
| 3509 | Ga0207676_10030791 | |||
| 3510 | Ga0207676_10032794 | |||
| 3511 | Ga0207676_10055223 | |||
| 3512 | Ga0207676_10067449 | |||
| 3513 | Ga0207676_10070230 | |||
| 3514 | Ga0207676_10090359 | |||
| 3515 | Ga0207676_10132256 | |||
| 3516 | Ga0207676_10211203 | |||
| 3517 | Ga0207676_10322560 | |||
| 3518 | Ga0207676_10409868 | |||
| 3519 | Ga0207676_10823230 | |||
| 3520 | Ga0207676_11198411 | |||
| 3521 | Ga0207676_11809298 | |||
| 3522 | Ga0207676_11883429 | |||
| 3523 | Ga0207674_10006828 | |||
| 3524 | Ga0207674_10091271 | |||
| 3525 | Ga0207674_10142420 | |||
| 3526 | Ga0207674_10161299 | |||
| 3527 | Ga0207674_10187239 | |||
| 3528 | Ga0207674_10257171 | |||
| 3529 | Ga0207674_10374322 | |||
| 3530 | Ga0207674_11130554 | |||
| 3531 | Ga0207675_100004553 | |||
| 3532 | Ga0207675_100009694 | |||
| 3533 | Ga0207675_100014548 | |||
| 3534 | Ga0207675_100197314 | |||
| 3535 | Ga0207675_100210134 | |||
| 3536 | Ga0207675_100239658 | |||
| 3537 | Ga0207675_100447241 | |||
| 3538 | Ga0207675_100687561 | |||
| 3539 | Ga0207675_100920913 | |||
| 3540 | Ga0207675_101042616 | |||
| 3541 | Ga0207675_101207690 | |||
| 3542 | Ga0207675_101627606 | |||
| 3543 | Ga0207683_10008415 | |||
| 3544 | Ga0207683_10010954 | |||
| 3545 | Ga0207683_10142568 | |||
| 3546 | Ga0207683_10179410 | |||
| 3547 | Ga0207683_10256864 | |||
| 3548 | Ga0207683_10379802 | |||
| 3549 | Ga0207683_10486276 | |||
| 3550 | Ga0207683_10549442 | |||
| 3551 | Ga0207683_10552254 | |||
| 3552 | Ga0207683_10577111 | |||
| 3553 | Ga0207683_10837759 | |||
| 3554 | Ga0207683_10859681 | |||
| 3555 | Ga0207683_11922119 | |||
| 3556 | Ga0207698_10147970 | |||
| 3557 | Ga0207698_10255878 | |||
| 3558 | Ga0207698_10679312 | |||
| 3559 | Ga0207698_10717755 | |||
| 3560 | Ga0207698_10930436 | |||
| 3561 | Ga0209981_1071703 | |||
| 3562 | Ga0209968_1088074 | |||
| 3563 | Ga0209974_10319506 | |||
| 3564 | Ga0209974_10320713 | |||
| 3565 | Ga0207428_10000527 | |||
| 3566 | Ga0207428_10004414 | |||
| 3567 | Ga0207428_10017113 | |||
| 3568 | Ga0207428_10142308 | |||
| 3569 | Ga0207428_10150857 | |||
| 3570 | Ga0207428_10241319 | |||
| 3571 | Ga0207428_10294418 | |||
| 3572 | Ga0207428_10321461 | |||
| 3573 | Ga0207428_10402596 | |||
| 3574 | Ga0207428_10491164 | |||
| 3575 | Ga0207428_10494367 | |||
| 3576 | Ga0207428_10734045 | |||
| 3577 | Ga0207428_10914384 | |||
| 3578 | Ga0268266_10009542 | |||
| 3579 | Ga0268266_10130451 | |||
| 3580 | Ga0268266_10726883 | |||
| 3581 | Ga0268266_10927708 | |||
| 3582 | Ga0268266_11027035 | |||
| 3583 | Ga0268266_11314676 | |||
| 3584 | Ga0268266_11389472 | |||
| 3585 | Ga0268265_10001463 | |||
| 3586 | Ga0268265_10009722 | |||
| 3587 | Ga0268265_10077817 | |||
| 3588 | Ga0268265_10144587 | |||
| 3589 | Ga0268265_10146120 | |||
| 3590 | Ga0268265_10223835 | |||
| 3591 | Ga0268265_10483891 | |||
| 3592 | Ga0268265_10985565 | |||
| 3593 | Ga0268265_11108192 | |||
| 3594 | Ga0268265_11196130 | |||
| 3595 | Ga0268265_11263798 | |||
| 3596 | Ga0268265_11294758 | |||
| 3597 | Ga0268265_11297125 | |||
| 3598 | Ga0268265_11440996 | |||
| 3599 | Ga0268265_11643542 | |||
| 3600 | Ga0268264_10011300 | |||
| 3601 | Ga0268264_10064504 | |||
| 3602 | Ga0268264_10145089 | |||
| 3603 | Ga0268264_10259747 | |||
| 3604 | Ga0268264_10427837 | |||
| 3605 | Ga0268264_10429280 | |||
| 3606 | Ga0268264_10446884 | |||
| 3607 | Ga0268264_10570671 | |||
| 3608 | Ga0268264_10715505 | |||
| 3609 | Ga0268264_10743360 | |||
| 3610 | Ga0268264_11101824 | |||
| 3611 | Ga0268264_11109541 | |||
| 3612 | Ga0268264_11544391 | |||
| 3613 | Ga0268264_11783778 | |||
| 3614 | Ga0265318_10401734 | |||
| 3615 | Ga0307511_10228856 | |||
| 3616 | Ga0316177_1067784 | |||
| 3617 | Ga0307408_100065395 | |||
| 3618 | Ga0307408_100335153 | |||
| 3619 | Ga0307408_100340286 | |||
| 3620 | Ga0307408_100613114 | |||
| 3621 | Ga0307408_100690569 | |||
| 3622 | Ga0307408_101565426 | |||
| 3623 | Ga0307405_10020527 | |||
| 3624 | Ga0307405_10046873 | |||
| 3625 | Ga0307405_10103027 | |||
| 3626 | Ga0307405_10731235 | |||
| 3627 | Ga0307405_10843144 | |||
| 3628 | Ga0307405_11458077 | |||
| 3629 | Ga0307413_10024650 | |||
| 3630 | Ga0307413_10148712 | |||
| 3631 | Ga0307413_10450460 | |||
| 3632 | Ga0307413_10702311 | |||
| 3633 | Ga0307413_10808995 | |||
| 3634 | Ga0307410_10002707 | |||
| 3635 | Ga0307410_10018326 | |||
| 3636 | Ga0307410_10320242 | |||
| 3637 | Ga0307410_10780237 | |||
| 3638 | Ga0307410_12030454 | |||
| 3639 | Ga0307406_10084061 | |||
| 3640 | Ga0307406_10188675 | |||
| 3641 | Ga0307407_10005552 | |||
| 3642 | Ga0307407_10162816 | |||
| 3643 | Ga0307412_10046165 | |||
| 3644 | Ga0307412_10068745 | |||
| 3645 | Ga0307412_10092398 | |||
| 3646 | Ga0307412_10112945 | |||
| 3647 | Ga0307409_100142461 | |||
| 3648 | Ga0307409_100178191 | |||
| 3649 | Ga0307409_100640346 | |||
| 3650 | Ga0307409_100684838 | |||
| 3651 | Ga0307416_100018347 | |||
| 3652 | Ga0307416_100037547 | |||
| 3653 | Ga0307416_100049139 | |||
| 3654 | Ga0307416_100057896 | |||
| 3655 | Ga0307416_100834107 | |||
| 3656 | Ga0307416_101458423 | |||
| 3657 | Ga0307416_102673387 | |||
| 3658 | Ga0307416_102931836 | |||
| 3659 | Ga0307414_10014285 | |||
| 3660 | Ga0307414_11737759 | |||
| 3661 | Ga0307414_12311757 | |||
| 3662 | Ga0307411_10003895 | |||
| 3663 | Ga0307411_10007445 | |||
| 3664 | Ga0307411_10041606 | |||
| 3665 | Ga0307411_10080942 | |||
| 3666 | Ga0307411_10196221 | |||
| 3667 | Ga0307411_10518552 | |||
| 3668 | Ga0307411_10715944 | |||
| 3669 | Ga0307411_11534026 | |||
| 3670 | Ga0307411_12039251 | |||
| 3671 | Ga0307415_100010976 | |||
| 3672 | Ga0307415_100076840 | |||
| 3673 | Ga0307415_100204903 | |||
| 3674 | Ga0307415_100827319 | |||
| 3675 | Ga0307415_102546267 | |||
| 3676 | Ga0373930_0004713 | |||
| 3677 | Ga0373948_0005040 | |||
| 3678 | Ga0373950_0000276 | |||
| 3679 | Ga0373958_0076447 | |||
| 3680 | Ga0373958_0082838 | |||
| 3681 | Ga0373959_0001408 | |||
| 3682 | Ga0373938_0023830 | |||
| 3683 | Ga0373928_0001861 | |||
| 3684 | Ga0373928_0060923 | |||
| 3685 | Ga0373928_0224993 | |||
| 3686 | Ga0373929_0001848 | |||
| 3687 | Ga0373934_0068660 | |||
| 3688 | Ga0373940_0010101 | |||
| 3689 | Ga0373940_0010283 | |||
| 3690 | Ga0373940_0317709 | |||
| 3691 | Ga0373944_0129337 | |||
| 3692 | Ga0373949_0005325 | |||
| 3693 | Ga0373951_0000713 | |||
| 3694 | Ga0373952_0015128 | |||
| 3695 | Ga0373923_0066682 | |||
| 3696 | Ga0373923_0354952 | |||
| 3697 | Ga0373923_0624523 | |||
| 3698 | Ga0373932_0000374 | |||
| 3699 | Ga0373936_0097095 | |||
| 3700 | Ga0373939_0007192 | |||
| 3701 | Ga0373941_0000482 | |||
| 3702 | Ga0373941_0072643 | |||
| 3703 | Ga0373941_0143507 | |||
| 3704 | Ga0373941_0392162 | |||
| 3705 | Ga0373945_0108029 | |||
| 3706 | Ga0373945_0334156 | |||
| 3707 | Ga0373953_0125717 | |||
| 3708 | Ga0373954_0264189 | |||
| 3709 | Ga0373954_0283438 | |||
| 3710 | Ga0373954_0472783 | |||
| 3711 | Ga0373954_0564697 | |||
| 3712 | Ga0373956_0235062 | |||
| 3713 | Ga0373956_0385097 | |||
| 3714 | Ga0373957_0264647 | |||
| 3715 | Ga0373960_0000304 | |||
| 3716 | Ga0373960_0037020 | |||
| 3717 | Ga0373943_0008686 | |||
| 3718 | Ga0373943_0166348 | |||
| 3719 | Ga0373946_0004998 | |||
| 3720 | Ga0373955_0051069 | |||
| 3721 | Ga0373955_0152885 | |||
| 3722 | Ga0373955_0194798 | |||
| 3723 | Ga0373955_0339826 | |||
| 3724 | Ga0373955_0582579 | |||
| 3725 | Ga0373942_0002761 | |||
| 3726 | Ga0373961_0003133 | |||
| 3727 | Ga0373961_0145965 | |||
| 3728 | Ga0373962_0000484 | |||
| 3729 | Ga0373962_0154014 | |||
| 3730 | Ga0373962_0167020 | |||
| 3731 | Ga0373962_0190474 | |||
| 3732 | Ga0373924_0104962 | |||
| 3733 | Ga0373924_0189700 | |||
| 3734 | Ga0373931_0002957 | |||
| 3735 | Ga0373931_0226314 | |||
| 3736 | Ga0373931_0506019 | |||
| 3737 | Ga0373931_0718744 | |||
| 3738 | Ga0373935_0090223 | |||
| 3739 | Ga0373935_0223769 | |||
| 3740 | Ga0373935_0275347 | |||
| 3741 | Ga0373935_0677332 | |||
| 3742 | Ga0373935_0691331 | |||
| 3743 | Ga0373927_0178932 | |||
| 3744 | Ga0373927_0277996 | |||
| 3745 | Ga0373933_0203563 | |||
| 3746 | Ga0373933_0414151 | |||
| 3747 | Ga0373933_0418019 | |||
| 3748 | Ga0373933_0580133 | |||
| 3749 | Ga0373947_0008171 | |||
| 3750 | Ga0373947_0359307 | |||
| 3751 | Ga0373947_1091361 | |||
| 3752 | Ga0373937_0009059 | |||
| 3753 | Ga0373937_0080467 | |||
| 3754 | Ga0373937_0186363 | |||
| 3755 | Ga0373937_0371473 | |||
| 3756 | Ga0373937_0575744 | |||
| 3757 | Ga0373937_0853517 | |||
| 3758 | Ga0373937_1105041 | |||
| 3759 | Ga0373937_1809025 | |||
| 3760 | Ga0373925_0015313 | |||
| 3761 | Ga0373925_0379196 | |||
| 3762 | Ga0373925_0669279 | |||
| 3763 | Ga0373925_0826530 | |||
| 3764 | Ga0373925_0863433 | |||
| 3765 | Ga0373925_1007934 | |||
| 3766 | Ga0242420_043178 | |||
| 3767 | Ga0436365_0974042 | |||
| 3768 | Ga0436363_0695528 | |||
| 3769 | Ga0436362_1204701 | |||
| 3770 | Ga0439436_0155822 | |||
| 3771 | Ga0439439_0150124 | |||
| 3772 | Ga0439453_0106445 | |||
| 3773 | Ga0451800_1099042 | |||
| 3774 | Ga0451807_0514159 | |||
| 3775 | Ga0451807_1968602 | |||
| 3776 | Ga0451845_0428115 | |||
| 3777 | Ga0451853_0326641 | |||
| 3778 | Ga0451853_1148563 | |||
| 3779 | Ga0439448_0315695 | |||
| 3780 | Ga0439450_091565 | |||
| 3781 | Ga0439462_0086984 | |||
| 3782 | Ga0450923_067636 | |||
| 3783 | Ga0450923_117699 | |||
| 3784 | Ga0439446_0217893 | |||
| 3785 | Ga0439446_0227777 | |||
| 3786 | Ga0450908_108368 | |||
| 3787 | Ga0439434_0128720 | |||
| 3788 | Ga0439435_0024756 | |||
| 3789 | Ga0439464_0291688 | |||
| 3790 | Ga0451577_0952727 | |||
| 3791 | Ga0451577_1132996 | |||
| 3792 | Ga0439440_0151667 | |||
| 3793 | Ga0453683_0430943 | |||
| 3794 | Ga0453683_0481647 | |||
| 3795 | Ga0466963_0026043 | |||
| 3796 | Ga0466964_0370735 | |||
| 3797 | Ga0453684_0530056 | |||
| 3798 | Ga0466968_0431886 | |||
| 3799 | Ga0466957_0492813 | |||
| 3800 | Ga0451576_0036825 | |||
| 3801 | Ga0451576_0069886 | |||
| 3802 | Ga0451576_0074874 | |||
| 3803 | Ga0451576_0282376 | |||
| 3804 | Ga0451576_0782165 | |||
| 3805 | Ga0451576_1114216 | |||
| 3806 | Ga0451576_2124176 | |||
| 3807 | Ga0451576_2201159 | |||
| 3808 | Ga0451576_2296737 | |||
| 3809 | Ga0451576_2492645 | |||
| 3810 | Ga0451576_2718879 | |||
| 3811 | Ga0466958_0436147 | |||
| 3812 | Ga0466967_0489595 | |||
| 3813 | Ga0466967_0583039 | |||
| 3814 | Ga0466967_0609524 | |||
| 3815 | Ga0466967_1760039 | |||
| 3816 | Ga0466967_2467962 | |||
| 3817 | Ga0495603_0107715 | |||
| 3818 | Ga0495591_179204 | |||
| 3819 | Ga0495629_0026452 | |||
| 3820 | Ga0495629_0211359 | |||
| 3821 | Ga0495629_0892849 | |||
| 3822 | Ga0495629_0966855 | |||
| 3823 | Ga0495651_0136250 | |||
| 3824 | Ga0495580_0031838 | |||
| 3825 | Ga0495580_0037989 | |||
| 3826 | Ga0495580_0302143 | |||
| 3827 | Ga0495580_0455137 | |||
| 3828 | Ga0495580_0479049 | |||
| 3829 | Ga0495580_0798990 | |||
| 3830 | Ga0495582_0311273 | |||
| 3831 | Ga0495582_0387856 | |||
| 3832 | Ga0495582_0628807 | |||
| 3833 | Ga0495582_0711689 | |||
| 3834 | Ga0495639_0425853 | |||
| 3835 | Ga0495584_0050641 | |||
| 3836 | Ga0495584_0263799 | |||
| 3837 | Ga0495594_0016304 | |||
| 3838 | Ga0495594_0068088 | |||
| 3839 | Ga0495594_0447550 | |||
| 3840 | Ga0495608_0010373 | |||
| 3841 | Ga0495618_0100511 | |||
| 3842 | Ga0495618_0252638 | |||
| 3843 | Ga0495628_0197372 | |||
| 3844 | Ga0495628_0831276 | |||
| 3845 | Ga0495630_0021167 | |||
| 3846 | Ga0495630_0475789 | |||
| 3847 | Ga0495630_0500145 | |||
| 3848 | Ga0495630_0501930 | |||
| 3849 | Ga0495643_0011009 | |||
| 3850 | Ga0495644_0230447 | |||
| 3851 | Ga0495663_0134568 | |||
| 3852 | Ga0495663_0159732 | |||
| 3853 | Ga0495663_0161489 | |||
| 3854 | Ga0495642_0005763 | |||
| 3855 | Ga0495642_0344802 | |||
| 3856 | Ga0495652_0036799 | |||
| 3857 | Ga0495652_0211056 | |||
| 3858 | Ga0495665_0056144 | |||
| 3859 | Ga0495640_0106328 | |||
| 3860 | Ga0495640_0366047 | |||
| 3861 | Ga0495640_0732195 | |||
| 3862 | Ga0495586_0260109 | |||
| 3863 | Ga0495586_0429547 | |||
| 3864 | Ga0495587_0046585 | |||
| 3865 | Ga0495598_0018119 | |||
| 3866 | Ga0495598_0050984 | |||
| 3867 | Ga0495598_0059865 | |||
| 3868 | Ga0495598_0079003 | |||
| 3869 | Ga0495598_0171509 | |||
| 3870 | Ga0495598_0199497 | |||
| 3871 | Ga0495598_0215782 | |||
| 3872 | Ga0495598_0444409 | |||
| 3873 | Ga0495609_0108794 | |||
| 3874 | Ga0495621_0000734 | |||
| 3875 | Ga0495621_0002328 | |||
| 3876 | Ga0495621_0004301 | |||
| 3877 | Ga0495621_0104597 | |||
| 3878 | Ga0495645_0110321 | |||
| 3879 | Ga0495633_0018310 | |||
| 3880 | Ga0495667_0434609 | |||
| 3881 | Ga0495656_0007731 | |||
| 3882 | Ga0495656_0541895 | |||
| 3883 | Ga0495668_0774921 | |||
| 3884 | Ga0495634_0185935 | |||
| 3885 | Ga0495634_0822900 | |||
| 3886 | Ga0495659_0005213 | |||
| 3887 | Ga0495659_0006176 | |||
| 3888 | Ga0495659_0043745 | |||
| 3889 | Ga0495659_0099457 | |||
| 3890 | Ga0495659_0143842 | |||
| 3891 | Ga0495659_0226285 | |||
| 3892 | Ga0495659_0246536 | |||
| 3893 | Ga0495659_0395920 | |||
| 3894 | Ga0495659_0418048 | |||
| 3895 | Ga0495659_0536433 | |||
| 3896 | Ga0495588_0154419 | |||
| 3897 | Ga0495588_0571087 | |||
| 3898 | Ga0495588_0631335 | |||
| 3899 | Ga0495657_0275115 | |||
| 3900 | Ga0495623_0609141 | |||
| 3901 | Ga0495646_0459353 | |||
| 3902 | Ga0495647_0046635 | |||
| 3903 | Ga0495647_0187730 | |||
| 3904 | Ga0495658_0085033 | |||
| 3905 | Ga0495658_0114637 | |||
| 3906 | Ga0495658_0466973 | |||
| 3907 | Ga0495658_0526902 | |||
| 3908 | Ga0495658_1108712 | |||
| 3909 | Ga0495669_0025552 | |||
| 3910 | Ga0495669_0047099 | |||
| 3911 | Ga0495669_0120449 | |||
| 3912 | Ga0495669_0142101 | |||
| 3913 | Ga0495669_0346718 | |||
| 3914 | Ga0495669_0410085 | |||
| 3915 | Ga0495613_0000720 | |||
| 3916 | Ga0495670_0805391 | |||
| 3917 | Ga0495581_0465120 | |||
| 3918 | Ga0495581_0598379 | |||
| 3919 | Ga0495604_0390745 | |||
| 3920 | Ga0495636_0142362 | |||
| 3921 | Ga0495674_0025567 | |||
| 3922 | Ga0495674_0473940 | |||
| 3923 | Ga0495674_0592575 | |||
| 3924 | Ga0495674_0612890 | |||
| 3925 | Ga0495672_0268271 | |||
| 3926 | Ga0495676_0036588 | |||
| 3927 | Ga0495680_0393814 | |||
| 3928 | Ga0495685_033432 | |||
| 3929 | Ga0495685_048797 | |||
| 3930 | Ga0495684_0000613 | |||
| 3931 | Ga0495684_0272083 | |||
| 3932 | Ga0495593_0287864 | |||
| 3933 | Ga0495614_0537676 | |||
| 3934 | Ga0495614_0657688 | |||
| 3935 | Ga0496100_0243294 | |||
| 3936 | Ga0496100_0811999 | |||
| 3937 | Ga0496100_0958564 | |||
| 3938 | Ga0496101_0000451 | |||
| 3939 | Ga0496101_0821314 | |||
| 3940 | Ga0496101_1041627 | |||
| 3941 | Ga0496102_0944611 | |||
| 3942 | Ga0496103_0362131 | |||
| 3943 | Ga0496104_0309891 | |||
| 3944 | Ga0496104_0333741 | |||
| 3945 | Ga0496104_0355658 | |||
| 3946 | Ga0496104_0423719 | |||
| 3947 | Ga0496104_0812657 | |||
| 3948 | Ga0496104_1222041 | |||
| 3949 | Ga0496105_0265325 | |||
| 3950 | Ga0496105_0675634 | |||
| 3951 | Ga0496105_0892135 | |||
| 3952 | Ga0496106_0045609 | |||
| 3953 | Ga0496106_0222706 | |||
| 3954 | Ga0496106_0639560 | |||
| 3955 | Ga0496106_0728760 | |||
| 3956 | Ga0496106_1513522 | |||
| 3957 | Ga0496106_1533206 | |||
| 3958 | Ga0496107_0345761 | |||
| 3959 | Ga0496107_0609011 | |||
| 3960 | Ga0496107_1025492 | |||
| 3961 | Ga0496107_1272644 | |||
| 3962 | Ga0496108_0890607 | |||
| 3963 | Ga0496108_0992209 | |||
| 3964 | Ga0496108_1130085 | |||
| 3965 | Ga0496108_1268264 | |||
| 3966 | Ga0496109_0446343 | |||
| 3967 | Ga0496109_0565345 | |||
| 3968 | Ga0496109_0614112 | |||
| 3969 | Ga0496110_0022673 | |||
| 3970 | Ga0496110_0688733 | |||
| 3971 | Ga0496110_0906301 | |||
| 3972 | Ga0496111_0799130 | |||
| 3973 | Ga0496111_1072711 | |||
| 3974 | Ga0496112_0538464 | |||
| 3975 | Ga0496112_1834331 | |||
| 3976 | Ga0496112_1864225 | |||
| 3977 | Ga0496113_0109187 | |||
| 3978 | Ga0496113_0180028 | |||
| 3979 | Ga0496113_0309279 | |||
| 3980 | Ga0496113_0363076 | |||
| 3981 | Ga0496114_0001764 | |||
| 3982 | Ga0496114_0202676 | |||
| 3983 | Ga0496114_0571906 | |||
| 3984 | Ga0496114_0590266 | |||
| 3985 | Ga0496115_0044293 | |||
| 3986 | Ga0496115_0619922 | |||
| 3987 | Ga0496115_0936752 | |||
| 3988 | Ga0501292_058286 | |||
| 3989 | Ga0501292_140448 | |||
| 3990 | Ga0501294_058889 | |||
| 3991 | Ga0501295_131299 | |||
| 3992 | Ga0501298_079386 | |||
| 3993 | Ga0501298_088894 | |||
| 3994 | Ga0501298_148641 | |||
| 3995 | Ga0501299_092513 | |||
| 3996 | Ga0501299_193258 | |||
| 3997 | Ga0501299_231899 | |||
| 3998 | Ga0501320_051899 | |||
| 3999 | Ga0501031_0595084 | |||
| 4000 | Ga0501032_0948403 | |||
| 4001 | Ga0501033_0054566 | |||
| 4002 | Ga0501033_0571682 | |||
| 4003 | Ga0501036_0481481 | |||
| 4004 | Ga0501036_1246464 | |||
| 4005 | Ga0501039_0043088 | |||
| 4006 | Ga0501039_0096051 | |||
| 4007 | Ga0501039_0629160 | |||
| 4008 | Ga0501039_1144699 | |||
| 4009 | Ga0501040_0191871 | |||
| 4010 | Ga0501040_0257776 | |||
| 4011 | Ga0501040_0533565 | |||
| 4012 | Ga0501040_1183758 | |||
| 4013 | Ga0501040_1304737 | |||
| 4014 | Ga0501041_0021002 | |||
| 4015 | Ga0501041_0027286 | |||
| 4016 | Ga0501041_0360458 | |||
| 4017 | Ga0501041_0836681 | |||
| 4018 | Ga0501041_1078564 | |||
| 4019 | Ga0501042_0020313 | |||
| 4020 | Ga0501042_0068209 | |||
| 4021 | Ga0501042_0104599 | |||
| 4022 | Ga0501042_0504033 | |||
| 4023 | Ga0501043_0380124 | |||
| 4024 | Ga0501043_0558438 | |||
| 4025 | Ga0501046_0224520 | |||
| 4026 | Ga0501046_0268583 | |||
| 4027 | Ga0501046_0659307 | |||
| 4028 | Ga0501046_1028641 | |||
| 4029 | Ga0501048_0097317 | |||
| 4030 | Ga0501048_0115376 | |||
| 4031 | Ga0501048_0936448 | |||
| 4032 | Ga0501067_0084722 | |||
| 4033 | Ga0501067_0415926 | |||
| 4034 | Ga0501068_0025829 | |||
| 4035 | Ga0501068_0074051 | |||
| 4036 | Ga0501068_0210604 | |||
| 4037 | Ga0501069_0759198 | |||
| 4038 | Ga0501069_0796871 | |||
| 4039 | Ga0501071_0038926 | |||
| 4040 | Ga0501071_0073892 | |||
| 4041 | Ga0501071_0339443 | |||
| 4042 | Ga0501071_1083652 | |||
| 4043 | Ga0501072_0059133 | |||
| 4044 | Ga0501072_0082245 | |||
| 4045 | Ga0501072_0377582 | |||
| 4046 | Ga0501073_0752714 | |||
| 4047 | Ga0501073_1274585 | |||
| 4048 | Ga0501074_0216331 | |||
| 4049 | Ga0501075_0011468 | |||
| 4050 | Ga0501075_0014710 | |||
| 4051 | Ga0501075_0027285 | |||
| 4052 | Ga0501076_0000430 | |||
| 4053 | Ga0501076_0029547 | |||
| 4054 | Ga0501076_0071935 | |||
| 4055 | Ga0501077_0007773 | |||
| 4056 | Ga0501209_112598 | |||
| 4057 | Ga0501216_121502 | |||
| 4058 | Ga0501233_188554 | |||
| 4059 | Ga0501235_104846 | |||
| 4060 | Ga0501235_214227 | |||
| 4061 | Ga0501243_092603 | |||
| 4062 | Ga0501247_022900 | |||
| 4063 | Ga0501249_057078 | |||
| 4064 | Ga0501249_100971 | |||
| 4065 | Ga0501253_217053 | |||
| 4066 | Ga0501256_042155 | |||
| 4067 | Ga0501257_160822 | |||
| 4068 | Ga0501245_066289 | |||
| 4069 | Ga0501245_094182 | |||
| 4070 | Ga0501079_0023834 | |||
| 4071 | Ga0501079_0032267 | |||
| 4072 | Ga0501079_0130665 | |||
| 4073 | Ga0501080_0225287 | |||
| 4074 | Ga0501080_0238544 | |||
| 4075 | Ga0501080_0597003 | |||
| 4076 | Ga0501081_0000588 | |||
| 4077 | Ga0501081_0002533 | |||
| 4078 | Ga0501081_0034421 | |||
| 4079 | Ga0501081_0045103 | |||
| 4080 | Ga0501081_0293922 | |||
| 4081 | Ga0501081_1522869 | |||
| 4082 | Ga0501083_0013562 | |||
| 4083 | Ga0501268_044925 | |||
| 4084 | Ga0501270_092061 | |||
| 4085 | Ga0501272_042658 | |||
| 4086 | Ga0501273_041202 | |||
| 4087 | Ga0501283_012511 | |||
| 4088 | Ga0501283_056205 | |||
| 4089 | Ga0501045_0034751 | |||
| 4090 | Ga0501045_0404199 | |||
| 4091 | Ga0501045_0521338 | |||
| 4092 | Ga0501045_0597340 | |||
| 4093 | nmdc:mga05p37_11992_c1 | |||
| 4094 | nmdc:mga05p37_126818_c1 | |||
| 4095 | nmdc:mga05p37_138659_c1 | |||
| 4096 | nmdc:mga05p37_142923_c1 | |||
| 4097 | nmdc:mga05p37_1513676_c1 | |||
| 4098 | nmdc:mga05p37_1594_c1 | |||
| 4099 | nmdc:mga05p37_16719_c1 | |||
| 4100 | nmdc:mga05p37_180101_c1 | |||
| 4101 | nmdc:mga05p37_20284_c1 | |||
| 4102 | nmdc:mga05p37_23331_c1 | |||
| 4103 | nmdc:mga05p37_234115_c1 | |||
| 4104 | nmdc:mga05p37_251554_c1 | |||
| 4105 | nmdc:mga05p37_311105_c1 | |||
| 4106 | nmdc:mga05p37_311393_c1 | |||
| 4107 | nmdc:mga05p37_312432_c1 | |||
| 4108 | nmdc:mga05p37_41791_c1 | |||
| 4109 | nmdc:mga05p37_49764_c1 | |||
| 4110 | nmdc:mga05p37_798158_c1 | |||
| 4111 | nmdc:mga05p37_915060_c1 | |||
| 4112 | nmdc:mga05p37_95613_c1 | |||
| 4113 | nmdc:mga09592_116992_c1 | |||
| 4114 | nmdc:mga09592_1600861_c1 | |||
| 4115 | nmdc:mga09592_164082_c1 | |||
| 4116 | nmdc:mga09592_1654440_c1 | |||
| 4117 | nmdc:mga09592_344209_c1 | |||
| 4118 | nmdc:mga09592_408004_c1 | |||
| 4119 | nmdc:mga09592_50392_c1 | |||
| 4120 | nmdc:mga09592_725034_c1 | |||
| 4121 | nmdc:mga09592_823574_c1 | |||
| 4122 | nmdc:mga09592_94175_c1 | |||
| 4123 | nmdc:mga09592_952643_c1 | |||
| 4124 | nmdc:mga0qj67_205251_c1 | |||
| 4125 | nmdc:mga0qj67_363910_c1 | |||
| 4126 | nmdc:mga0qj67_45395_c1 | |||
| 4127 | nmdc:mga0qj67_789939_c1 | |||
| 4128 | nmdc:mga0qj67_850976_c1 | |||
| 4129 | nmdc:mga06r32_102411_c1 | |||
| 4130 | nmdc:mga06r32_1337435_c1 | |||
| 4131 | nmdc:mga06r32_143953_c1 | |||
| 4132 | nmdc:mga06r32_20491_c1 | |||
| 4133 | nmdc:mga06r32_53901_c1 | |||
| 4134 | nmdc:mga06r32_558345_c1 | |||
| 4135 | nmdc:mga06r32_718852_c1 | |||
| 4136 | nmdc:mga08y16_1005311_c1 | |||
| 4137 | nmdc:mga08y16_1020998_c1 | |||
| 4138 | nmdc:mga08y16_1480043_c1 | |||
| 4139 | nmdc:mga08y16_1740986_c1 | |||
| 4140 | nmdc:mga08y16_28149_c1 | |||
| 4141 | nmdc:mga08y16_349_c1 | |||
| 4142 | nmdc:mga08y16_365948_c1 | |||
| 4143 | nmdc:mga08y16_38371_c1 | |||
| 4144 | nmdc:mga08y16_427316_c1 | |||
| 4145 | nmdc:mga08y16_4417_c1 | |||
| 4146 | nmdc:mga08y16_55349_c1 | |||
| 4147 | nmdc:mga08y16_6726_c1 | |||
| 4148 | nmdc:mga08y16_718120_c1 | |||
| 4149 | nmdc:mga08y16_816436_c1 | |||
| 4150 | nmdc:mga08y16_967731_c1 | |||
| 4151 | nmdc:mga0n895_1217475_c1 | |||
| 4152 | nmdc:mga0n895_13192_c1 | |||
| 4153 | nmdc:mga0n895_1368851_c1 | |||
| 4154 | nmdc:mga0n895_13752_c1 | |||
| 4155 | nmdc:mga0n895_1429060_c1 | |||
| 4156 | nmdc:mga0n895_146142_c1 | |||
| 4157 | nmdc:mga0n895_148627_c1 | |||
| 4158 | nmdc:mga0n895_17933_c1 | |||
| 4159 | nmdc:mga0n895_182794_c1 | |||
| 4160 | nmdc:mga0n895_193415_c1 | |||
| 4161 | nmdc:mga0n895_203557_c1 | |||
| 4162 | nmdc:mga0n895_2068153_c1 | |||
| 4163 | nmdc:mga0n895_2142851_c1 | |||
| 4164 | nmdc:mga0n895_49792_c1 | |||
| 4165 | nmdc:mga0n895_502727_c1 | |||
| 4166 | nmdc:mga0n895_61181_c1 | |||
| 4167 | nmdc:mga0n895_611894_c1 | |||
| 4168 | nmdc:mga0n895_77585_c1 | |||
| 4169 | nmdc:mga0n895_7906_c1 | |||
| 4170 | nmdc:mga0n895_854671_c1 | |||
| 4171 | nmdc:mga0n895_892857_c1 | |||
| 4172 | nmdc:mga0n895_952906_c1 | |||
| 4173 | nmdc:mga0n895_98062_c1 | |||
| 4174 | nmdc:mga0rr50_116480_c1 | |||
| 4175 | nmdc:mga0rr50_136179_c1 | |||
| 4176 | nmdc:mga0rr50_139327_c1 | |||
| 4177 | nmdc:mga0rr50_1702203_c1 | |||
| 4178 | nmdc:mga0rr50_1712792_c1 | |||
| 4179 | nmdc:mga0rr50_177697_c1 | |||
| 4180 | nmdc:mga0rr50_179124_c1 | |||
| 4181 | nmdc:mga0rr50_342715_c1 | |||
| 4182 | nmdc:mga0rr50_414_c1 | |||
| 4183 | nmdc:mga0rr50_841396_c1 | |||
| 4184 | nmdc:mga0rr50_860872_c1 | |||
| 4185 | nmdc:mga0rr50_883594_c1 | |||
| 4186 | nmdc:mga0rr50_9355_c1 | |||
| 4187 | nmdc:mga08x19_11381_c1 | |||
| 4188 | nmdc:mga08x19_120066_c1 | |||
| 4189 | nmdc:mga08x19_204388_c1 | |||
| 4190 | nmdc:mga08x19_228795_c1 | |||
| 4191 | nmdc:mga08x19_51300_c1 | |||
| 4192 | nmdc:mga08x19_639300_c1 | |||
| 4193 | nmdc:mga08x19_762954_c1 | |||
| 4194 | nmdc:mga0a205_120182_c1 | |||
| 4195 | nmdc:mga0a205_1352021_c1 | |||
| 4196 | nmdc:mga0a205_158500_c1 | |||
| 4197 | nmdc:mga0a205_176082_c1 | |||
| 4198 | nmdc:mga0a205_265938_c1 | |||
| 4199 | nmdc:mga0a205_29340_c1 | |||
| 4200 | nmdc:mga0a205_33180_c1 | |||
| 4201 | nmdc:mga0a205_506590_c1 | |||
| 4202 | nmdc:mga0a205_532212_c1 | |||
| 4203 | nmdc:mga0a205_58127_c1 | |||
| 4204 | nmdc:mga0a205_6492_c1 | |||
| 4205 | nmdc:mga0a205_652025_c1 | |||
| 4206 | nmdc:mga0a205_84748_c1 | |||
| 4207 | Ga0495601_0048683 | |||
| 4208 | Ga0495601_0361678 | |||
| 4209 | Ga0495601_0636841 | |||
| 4210 | Ga0495601_0788862 | |||
| 4211 | Ga0495612_0204082 | |||
| 4212 | Ga0495612_0402516 | |||
| 4213 | Ga0495655_0054240 | |||
| 4214 | Ga0495655_0096664 | |||
| 4215 | Ga0495595_0150988 | |||
| 4216 | Ga0495595_0251778 | |||
| 4217 | Ga0495595_0458141 | |||
| 4218 | Ga0495595_0682950 | |||
| 4219 | Ga0495619_0001542 | |||
| 4220 | Ga0495619_0195727 | |||
| 4221 | Ga0495619_0271918 | |||
| 4222 | Ga0495619_0333392 | |||
| 4223 | Ga0495619_0466073 | |||
| 4224 | Ga0495619_0757885 | |||
| 4225 | Ga0501084_0019884 | |||
| 4226 | Ga0501084_0078604 | |||
| 4227 | Ga0501084_0108923 | |||
| 4228 | Ga0501084_0388198 | |||
| 4229 | Ga0501084_0730286 | |||
| 4230 | Ga0590071_000382 | |||
| 4231 | Ga0590071_000521 | |||
| 4232 | Ga0590074_029475 | |||
| 4233 | Ga0590075_002497 | |||
| 4234 | Ga0590075_026192 | |||
| 4235 | Ga0590077_000003 | |||
| 4236 | Ga0590077_000431 | |||
| 4237 | Ga0590077_042093 | |||
| 4238 | Ga0501082_0148948 | |||
| 4239 | Ga0501082_0197894 | |||
| 4240 | Ga0501082_1413822 | |||
| 4241 | Ga0466962_0534873 | |||
| 4242 | Ga0530510_0001508 | |||
| 4243 | Ga0530510_0002012 | |||
| 4244 | Ga0530510_0089323 | |||
| 4245 | Ga0530510_0437834 | |||
| 4246 | Ga0530510_1593966 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uj8-assembly1.cif.gz_A | structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters | 0.9902 | 1 | 62 |
| 2bzt-assembly1.cif.gz_A | nmr structure of the bacterial protein yfhj from e. coli | 0.9547 | 1 | 63 |
| 1uj8-assembly1.cif.gz_A | structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters | 0.9038 | 1 | 62 |
| 2bzt-assembly1.cif.gz_A | nmr structure of the bacterial protein yfhj from e. coli | 0.9003 | 1 | 63 |
| 7qca-assembly1.cif.gz_SR0 | spraguea lophii ribosome | 0.5313 | 6 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1uj8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.9902 | 1 | 62 | 1.10.10.600 |
| 2bztA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.9547 | 1 | 63 | 1.10.10.600 |
| 1uj8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.9038 | 1 | 62 | 1.10.10.600 |
| 2bztA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.9003 | 1 | 63 | 1.10.10.600 |
| af_O02254_189_310_1.20.80.10 | Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; | 0.5606 | 6 | 67 | 1.20.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2R3X3-F1-model_v4 | Fe-S assembly protein IscX | 1.01 | 1 | 67 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A2V8FCK3-F1-model_v4 | Fe-S assembly protein IscX | 1.01 | 1 | 64 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A2V6U3E9-F1-model_v4 | Fe-S assembly protein IscX | 1.004 | 1 | 65 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A2V9YC42-F1-model_v4 | Fe-S assembly protein IscX | 1.004 | 1 | 65 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A521KAZ6-F1-model_v4 | Fe-S assembly protein IscX | 1.001 | 1 | 63 |
GO:0005829
GO:0008198 GO:0016226 |