F496415
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2112 | 415 | 4224 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100001262|Ga0070699_10000126220 |
| Length | 156 |
| Sequence | MTVLTRWEPFREFTTLQDRMNRLFRDSFGSESEEALTSTSFAPAVDVYEDEHNVTLKIEVPGIDEKDIAVRIENNTLTVHGERKFEKEEKEENFRRVERQYGSFTRSFTLPNTVDSAHYDKGVLKITLAKKAEAKPKQIKVNVGSEKALEGLGKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 19 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 126 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 157 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 165 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 167 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 168 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 169 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 173 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 174 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 176 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 245 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 246 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 247 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 248 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 266 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 267 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 268 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 271 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 272 | 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 273 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 274 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 275 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 280 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 281 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 282 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 283 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 284 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 291 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 293 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 305 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 306 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 319 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 366 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 367 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 368 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.19 |
| Metatranscriptomes | 16.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.69 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100001262 | 3300005518 | Bacteria | 23318 |
| 2 | MRS1b_contig_499290 | 2162886011 | Bacteria | 829 |
| 3 | LJNas_1000100 | 3300000546 | Bacteria | 13067 |
| 4 | LJNas_1000764 | 3300000546 | Bacteria | 5369 |
| 5 | JGI24737J22298_10040989 | 3300001990 | Unclassified | 1420 |
| 6 | JGI24743J22301_10016817 | 3300001991 | Unclassified | 1368 |
| 7 | JGI24735J21928_10144745 | 3300002067 | Bacteria | 686 |
| 8 | JGI24748J21848_1012010 | 3300002074 | Bacteria | 1021 |
| 9 | JGI24738J21930_10042458 | 3300002075 | Bacteria | 924 |
| 10 | JGI24034J26672_10000846 | 3300002239 | Bacteria | 3981 |
| 11 | JGI24751J29686_10003056 | 3300002459 | Bacteria | 3371 |
| 12 | Ga0006770J48903_1043594 | 3300003305 | Bacteria | 614 |
| 13 | Ga0007417J51691_1078715 | 3300003544 | Bacteria | 621 |
| 14 | Ga0007416J51690_1049252 | 3300003577 | Bacteria | 626 |
| 15 | Ga0006780_1026440 | 3300003735 | Unclassified | 569 |
| 16 | Ga0058859_10038725 | 3300004798 | Unclassified | 597 |
| 17 | Ga0058859_11598358 | 3300004798 | Unclassified | 628 |
| 18 | Ga0058863_11538588 | 3300004799 | Unclassified | 774 |
| 19 | Ga0058863_11605465 | 3300004799 | Bacteria | 693 |
| 20 | Ga0058863_11931210 | 3300004799 | Bacteria | 651 |
| 21 | Ga0058863_11950456 | 3300004799 | Bacteria | 743 |
| 22 | Ga0058861_10036912 | 3300004800 | Bacteria | 682 |
| 23 | Ga0058861_11296361 | 3300004800 | Bacteria | 686 |
| 24 | Ga0058861_11575201 | 3300004800 | Bacteria | 915 |
| 25 | Ga0058861_11708729 | 3300004800 | Unclassified | 707 |
| 26 | Ga0058860_10071064 | 3300004801 | Unclassified | 617 |
| 27 | Ga0058860_10074548 | 3300004801 | Unclassified | 1068 |
| 28 | Ga0058860_11005499 | 3300004801 | Bacteria | 554 |
| 29 | Ga0058860_11998714 | 3300004801 | Bacteria | 681 |
| 30 | Ga0058862_10015289 | 3300004803 | Unclassified | 814 |
| 31 | Ga0058862_12198476 | 3300004803 | Bacteria | 1018 |
| 32 | Ga0058862_12282851 | 3300004803 | Bacteria | 595 |
| 33 | Ga0058862_12675983 | 3300004803 | Bacteria | 1477 |
| 34 | Ga0058862_12840414 | 3300004803 | Bacteria | 595 |
| 35 | Ga0065712_10113216 | 3300005290 | Bacteria | 1787 |
| 36 | Ga0065712_10124491 | 3300005290 | Bacteria | 1625 |
| 37 | Ga0065712_10141052 | 3300005290 | Bacteria | 1450 |
| 38 | Ga0065712_10239745 | 3300005290 | Unclassified | 987 |
| 39 | Ga0065712_10506342 | 3300005290 | Unclassified | 645 |
| 40 | Ga0065715_10263171 | 3300005293 | Bacteria | 1132 |
| 41 | Ga0065707_10123107 | 3300005295 | Bacteria | 2073 |
| 42 | Ga0070658_10015965 | 3300005327 | Bacteria | 6006 |
| 43 | Ga0070658_11323806 | 3300005327 | Unclassified | 625 |
| 44 | Ga0070676_10008546 | 3300005328 | Bacteria | 5520 |
| 45 | Ga0070676_10076670 | 3300005328 | Bacteria | 2019 |
| 46 | Ga0070676_10127578 | 3300005328 | Bacteria | 1605 |
| 47 | Ga0070676_10141413 | 3300005328 | Bacteria | 1532 |
| 48 | Ga0070683_100001654 | 3300005329 | Bacteria | 17275 |
| 49 | Ga0070683_100052982 | 3300005329 | Unclassified | 3760 |
| 50 | Ga0070683_100059458 | 3300005329 | Bacteria | 3551 |
| 51 | Ga0070683_100175031 | 3300005329 | Bacteria | 2037 |
| 52 | Ga0070683_100188021 | 3300005329 | Bacteria | 1961 |
| 53 | Ga0070683_100293618 | 3300005329 | Bacteria | 1546 |
| 54 | Ga0070683_100533823 | 3300005329 | Bacteria | 1121 |
| 55 | Ga0070683_100654461 | 3300005329 | Bacteria | 1006 |
| 56 | Ga0070690_100022284 | 3300005330 | Bacteria | 3874 |
| 57 | Ga0070690_100044309 | 3300005330 | Bacteria | 2823 |
| 58 | Ga0070690_100208291 | 3300005330 | Bacteria | 1364 |
| 59 | Ga0070690_100742659 | 3300005330 | Bacteria | 757 |
| 60 | Ga0070670_100001229 | 3300005331 | Bacteria | 20368 |
| 61 | Ga0070670_100004866 | 3300005331 | Bacteria | 11295 |
| 62 | Ga0070670_100345515 | 3300005331 | Bacteria | 1306 |
| 63 | Ga0070670_100365080 | 3300005331 | Unclassified | 1270 |
| 64 | Ga0070670_100507913 | 3300005331 | Bacteria | 1072 |
| 65 | Ga0070670_100579488 | 3300005331 | Bacteria | 1003 |
| 66 | Ga0070670_101085664 | 3300005331 | Bacteria | 729 |
| 67 | Ga0070677_10004176 | 3300005333 | Bacteria | 4698 |
| 68 | Ga0070677_10027851 | 3300005333 | Bacteria | 2131 |
| 69 | Ga0068869_100011004 | 3300005334 | Bacteria | 5925 |
| 70 | Ga0068869_100169745 | 3300005334 | Bacteria | 1703 |
| 71 | Ga0070666_10028622 | 3300005335 | Bacteria | 3657 |
| 72 | Ga0070666_10093657 | 3300005335 | Bacteria | 2065 |
| 73 | Ga0070680_100086435 | 3300005336 | Bacteria | 2592 |
| 74 | Ga0070680_100087048 | 3300005336 | Bacteria | 2583 |
| 75 | Ga0070680_100103263 | 3300005336 | Bacteria | 2368 |
| 76 | Ga0070680_100260332 | 3300005336 | Bacteria | 1467 |
| 77 | Ga0070680_100363823 | 3300005336 | Bacteria | 1230 |
| 78 | Ga0070680_100472491 | 3300005336 | Bacteria | 1072 |
| 79 | Ga0070682_100032714 | 3300005337 | Bacteria | 3156 |
| 80 | Ga0070682_100038345 | 3300005337 | Bacteria | 2939 |
| 81 | Ga0070682_100168724 | 3300005337 | Bacteria | 1519 |
| 82 | Ga0070682_100379264 | 3300005337 | Bacteria | 1063 |
| 83 | Ga0070682_100774875 | 3300005337 | Bacteria | 777 |
| 84 | Ga0068868_100005644 | 3300005338 | Bacteria | 8807 |
| 85 | Ga0068868_100006335 | 3300005338 | Bacteria | 8366 |
| 86 | Ga0068868_100009828 | 3300005338 | Bacteria | 6906 |
| 87 | Ga0068868_100011480 | 3300005338 | Bacteria | 6451 |
| 88 | Ga0068868_100036023 | 3300005338 | Bacteria | 3827 |
| 89 | Ga0068868_100060463 | 3300005338 | Bacteria | 3000 |
| 90 | Ga0068868_100063303 | 3300005338 | Bacteria | 2934 |
| 91 | Ga0068868_100126790 | 3300005338 | Bacteria | 2086 |
| 92 | Ga0068868_100172257 | 3300005338 | Bacteria | 1792 |
| 93 | Ga0068868_100403293 | 3300005338 | Bacteria | 1180 |
| 94 | Ga0068868_100418555 | 3300005338 | Bacteria | 1160 |
| 95 | Ga0070660_100003182 | 3300005339 | Bacteria | 11279 |
| 96 | Ga0070660_100123147 | 3300005339 | Bacteria | 2070 |
| 97 | Ga0070660_100293639 | 3300005339 | Bacteria | 1331 |
| 98 | Ga0070660_100331052 | 3300005339 | Bacteria | 1252 |
| 99 | Ga0070689_100225918 | 3300005340 | Bacteria | 1537 |
| 100 | Ga0070689_100372378 | 3300005340 | Bacteria | 1202 |
| 101 | Ga0070689_100562121 | 3300005340 | Bacteria | 984 |
| 102 | Ga0070689_100727431 | 3300005340 | Unclassified | 868 |
| 103 | Ga0070691_10029763 | 3300005341 | Bacteria | 2556 |
| 104 | Ga0070691_10247336 | 3300005341 | Bacteria | 955 |
| 105 | Ga0070691_10649673 | 3300005341 | Unclassified | 628 |
| 106 | Ga0070661_100009132 | 3300005344 | Bacteria | 6853 |
| 107 | Ga0070661_100045709 | 3300005344 | Bacteria | 3201 |
| 108 | Ga0070661_100049730 | 3300005344 | Bacteria | 3069 |
| 109 | Ga0070661_100202816 | 3300005344 | Bacteria | 1516 |
| 110 | Ga0070661_100303435 | 3300005344 | Bacteria | 1243 |
| 111 | Ga0070661_101039651 | 3300005344 | Unclassified | 681 |
| 112 | Ga0070692_10080466 | 3300005345 | Bacteria | 1754 |
| 113 | Ga0070692_10826867 | 3300005345 | Unclassified | 634 |
| 114 | Ga0070668_100017062 | 3300005347 | Bacteria | 5432 |
| 115 | Ga0070668_100175143 | 3300005347 | Bacteria | 1749 |
| 116 | Ga0070668_100193198 | 3300005347 | Bacteria | 1668 |
| 117 | Ga0070669_100021818 | 3300005353 | Bacteria | 4579 |
| 118 | Ga0070669_100037244 | 3300005353 | Bacteria | 3528 |
| 119 | Ga0070669_100288951 | 3300005353 | Bacteria | 1316 |
| 120 | Ga0070669_100384576 | 3300005353 | Unclassified | 1145 |
| 121 | Ga0070669_100388557 | 3300005353 | Bacteria | 1139 |
| 122 | Ga0070669_100851531 | 3300005353 | Bacteria | 777 |
| 123 | Ga0070675_100020968 | 3300005354 | Bacteria | 5218 |
| 124 | Ga0070675_100090245 | 3300005354 | Unclassified | 2566 |
| 125 | Ga0070675_100093809 | 3300005354 | Bacteria | 2518 |
| 126 | Ga0070675_100161541 | 3300005354 | Bacteria | 1927 |
| 127 | Ga0070675_100196375 | 3300005354 | Bacteria | 1750 |
| 128 | Ga0070675_100201064 | 3300005354 | Bacteria | 1729 |
| 129 | Ga0070675_101869748 | 3300005354 | Unclassified | 554 |
| 130 | Ga0070671_100142129 | 3300005355 | Bacteria | 2025 |
| 131 | Ga0070671_100170413 | 3300005355 | Unclassified | 1841 |
| 132 | Ga0070671_100393174 | 3300005355 | Unclassified | 1186 |
| 133 | Ga0070671_101485425 | 3300005355 | Unclassified | 599 |
| 134 | Ga0070674_100177804 | 3300005356 | Bacteria | 1627 |
| 135 | Ga0070674_100524557 | 3300005356 | Bacteria | 990 |
| 136 | Ga0070674_100733154 | 3300005356 | Unclassified | 848 |
| 137 | Ga0070673_100028368 | 3300005364 | Bacteria | 4162 |
| 138 | Ga0070673_100056891 | 3300005364 | Bacteria | 3087 |
| 139 | Ga0070673_100057392 | 3300005364 | Bacteria | 3075 |
| 140 | Ga0070673_100310560 | 3300005364 | Unclassified | 1391 |
| 141 | Ga0070688_100016967 | 3300005365 | Bacteria | 4172 |
| 142 | Ga0070688_100409436 | 3300005365 | Bacteria | 1005 |
| 143 | Ga0070659_100008280 | 3300005366 | Bacteria | 7590 |
| 144 | Ga0070659_100094209 | 3300005366 | Bacteria | 2404 |
| 145 | Ga0070659_100134607 | 3300005366 | Bacteria | 2009 |
| 146 | Ga0070659_100856807 | 3300005366 | Unclassified | 792 |
| 147 | Ga0070667_100038354 | 3300005367 | Bacteria | 4016 |
| 148 | Ga0070667_100245753 | 3300005367 | Bacteria | 1599 |
| 149 | Ga0070667_100433027 | 3300005367 | Bacteria | 1200 |
| 150 | Ga0070667_100795621 | 3300005367 | Unclassified | 878 |
| 151 | Ga0070709_10006962 | 3300005434 | Bacteria | 6173 |
| 152 | Ga0070709_10012446 | 3300005434 | Bacteria | 4764 |
| 153 | Ga0070709_10143436 | 3300005434 | Bacteria | 1643 |
| 154 | Ga0070709_10284094 | 3300005434 | Bacteria | 1204 |
| 155 | Ga0070709_10335172 | 3300005434 | Bacteria | 1114 |
| 156 | Ga0070709_10883797 | 3300005434 | Bacteria | 706 |
| 157 | Ga0070709_11163454 | 3300005434 | Unclassified | 619 |
| 158 | Ga0070709_11224058 | 3300005434 | Bacteria | 604 |
| 159 | Ga0070714_100000186 | 3300005435 | Bacteria | 49870 |
| 160 | Ga0070714_100016776 | 3300005435 | Bacteria | 5921 |
| 161 | Ga0070714_100042467 | 3300005435 | Bacteria | 3842 |
| 162 | Ga0070714_100099024 | 3300005435 | Unclassified | 2565 |
| 163 | Ga0070714_100149680 | 3300005435 | Bacteria | 2102 |
| 164 | Ga0070714_100157080 | 3300005435 | Bacteria | 2054 |
| 165 | Ga0070714_100179169 | 3300005435 | Unclassified | 1927 |
| 166 | Ga0070714_100203760 | 3300005435 | Bacteria | 1811 |
| 167 | Ga0070714_100230678 | 3300005435 | Bacteria | 1705 |
| 168 | Ga0070714_100297792 | 3300005435 | Bacteria | 1503 |
| 169 | Ga0070714_100299040 | 3300005435 | Bacteria | 1500 |
| 170 | Ga0070714_100409956 | 3300005435 | Bacteria | 1282 |
| 171 | Ga0070714_100491102 | 3300005435 | Bacteria | 1170 |
| 172 | Ga0070714_100516538 | 3300005435 | Bacteria | 1140 |
| 173 | Ga0070714_100543703 | 3300005435 | Bacteria | 1111 |
| 174 | Ga0070714_100572671 | 3300005435 | Bacteria | 1083 |
| 175 | Ga0070714_100581141 | 3300005435 | Bacteria | 1075 |
| 176 | Ga0070713_100000117 | 3300005436 | Bacteria | 51918 |
| 177 | Ga0070713_100001059 | 3300005436 | Bacteria | 17578 |
| 178 | Ga0070713_100004152 | 3300005436 | Bacteria | 9658 |
| 179 | Ga0070713_100004649 | 3300005436 | Bacteria | 9262 |
| 180 | Ga0070713_100016285 | 3300005436 | Bacteria | 5588 |
| 181 | Ga0070713_100036385 | 3300005436 | Bacteria | 3972 |
| 182 | Ga0070713_100046743 | 3300005436 | Bacteria | 3553 |
| 183 | Ga0070713_100052366 | 3300005436 | Bacteria | 3380 |
| 184 | Ga0070713_100074763 | 3300005436 | Bacteria | 2872 |
| 185 | Ga0070713_100075817 | 3300005436 | Bacteria | 2854 |
| 186 | Ga0070713_100109450 | 3300005436 | Bacteria | 2407 |
| 187 | Ga0070713_100126554 | 3300005436 | Bacteria | 2248 |
| 188 | Ga0070713_100129384 | 3300005436 | Bacteria | 2224 |
| 189 | Ga0070713_100148717 | 3300005436 | Bacteria | 2081 |
| 190 | Ga0070713_100158380 | 3300005436 | Unclassified | 2019 |
| 191 | Ga0070713_100221359 | 3300005436 | Bacteria | 1717 |
| 192 | Ga0070713_100238077 | 3300005436 | Bacteria | 1657 |
| 193 | Ga0070713_100357060 | 3300005436 | Unclassified | 1357 |
| 194 | Ga0070713_100375706 | 3300005436 | Bacteria | 1323 |
| 195 | Ga0070713_100433450 | 3300005436 | Unclassified | 1232 |
| 196 | Ga0070713_100472338 | 3300005436 | Bacteria | 1180 |
| 197 | Ga0070713_100480418 | 3300005436 | Unclassified | 1170 |
| 198 | Ga0070713_100481843 | 3300005436 | Bacteria | 1169 |
| 199 | Ga0070713_100537792 | 3300005436 | Bacteria | 1106 |
| 200 | Ga0070713_100636489 | 3300005436 | Unclassified | 1015 |
| 201 | Ga0070713_100741326 | 3300005436 | Unclassified | 939 |
| 202 | Ga0070713_100760265 | 3300005436 | Bacteria | 927 |
| 203 | Ga0070713_100808713 | 3300005436 | Bacteria | 899 |
| 204 | Ga0070713_101083587 | 3300005436 | Unclassified | 774 |
| 205 | Ga0070713_101162407 | 3300005436 | Bacteria | 747 |
| 206 | Ga0070710_10015633 | 3300005437 | Bacteria | 3845 |
| 207 | Ga0070710_10017745 | 3300005437 | Unclassified | 3649 |
| 208 | Ga0070710_10021719 | 3300005437 | Bacteria | 3350 |
| 209 | Ga0070710_10028294 | 3300005437 | Bacteria | 2997 |
| 210 | Ga0070710_10068784 | 3300005437 | Bacteria | 2036 |
| 211 | Ga0070710_10162273 | 3300005437 | Bacteria | 1387 |
| 212 | Ga0070710_10238171 | 3300005437 | Unclassified | 1165 |
| 213 | Ga0070710_10254505 | 3300005437 | Unclassified | 1130 |
| 214 | Ga0070710_10430059 | 3300005437 | Unclassified | 891 |
| 215 | Ga0070710_10884248 | 3300005437 | Bacteria | 644 |
| 216 | Ga0070710_10888030 | 3300005437 | Bacteria | 643 |
| 217 | Ga0070701_10292121 | 3300005438 | Bacteria | 999 |
| 218 | Ga0070701_10310086 | 3300005438 | Unclassified | 973 |
| 219 | Ga0070711_100001103 | 3300005439 | Bacteria | 14406 |
| 220 | Ga0070711_100004752 | 3300005439 | Bacteria | 8045 |
| 221 | Ga0070711_100020447 | 3300005439 | Bacteria | 4266 |
| 222 | Ga0070711_100030422 | 3300005439 | Bacteria | 3574 |
| 223 | Ga0070711_100046688 | 3300005439 | Unclassified | 2952 |
| 224 | Ga0070711_100088555 | 3300005439 | Bacteria | 2225 |
| 225 | Ga0070711_100114487 | 3300005439 | Unclassified | 1985 |
| 226 | Ga0070711_100122039 | 3300005439 | Bacteria | 1929 |
| 227 | Ga0070711_100201069 | 3300005439 | Bacteria | 1537 |
| 228 | Ga0070711_100222807 | 3300005439 | Bacteria | 1467 |
| 229 | Ga0070711_100273761 | 3300005439 | Unclassified | 1333 |
| 230 | Ga0070711_100375946 | 3300005439 | Bacteria | 1148 |
| 231 | Ga0070711_100485689 | 3300005439 | Unclassified | 1016 |
| 232 | Ga0070711_100553458 | 3300005439 | Unclassified | 955 |
| 233 | Ga0070711_100672705 | 3300005439 | Unclassified | 870 |
| 234 | Ga0070711_100789548 | 3300005439 | Unclassified | 805 |
| 235 | Ga0070711_100931047 | 3300005439 | Unclassified | 743 |
| 236 | Ga0070705_100334214 | 3300005440 | Bacteria | 1099 |
| 237 | Ga0070705_100418645 | 3300005440 | Bacteria | 997 |
| 238 | Ga0070705_101346757 | 3300005440 | Unclassified | 593 |
| 239 | Ga0070694_100333374 | 3300005444 | Unclassified | 1171 |
| 240 | Ga0070708_100000178 | 3300005445 | Bacteria | 45462 |
| 241 | Ga0070708_100003771 | 3300005445 | Bacteria | 11893 |
| 242 | Ga0070708_100010668 | 3300005445 | Bacteria | 7453 |
| 243 | Ga0070708_100018556 | 3300005445 | Bacteria | 5824 |
| 244 | Ga0070708_100019661 | 3300005445 | Bacteria | 5680 |
| 245 | Ga0070708_100019711 | 3300005445 | Bacteria | 5673 |
| 246 | Ga0070708_100033368 | 3300005445 | Unclassified | 4472 |
| 247 | Ga0070708_100037136 | 3300005445 | Bacteria | 4248 |
| 248 | Ga0070708_100053835 | 3300005445 | Bacteria | 3573 |
| 249 | Ga0070708_100058833 | 3300005445 | Bacteria | 3425 |
| 250 | Ga0070708_100070219 | 3300005445 | Bacteria | 3151 |
| 251 | Ga0070708_100083298 | 3300005445 | Unclassified | 2899 |
| 252 | Ga0070708_100105508 | 3300005445 | Bacteria | 2585 |
| 253 | Ga0070708_100127490 | 3300005445 | Bacteria | 2353 |
| 254 | Ga0070708_100319929 | 3300005445 | Bacteria | 1461 |
| 255 | Ga0070708_100531462 | 3300005445 | Bacteria | 1109 |
| 256 | Ga0070663_100010546 | 3300005455 | Bacteria | 5761 |
| 257 | Ga0070663_100158984 | 3300005455 | Bacteria | 1738 |
| 258 | Ga0070663_100362014 | 3300005455 | Bacteria | 1177 |
| 259 | Ga0070678_100020766 | 3300005456 | Bacteria | 4315 |
| 260 | Ga0070678_100269813 | 3300005456 | Unclassified | 1434 |
| 261 | Ga0070678_100336612 | 3300005456 | Bacteria | 1293 |
| 262 | Ga0070678_100729229 | 3300005456 | Unclassified | 895 |
| 263 | Ga0070678_101150850 | 3300005456 | Bacteria | 718 |
| 264 | Ga0070678_101213479 | 3300005456 | Bacteria | 700 |
| 265 | Ga0070662_100001840 | 3300005457 | Bacteria | 12997 |
| 266 | Ga0070662_100013854 | 3300005457 | Bacteria | 5371 |
| 267 | Ga0070662_100048772 | 3300005457 | Bacteria | 3052 |
| 268 | Ga0070662_100115951 | 3300005457 | Bacteria | 2047 |
| 269 | Ga0070681_10000242 | 3300005458 | Bacteria | 43180 |
| 270 | Ga0070681_10001052 | 3300005458 | Bacteria | 23450 |
| 271 | Ga0070681_10007304 | 3300005458 | Bacteria | 10783 |
| 272 | Ga0070681_10037476 | 3300005458 | Bacteria | 4865 |
| 273 | Ga0070681_10058089 | 3300005458 | Bacteria | 3848 |
| 274 | Ga0070681_10149255 | 3300005458 | Unclassified | 2265 |
| 275 | Ga0070681_10239335 | 3300005458 | Bacteria | 1729 |
| 276 | Ga0070681_10559122 | 3300005458 | Unclassified | 1058 |
| 277 | Ga0070681_10575054 | 3300005458 | Bacteria | 1040 |
| 278 | Ga0070681_10673814 | 3300005458 | Unclassified | 949 |
| 279 | Ga0070681_11019370 | 3300005458 | Bacteria | 748 |
| 280 | Ga0068867_100002152 | 3300005459 | Bacteria | 13818 |
| 281 | Ga0068867_100005036 | 3300005459 | Bacteria | 9321 |
| 282 | Ga0068867_100007869 | 3300005459 | Bacteria | 7533 |
| 283 | Ga0068867_100019151 | 3300005459 | Bacteria | 4875 |
| 284 | Ga0068867_100127446 | 3300005459 | Unclassified | 1974 |
| 285 | Ga0068867_100135238 | 3300005459 | Bacteria | 1921 |
| 286 | Ga0068867_100242809 | 3300005459 | Bacteria | 1461 |
| 287 | Ga0068867_100370711 | 3300005459 | Bacteria | 1200 |
| 288 | Ga0068867_100449975 | 3300005459 | Bacteria | 1097 |
| 289 | Ga0068867_100471519 | 3300005459 | Bacteria | 1074 |
| 290 | Ga0068867_100484797 | 3300005459 | Unclassified | 1060 |
| 291 | Ga0068867_100959091 | 3300005459 | Bacteria | 773 |
| 292 | Ga0070685_10011180 | 3300005466 | Bacteria | 4694 |
| 293 | Ga0070685_10018085 | 3300005466 | Bacteria | 3786 |
| 294 | Ga0070685_10363433 | 3300005466 | Unclassified | 993 |
| 295 | Ga0070706_100000430 | 3300005467 | Bacteria | 50312 |
| 296 | Ga0070706_100000710 | 3300005467 | Bacteria | 37432 |
| 297 | Ga0070706_100001963 | 3300005467 | Bacteria | 21185 |
| 298 | Ga0070706_100002303 | 3300005467 | Bacteria | 19295 |
| 299 | Ga0070706_100021815 | 3300005467 | Bacteria | 5897 |
| 300 | Ga0070706_100026942 | 3300005467 | Bacteria | 5290 |
| 301 | Ga0070706_100087906 | 3300005467 | Bacteria | 2881 |
| 302 | Ga0070706_100139595 | 3300005467 | Bacteria | 2262 |
| 303 | Ga0070706_100466111 | 3300005467 | Unclassified | 1175 |
| 304 | Ga0070706_100479761 | 3300005467 | Bacteria | 1157 |
| 305 | Ga0070706_100588595 | 3300005467 | Bacteria | 1034 |
| 306 | Ga0070706_100651896 | 3300005467 | Bacteria | 977 |
| 307 | Ga0070707_100000607 | 3300005468 | Bacteria | 36047 |
| 308 | Ga0070707_100000704 | 3300005468 | Bacteria | 33310 |
| 309 | Ga0070707_100052713 | 3300005468 | Bacteria | 3900 |
| 310 | Ga0070707_100106828 | 3300005468 | Unclassified | 2715 |
| 311 | Ga0070707_100137114 | 3300005468 | Unclassified | 2380 |
| 312 | Ga0070707_100160971 | 3300005468 | Bacteria | 2187 |
| 313 | Ga0070707_100182686 | 3300005468 | Bacteria | 2045 |
| 314 | Ga0070707_100236862 | 3300005468 | Bacteria | 1776 |
| 315 | Ga0070707_100285897 | 3300005468 | Unclassified | 1602 |
| 316 | Ga0070707_100330999 | 3300005468 | Bacteria | 1480 |
| 317 | Ga0070707_100605953 | 3300005468 | Bacteria | 1058 |
| 318 | Ga0070707_100793948 | 3300005468 | Unclassified | 910 |
| 319 | Ga0070698_100000091 | 3300005471 | Bacteria | 71604 |
| 320 | Ga0070698_100003170 | 3300005471 | Bacteria | 18130 |
| 321 | Ga0070698_100031612 | 3300005471 | Bacteria | 5487 |
| 322 | Ga0070698_100216266 | 3300005471 | Bacteria | 1850 |
| 323 | Ga0070698_100477767 | 3300005471 | Bacteria | 1183 |
| 324 | Ga0070698_100638627 | 3300005471 | Bacteria | 1006 |
| 325 | Ga0070698_100643587 | 3300005471 | Bacteria | 1001 |
| 326 | Ga0070698_100871691 | 3300005471 | Bacteria | 845 |
| 327 | Ga0070699_100000556 | 3300005518 | Bacteria | 35214 |
| 328 | Ga0070699_100074244 | 3300005518 | Bacteria | 2959 |
| 329 | Ga0070699_100109392 | 3300005518 | Bacteria | 2425 |
| 330 | Ga0070699_100131242 | 3300005518 | Bacteria | 2208 |
| 331 | Ga0070699_101011671 | 3300005518 | Bacteria | 762 |
| 332 | Ga0070699_101361066 | 3300005518 | Unclassified | 651 |
| 333 | Ga0070679_100001381 | 3300005530 | Bacteria | 21401 |
| 334 | Ga0070679_100025670 | 3300005530 | Bacteria | 5781 |
| 335 | Ga0070679_100096995 | 3300005530 | Bacteria | 2936 |
| 336 | Ga0070679_100098873 | 3300005530 | Bacteria | 2905 |
| 337 | Ga0070679_100142669 | 3300005530 | Bacteria | 2374 |
| 338 | Ga0070679_100180698 | 3300005530 | Bacteria | 2082 |
| 339 | Ga0070679_100194609 | 3300005530 | Bacteria | 1995 |
| 340 | Ga0070679_100413690 | 3300005530 | Unclassified | 1294 |
| 341 | Ga0070679_100459801 | 3300005530 | Bacteria | 1217 |
| 342 | Ga0070679_100973591 | 3300005530 | Bacteria | 792 |
| 343 | Ga0070684_100006558 | 3300005535 | Bacteria | 9012 |
| 344 | Ga0070684_100007287 | 3300005535 | Bacteria | 8599 |
| 345 | Ga0070684_100023353 | 3300005535 | Bacteria | 5171 |
| 346 | Ga0070684_100027979 | 3300005535 | Unclassified | 4765 |
| 347 | Ga0070684_100038647 | 3300005535 | Bacteria | 4101 |
| 348 | Ga0070684_100041911 | 3300005535 | Bacteria | 3949 |
| 349 | Ga0070684_100054241 | 3300005535 | Bacteria | 3492 |
| 350 | Ga0070684_100057501 | 3300005535 | Bacteria | 3396 |
| 351 | Ga0070684_100558673 | 3300005535 | Unclassified | 1062 |
| 352 | Ga0070684_100825161 | 3300005535 | Unclassified | 867 |
| 353 | Ga0070697_100000111 | 3300005536 | Bacteria | 63543 |
| 354 | Ga0070697_100000114 | 3300005536 | Bacteria | 63225 |
| 355 | Ga0070697_100001108 | 3300005536 | Bacteria | 20385 |
| 356 | Ga0070697_100001219 | 3300005536 | Bacteria | 19410 |
| 357 | Ga0070697_100001461 | 3300005536 | Bacteria | 18005 |
| 358 | Ga0070697_100006660 | 3300005536 | Bacteria | 8958 |
| 359 | Ga0070697_100040910 | 3300005536 | Bacteria | 3750 |
| 360 | Ga0070697_100059463 | 3300005536 | Unclassified | 3112 |
| 361 | Ga0070697_100092278 | 3300005536 | Bacteria | 2505 |
| 362 | Ga0070697_100141093 | 3300005536 | Bacteria | 2027 |
| 363 | Ga0070697_100163163 | 3300005536 | Bacteria | 1883 |
| 364 | Ga0070697_100166616 | 3300005536 | Unclassified | 1863 |
| 365 | Ga0070697_100183765 | 3300005536 | Unclassified | 1773 |
| 366 | Ga0070697_100242415 | 3300005536 | Bacteria | 1540 |
| 367 | Ga0070697_100322984 | 3300005536 | Bacteria | 1329 |
| 368 | Ga0070697_100583539 | 3300005536 | Bacteria | 982 |
| 369 | Ga0070697_101266263 | 3300005536 | Unclassified | 658 |
| 370 | Ga0068853_100011730 | 3300005539 | Bacteria | 7121 |
| 371 | Ga0068853_100084923 | 3300005539 | Bacteria | 2774 |
| 372 | Ga0068853_100089325 | 3300005539 | Unclassified | 2706 |
| 373 | Ga0068853_100117335 | 3300005539 | Bacteria | 2370 |
| 374 | Ga0068853_100123336 | 3300005539 | Bacteria | 2313 |
| 375 | Ga0068853_100175087 | 3300005539 | Bacteria | 1943 |
| 376 | Ga0068853_100490549 | 3300005539 | Unclassified | 1159 |
| 377 | Ga0068853_100509924 | 3300005539 | Bacteria | 1136 |
| 378 | Ga0070672_100295377 | 3300005543 | Bacteria | 1372 |
| 379 | Ga0070686_100000992 | 3300005544 | Bacteria | 16380 |
| 380 | Ga0070686_100329382 | 3300005544 | Bacteria | 1141 |
| 381 | Ga0070686_101682734 | 3300005544 | Bacteria | 538 |
| 382 | Ga0070695_100132508 | 3300005545 | Bacteria | 1719 |
| 383 | Ga0070695_100209500 | 3300005545 | Bacteria | 1398 |
| 384 | Ga0070695_100475251 | 3300005545 | Unclassified | 962 |
| 385 | Ga0070696_100124015 | 3300005546 | Bacteria | 1872 |
| 386 | Ga0070696_100165620 | 3300005546 | Bacteria | 1631 |
| 387 | Ga0070693_100021527 | 3300005547 | Bacteria | 3416 |
| 388 | Ga0070693_100076244 | 3300005547 | Unclassified | 1987 |
| 389 | Ga0070693_100237398 | 3300005547 | Bacteria | 1202 |
| 390 | Ga0070693_100251013 | 3300005547 | Bacteria | 1173 |
| 391 | Ga0070693_100480445 | 3300005547 | Unclassified | 878 |
| 392 | Ga0070693_100992902 | 3300005547 | Unclassified | 635 |
| 393 | Ga0070665_100004447 | 3300005548 | Bacteria | 14722 |
| 394 | Ga0070665_100052292 | 3300005548 | Unclassified | 4098 |
| 395 | Ga0070665_100326174 | 3300005548 | Bacteria | 1539 |
| 396 | Ga0070665_100335376 | 3300005548 | Bacteria | 1517 |
| 397 | Ga0070665_100503023 | 3300005548 | Bacteria | 1223 |
| 398 | Ga0070665_100661090 | 3300005548 | Unclassified | 1058 |
| 399 | Ga0068855_100000722 | 3300005563 | Bacteria | 40559 |
| 400 | Ga0068855_100001560 | 3300005563 | Bacteria | 28791 |
| 401 | Ga0068855_100004114 | 3300005563 | Bacteria | 17736 |
| 402 | Ga0068855_100014007 | 3300005563 | Bacteria | 9667 |
| 403 | Ga0068855_100031428 | 3300005563 | Bacteria | 6340 |
| 404 | Ga0068855_100061459 | 3300005563 | Bacteria | 4389 |
| 405 | Ga0068855_100107535 | 3300005563 | Bacteria | 3204 |
| 406 | Ga0068855_100152779 | 3300005563 | Bacteria | 2624 |
| 407 | Ga0068855_100226813 | 3300005563 | Bacteria | 2093 |
| 408 | Ga0068855_100244096 | 3300005563 | Bacteria | 2005 |
| 409 | Ga0068855_100294204 | 3300005563 | Bacteria | 1799 |
| 410 | Ga0068855_101073574 | 3300005563 | Unclassified | 843 |
| 411 | Ga0070664_100003973 | 3300005564 | Bacteria | 11895 |
| 412 | Ga0070664_100008728 | 3300005564 | Bacteria | 8207 |
| 413 | Ga0070664_100035323 | 3300005564 | Bacteria | 4196 |
| 414 | Ga0070664_100075959 | 3300005564 | Bacteria | 2886 |
| 415 | Ga0070664_100091351 | 3300005564 | Bacteria | 2635 |
| 416 | Ga0070664_100139034 | 3300005564 | Bacteria | 2137 |
| 417 | Ga0070664_100178614 | 3300005564 | Bacteria | 1886 |
| 418 | Ga0070664_100201464 | 3300005564 | Bacteria | 1776 |
| 419 | Ga0070664_101186033 | 3300005564 | Bacteria | 720 |
| 420 | Ga0068857_100000430 | 3300005577 | Bacteria | 29723 |
| 421 | Ga0068857_100000538 | 3300005577 | Bacteria | 27467 |
| 422 | Ga0068857_100006903 | 3300005577 | Bacteria | 9775 |
| 423 | Ga0068857_100018258 | 3300005577 | Bacteria | 6152 |
| 424 | Ga0068857_100043047 | 3300005577 | Unclassified | 4006 |
| 425 | Ga0068857_100064768 | 3300005577 | Unclassified | 3250 |
| 426 | Ga0068857_100074902 | 3300005577 | Bacteria | 3017 |
| 427 | Ga0068857_100110225 | 3300005577 | Bacteria | 2473 |
| 428 | Ga0068857_100225005 | 3300005577 | Unclassified | 1715 |
| 429 | Ga0068857_100240545 | 3300005577 | Bacteria | 1657 |
| 430 | Ga0068857_100459544 | 3300005577 | Unclassified | 1191 |
| 431 | Ga0068857_100542422 | 3300005577 | Unclassified | 1095 |
| 432 | Ga0068854_100010535 | 3300005578 | Bacteria | 5999 |
| 433 | Ga0068854_100028598 | 3300005578 | Bacteria | 3853 |
| 434 | Ga0068854_100073521 | 3300005578 | Bacteria | 2505 |
| 435 | Ga0068854_100092927 | 3300005578 | Bacteria | 2248 |
| 436 | Ga0068854_100263231 | 3300005578 | Bacteria | 1381 |
| 437 | Ga0068854_101289047 | 3300005578 | Unclassified | 657 |
| 438 | Ga0068856_100000618 | 3300005614 | Bacteria | 38933 |
| 439 | Ga0068856_100000893 | 3300005614 | Bacteria | 31927 |
| 440 | Ga0068856_100004426 | 3300005614 | Bacteria | 13984 |
| 441 | Ga0068856_100005515 | 3300005614 | Bacteria | 12459 |
| 442 | Ga0068856_100009769 | 3300005614 | Bacteria | 9323 |
| 443 | Ga0068856_100016707 | 3300005614 | Bacteria | 7108 |
| 444 | Ga0068856_100018332 | 3300005614 | Bacteria | 6785 |
| 445 | Ga0068856_100035221 | 3300005614 | Bacteria | 4905 |
| 446 | Ga0068856_100052289 | 3300005614 | Bacteria | 4028 |
| 447 | Ga0068856_100134565 | 3300005614 | Unclassified | 2477 |
| 448 | Ga0068856_100174564 | 3300005614 | Bacteria | 2161 |
| 449 | Ga0068856_100266068 | 3300005614 | Bacteria | 1730 |
| 450 | Ga0068856_100273735 | 3300005614 | Bacteria | 1704 |
| 451 | Ga0068856_100318831 | 3300005614 | Unclassified | 1572 |
| 452 | Ga0068856_100445536 | 3300005614 | Bacteria | 1315 |
| 453 | Ga0068856_100623635 | 3300005614 | Bacteria | 1099 |
| 454 | Ga0070702_100008267 | 3300005615 | Bacteria | 5030 |
| 455 | Ga0070702_100117046 | 3300005615 | Bacteria | 1662 |
| 456 | Ga0070702_100578343 | 3300005615 | Bacteria | 838 |
| 457 | Ga0068852_100052727 | 3300005616 | Bacteria | 3497 |
| 458 | Ga0068852_100073031 | 3300005616 | Bacteria | 3017 |
| 459 | Ga0068852_100078382 | 3300005616 | Bacteria | 2923 |
| 460 | Ga0068852_100091322 | 3300005616 | Bacteria | 2725 |
| 461 | Ga0068852_100148485 | 3300005616 | Bacteria | 2177 |
| 462 | Ga0068852_100153539 | 3300005616 | Bacteria | 2143 |
| 463 | Ga0068852_100523010 | 3300005616 | Bacteria | 1184 |
| 464 | Ga0068852_100531833 | 3300005616 | Unclassified | 1174 |
| 465 | Ga0068852_100698552 | 3300005616 | Bacteria | 1024 |
| 466 | Ga0068852_101160900 | 3300005616 | Unclassified | 793 |
| 467 | Ga0068852_101628556 | 3300005616 | Unclassified | 668 |
| 468 | Ga0068859_100012661 | 3300005617 | Bacteria | 8480 |
| 469 | Ga0068859_100020364 | 3300005617 | Bacteria | 6659 |
| 470 | Ga0068859_100064830 | 3300005617 | Bacteria | 3686 |
| 471 | Ga0068859_100129661 | 3300005617 | Bacteria | 2593 |
| 472 | Ga0068859_100511823 | 3300005617 | Bacteria | 1295 |
| 473 | Ga0068859_101089392 | 3300005617 | Unclassified | 879 |
| 474 | Ga0068859_101177054 | 3300005617 | Unclassified | 844 |
| 475 | Ga0068864_100001201 | 3300005618 | Bacteria | 21506 |
| 476 | Ga0068864_100016519 | 3300005618 | Bacteria | 6142 |
| 477 | Ga0068864_100018035 | 3300005618 | Bacteria | 5891 |
| 478 | Ga0068864_100053666 | 3300005618 | Bacteria | 3478 |
| 479 | Ga0068864_100265879 | 3300005618 | Bacteria | 1597 |
| 480 | Ga0068864_100553209 | 3300005618 | Unclassified | 1112 |
| 481 | Ga0068864_100710051 | 3300005618 | Unclassified | 983 |
| 482 | Ga0068866_10004569 | 3300005718 | Bacteria | 5671 |
| 483 | Ga0068866_10006928 | 3300005718 | Bacteria | 4734 |
| 484 | Ga0068866_10011478 | 3300005718 | Bacteria | 3833 |
| 485 | Ga0068866_10021108 | 3300005718 | Bacteria | 2995 |
| 486 | Ga0068866_10052758 | 3300005718 | Bacteria | 2076 |
| 487 | Ga0068866_10159124 | 3300005718 | Bacteria | 1315 |
| 488 | Ga0068866_10242928 | 3300005718 | Bacteria | 1098 |
| 489 | Ga0068866_10243876 | 3300005718 | Unclassified | 1096 |
| 490 | Ga0068861_100111519 | 3300005719 | Bacteria | 2192 |
| 491 | Ga0068861_101246502 | 3300005719 | Unclassified | 721 |
| 492 | Ga0068851_10000768 | 3300005834 | Bacteria | 13842 |
| 493 | Ga0068851_10010134 | 3300005834 | Bacteria | 4393 |
| 494 | Ga0068851_10031502 | 3300005834 | Bacteria | 2634 |
| 495 | Ga0068851_10077006 | 3300005834 | Bacteria | 1735 |
| 496 | Ga0068870_10003013 | 3300005840 | Bacteria | 7097 |
| 497 | Ga0068870_10128130 | 3300005840 | Bacteria | 1471 |
| 498 | Ga0068870_10228920 | 3300005840 | Bacteria | 1142 |
| 499 | Ga0068863_100030358 | 3300005841 | Bacteria | 5162 |
| 500 | Ga0068863_100072368 | 3300005841 | Bacteria | 3261 |
| 501 | Ga0068863_100072387 | 3300005841 | Bacteria | 3260 |
| 502 | Ga0068863_100091923 | 3300005841 | Bacteria | 2878 |
| 503 | Ga0068863_100225206 | 3300005841 | Bacteria | 1808 |
| 504 | Ga0068863_100356631 | 3300005841 | Bacteria | 1425 |
| 505 | Ga0068863_100424164 | 3300005841 | Bacteria | 1303 |
| 506 | Ga0068863_100786600 | 3300005841 | Unclassified | 948 |
| 507 | Ga0068858_100001918 | 3300005842 | Bacteria | 21203 |
| 508 | Ga0068858_100004951 | 3300005842 | Bacteria | 13050 |
| 509 | Ga0068858_100011743 | 3300005842 | Bacteria | 8261 |
| 510 | Ga0068858_100015080 | 3300005842 | Bacteria | 7268 |
| 511 | Ga0068858_100015573 | 3300005842 | Bacteria | 7152 |
| 512 | Ga0068858_100044143 | 3300005842 | Bacteria | 4133 |
| 513 | Ga0068858_100067719 | 3300005842 | Bacteria | 3307 |
| 514 | Ga0068858_100136778 | 3300005842 | Bacteria | 2299 |
| 515 | Ga0068858_100157154 | 3300005842 | Bacteria | 2139 |
| 516 | Ga0068858_100244776 | 3300005842 | Bacteria | 1702 |
| 517 | Ga0068860_100009019 | 3300005843 | Bacteria | 9927 |
| 518 | Ga0068860_100020415 | 3300005843 | Bacteria | 6417 |
| 519 | Ga0068860_100031193 | 3300005843 | Bacteria | 5125 |
| 520 | Ga0068860_100039235 | 3300005843 | Bacteria | 4529 |
| 521 | Ga0068860_100043099 | 3300005843 | Bacteria | 4307 |
| 522 | Ga0068860_100071482 | 3300005843 | Bacteria | 3297 |
| 523 | Ga0068860_100167531 | 3300005843 | Bacteria | 2121 |
| 524 | Ga0068860_100196125 | 3300005843 | Bacteria | 1955 |
| 525 | Ga0068860_100328244 | 3300005843 | Unclassified | 1502 |
| 526 | Ga0068860_100361747 | 3300005843 | Bacteria | 1430 |
| 527 | Ga0068860_100429487 | 3300005843 | Bacteria | 1311 |
| 528 | Ga0068860_100462054 | 3300005843 | Unclassified | 1263 |
| 529 | Ga0068860_100676324 | 3300005843 | Unclassified | 1041 |
| 530 | Ga0068862_100062550 | 3300005844 | Bacteria | 3201 |
| 531 | Ga0068862_100159946 | 3300005844 | Unclassified | 2010 |
| 532 | Ga0068862_100185764 | 3300005844 | Bacteria | 1868 |
| 533 | Ga0070717_10000706 | 3300006028 | Bacteria | 21629 |
| 534 | Ga0070717_10005162 | 3300006028 | Bacteria | 9522 |
| 535 | Ga0070717_10005425 | 3300006028 | Bacteria | 9309 |
| 536 | Ga0070717_10011062 | 3300006028 | Bacteria | 6836 |
| 537 | Ga0070717_10017266 | 3300006028 | Bacteria | 5612 |
| 538 | Ga0070717_10025423 | 3300006028 | Unclassified | 4709 |
| 539 | Ga0070717_10034487 | 3300006028 | Bacteria | 4091 |
| 540 | Ga0070717_10039339 | 3300006028 | Bacteria | 3847 |
| 541 | Ga0070717_10045761 | 3300006028 | Bacteria | 3578 |
| 542 | Ga0070717_10066177 | 3300006028 | Bacteria | 3005 |
| 543 | Ga0070717_10079516 | 3300006028 | Unclassified | 2749 |
| 544 | Ga0070717_10083277 | 3300006028 | Unclassified | 2689 |
| 545 | Ga0070717_10136092 | 3300006028 | Bacteria | 2116 |
| 546 | Ga0070717_10163120 | 3300006028 | Bacteria | 1934 |
| 547 | Ga0070717_10163928 | 3300006028 | Bacteria | 1930 |
| 548 | Ga0070717_10172318 | 3300006028 | Bacteria | 1883 |
| 549 | Ga0070717_10203065 | 3300006028 | Unclassified | 1737 |
| 550 | Ga0070717_10221909 | 3300006028 | Unclassified | 1662 |
| 551 | Ga0070717_10234313 | 3300006028 | Bacteria | 1617 |
| 552 | Ga0070717_10235901 | 3300006028 | Bacteria | 1612 |
| 553 | Ga0070717_10288492 | 3300006028 | Unclassified | 1457 |
| 554 | Ga0070717_10366748 | 3300006028 | Bacteria | 1290 |
| 555 | Ga0070717_10452837 | 3300006028 | Bacteria | 1157 |
| 556 | Ga0070717_10576470 | 3300006028 | Bacteria | 1020 |
| 557 | Ga0070717_10762338 | 3300006028 | Bacteria | 880 |
| 558 | Ga0070717_10911947 | 3300006028 | Unclassified | 800 |
| 559 | Ga0070717_10916983 | 3300006028 | Bacteria | 798 |
| 560 | Ga0070717_10980203 | 3300006028 | Bacteria | 770 |
| 561 | Ga0070715_10003791 | 3300006163 | Bacteria | 4875 |
| 562 | Ga0070715_10006634 | 3300006163 | Bacteria | 3948 |
| 563 | Ga0070715_10037422 | 3300006163 | Unclassified | 2008 |
| 564 | Ga0070715_10084753 | 3300006163 | Bacteria | 1446 |
| 565 | Ga0070715_10091611 | 3300006163 | Bacteria | 1400 |
| 566 | Ga0070715_10126251 | 3300006163 | Bacteria | 1226 |
| 567 | Ga0070715_10405407 | 3300006163 | Unclassified | 759 |
| 568 | Ga0070715_10478559 | 3300006163 | Bacteria | 708 |
| 569 | Ga0070716_100000053 | 3300006173 | Bacteria | 44317 |
| 570 | Ga0070716_100001666 | 3300006173 | Bacteria | 10018 |
| 571 | Ga0070716_100002780 | 3300006173 | Bacteria | 8131 |
| 572 | Ga0070716_100004145 | 3300006173 | Bacteria | 6884 |
| 573 | Ga0070716_100004434 | 3300006173 | Bacteria | 6714 |
| 574 | Ga0070716_100022462 | 3300006173 | Bacteria | 3335 |
| 575 | Ga0070716_100032373 | 3300006173 | Bacteria | 2851 |
| 576 | Ga0070716_100038836 | 3300006173 | Bacteria | 2638 |
| 577 | Ga0070716_100043243 | 3300006173 | Bacteria | 2518 |
| 578 | Ga0070716_100075532 | 3300006173 | Bacteria | 1994 |
| 579 | Ga0070716_100148197 | 3300006173 | Unclassified | 1506 |
| 580 | Ga0070716_100159551 | 3300006173 | Bacteria | 1460 |
| 581 | Ga0070716_100174715 | 3300006173 | Bacteria | 1405 |
| 582 | Ga0070716_100430404 | 3300006173 | Unclassified | 957 |
| 583 | Ga0070716_100441167 | 3300006173 | Unclassified | 946 |
| 584 | Ga0070716_100503756 | 3300006173 | Bacteria | 894 |
| 585 | Ga0070716_100781908 | 3300006173 | Unclassified | 737 |
| 586 | Ga0070716_100923378 | 3300006173 | Unclassified | 685 |
| 587 | Ga0070716_101335274 | 3300006173 | Unclassified | 581 |
| 588 | Ga0070712_100000245 | 3300006175 | Bacteria | 30626 |
| 589 | Ga0070712_100000883 | 3300006175 | Bacteria | 17912 |
| 590 | Ga0070712_100001242 | 3300006175 | Bacteria | 15410 |
| 591 | Ga0070712_100001620 | 3300006175 | Bacteria | 13772 |
| 592 | Ga0070712_100002079 | 3300006175 | Bacteria | 12290 |
| 593 | Ga0070712_100003518 | 3300006175 | Bacteria | 9636 |
| 594 | Ga0070712_100004827 | 3300006175 | Bacteria | 8333 |
| 595 | Ga0070712_100016276 | 3300006175 | Bacteria | 4803 |
| 596 | Ga0070712_100023337 | 3300006175 | Bacteria | 4085 |
| 597 | Ga0070712_100027410 | 3300006175 | Unclassified | 3804 |
| 598 | Ga0070712_100051755 | 3300006175 | Bacteria | 2862 |
| 599 | Ga0070712_100062286 | 3300006175 | Bacteria | 2637 |
| 600 | Ga0070712_100107575 | 3300006175 | Bacteria | 2075 |
| 601 | Ga0070712_100177853 | 3300006175 | Bacteria | 1656 |
| 602 | Ga0070712_100231151 | 3300006175 | Bacteria | 1469 |
| 603 | Ga0070712_100268367 | 3300006175 | Bacteria | 1370 |
| 604 | Ga0070712_100289223 | 3300006175 | Bacteria | 1322 |
| 605 | Ga0070712_100451364 | 3300006175 | Bacteria | 1070 |
| 606 | Ga0070712_100489346 | 3300006175 | Unclassified | 1030 |
| 607 | Ga0070712_100522873 | 3300006175 | Bacteria | 997 |
| 608 | Ga0070712_100612454 | 3300006175 | Bacteria | 923 |
| 609 | Ga0070712_100944647 | 3300006175 | Unclassified | 745 |
| 610 | Ga0070712_101087706 | 3300006175 | Unclassified | 694 |
| 611 | Ga0070712_101402608 | 3300006175 | Bacteria | 610 |
| 612 | Ga0097621_100000058 | 3300006237 | Bacteria | 58363 |
| 613 | Ga0097621_100000214 | 3300006237 | Bacteria | 38208 |
| 614 | Ga0097621_100000258 | 3300006237 | Bacteria | 35731 |
| 615 | Ga0097621_100000912 | 3300006237 | Bacteria | 20655 |
| 616 | Ga0097621_100007274 | 3300006237 | Bacteria | 7907 |
| 617 | Ga0097621_100017536 | 3300006237 | Bacteria | 5439 |
| 618 | Ga0097621_100019462 | 3300006237 | Bacteria | 5210 |
| 619 | Ga0097621_100028897 | 3300006237 | Bacteria | 4374 |
| 620 | Ga0097621_100073050 | 3300006237 | Bacteria | 2838 |
| 621 | Ga0097621_100074005 | 3300006237 | Bacteria | 2821 |
| 622 | Ga0097621_100100674 | 3300006237 | Unclassified | 2431 |
| 623 | Ga0097621_100128639 | 3300006237 | Bacteria | 2153 |
| 624 | Ga0097621_100233594 | 3300006237 | Bacteria | 1606 |
| 625 | Ga0097621_100289597 | 3300006237 | Bacteria | 1443 |
| 626 | Ga0097621_100466076 | 3300006237 | Unclassified | 1140 |
| 627 | Ga0097621_100468894 | 3300006237 | Bacteria | 1137 |
| 628 | Ga0097621_100617046 | 3300006237 | Bacteria | 992 |
| 629 | Ga0068871_100000167 | 3300006358 | Bacteria | 43972 |
| 630 | Ga0068871_100001429 | 3300006358 | Bacteria | 16001 |
| 631 | Ga0068871_100002785 | 3300006358 | Bacteria | 11948 |
| 632 | Ga0068871_100005906 | 3300006358 | Bacteria | 8611 |
| 633 | Ga0068871_100006017 | 3300006358 | Bacteria | 8540 |
| 634 | Ga0068871_100008022 | 3300006358 | Bacteria | 7581 |
| 635 | Ga0068871_100019578 | 3300006358 | Bacteria | 5170 |
| 636 | Ga0068871_100026119 | 3300006358 | Bacteria | 4553 |
| 637 | Ga0068871_100055484 | 3300006358 | Bacteria | 3216 |
| 638 | Ga0068871_100073483 | 3300006358 | Unclassified | 2819 |
| 639 | Ga0068871_100155421 | 3300006358 | Bacteria | 1953 |
| 640 | Ga0068871_100197694 | 3300006358 | Bacteria | 1735 |
| 641 | Ga0068871_100662049 | 3300006358 | Unclassified | 954 |
| 642 | Ga0075433_10000887 | 3300006852 | Bacteria | 21052 |
| 643 | Ga0075433_10048044 | 3300006852 | Unclassified | 3711 |
| 644 | Ga0075433_10127073 | 3300006852 | Bacteria | 2264 |
| 645 | Ga0075433_10139473 | 3300006852 | Bacteria | 2155 |
| 646 | Ga0075433_10253992 | 3300006852 | Bacteria | 1559 |
| 647 | Ga0075434_100000143 | 3300006871 | Bacteria | 43754 |
| 648 | Ga0075434_100000462 | 3300006871 | Bacteria | 30392 |
| 649 | Ga0075434_100017865 | 3300006871 | Bacteria | 6842 |
| 650 | Ga0075434_100020014 | 3300006871 | Bacteria | 6482 |
| 651 | Ga0075434_100050988 | 3300006871 | Bacteria | 4111 |
| 652 | Ga0075434_100075591 | 3300006871 | Unclassified | 3362 |
| 653 | Ga0075434_100084874 | 3300006871 | Unclassified | 3165 |
| 654 | Ga0075434_100120080 | 3300006871 | Bacteria | 2643 |
| 655 | Ga0075434_100623995 | 3300006871 | Bacteria | 1097 |
| 656 | Ga0075429_100561199 | 3300006880 | Bacteria | 1000 |
| 657 | Ga0068865_100007234 | 3300006881 | Bacteria | 6819 |
| 658 | Ga0068865_100017624 | 3300006881 | Bacteria | 4596 |
| 659 | Ga0068865_100040411 | 3300006881 | Unclassified | 3169 |
| 660 | Ga0068865_100067336 | 3300006881 | Unclassified | 2529 |
| 661 | Ga0068865_100082206 | 3300006881 | Bacteria | 2315 |
| 662 | Ga0068865_100142863 | 3300006881 | Bacteria | 1806 |
| 663 | Ga0068865_100217276 | 3300006881 | Bacteria | 1493 |
| 664 | Ga0068865_100297623 | 3300006881 | Bacteria | 1290 |
| 665 | Ga0068865_100655626 | 3300006881 | Bacteria | 892 |
| 666 | Ga0075436_100006013 | 3300006914 | Bacteria | 8333 |
| 667 | Ga0075436_100019838 | 3300006914 | Bacteria | 4610 |
| 668 | Ga0075436_100123796 | 3300006914 | Bacteria | 1811 |
| 669 | Ga0075436_100125432 | 3300006914 | Bacteria | 1798 |
| 670 | Ga0075436_100295295 | 3300006914 | Bacteria | 1160 |
| 671 | Ga0075436_100401618 | 3300006914 | Bacteria | 993 |
| 672 | Ga0075436_100728590 | 3300006914 | Bacteria | 735 |
| 673 | Ga0075436_101101299 | 3300006914 | Unclassified | 598 |
| 674 | Ga0097620_100012661 | 3300006931 | Bacteria | 8480 |
| 675 | Ga0097620_100020363 | 3300006931 | Bacteria | 6659 |
| 676 | Ga0097620_100064832 | 3300006931 | Bacteria | 3686 |
| 677 | Ga0097620_100129653 | 3300006931 | Bacteria | 2593 |
| 678 | Ga0097620_100511815 | 3300006931 | Unclassified | 1295 |
| 679 | Ga0097620_101089426 | 3300006931 | Unclassified | 879 |
| 680 | Ga0097620_101177455 | 3300006931 | Unclassified | 844 |
| 681 | Ga0075435_100000097 | 3300007076 | Bacteria | 46173 |
| 682 | Ga0075435_100008506 | 3300007076 | Bacteria | 7369 |
| 683 | Ga0075435_100019078 | 3300007076 | Bacteria | 5227 |
| 684 | Ga0075435_100047665 | 3300007076 | Bacteria | 3441 |
| 685 | Ga0075435_100048854 | 3300007076 | Unclassified | 3400 |
| 686 | Ga0075435_100069224 | 3300007076 | Bacteria | 2877 |
| 687 | Ga0075435_100326260 | 3300007076 | Unclassified | 1314 |
| 688 | Ga0075435_101628623 | 3300007076 | Unclassified | 566 |
| 689 | Ga0099794_10121978 | 3300007265 | Unclassified | 1312 |
| 690 | Ga0099795_10065329 | 3300007788 | Unclassified | 1360 |
| 691 | Ga0105251_10300231 | 3300009011 | Bacteria | 728 |
| 692 | Ga0105250_10260091 | 3300009092 | Unclassified | 743 |
| 693 | Ga0105240_10009153 | 3300009093 | Bacteria | 14050 |
| 694 | Ga0105240_10025327 | 3300009093 | Bacteria | 7799 |
| 695 | Ga0105240_10047077 | 3300009093 | Bacteria | 5459 |
| 696 | Ga0105240_10106642 | 3300009093 | Unclassified | 3398 |
| 697 | Ga0105240_10163926 | 3300009093 | Bacteria | 2638 |
| 698 | Ga0105240_10166929 | 3300009093 | Bacteria | 2610 |
| 699 | Ga0105240_10293490 | 3300009093 | Bacteria | 1863 |
| 700 | Ga0105240_10397030 | 3300009093 | Bacteria | 1554 |
| 701 | Ga0105240_10718666 | 3300009093 | Bacteria | 1089 |
| 702 | Ga0105240_11160838 | 3300009093 | Unclassified | 819 |
| 703 | Ga0111539_11219315 | 3300009094 | Unclassified | 874 |
| 704 | Ga0105245_10000435 | 3300009098 | Bacteria | 38523 |
| 705 | Ga0105245_10014444 | 3300009098 | Bacteria | 6880 |
| 706 | Ga0105245_10082441 | 3300009098 | Bacteria | 2942 |
| 707 | Ga0105245_10143086 | 3300009098 | Bacteria | 2254 |
| 708 | Ga0105245_10220745 | 3300009098 | Bacteria | 1829 |
| 709 | Ga0105245_10421157 | 3300009098 | Bacteria | 1338 |
| 710 | Ga0105247_10006697 | 3300009101 | Bacteria | 7111 |
| 711 | Ga0105247_10027839 | 3300009101 | Bacteria | 3417 |
| 712 | Ga0105247_10031755 | 3300009101 | Bacteria | 3207 |
| 713 | Ga0105247_10135865 | 3300009101 | Unclassified | 1606 |
| 714 | Ga0105247_10152677 | 3300009101 | Bacteria | 1523 |
| 715 | Ga0105247_10273797 | 3300009101 | Bacteria | 1162 |
| 716 | Ga0114129_10010746 | 3300009147 | Bacteria | 13046 |
| 717 | Ga0114129_12261013 | 3300009147 | Unclassified | 653 |
| 718 | Ga0105243_10069911 | 3300009148 | Bacteria | 2833 |
| 719 | Ga0105243_10603415 | 3300009148 | Bacteria | 1057 |
| 720 | Ga0105241_10000938 | 3300009174 | Bacteria | 22068 |
| 721 | Ga0105241_10015728 | 3300009174 | Bacteria | 5544 |
| 722 | Ga0105241_10025197 | 3300009174 | Bacteria | 4421 |
| 723 | Ga0105241_10032232 | 3300009174 | Bacteria | 3928 |
| 724 | Ga0105241_10078333 | 3300009174 | Bacteria | 2582 |
| 725 | Ga0105241_10082499 | 3300009174 | Bacteria | 2520 |
| 726 | Ga0105241_10126781 | 3300009174 | Bacteria | 2062 |
| 727 | Ga0105241_10131715 | 3300009174 | Bacteria | 2025 |
| 728 | Ga0105241_10233286 | 3300009174 | Unclassified | 1552 |
| 729 | Ga0105241_10264100 | 3300009174 | Bacteria | 1464 |
| 730 | Ga0105241_10536205 | 3300009174 | Bacteria | 1049 |
| 731 | Ga0105241_10778362 | 3300009174 | Bacteria | 880 |
| 732 | Ga0105241_10985699 | 3300009174 | Bacteria | 787 |
| 733 | Ga0105241_11284358 | 3300009174 | Bacteria | 696 |
| 734 | Ga0105242_10017283 | 3300009176 | Bacteria | 5618 |
| 735 | Ga0105242_10052411 | 3300009176 | Bacteria | 3329 |
| 736 | Ga0105242_10133098 | 3300009176 | Bacteria | 2149 |
| 737 | Ga0105242_10461366 | 3300009176 | Bacteria | 1200 |
| 738 | Ga0105248_10020678 | 3300009177 | Bacteria | 7293 |
| 739 | Ga0105248_10028479 | 3300009177 | Bacteria | 6223 |
| 740 | Ga0105248_10062653 | 3300009177 | Unclassified | 4176 |
| 741 | Ga0105248_10139012 | 3300009177 | Bacteria | 2740 |
| 742 | Ga0105248_10187701 | 3300009177 | Bacteria | 2329 |
| 743 | Ga0105248_10220322 | 3300009177 | Bacteria | 2136 |
| 744 | Ga0105248_10260008 | 3300009177 | Bacteria | 1954 |
| 745 | Ga0105248_10348587 | 3300009177 | Bacteria | 1667 |
| 746 | Ga0105248_10478995 | 3300009177 | Bacteria | 1403 |
| 747 | Ga0105248_10635874 | 3300009177 | Unclassified | 1204 |
| 748 | Ga0105248_10829756 | 3300009177 | Bacteria | 1043 |
| 749 | Ga0105237_10064690 | 3300009545 | Unclassified | 3653 |
| 750 | Ga0105237_10086868 | 3300009545 | Bacteria | 3117 |
| 751 | Ga0105237_10120324 | 3300009545 | Bacteria | 2620 |
| 752 | Ga0105237_10125221 | 3300009545 | Bacteria | 2564 |
| 753 | Ga0105237_10132307 | 3300009545 | Bacteria | 2489 |
| 754 | Ga0105237_10138112 | 3300009545 | Bacteria | 2432 |
| 755 | Ga0105237_10200533 | 3300009545 | Bacteria | 1995 |
| 756 | Ga0105237_10262432 | 3300009545 | Bacteria | 1730 |
| 757 | Ga0105237_10268576 | 3300009545 | Bacteria | 1709 |
| 758 | Ga0105237_10283368 | 3300009545 | Bacteria | 1660 |
| 759 | Ga0105237_10472028 | 3300009545 | Bacteria | 1261 |
| 760 | Ga0105237_10472404 | 3300009545 | Bacteria | 1260 |
| 761 | Ga0105237_10496256 | 3300009545 | Unclassified | 1227 |
| 762 | Ga0105237_10527855 | 3300009545 | Bacteria | 1187 |
| 763 | Ga0105237_10868981 | 3300009545 | Bacteria | 909 |
| 764 | Ga0105237_10948345 | 3300009545 | Unclassified | 867 |
| 765 | Ga0105237_10991107 | 3300009545 | Bacteria | 847 |
| 766 | Ga0105237_11034034 | 3300009545 | Unclassified | 828 |
| 767 | Ga0105237_11296670 | 3300009545 | Bacteria | 735 |
| 768 | Ga0105238_10000552 | 3300009551 | Bacteria | 39122 |
| 769 | Ga0105238_10028704 | 3300009551 | Bacteria | 5667 |
| 770 | Ga0105238_10040557 | 3300009551 | Bacteria | 4717 |
| 771 | Ga0105238_10070810 | 3300009551 | Bacteria | 3485 |
| 772 | Ga0105238_10158398 | 3300009551 | Unclassified | 2239 |
| 773 | Ga0105238_10380117 | 3300009551 | Bacteria | 1404 |
| 774 | Ga0105238_10417173 | 3300009551 | Unclassified | 1336 |
| 775 | Ga0105238_10839222 | 3300009551 | Unclassified | 936 |
| 776 | Ga0105238_11765441 | 3300009551 | Bacteria | 650 |
| 777 | Ga0105249_10063330 | 3300009553 | Unclassified | 3397 |
| 778 | Ga0105249_10102027 | 3300009553 | Bacteria | 2699 |
| 779 | Ga0105249_10255672 | 3300009553 | Bacteria | 1738 |
| 780 | Ga0105249_10850205 | 3300009553 | Unclassified | 978 |
| 781 | Ga0099796_10131439 | 3300010159 | Bacteria | 971 |
| 782 | Ga0105239_10052078 | 3300010375 | Bacteria | 4489 |
| 783 | Ga0105239_10099794 | 3300010375 | Bacteria | 3210 |
| 784 | Ga0105239_10137305 | 3300010375 | Bacteria | 2722 |
| 785 | Ga0105239_10155368 | 3300010375 | Bacteria | 2555 |
| 786 | Ga0105239_10174907 | 3300010375 | Unclassified | 2401 |
| 787 | Ga0105239_10206191 | 3300010375 | Bacteria | 2203 |
| 788 | Ga0105239_10230253 | 3300010375 | Unclassified | 2079 |
| 789 | Ga0105239_10379772 | 3300010375 | Bacteria | 1597 |
| 790 | Ga0105239_10765117 | 3300010375 | Bacteria | 1106 |
| 791 | Ga0105239_10826520 | 3300010375 | Bacteria | 1062 |
| 792 | Ga0105239_10849721 | 3300010375 | Unclassified | 1047 |
| 793 | Ga0105239_10931041 | 3300010375 | Bacteria | 998 |
| 794 | Ga0105246_10008782 | 3300011119 | Bacteria | 6217 |
| 795 | Ga0105246_10025952 | 3300011119 | Unclassified | 3822 |
| 796 | Ga0105246_10165923 | 3300011119 | Bacteria | 1687 |
| 797 | Ga0105246_10187967 | 3300011119 | Bacteria | 1596 |
| 798 | Ga0105246_10596240 | 3300011119 | Unclassified | 954 |
| 799 | Ga0157342_1008036 | 3300012507 | Bacteria | 1037 |
| 800 | Ga0154016_121265 | 3300013045 | Unclassified | 558 |
| 801 | Ga0157373_10002001 | 3300013100 | Bacteria | 15451 |
| 802 | Ga0157373_10012901 | 3300013100 | Bacteria | 6135 |
| 803 | Ga0157373_10013891 | 3300013100 | Bacteria | 5905 |
| 804 | Ga0157373_10020693 | 3300013100 | Bacteria | 4779 |
| 805 | Ga0157373_10033416 | 3300013100 | Bacteria | 3700 |
| 806 | Ga0157373_10036182 | 3300013100 | Bacteria | 3544 |
| 807 | Ga0157373_10049697 | 3300013100 | Bacteria | 2988 |
| 808 | Ga0157373_10310322 | 3300013100 | Bacteria | 1121 |
| 809 | Ga0157373_10317153 | 3300013100 | Bacteria | 1108 |
| 810 | Ga0157373_10356713 | 3300013100 | Bacteria | 1043 |
| 811 | Ga0157371_10031090 | 3300013102 | Bacteria | 3847 |
| 812 | Ga0157371_10034360 | 3300013102 | Bacteria | 3637 |
| 813 | Ga0157371_10097836 | 3300013102 | Bacteria | 2080 |
| 814 | Ga0157371_10634512 | 3300013102 | Unclassified | 796 |
| 815 | Ga0157370_10153738 | 3300013104 | Bacteria | 2141 |
| 816 | Ga0157370_10174783 | 3300013104 | Bacteria | 1996 |
| 817 | Ga0157370_10542901 | 3300013104 | Unclassified | 1066 |
| 818 | Ga0157370_10667322 | 3300013104 | Bacteria | 950 |
| 819 | Ga0157370_10702637 | 3300013104 | Bacteria | 923 |
| 820 | Ga0157370_10849127 | 3300013104 | Bacteria | 830 |
| 821 | Ga0157369_10000592 | 3300013105 | Bacteria | 47171 |
| 822 | Ga0157369_10010252 | 3300013105 | Bacteria | 10694 |
| 823 | Ga0157369_10010541 | 3300013105 | Bacteria | 10517 |
| 824 | Ga0157369_10107692 | 3300013105 | Bacteria | 2965 |
| 825 | Ga0157369_10220070 | 3300013105 | Bacteria | 1987 |
| 826 | Ga0157369_10333976 | 3300013105 | Unclassified | 1574 |
| 827 | Ga0157369_10395093 | 3300013105 | Unclassified | 1435 |
| 828 | Ga0157369_10543616 | 3300013105 | Unclassified | 1201 |
| 829 | Ga0157369_10563591 | 3300013105 | Unclassified | 1177 |
| 830 | Ga0157369_10585342 | 3300013105 | Unclassified | 1152 |
| 831 | Ga0157369_10708217 | 3300013105 | Bacteria | 1037 |
| 832 | Ga0157369_11462205 | 3300013105 | Unclassified | 695 |
| 833 | Ga0157374_10000181 | 3300013296 | Bacteria | 58388 |
| 834 | Ga0157374_10000441 | 3300013296 | Bacteria | 37640 |
| 835 | Ga0157374_10000669 | 3300013296 | Bacteria | 30173 |
| 836 | Ga0157374_10002847 | 3300013296 | Bacteria | 14509 |
| 837 | Ga0157374_10003184 | 3300013296 | Bacteria | 13784 |
| 838 | Ga0157374_10004152 | 3300013296 | Bacteria | 12154 |
| 839 | Ga0157374_10010585 | 3300013296 | Bacteria | 7938 |
| 840 | Ga0157374_10024679 | 3300013296 | Bacteria | 5389 |
| 841 | Ga0157374_10050889 | 3300013296 | Unclassified | 3852 |
| 842 | Ga0157374_10063644 | 3300013296 | Bacteria | 3460 |
| 843 | Ga0157374_10085882 | 3300013296 | Unclassified | 2993 |
| 844 | Ga0157374_10090359 | 3300013296 | Unclassified | 2920 |
| 845 | Ga0157374_10092356 | 3300013296 | Bacteria | 2888 |
| 846 | Ga0157374_10267208 | 3300013296 | Bacteria | 1686 |
| 847 | Ga0157374_10365133 | 3300013296 | Bacteria | 1436 |
| 848 | Ga0157374_10372812 | 3300013296 | Bacteria | 1421 |
| 849 | Ga0157374_10619788 | 3300013296 | Bacteria | 1093 |
| 850 | Ga0157374_11082467 | 3300013296 | Bacteria | 822 |
| 851 | Ga0157378_10000183 | 3300013297 | Bacteria | 60010 |
| 852 | Ga0157378_10000680 | 3300013297 | Bacteria | 31989 |
| 853 | Ga0157378_10000980 | 3300013297 | Bacteria | 26121 |
| 854 | Ga0157378_10003268 | 3300013297 | Bacteria | 14406 |
| 855 | Ga0157378_10007887 | 3300013297 | Bacteria | 9292 |
| 856 | Ga0157378_10045247 | 3300013297 | Bacteria | 3910 |
| 857 | Ga0157378_10048288 | 3300013297 | Bacteria | 3784 |
| 858 | Ga0157378_10091209 | 3300013297 | Bacteria | 2770 |
| 859 | Ga0157378_10151675 | 3300013297 | Bacteria | 2160 |
| 860 | Ga0157378_10167510 | 3300013297 | Bacteria | 2059 |
| 861 | Ga0157378_10169798 | 3300013297 | Bacteria | 2045 |
| 862 | Ga0157378_10276505 | 3300013297 | Bacteria | 1617 |
| 863 | Ga0157378_10311172 | 3300013297 | Bacteria | 1528 |
| 864 | Ga0157378_10342546 | 3300013297 | Bacteria | 1458 |
| 865 | Ga0157378_10675456 | 3300013297 | Bacteria | 1050 |
| 866 | Ga0157378_11107315 | 3300013297 | Bacteria | 829 |
| 867 | Ga0157378_12122956 | 3300013297 | Unclassified | 612 |
| 868 | Ga0163162_10005932 | 3300013306 | Bacteria | 11822 |
| 869 | Ga0163162_10010650 | 3300013306 | Bacteria | 8942 |
| 870 | Ga0163162_10012073 | 3300013306 | Bacteria | 8426 |
| 871 | Ga0163162_10014846 | 3300013306 | Bacteria | 7606 |
| 872 | Ga0163162_10048730 | 3300013306 | Bacteria | 4245 |
| 873 | Ga0163162_10089492 | 3300013306 | Unclassified | 3159 |
| 874 | Ga0163162_10328458 | 3300013306 | Bacteria | 1662 |
| 875 | Ga0163162_11366272 | 3300013306 | Bacteria | 806 |
| 876 | Ga0157372_10000685 | 3300013307 | Bacteria | 37210 |
| 877 | Ga0157372_10001790 | 3300013307 | Bacteria | 23336 |
| 878 | Ga0157372_10007825 | 3300013307 | Bacteria | 11350 |
| 879 | Ga0157372_10010095 | 3300013307 | Bacteria | 10030 |
| 880 | Ga0157372_10013222 | 3300013307 | Bacteria | 8808 |
| 881 | Ga0157372_10020965 | 3300013307 | Bacteria | 7055 |
| 882 | Ga0157372_10091930 | 3300013307 | Bacteria | 3451 |
| 883 | Ga0157372_10119777 | 3300013307 | Bacteria | 3022 |
| 884 | Ga0157372_10155597 | 3300013307 | Bacteria | 2640 |
| 885 | Ga0157372_10213541 | 3300013307 | Bacteria | 2236 |
| 886 | Ga0157372_10300787 | 3300013307 | Bacteria | 1866 |
| 887 | Ga0157372_10328273 | 3300013307 | Bacteria | 1781 |
| 888 | Ga0157372_10332101 | 3300013307 | Bacteria | 1770 |
| 889 | Ga0157372_10349444 | 3300013307 | Bacteria | 1723 |
| 890 | Ga0157372_10365769 | 3300013307 | Unclassified | 1681 |
| 891 | Ga0157372_10652478 | 3300013307 | Bacteria | 1225 |
| 892 | Ga0157372_11590608 | 3300013307 | Unclassified | 752 |
| 893 | Ga0157375_10008727 | 3300013308 | Bacteria | 8880 |
| 894 | Ga0157375_10028055 | 3300013308 | Bacteria | 5271 |
| 895 | Ga0157375_10045953 | 3300013308 | Bacteria | 4254 |
| 896 | Ga0157375_10132623 | 3300013308 | Bacteria | 2612 |
| 897 | Ga0157375_10232146 | 3300013308 | Bacteria | 2004 |
| 898 | Ga0157375_10396784 | 3300013308 | Unclassified | 1546 |
| 899 | Ga0157375_10868750 | 3300013308 | Unclassified | 1047 |
| 900 | Ga0157375_11132831 | 3300013308 | Unclassified | 916 |
| 901 | Ga0157375_11572232 | 3300013308 | Unclassified | 777 |
| 902 | Ga0157375_11883865 | 3300013308 | Bacteria | 710 |
| 903 | Ga0157375_12034875 | 3300013308 | Bacteria | 683 |
| 904 | Ga0163163_10058592 | 3300014325 | Unclassified | 3808 |
| 905 | Ga0163163_10097583 | 3300014325 | Bacteria | 2959 |
| 906 | Ga0163163_10183345 | 3300014325 | Bacteria | 2141 |
| 907 | Ga0163163_10186510 | 3300014325 | Bacteria | 2122 |
| 908 | Ga0163163_10191165 | 3300014325 | Bacteria | 2095 |
| 909 | Ga0163163_10192881 | 3300014325 | Bacteria | 2085 |
| 910 | Ga0163163_10225225 | 3300014325 | Unclassified | 1924 |
| 911 | Ga0163163_10242306 | 3300014325 | Unclassified | 1853 |
| 912 | Ga0163163_10424392 | 3300014325 | Unclassified | 1389 |
| 913 | Ga0163163_11548357 | 3300014325 | Unclassified | 724 |
| 914 | Ga0157380_10044130 | 3300014326 | Bacteria | 3492 |
| 915 | Ga0157380_10802759 | 3300014326 | Unclassified | 958 |
| 916 | Ga0182008_10099708 | 3300014497 | Bacteria | 1435 |
| 917 | Ga0182008_10169143 | 3300014497 | Viruses | 1103 |
| 918 | Ga0182008_10252772 | 3300014497 | Bacteria | 909 |
| 919 | Ga0157377_10004630 | 3300014745 | Bacteria | 6360 |
| 920 | Ga0157377_10127287 | 3300014745 | Bacteria | 1551 |
| 921 | Ga0157377_10237372 | 3300014745 | Bacteria | 1175 |
| 922 | Ga0157377_10686572 | 3300014745 | Unclassified | 741 |
| 923 | Ga0157379_10029300 | 3300014968 | Bacteria | 4895 |
| 924 | Ga0157379_10033714 | 3300014968 | Unclassified | 4567 |
| 925 | Ga0157379_10048814 | 3300014968 | Bacteria | 3778 |
| 926 | Ga0157379_10151334 | 3300014968 | Bacteria | 2093 |
| 927 | Ga0157379_10179925 | 3300014968 | Bacteria | 1910 |
| 928 | Ga0157379_10201322 | 3300014968 | Unclassified | 1801 |
| 929 | Ga0157379_10392664 | 3300014968 | Bacteria | 1274 |
| 930 | Ga0157379_10400093 | 3300014968 | Bacteria | 1262 |
| 931 | Ga0157379_10447080 | 3300014968 | Bacteria | 1193 |
| 932 | Ga0157376_10046987 | 3300014969 | Bacteria | 3562 |
| 933 | Ga0157376_10056221 | 3300014969 | Bacteria | 3286 |
| 934 | Ga0157376_10081575 | 3300014969 | Bacteria | 2777 |
| 935 | Ga0157376_10150690 | 3300014969 | Unclassified | 2097 |
| 936 | Ga0157376_10197089 | 3300014969 | Bacteria | 1851 |
| 937 | Ga0182006_1077007 | 3300015261 | Bacteria | 1224 |
| 938 | Ga0182007_10009581 | 3300015262 | Bacteria | 3893 |
| 939 | Ga0182007_10046823 | 3300015262 | Bacteria | 1431 |
| 940 | Ga0182007_10050526 | 3300015262 | Bacteria | 1372 |
| 941 | Ga0182005_1023597 | 3300015265 | Unclassified | 1680 |
| 942 | Ga0163161_10013876 | 3300017792 | Bacteria | 5612 |
| 943 | Ga0163161_10366939 | 3300017792 | Bacteria | 1148 |
| 944 | Ga0184602_106269 | 3300019161 | Unclassified | 605 |
| 945 | Ga0184602_109861 | 3300019161 | Unclassified | 549 |
| 946 | Ga0184595_120694 | 3300019166 | Unclassified | 839 |
| 947 | Ga0184598_100081 | 3300019182 | Unclassified | 620 |
| 948 | Ga0184598_115043 | 3300019182 | Unclassified | 563 |
| 949 | Ga0184598_145996 | 3300019182 | Unclassified | 790 |
| 950 | Ga0184601_107723 | 3300019183 | Bacteria | 602 |
| 951 | Ga0184601_129239 | 3300019183 | Unclassified | 533 |
| 952 | Ga0184601_130551 | 3300019183 | Unclassified | 636 |
| 953 | Ga0184599_102866 | 3300019188 | Unclassified | 627 |
| 954 | Ga0184599_103104 | 3300019188 | Bacteria | 669 |
| 955 | Ga0184599_110615 | 3300019188 | Unclassified | 750 |
| 956 | Ga0184599_124047 | 3300019188 | Unclassified | 620 |
| 957 | Ga0184599_131861 | 3300019188 | Unclassified | 649 |
| 958 | Ga0184599_142771 | 3300019188 | Unclassified | 597 |
| 959 | Ga0184600_119842 | 3300019190 | Unclassified | 1486 |
| 960 | Ga0184600_120803 | 3300019190 | Unclassified | 797 |
| 961 | Ga0184600_123884 | 3300019190 | Bacteria | 648 |
| 962 | Ga0184600_126708 | 3300019190 | Unclassified | 708 |
| 963 | Ga0184600_137157 | 3300019190 | Unclassified | 837 |
| 964 | Ga0184600_142494 | 3300019190 | Bacteria | 598 |
| 965 | Ga0184600_143183 | 3300019190 | Unclassified | 635 |
| 966 | Ga0184603_105345 | 3300019192 | Unclassified | 587 |
| 967 | Ga0184603_114215 | 3300019192 | Bacteria | 939 |
| 968 | Ga0184603_117323 | 3300019192 | Bacteria | 602 |
| 969 | Ga0184603_131582 | 3300019192 | Bacteria | 1887 |
| 970 | Ga0184603_138916 | 3300019192 | Unclassified | 1036 |
| 971 | Ga0184603_140924 | 3300019192 | Unclassified | 711 |
| 972 | Ga0184603_142059 | 3300019192 | Unclassified | 602 |
| 973 | Ga0184603_152573 | 3300019192 | Unclassified | 652 |
| 974 | Ga0197907_10084420 | 3300020069 | Bacteria | 798 |
| 975 | Ga0197907_10564868 | 3300020069 | Bacteria | 806 |
| 976 | Ga0197907_10936568 | 3300020069 | Bacteria | 680 |
| 977 | Ga0197907_10983481 | 3300020069 | Bacteria | 812 |
| 978 | Ga0197907_11085293 | 3300020069 | Unclassified | 585 |
| 979 | Ga0197907_11105990 | 3300020069 | Bacteria | 710 |
| 980 | Ga0197907_11112728 | 3300020069 | Bacteria | 748 |
| 981 | Ga0197907_11170937 | 3300020069 | Bacteria | 791 |
| 982 | Ga0197907_11172515 | 3300020069 | Bacteria | 977 |
| 983 | Ga0197907_11195871 | 3300020069 | Bacteria | 891 |
| 984 | Ga0206356_10441556 | 3300020070 | Bacteria | 798 |
| 985 | Ga0206356_10570719 | 3300020070 | Unclassified | 660 |
| 986 | Ga0206356_10822215 | 3300020070 | Bacteria | 816 |
| 987 | Ga0206356_11185349 | 3300020070 | Bacteria | 836 |
| 988 | Ga0206356_11295561 | 3300020070 | Bacteria | 704 |
| 989 | Ga0206356_11671056 | 3300020070 | Bacteria | 753 |
| 990 | Ga0206356_11683825 | 3300020070 | Bacteria | 1013 |
| 991 | Ga0206356_11883121 | 3300020070 | Bacteria | 725 |
| 992 | Ga0206349_1015588 | 3300020075 | Bacteria | 596 |
| 993 | Ga0206349_1037644 | 3300020075 | Unclassified | 563 |
| 994 | Ga0206349_1456218 | 3300020075 | Bacteria | 737 |
| 995 | Ga0206349_1460947 | 3300020075 | Bacteria | 1633 |
| 996 | Ga0206349_1563308 | 3300020075 | Unclassified | 759 |
| 997 | Ga0206349_1719180 | 3300020075 | Bacteria | 820 |
| 998 | Ga0206349_1834150 | 3300020075 | Bacteria | 902 |
| 999 | Ga0206355_1009431 | 3300020076 | Bacteria | 619 |
| 1000 | Ga0206355_1153129 | 3300020076 | Unclassified | 584 |
| 1001 | Ga0206355_1230871 | 3300020076 | Bacteria | 585 |
| 1002 | Ga0206355_1416264 | 3300020076 | Bacteria | 735 |
| 1003 | Ga0206355_1553201 | 3300020076 | Bacteria | 692 |
| 1004 | Ga0206355_1690397 | 3300020076 | Unclassified | 1251 |
| 1005 | Ga0206355_1710496 | 3300020076 | Bacteria | 701 |
| 1006 | Ga0206355_1716887 | 3300020076 | Unclassified | 669 |
| 1007 | Ga0206351_10014578 | 3300020077 | Bacteria | 682 |
| 1008 | Ga0206351_10056875 | 3300020077 | Unclassified | 684 |
| 1009 | Ga0206351_10303508 | 3300020077 | Bacteria | 844 |
| 1010 | Ga0206351_10350621 | 3300020077 | Bacteria | 720 |
| 1011 | Ga0206351_10354870 | 3300020077 | Bacteria | 564 |
| 1012 | Ga0206351_10363783 | 3300020077 | Unclassified | 619 |
| 1013 | Ga0206351_10430873 | 3300020077 | Unclassified | 580 |
| 1014 | Ga0206351_10442687 | 3300020077 | Unclassified | 1292 |
| 1015 | Ga0206351_10507452 | 3300020077 | Unclassified | 680 |
| 1016 | Ga0206351_10517272 | 3300020077 | Bacteria | 796 |
| 1017 | Ga0206351_10536639 | 3300020077 | Bacteria | 528 |
| 1018 | Ga0206351_10578521 | 3300020077 | Bacteria | 635 |
| 1019 | Ga0206351_10715667 | 3300020077 | Unclassified | 752 |
| 1020 | Ga0206351_10758291 | 3300020077 | Bacteria | 591 |
| 1021 | Ga0206351_11004638 | 3300020077 | Bacteria | 856 |
| 1022 | Ga0206352_10117765 | 3300020078 | Unclassified | 1138 |
| 1023 | Ga0206352_10169050 | 3300020078 | Unclassified | 559 |
| 1024 | Ga0206352_10258708 | 3300020078 | Bacteria | 719 |
| 1025 | Ga0206352_10339657 | 3300020078 | Bacteria | 879 |
| 1026 | Ga0206352_10363745 | 3300020078 | Bacteria | 853 |
| 1027 | Ga0206352_10454458 | 3300020078 | Bacteria | 567 |
| 1028 | Ga0206352_10496089 | 3300020078 | Bacteria | 669 |
| 1029 | Ga0206352_11082821 | 3300020078 | Bacteria | 855 |
| 1030 | Ga0206352_11288835 | 3300020078 | Bacteria | 825 |
| 1031 | Ga0206352_11362225 | 3300020078 | Unclassified | 571 |
| 1032 | Ga0206350_10168586 | 3300020080 | Bacteria | 861 |
| 1033 | Ga0206350_10198168 | 3300020080 | Bacteria | 873 |
| 1034 | Ga0206350_10307226 | 3300020080 | Unclassified | 827 |
| 1035 | Ga0206350_10387789 | 3300020080 | Bacteria | 767 |
| 1036 | Ga0206350_10556898 | 3300020080 | Bacteria | 785 |
| 1037 | Ga0206350_10670875 | 3300020080 | Bacteria | 763 |
| 1038 | Ga0206350_10758558 | 3300020080 | Bacteria | 906 |
| 1039 | Ga0206350_10854374 | 3300020080 | Unclassified | 707 |
| 1040 | Ga0206350_11244989 | 3300020080 | Bacteria | 1223 |
| 1041 | Ga0206350_11276827 | 3300020080 | Bacteria | 681 |
| 1042 | Ga0206350_11568119 | 3300020080 | Bacteria | 1021 |
| 1043 | Ga0206354_10075735 | 3300020081 | Unclassified | 693 |
| 1044 | Ga0206354_10183032 | 3300020081 | Unclassified | 941 |
| 1045 | Ga0206354_10709426 | 3300020081 | Unclassified | 579 |
| 1046 | Ga0206354_10740595 | 3300020081 | Bacteria | 823 |
| 1047 | Ga0206354_11316437 | 3300020081 | Bacteria | 719 |
| 1048 | Ga0206354_11541019 | 3300020081 | Bacteria | 700 |
| 1049 | Ga0206353_10170859 | 3300020082 | Bacteria | 637 |
| 1050 | Ga0206353_10359605 | 3300020082 | Unclassified | 872 |
| 1051 | Ga0206353_10638938 | 3300020082 | Unclassified | 1025 |
| 1052 | Ga0206353_10702936 | 3300020082 | Bacteria | 837 |
| 1053 | Ga0206353_11510999 | 3300020082 | Unclassified | 565 |
| 1054 | Ga0154015_1009788 | 3300020610 | Unclassified | 712 |
| 1055 | Ga0154015_1327883 | 3300020610 | Bacteria | 607 |
| 1056 | Ga0154015_1328348 | 3300020610 | Unclassified | 579 |
| 1057 | Ga0154015_1401913 | 3300020610 | Bacteria | 562 |
| 1058 | Ga0154015_1415416 | 3300020610 | Bacteria | 591 |
| 1059 | Ga0154015_1448305 | 3300020610 | Unclassified | 743 |
| 1060 | Ga0154015_1545072 | 3300020610 | Bacteria | 517 |
| 1061 | Ga0154015_1632807 | 3300020610 | Unclassified | 1039 |
| 1062 | Ga0213876_10357091 | 3300021384 | Unclassified | 777 |
| 1063 | Ga0213871_10148271 | 3300021441 | Bacteria | 712 |
| 1064 | Ga0224712_10008765 | 3300022467 | Bacteria | 3015 |
| 1065 | Ga0224712_10102778 | 3300022467 | Bacteria | 1214 |
| 1066 | Ga0224712_10126991 | 3300022467 | Bacteria | 1110 |
| 1067 | Ga0224712_10164097 | 3300022467 | Bacteria | 993 |
| 1068 | Ga0224712_10165116 | 3300022467 | Bacteria | 990 |
| 1069 | Ga0224712_10226632 | 3300022467 | Bacteria | 857 |
| 1070 | Ga0224712_10245654 | 3300022467 | Bacteria | 826 |
| 1071 | Ga0224712_10245664 | 3300022467 | Unclassified | 826 |
| 1072 | Ga0224712_10262616 | 3300022467 | Bacteria | 800 |
| 1073 | Ga0224712_10274837 | 3300022467 | Unclassified | 783 |
| 1074 | Ga0224712_10277683 | 3300022467 | Bacteria | 779 |
| 1075 | Ga0224712_10292094 | 3300022467 | Bacteria | 761 |
| 1076 | Ga0224712_10313110 | 3300022467 | Unclassified | 736 |
| 1077 | Ga0224712_10355767 | 3300022467 | Bacteria | 692 |
| 1078 | Ga0224712_10362880 | 3300022467 | Unclassified | 686 |
| 1079 | Ga0224712_10371925 | 3300022467 | Bacteria | 678 |
| 1080 | Ga0224712_10493541 | 3300022467 | Unclassified | 591 |
| 1081 | Ga0224712_10517472 | 3300022467 | Unclassified | 578 |
| 1082 | Ga0224712_10566993 | 3300022467 | Unclassified | 553 |
| 1083 | Ga0224570_100259 | 3300022730 | Bacteria | 3911 |
| 1084 | Ga0224569_100095 | 3300022732 | Bacteria | 5885 |
| 1085 | Ga0224571_100363 | 3300022734 | Bacteria | 2424 |
| 1086 | Ga0247552_101548 | 3300023536 | Unclassified | 693 |
| 1087 | Ga0247555_100282 | 3300023539 | Unclassified | 1232 |
| 1088 | Ga0247555_100656 | 3300023539 | Bacteria | 949 |
| 1089 | Ga0247555_101592 | 3300023539 | Unclassified | 712 |
| 1090 | Ga0247555_101933 | 3300023539 | Unclassified | 668 |
| 1091 | Ga0247555_102612 | 3300023539 | Unclassified | 605 |
| 1092 | Ga0247555_102616 | 3300023539 | Unclassified | 604 |
| 1093 | Ga0247554_100243 | 3300023547 | Unclassified | 1449 |
| 1094 | Ga0247554_103375 | 3300023547 | Unclassified | 625 |
| 1095 | Ga0247527_112489 | 3300023664 | Unclassified | 580 |
| 1096 | Ga0247525_115464 | 3300023668 | Unclassified | 596 |
| 1097 | Ga0247553_101269 | 3300023672 | Unclassified | 1060 |
| 1098 | Ga0247553_103670 | 3300023672 | Unclassified | 757 |
| 1099 | Ga0247553_104285 | 3300023672 | Unclassified | 718 |
| 1100 | Ga0247553_104650 | 3300023672 | Bacteria | 699 |
| 1101 | Ga0247553_104670 | 3300023672 | Unclassified | 698 |
| 1102 | Ga0247553_106330 | 3300023672 | Bacteria | 629 |
| 1103 | Ga0247553_106912 | 3300023672 | Unclassified | 610 |
| 1104 | Ga0247553_108607 | 3300023672 | Bacteria | 570 |
| 1105 | Ga0247553_108613 | 3300023672 | Unclassified | 570 |
| 1106 | Ga0247553_108659 | 3300023672 | Bacteria | 569 |
| 1107 | Ga0247553_109550 | 3300023672 | Unclassified | 551 |
| 1108 | Ga0224572_1000054 | 3300024225 | Bacteria | 7405 |
| 1109 | Ga0224572_1004413 | 3300024225 | Bacteria | 2445 |
| 1110 | Ga0228598_1000204 | 3300024227 | Bacteria | 10965 |
| 1111 | Ga0228598_1001159 | 3300024227 | Bacteria | 5811 |
| 1112 | Ga0228598_1002707 | 3300024227 | Bacteria | 3837 |
| 1113 | Ga0228598_1009508 | 3300024227 | Bacteria | 1948 |
| 1114 | Ga0207697_10008045 | 3300025315 | Bacteria | 4652 |
| 1115 | Ga0207697_10062920 | 3300025315 | Bacteria | 1546 |
| 1116 | Ga0207697_10103769 | 3300025315 | Bacteria | 1213 |
| 1117 | Ga0207656_10010107 | 3300025321 | Bacteria | 3522 |
| 1118 | Ga0207656_10057008 | 3300025321 | Bacteria | 1704 |
| 1119 | Ga0207656_10174310 | 3300025321 | Bacteria | 1029 |
| 1120 | Ga0207656_10325353 | 3300025321 | Bacteria | 764 |
| 1121 | Ga0207653_10257307 | 3300025885 | Unclassified | 670 |
| 1122 | Ga0207682_10006790 | 3300025893 | Bacteria | 4592 |
| 1123 | Ga0207682_10053388 | 3300025893 | Bacteria | 1676 |
| 1124 | Ga0207692_10009832 | 3300025898 | Unclassified | 4009 |
| 1125 | Ga0207692_10068561 | 3300025898 | Bacteria | 1861 |
| 1126 | Ga0207692_10072825 | 3300025898 | Bacteria | 1816 |
| 1127 | Ga0207692_10135856 | 3300025898 | Bacteria | 1394 |
| 1128 | Ga0207692_10246757 | 3300025898 | Unclassified | 1068 |
| 1129 | Ga0207692_10252754 | 3300025898 | Bacteria | 1057 |
| 1130 | Ga0207692_10356218 | 3300025898 | Unclassified | 903 |
| 1131 | Ga0207692_10379170 | 3300025898 | Bacteria | 877 |
| 1132 | Ga0207642_10002007 | 3300025899 | Bacteria | 6275 |
| 1133 | Ga0207642_10015311 | 3300025899 | Bacteria | 2854 |
| 1134 | Ga0207642_10017593 | 3300025899 | Bacteria | 2723 |
| 1135 | Ga0207642_10038264 | 3300025899 | Bacteria | 2075 |
| 1136 | Ga0207642_10082480 | 3300025899 | Bacteria | 1565 |
| 1137 | Ga0207642_10317888 | 3300025899 | Unclassified | 908 |
| 1138 | Ga0207642_10336917 | 3300025899 | Unclassified | 886 |
| 1139 | Ga0207642_10599328 | 3300025899 | Bacteria | 685 |
| 1140 | Ga0207710_10021795 | 3300025900 | Bacteria | 2749 |
| 1141 | Ga0207710_10048477 | 3300025900 | Bacteria | 1901 |
| 1142 | Ga0207710_10208466 | 3300025900 | Bacteria | 967 |
| 1143 | Ga0207688_10059967 | 3300025901 | Bacteria | 2143 |
| 1144 | Ga0207680_10022725 | 3300025903 | Bacteria | 3415 |
| 1145 | Ga0207680_10031045 | 3300025903 | Bacteria | 3023 |
| 1146 | Ga0207680_10037411 | 3300025903 | Bacteria | 2801 |
| 1147 | Ga0207680_10742990 | 3300025903 | Unclassified | 703 |
| 1148 | Ga0207647_10000781 | 3300025904 | Bacteria | 24778 |
| 1149 | Ga0207647_10003191 | 3300025904 | Bacteria | 12297 |
| 1150 | Ga0207647_10009223 | 3300025904 | Bacteria | 7017 |
| 1151 | Ga0207647_10011030 | 3300025904 | Bacteria | 6357 |
| 1152 | Ga0207647_10022166 | 3300025904 | Unclassified | 4224 |
| 1153 | Ga0207647_10028145 | 3300025904 | Unclassified | 3654 |
| 1154 | Ga0207647_10031771 | 3300025904 | Bacteria | 3396 |
| 1155 | Ga0207647_10054509 | 3300025904 | Bacteria | 2460 |
| 1156 | Ga0207647_10236607 | 3300025904 | Bacteria | 1050 |
| 1157 | Ga0207685_10026203 | 3300025905 | Bacteria | 2024 |
| 1158 | Ga0207685_10046253 | 3300025905 | Bacteria | 1655 |
| 1159 | Ga0207685_10054998 | 3300025905 | Unclassified | 1552 |
| 1160 | Ga0207699_10000556 | 3300025906 | Bacteria | 18416 |
| 1161 | Ga0207699_10003478 | 3300025906 | Bacteria | 7518 |
| 1162 | Ga0207699_10028506 | 3300025906 | Bacteria | 3104 |
| 1163 | Ga0207699_10052070 | 3300025906 | Bacteria | 2421 |
| 1164 | Ga0207699_10131141 | 3300025906 | Bacteria | 1635 |
| 1165 | Ga0207699_10169117 | 3300025906 | Bacteria | 1461 |
| 1166 | Ga0207699_10247286 | 3300025906 | Bacteria | 1228 |
| 1167 | Ga0207699_10328435 | 3300025906 | Bacteria | 1075 |
| 1168 | Ga0207699_10395687 | 3300025906 | Unclassified | 983 |
| 1169 | Ga0207699_10535046 | 3300025906 | Bacteria | 849 |
| 1170 | Ga0207699_10550860 | 3300025906 | Bacteria | 836 |
| 1171 | Ga0207699_10653275 | 3300025906 | Bacteria | 768 |
| 1172 | Ga0207699_10795924 | 3300025906 | Bacteria | 695 |
| 1173 | Ga0207699_10974849 | 3300025906 | Unclassified | 626 |
| 1174 | Ga0207699_11360676 | 3300025906 | Unclassified | 525 |
| 1175 | Ga0207645_10002790 | 3300025907 | Bacteria | 13600 |
| 1176 | Ga0207645_10013861 | 3300025907 | Bacteria | 5409 |
| 1177 | Ga0207645_10089272 | 3300025907 | Bacteria | 1982 |
| 1178 | Ga0207645_10095633 | 3300025907 | Bacteria | 1913 |
| 1179 | Ga0207645_10371457 | 3300025907 | Bacteria | 959 |
| 1180 | Ga0207643_10000928 | 3300025908 | Bacteria | 17570 |
| 1181 | Ga0207643_10162239 | 3300025908 | Bacteria | 1345 |
| 1182 | Ga0207643_10187176 | 3300025908 | Bacteria | 1255 |
| 1183 | Ga0207705_10179141 | 3300025909 | Bacteria | 1599 |
| 1184 | Ga0207705_10529067 | 3300025909 | Bacteria | 916 |
| 1185 | Ga0207684_10000274 | 3300025910 | Bacteria | 76497 |
| 1186 | Ga0207684_10000383 | 3300025910 | Bacteria | 59620 |
| 1187 | Ga0207684_10003435 | 3300025910 | Bacteria | 15464 |
| 1188 | Ga0207684_10003824 | 3300025910 | Bacteria | 14503 |
| 1189 | Ga0207684_10013210 | 3300025910 | Bacteria | 7147 |
| 1190 | Ga0207684_10150842 | 3300025910 | Bacteria | 2000 |
| 1191 | Ga0207684_10197581 | 3300025910 | Bacteria | 1735 |
| 1192 | Ga0207684_10711199 | 3300025910 | Unclassified | 853 |
| 1193 | Ga0207684_10856164 | 3300025910 | Bacteria | 766 |
| 1194 | Ga0207684_10907632 | 3300025910 | Bacteria | 740 |
| 1195 | Ga0207684_10937339 | 3300025910 | Bacteria | 726 |
| 1196 | Ga0207654_10003606 | 3300025911 | Bacteria | 7812 |
| 1197 | Ga0207654_10008365 | 3300025911 | Bacteria | 5228 |
| 1198 | Ga0207654_10014332 | 3300025911 | Bacteria | 4096 |
| 1199 | Ga0207654_10017010 | 3300025911 | Bacteria | 3795 |
| 1200 | Ga0207654_10032108 | 3300025911 | Bacteria | 2898 |
| 1201 | Ga0207654_10043207 | 3300025911 | Bacteria | 2554 |
| 1202 | Ga0207654_10060143 | 3300025911 | Unclassified | 2219 |
| 1203 | Ga0207654_10097311 | 3300025911 | Bacteria | 1807 |
| 1204 | Ga0207654_10100694 | 3300025911 | Unclassified | 1780 |
| 1205 | Ga0207654_10253004 | 3300025911 | Bacteria | 1182 |
| 1206 | Ga0207707_10000479 | 3300025912 | Bacteria | 41436 |
| 1207 | Ga0207707_10008797 | 3300025912 | Bacteria | 8762 |
| 1208 | Ga0207707_10021477 | 3300025912 | Bacteria | 5643 |
| 1209 | Ga0207707_10034359 | 3300025912 | Bacteria | 4436 |
| 1210 | Ga0207707_10035532 | 3300025912 | Bacteria | 4357 |
| 1211 | Ga0207707_10078779 | 3300025912 | Bacteria | 2878 |
| 1212 | Ga0207707_10080729 | 3300025912 | Bacteria | 2840 |
| 1213 | Ga0207707_10309375 | 3300025912 | Unclassified | 1365 |
| 1214 | Ga0207707_10409363 | 3300025912 | Unclassified | 1164 |
| 1215 | Ga0207707_10409795 | 3300025912 | Unclassified | 1163 |
| 1216 | Ga0207707_10419830 | 3300025912 | Bacteria | 1147 |
| 1217 | Ga0207695_10004679 | 3300025913 | Bacteria | 18538 |
| 1218 | Ga0207695_10019767 | 3300025913 | Bacteria | 7743 |
| 1219 | Ga0207695_10075734 | 3300025913 | Unclassified | 3423 |
| 1220 | Ga0207695_10117291 | 3300025913 | Bacteria | 2635 |
| 1221 | Ga0207695_10235323 | 3300025913 | Bacteria | 1734 |
| 1222 | Ga0207695_10254606 | 3300025913 | Bacteria | 1654 |
| 1223 | Ga0207695_10405336 | 3300025913 | Unclassified | 1248 |
| 1224 | Ga0207695_11337049 | 3300025913 | Unclassified | 597 |
| 1225 | Ga0207671_10075337 | 3300025914 | Bacteria | 2523 |
| 1226 | Ga0207671_10083169 | 3300025914 | Bacteria | 2403 |
| 1227 | Ga0207671_10086889 | 3300025914 | Bacteria | 2351 |
| 1228 | Ga0207671_10118872 | 3300025914 | Bacteria | 2019 |
| 1229 | Ga0207671_10262791 | 3300025914 | Bacteria | 1358 |
| 1230 | Ga0207671_10611268 | 3300025914 | Bacteria | 869 |
| 1231 | Ga0207671_10693801 | 3300025914 | Bacteria | 810 |
| 1232 | Ga0207693_10000121 | 3300025915 | Bacteria | 69495 |
| 1233 | Ga0207693_10000187 | 3300025915 | Bacteria | 56636 |
| 1234 | Ga0207693_10000204 | 3300025915 | Bacteria | 54264 |
| 1235 | Ga0207693_10000268 | 3300025915 | Bacteria | 48018 |
| 1236 | Ga0207693_10002043 | 3300025915 | Bacteria | 17694 |
| 1237 | Ga0207693_10005199 | 3300025915 | Bacteria | 10895 |
| 1238 | Ga0207693_10007003 | 3300025915 | Bacteria | 9315 |
| 1239 | Ga0207693_10008027 | 3300025915 | Bacteria | 8667 |
| 1240 | Ga0207693_10021770 | 3300025915 | Bacteria | 5097 |
| 1241 | Ga0207693_10034963 | 3300025915 | Bacteria | 3964 |
| 1242 | Ga0207693_10045505 | 3300025915 | Unclassified | 3449 |
| 1243 | Ga0207693_10061906 | 3300025915 | Bacteria | 2931 |
| 1244 | Ga0207693_10064769 | 3300025915 | Bacteria | 2862 |
| 1245 | Ga0207693_10067871 | 3300025915 | Bacteria | 2792 |
| 1246 | Ga0207693_10068545 | 3300025915 | Unclassified | 2776 |
| 1247 | Ga0207693_10098700 | 3300025915 | Bacteria | 2290 |
| 1248 | Ga0207693_10230545 | 3300025915 | Bacteria | 1454 |
| 1249 | Ga0207693_10246047 | 3300025915 | Bacteria | 1404 |
| 1250 | Ga0207693_10306322 | 3300025915 | Bacteria | 1244 |
| 1251 | Ga0207693_10385706 | 3300025915 | Bacteria | 1096 |
| 1252 | Ga0207693_10506567 | 3300025915 | Bacteria | 942 |
| 1253 | Ga0207693_10684566 | 3300025915 | Unclassified | 795 |
| 1254 | Ga0207693_10893764 | 3300025915 | Bacteria | 682 |
| 1255 | Ga0207693_11090953 | 3300025915 | Bacteria | 607 |
| 1256 | Ga0207663_10003935 | 3300025916 | Bacteria | 7349 |
| 1257 | Ga0207663_10009060 | 3300025916 | Bacteria | 5241 |
| 1258 | Ga0207663_10012361 | 3300025916 | Bacteria | 4614 |
| 1259 | Ga0207663_10014515 | 3300025916 | Bacteria | 4316 |
| 1260 | Ga0207663_10015574 | 3300025916 | Bacteria | 4199 |
| 1261 | Ga0207663_10053182 | 3300025916 | Bacteria | 2529 |
| 1262 | Ga0207663_10108458 | 3300025916 | Bacteria | 1880 |
| 1263 | Ga0207663_10149130 | 3300025916 | Bacteria | 1638 |
| 1264 | Ga0207663_10174466 | 3300025916 | Bacteria | 1530 |
| 1265 | Ga0207663_10291507 | 3300025916 | Bacteria | 1216 |
| 1266 | Ga0207663_10388614 | 3300025916 | Unclassified | 1064 |
| 1267 | Ga0207663_10498119 | 3300025916 | Unclassified | 946 |
| 1268 | Ga0207660_10054923 | 3300025917 | Bacteria | 2844 |
| 1269 | Ga0207660_10069221 | 3300025917 | Unclassified | 2562 |
| 1270 | Ga0207660_10088172 | 3300025917 | Bacteria | 2294 |
| 1271 | Ga0207660_10089064 | 3300025917 | Bacteria | 2284 |
| 1272 | Ga0207660_10234318 | 3300025917 | Bacteria | 1444 |
| 1273 | Ga0207660_10387130 | 3300025917 | Bacteria | 1125 |
| 1274 | Ga0207660_10549454 | 3300025917 | Bacteria | 939 |
| 1275 | Ga0207657_10002968 | 3300025919 | Bacteria | 18190 |
| 1276 | Ga0207657_10062196 | 3300025919 | Bacteria | 3197 |
| 1277 | Ga0207649_10000349 | 3300025920 | Bacteria | 34894 |
| 1278 | Ga0207649_10011591 | 3300025920 | Bacteria | 4865 |
| 1279 | Ga0207649_10070582 | 3300025920 | Bacteria | 2228 |
| 1280 | Ga0207649_10171795 | 3300025920 | Unclassified | 1510 |
| 1281 | Ga0207649_10807425 | 3300025920 | Unclassified | 732 |
| 1282 | Ga0207649_10939534 | 3300025920 | Bacteria | 679 |
| 1283 | Ga0207652_10003809 | 3300025921 | Bacteria | 12364 |
| 1284 | Ga0207652_10109677 | 3300025921 | Bacteria | 2447 |
| 1285 | Ga0207652_10135571 | 3300025921 | Bacteria | 2198 |
| 1286 | Ga0207652_10158205 | 3300025921 | Bacteria | 2030 |
| 1287 | Ga0207652_10158494 | 3300025921 | Bacteria | 2028 |
| 1288 | Ga0207652_10305402 | 3300025921 | Bacteria | 1436 |
| 1289 | Ga0207652_10408692 | 3300025921 | Bacteria | 1225 |
| 1290 | Ga0207652_10541816 | 3300025921 | Bacteria | 1046 |
| 1291 | Ga0207652_10727257 | 3300025921 | Unclassified | 884 |
| 1292 | Ga0207646_10000229 | 3300025922 | Bacteria | 77035 |
| 1293 | Ga0207646_10000240 | 3300025922 | Bacteria | 75609 |
| 1294 | Ga0207646_10044631 | 3300025922 | Unclassified | 3979 |
| 1295 | Ga0207646_10046578 | 3300025922 | Bacteria | 3890 |
| 1296 | Ga0207646_10057735 | 3300025922 | Bacteria | 3468 |
| 1297 | Ga0207646_10085901 | 3300025922 | Bacteria | 2814 |
| 1298 | Ga0207646_10128216 | 3300025922 | Bacteria | 2282 |
| 1299 | Ga0207646_10159864 | 3300025922 | Bacteria | 2032 |
| 1300 | Ga0207646_10236349 | 3300025922 | Bacteria | 1651 |
| 1301 | Ga0207646_10255937 | 3300025922 | Bacteria | 1582 |
| 1302 | Ga0207646_10298918 | 3300025922 | Unclassified | 1454 |
| 1303 | Ga0207646_10369849 | 3300025922 | Bacteria | 1295 |
| 1304 | Ga0207646_10415702 | 3300025922 | Unclassified | 1214 |
| 1305 | Ga0207646_10515480 | 3300025922 | Bacteria | 1077 |
| 1306 | Ga0207646_10680670 | 3300025922 | Unclassified | 920 |
| 1307 | Ga0207646_10855972 | 3300025922 | Bacteria | 808 |
| 1308 | Ga0207646_10882243 | 3300025922 | Bacteria | 794 |
| 1309 | Ga0207646_11057775 | 3300025922 | Bacteria | 715 |
| 1310 | Ga0207681_10014793 | 3300025923 | Bacteria | 4858 |
| 1311 | Ga0207681_10221319 | 3300025923 | Bacteria | 1464 |
| 1312 | Ga0207681_10361278 | 3300025923 | Unclassified | 1165 |
| 1313 | Ga0207694_10002906 | 3300025924 | Bacteria | 13785 |
| 1314 | Ga0207694_10004143 | 3300025924 | Bacteria | 11387 |
| 1315 | Ga0207694_10052740 | 3300025924 | Bacteria | 3153 |
| 1316 | Ga0207694_10116914 | 3300025924 | Bacteria | 2125 |
| 1317 | Ga0207694_10155653 | 3300025924 | Bacteria | 1843 |
| 1318 | Ga0207694_10318085 | 3300025924 | Bacteria | 1284 |
| 1319 | Ga0207694_10440321 | 3300025924 | Bacteria | 1087 |
| 1320 | Ga0207694_10763210 | 3300025924 | Bacteria | 816 |
| 1321 | Ga0207694_10775602 | 3300025924 | Bacteria | 810 |
| 1322 | Ga0207650_10000104 | 3300025925 | Bacteria | 111268 |
| 1323 | Ga0207650_10008455 | 3300025925 | Bacteria | 7028 |
| 1324 | Ga0207650_10337877 | 3300025925 | Unclassified | 1236 |
| 1325 | Ga0207650_10621598 | 3300025925 | Bacteria | 909 |
| 1326 | Ga0207650_11183854 | 3300025925 | Unclassified | 651 |
| 1327 | Ga0207659_10013254 | 3300025926 | Bacteria | 5273 |
| 1328 | Ga0207659_10087080 | 3300025926 | Bacteria | 2324 |
| 1329 | Ga0207659_10244531 | 3300025926 | Bacteria | 1453 |
| 1330 | Ga0207659_10295690 | 3300025926 | Unclassified | 1328 |
| 1331 | Ga0207659_10526408 | 3300025926 | Bacteria | 1003 |
| 1332 | Ga0207687_10001100 | 3300025927 | Bacteria | 18374 |
| 1333 | Ga0207687_10012648 | 3300025927 | Bacteria | 5514 |
| 1334 | Ga0207687_10030137 | 3300025927 | Unclassified | 3655 |
| 1335 | Ga0207687_10082531 | 3300025927 | Bacteria | 2326 |
| 1336 | Ga0207687_10108967 | 3300025927 | Bacteria | 2051 |
| 1337 | Ga0207687_10202918 | 3300025927 | Bacteria | 1551 |
| 1338 | Ga0207687_10251635 | 3300025927 | Bacteria | 1405 |
| 1339 | Ga0207687_10299649 | 3300025927 | Bacteria | 1294 |
| 1340 | Ga0207687_10610907 | 3300025927 | Bacteria | 920 |
| 1341 | Ga0207687_10738437 | 3300025927 | Unclassified | 837 |
| 1342 | Ga0207700_10000064 | 3300025928 | Bacteria | 65512 |
| 1343 | Ga0207700_10003344 | 3300025928 | Bacteria | 9299 |
| 1344 | Ga0207700_10023819 | 3300025928 | Bacteria | 4230 |
| 1345 | Ga0207700_10027658 | 3300025928 | Bacteria | 3975 |
| 1346 | Ga0207700_10037210 | 3300025928 | Bacteria | 3522 |
| 1347 | Ga0207700_10060705 | 3300025928 | Bacteria | 2864 |
| 1348 | Ga0207700_10066784 | 3300025928 | Unclassified | 2750 |
| 1349 | Ga0207700_10067742 | 3300025928 | Bacteria | 2734 |
| 1350 | Ga0207700_10139398 | 3300025928 | Bacteria | 1991 |
| 1351 | Ga0207700_10155052 | 3300025928 | Unclassified | 1897 |
| 1352 | Ga0207700_10209102 | 3300025928 | Bacteria | 1648 |
| 1353 | Ga0207700_10257144 | 3300025928 | Bacteria | 1494 |
| 1354 | Ga0207700_10262558 | 3300025928 | Bacteria | 1479 |
| 1355 | Ga0207700_10286965 | 3300025928 | Unclassified | 1417 |
| 1356 | Ga0207700_10376791 | 3300025928 | Bacteria | 1240 |
| 1357 | Ga0207700_10392253 | 3300025928 | Bacteria | 1215 |
| 1358 | Ga0207700_10554989 | 3300025928 | Unclassified | 1020 |
| 1359 | Ga0207700_10565870 | 3300025928 | Unclassified | 1010 |
| 1360 | Ga0207700_10578027 | 3300025928 | Unclassified | 999 |
| 1361 | Ga0207700_10582115 | 3300025928 | Unclassified | 995 |
| 1362 | Ga0207700_10603792 | 3300025928 | Unclassified | 977 |
| 1363 | Ga0207700_10632881 | 3300025928 | Unclassified | 953 |
| 1364 | Ga0207700_10669988 | 3300025928 | Unclassified | 925 |
| 1365 | Ga0207700_10679607 | 3300025928 | Unclassified | 918 |
| 1366 | Ga0207700_10722522 | 3300025928 | Bacteria | 890 |
| 1367 | Ga0207700_10724579 | 3300025928 | Unclassified | 888 |
| 1368 | Ga0207700_10777840 | 3300025928 | Unclassified | 856 |
| 1369 | Ga0207700_10780569 | 3300025928 | Bacteria | 854 |
| 1370 | Ga0207700_10849345 | 3300025928 | Unclassified | 817 |
| 1371 | Ga0207700_11081718 | 3300025928 | Unclassified | 717 |
| 1372 | Ga0207700_11135980 | 3300025928 | Unclassified | 698 |
| 1373 | Ga0207700_11672568 | 3300025928 | Bacteria | 562 |
| 1374 | Ga0207664_10000086 | 3300025929 | Bacteria | 89769 |
| 1375 | Ga0207664_10021010 | 3300025929 | Bacteria | 4845 |
| 1376 | Ga0207664_10056601 | 3300025929 | Bacteria | 3114 |
| 1377 | Ga0207664_10068590 | 3300025929 | Bacteria | 2849 |
| 1378 | Ga0207664_10079803 | 3300025929 | Bacteria | 2658 |
| 1379 | Ga0207664_10109332 | 3300025929 | Bacteria | 2297 |
| 1380 | Ga0207664_10268603 | 3300025929 | Unclassified | 1494 |
| 1381 | Ga0207664_10317277 | 3300025929 | Bacteria | 1375 |
| 1382 | Ga0207664_10334143 | 3300025929 | Bacteria | 1339 |
| 1383 | Ga0207664_10343361 | 3300025929 | Bacteria | 1320 |
| 1384 | Ga0207664_10404931 | 3300025929 | Unclassified | 1214 |
| 1385 | Ga0207664_10411831 | 3300025929 | Unclassified | 1203 |
| 1386 | Ga0207664_10868868 | 3300025929 | Bacteria | 810 |
| 1387 | Ga0207664_11104282 | 3300025929 | Bacteria | 709 |
| 1388 | Ga0207664_11349142 | 3300025929 | Unclassified | 633 |
| 1389 | Ga0207664_11502492 | 3300025929 | Unclassified | 595 |
| 1390 | Ga0207664_11746338 | 3300025929 | Unclassified | 545 |
| 1391 | Ga0207644_10055757 | 3300025931 | Bacteria | 2849 |
| 1392 | Ga0207644_10230824 | 3300025931 | Bacteria | 1470 |
| 1393 | Ga0207644_10840605 | 3300025931 | Bacteria | 768 |
| 1394 | Ga0207690_10144065 | 3300025932 | Bacteria | 1759 |
| 1395 | Ga0207690_10167704 | 3300025932 | Bacteria | 1642 |
| 1396 | Ga0207690_10344940 | 3300025932 | Bacteria | 1176 |
| 1397 | Ga0207690_11023767 | 3300025932 | Bacteria | 687 |
| 1398 | Ga0207690_11594604 | 3300025932 | Unclassified | 545 |
| 1399 | Ga0207706_10000880 | 3300025933 | Bacteria | 30836 |
| 1400 | Ga0207706_10003401 | 3300025933 | Bacteria | 15198 |
| 1401 | Ga0207706_10068202 | 3300025933 | Bacteria | 3130 |
| 1402 | Ga0207706_10103438 | 3300025933 | Bacteria | 2505 |
| 1403 | Ga0207706_10287030 | 3300025933 | Bacteria | 1435 |
| 1404 | Ga0207706_10836725 | 3300025933 | Unclassified | 780 |
| 1405 | Ga0207686_10031182 | 3300025934 | Bacteria | 3163 |
| 1406 | Ga0207686_10175997 | 3300025934 | Bacteria | 1513 |
| 1407 | Ga0207686_10312097 | 3300025934 | Bacteria | 1172 |
| 1408 | Ga0207686_10318805 | 3300025934 | Bacteria | 1161 |
| 1409 | Ga0207686_10387757 | 3300025934 | Bacteria | 1061 |
| 1410 | Ga0207686_10508602 | 3300025934 | Bacteria | 936 |
| 1411 | Ga0207709_10764939 | 3300025935 | Bacteria | 777 |
| 1412 | Ga0207670_10018169 | 3300025936 | Bacteria | 4267 |
| 1413 | Ga0207670_10193382 | 3300025936 | Bacteria | 1541 |
| 1414 | Ga0207670_11117445 | 3300025936 | Bacteria | 666 |
| 1415 | Ga0207669_10049161 | 3300025937 | Bacteria | 2512 |
| 1416 | Ga0207669_10067199 | 3300025937 | Bacteria | 2233 |
| 1417 | Ga0207669_10178716 | 3300025937 | Bacteria | 1519 |
| 1418 | Ga0207669_10271533 | 3300025937 | Bacteria | 1274 |
| 1419 | Ga0207669_10968232 | 3300025937 | Unclassified | 714 |
| 1420 | Ga0207704_10024042 | 3300025938 | Bacteria | 3296 |
| 1421 | Ga0207704_10052608 | 3300025938 | Unclassified | 2469 |
| 1422 | Ga0207704_10092013 | 3300025938 | Bacteria | 1995 |
| 1423 | Ga0207704_10241515 | 3300025938 | Bacteria | 1350 |
| 1424 | Ga0207704_10483583 | 3300025938 | Unclassified | 994 |
| 1425 | Ga0207704_10977233 | 3300025938 | Bacteria | 715 |
| 1426 | Ga0207704_11607387 | 3300025938 | Unclassified | 558 |
| 1427 | Ga0207665_10000061 | 3300025939 | Bacteria | 70024 |
| 1428 | Ga0207665_10000644 | 3300025939 | Bacteria | 23552 |
| 1429 | Ga0207665_10002034 | 3300025939 | Bacteria | 13621 |
| 1430 | Ga0207665_10004612 | 3300025939 | Bacteria | 9152 |
| 1431 | Ga0207665_10010539 | 3300025939 | Bacteria | 6071 |
| 1432 | Ga0207665_10014394 | 3300025939 | Bacteria | 5209 |
| 1433 | Ga0207665_10014395 | 3300025939 | Bacteria | 5209 |
| 1434 | Ga0207665_10016008 | 3300025939 | Bacteria | 4925 |
| 1435 | Ga0207665_10067922 | 3300025939 | Bacteria | 2428 |
| 1436 | Ga0207665_10149186 | 3300025939 | Bacteria | 1673 |
| 1437 | Ga0207665_10177168 | 3300025939 | Unclassified | 1542 |
| 1438 | Ga0207665_10213450 | 3300025939 | Bacteria | 1411 |
| 1439 | Ga0207665_10253799 | 3300025939 | Bacteria | 1300 |
| 1440 | Ga0207665_10501966 | 3300025939 | Bacteria | 937 |
| 1441 | Ga0207665_10583481 | 3300025939 | Unclassified | 871 |
| 1442 | Ga0207665_10655174 | 3300025939 | Bacteria | 823 |
| 1443 | Ga0207665_10851076 | 3300025939 | Unclassified | 722 |
| 1444 | Ga0207691_10000280 | 3300025940 | Bacteria | 50497 |
| 1445 | Ga0207691_10019171 | 3300025940 | Bacteria | 6477 |
| 1446 | Ga0207691_10502496 | 3300025940 | Bacteria | 1030 |
| 1447 | Ga0207691_10633763 | 3300025940 | Unclassified | 904 |
| 1448 | Ga0207711_10001004 | 3300025941 | Bacteria | 27059 |
| 1449 | Ga0207711_10013268 | 3300025941 | Bacteria | 6846 |
| 1450 | Ga0207711_10025020 | 3300025941 | Bacteria | 5008 |
| 1451 | Ga0207711_10042451 | 3300025941 | Bacteria | 3875 |
| 1452 | Ga0207711_10228350 | 3300025941 | Bacteria | 1704 |
| 1453 | Ga0207711_10467363 | 3300025941 | Unclassified | 1175 |
| 1454 | Ga0207689_10003173 | 3300025942 | Bacteria | 15081 |
| 1455 | Ga0207689_10007450 | 3300025942 | Bacteria | 9591 |
| 1456 | Ga0207689_10019778 | 3300025942 | Bacteria | 5672 |
| 1457 | Ga0207689_10027617 | 3300025942 | Bacteria | 4749 |
| 1458 | Ga0207689_10149514 | 3300025942 | Bacteria | 1925 |
| 1459 | Ga0207689_11379009 | 3300025942 | Unclassified | 591 |
| 1460 | Ga0207661_10000869 | 3300025944 | Bacteria | 19833 |
| 1461 | Ga0207661_10040740 | 3300025944 | Bacteria | 3653 |
| 1462 | Ga0207661_10061357 | 3300025944 | Bacteria | 3037 |
| 1463 | Ga0207661_10068509 | 3300025944 | Unclassified | 2890 |
| 1464 | Ga0207661_10471738 | 3300025944 | Unclassified | 1145 |
| 1465 | Ga0207661_10651991 | 3300025944 | Bacteria | 967 |
| 1466 | Ga0207661_11177870 | 3300025944 | Unclassified | 705 |
| 1467 | Ga0207661_11247554 | 3300025944 | Unclassified | 683 |
| 1468 | Ga0207679_10000089 | 3300025945 | Bacteria | 79512 |
| 1469 | Ga0207679_10076974 | 3300025945 | Unclassified | 2536 |
| 1470 | Ga0207679_10098561 | 3300025945 | Bacteria | 2280 |
| 1471 | Ga0207679_10132011 | 3300025945 | Bacteria | 2005 |
| 1472 | Ga0207679_10333464 | 3300025945 | Bacteria | 1317 |
| 1473 | Ga0207679_10759098 | 3300025945 | Bacteria | 882 |
| 1474 | Ga0207667_10001950 | 3300025949 | Bacteria | 25855 |
| 1475 | Ga0207667_10008435 | 3300025949 | Bacteria | 12240 |
| 1476 | Ga0207667_10012807 | 3300025949 | Bacteria | 9635 |
| 1477 | Ga0207667_10049344 | 3300025949 | Bacteria | 4445 |
| 1478 | Ga0207667_10053450 | 3300025949 | Bacteria | 4250 |
| 1479 | Ga0207667_10106220 | 3300025949 | Bacteria | 2896 |
| 1480 | Ga0207667_10107581 | 3300025949 | Bacteria | 2877 |
| 1481 | Ga0207667_10375514 | 3300025949 | Bacteria | 1449 |
| 1482 | Ga0207667_10469133 | 3300025949 | Bacteria | 1278 |
| 1483 | Ga0207667_10536481 | 3300025949 | Unclassified | 1184 |
| 1484 | Ga0207667_10654960 | 3300025949 | Bacteria | 1055 |
| 1485 | Ga0207667_10952378 | 3300025949 | Unclassified | 848 |
| 1486 | Ga0207667_10968355 | 3300025949 | Bacteria | 839 |
| 1487 | Ga0207651_10032281 | 3300025960 | Bacteria | 3361 |
| 1488 | Ga0207651_10199810 | 3300025960 | Bacteria | 1601 |
| 1489 | Ga0207651_11461751 | 3300025960 | Unclassified | 615 |
| 1490 | Ga0207712_10008211 | 3300025961 | Bacteria | 6598 |
| 1491 | Ga0207712_10389207 | 3300025961 | Bacteria | 1169 |
| 1492 | Ga0207712_12118143 | 3300025961 | Unclassified | 503 |
| 1493 | Ga0207668_10062611 | 3300025972 | Bacteria | 2620 |
| 1494 | Ga0207668_10142677 | 3300025972 | Bacteria | 1844 |
| 1495 | Ga0207640_10005064 | 3300025981 | Bacteria | 7171 |
| 1496 | Ga0207640_10037552 | 3300025981 | Bacteria | 3049 |
| 1497 | Ga0207640_10091977 | 3300025981 | Bacteria | 2103 |
| 1498 | Ga0207640_10114901 | 3300025981 | Unclassified | 1916 |
| 1499 | Ga0207640_10514553 | 3300025981 | Bacteria | 999 |
| 1500 | Ga0207640_11113873 | 3300025981 | Unclassified | 699 |
| 1501 | Ga0207658_10266994 | 3300025986 | Bacteria | 1461 |
| 1502 | Ga0207658_10315047 | 3300025986 | Unclassified | 1352 |
| 1503 | Ga0207658_10546186 | 3300025986 | Bacteria | 1036 |
| 1504 | Ga0207658_10847366 | 3300025986 | Unclassified | 831 |
| 1505 | Ga0207677_10001630 | 3300026023 | Bacteria | 11916 |
| 1506 | Ga0207677_10002011 | 3300026023 | Bacteria | 10724 |
| 1507 | Ga0207677_10005802 | 3300026023 | Bacteria | 6717 |
| 1508 | Ga0207677_10009433 | 3300026023 | Bacteria | 5494 |
| 1509 | Ga0207677_10014013 | 3300026023 | Unclassified | 4666 |
| 1510 | Ga0207677_10016609 | 3300026023 | Bacteria | 4365 |
| 1511 | Ga0207677_10036531 | 3300026023 | Bacteria | 3203 |
| 1512 | Ga0207677_10051327 | 3300026023 | Bacteria | 2796 |
| 1513 | Ga0207677_10079159 | 3300026023 | Bacteria | 2349 |
| 1514 | Ga0207677_10270822 | 3300026023 | Bacteria | 1389 |
| 1515 | Ga0207677_10304266 | 3300026023 | Unclassified | 1318 |
| 1516 | Ga0207677_10738684 | 3300026023 | Unclassified | 876 |
| 1517 | Ga0207677_11123477 | 3300026023 | Bacteria | 717 |
| 1518 | Ga0207703_10004581 | 3300026035 | Bacteria | 11329 |
| 1519 | Ga0207703_10005202 | 3300026035 | Bacteria | 10517 |
| 1520 | Ga0207703_10011631 | 3300026035 | Bacteria | 6842 |
| 1521 | Ga0207703_10027012 | 3300026035 | Unclassified | 4521 |
| 1522 | Ga0207703_10030655 | 3300026035 | Bacteria | 4251 |
| 1523 | Ga0207703_10044458 | 3300026035 | Plasmid | 3570 |
| 1524 | Ga0207703_10047169 | 3300026035 | Bacteria | 3473 |
| 1525 | Ga0207703_10089227 | 3300026035 | Bacteria | 2589 |
| 1526 | Ga0207703_11213281 | 3300026035 | Archaea | 725 |
| 1527 | Ga0207639_10054676 | 3300026041 | Bacteria | 3052 |
| 1528 | Ga0207639_10197587 | 3300026041 | Bacteria | 1722 |
| 1529 | Ga0207639_10202061 | 3300026041 | Bacteria | 1705 |
| 1530 | Ga0207639_10373302 | 3300026041 | Bacteria | 1279 |
| 1531 | Ga0207639_10451333 | 3300026041 | Unclassified | 1167 |
| 1532 | Ga0207639_10876233 | 3300026041 | Unclassified | 838 |
| 1533 | Ga0207639_10923359 | 3300026041 | Unclassified | 816 |
| 1534 | Ga0207639_10973471 | 3300026041 | Bacteria | 794 |
| 1535 | Ga0207678_10001258 | 3300026067 | Bacteria | 23384 |
| 1536 | Ga0207678_10005442 | 3300026067 | Bacteria | 11392 |
| 1537 | Ga0207678_10393753 | 3300026067 | Bacteria | 1199 |
| 1538 | Ga0207708_10116375 | 3300026075 | Bacteria | 2080 |
| 1539 | Ga0207708_10869681 | 3300026075 | Unclassified | 779 |
| 1540 | Ga0207702_10000150 | 3300026078 | Bacteria | 81496 |
| 1541 | Ga0207702_10000962 | 3300026078 | Bacteria | 29642 |
| 1542 | Ga0207702_10000989 | 3300026078 | Bacteria | 29131 |
| 1543 | Ga0207702_10001145 | 3300026078 | Bacteria | 27111 |
| 1544 | Ga0207702_10003770 | 3300026078 | Bacteria | 13690 |
| 1545 | Ga0207702_10009489 | 3300026078 | Bacteria | 8176 |
| 1546 | Ga0207702_10017829 | 3300026078 | Bacteria | 5878 |
| 1547 | Ga0207702_10020248 | 3300026078 | Bacteria | 5511 |
| 1548 | Ga0207702_10055616 | 3300026078 | Bacteria | 3356 |
| 1549 | Ga0207702_10070610 | 3300026078 | Unclassified | 3004 |
| 1550 | Ga0207702_10165647 | 3300026078 | Bacteria | 2022 |
| 1551 | Ga0207702_10180807 | 3300026078 | Bacteria | 1942 |
| 1552 | Ga0207702_10316519 | 3300026078 | Bacteria | 1485 |
| 1553 | Ga0207702_11040013 | 3300026078 | Bacteria | 813 |
| 1554 | Ga0207702_11488751 | 3300026078 | Unclassified | 670 |
| 1555 | Ga0207641_10000020 | 3300026088 | Bacteria | 286415 |
| 1556 | Ga0207641_10002104 | 3300026088 | Bacteria | 18817 |
| 1557 | Ga0207641_10031762 | 3300026088 | Bacteria | 4381 |
| 1558 | Ga0207641_10038990 | 3300026088 | Bacteria | 3973 |
| 1559 | Ga0207641_10051991 | 3300026088 | Bacteria | 3469 |
| 1560 | Ga0207641_10140422 | 3300026088 | Bacteria | 2179 |
| 1561 | Ga0207641_10389539 | 3300026088 | Bacteria | 1336 |
| 1562 | Ga0207641_10733180 | 3300026088 | Unclassified | 975 |
| 1563 | Ga0207641_11339885 | 3300026088 | Unclassified | 716 |
| 1564 | Ga0207641_11455863 | 3300026088 | Unclassified | 686 |
| 1565 | Ga0207648_10003740 | 3300026089 | Bacteria | 15909 |
| 1566 | Ga0207648_10007359 | 3300026089 | Bacteria | 10839 |
| 1567 | Ga0207648_10012154 | 3300026089 | Bacteria | 8068 |
| 1568 | Ga0207648_10018733 | 3300026089 | Bacteria | 6260 |
| 1569 | Ga0207648_10051316 | 3300026089 | Unclassified | 3605 |
| 1570 | Ga0207648_10129412 | 3300026089 | Bacteria | 2222 |
| 1571 | Ga0207648_10147488 | 3300026089 | Bacteria | 2075 |
| 1572 | Ga0207648_10149221 | 3300026089 | Bacteria | 2063 |
| 1573 | Ga0207648_10268893 | 3300026089 | Bacteria | 1522 |
| 1574 | Ga0207648_10668015 | 3300026089 | Bacteria | 961 |
| 1575 | Ga0207676_10000108 | 3300026095 | Bacteria | 74129 |
| 1576 | Ga0207676_10011432 | 3300026095 | Bacteria | 6344 |
| 1577 | Ga0207676_10046865 | 3300026095 | Bacteria | 3347 |
| 1578 | Ga0207676_10051851 | 3300026095 | Bacteria | 3205 |
| 1579 | Ga0207676_10717111 | 3300026095 | Unclassified | 970 |
| 1580 | Ga0207676_10836942 | 3300026095 | Bacteria | 899 |
| 1581 | Ga0207676_11403199 | 3300026095 | Unclassified | 694 |
| 1582 | Ga0207674_10000512 | 3300026116 | Bacteria | 50807 |
| 1583 | Ga0207674_10000867 | 3300026116 | Bacteria | 39599 |
| 1584 | Ga0207674_10003236 | 3300026116 | Bacteria | 20046 |
| 1585 | Ga0207674_10012313 | 3300026116 | Bacteria | 9564 |
| 1586 | Ga0207674_10032234 | 3300026116 | Bacteria | 5498 |
| 1587 | Ga0207674_10058525 | 3300026116 | Bacteria | 3903 |
| 1588 | Ga0207674_10065236 | 3300026116 | Bacteria | 3671 |
| 1589 | Ga0207674_10100496 | 3300026116 | Bacteria | 2874 |
| 1590 | Ga0207674_10345228 | 3300026116 | Bacteria | 1439 |
| 1591 | Ga0207674_10358184 | 3300026116 | Bacteria | 1410 |
| 1592 | Ga0207675_100027917 | 3300026118 | Bacteria | 5256 |
| 1593 | Ga0207675_100032646 | 3300026118 | Bacteria | 4849 |
| 1594 | Ga0207675_100382341 | 3300026118 | Bacteria | 1385 |
| 1595 | Ga0207683_10000338 | 3300026121 | Bacteria | 42662 |
| 1596 | Ga0207683_10021015 | 3300026121 | Bacteria | 5586 |
| 1597 | Ga0207683_10093104 | 3300026121 | Bacteria | 2685 |
| 1598 | Ga0207683_10221220 | 3300026121 | Unclassified | 1725 |
| 1599 | Ga0207683_10805691 | 3300026121 | Bacteria | 872 |
| 1600 | Ga0207683_11040461 | 3300026121 | Unclassified | 760 |
| 1601 | Ga0207698_10014736 | 3300026142 | Bacteria | 5208 |
| 1602 | Ga0207698_10037545 | 3300026142 | Bacteria | 3569 |
| 1603 | Ga0207698_10088714 | 3300026142 | Bacteria | 2523 |
| 1604 | Ga0207698_10100426 | 3300026142 | Bacteria | 2396 |
| 1605 | Ga0207698_10106264 | 3300026142 | Bacteria | 2341 |
| 1606 | Ga0207698_10744112 | 3300026142 | Bacteria | 979 |
| 1607 | Ga0207698_10884004 | 3300026142 | Unclassified | 900 |
| 1608 | Ga0207698_11345984 | 3300026142 | Unclassified | 729 |
| 1609 | Ga0265354_1009212 | 3300028016 | Bacteria | 950 |
| 1610 | Ga0265356_1000074 | 3300028017 | Bacteria | 16319 |
| 1611 | Ga0265356_1001335 | 3300028017 | Bacteria | 3677 |
| 1612 | Ga0265357_1007736 | 3300028023 | Unclassified | 1043 |
| 1613 | Ga0265355_1000278 | 3300028036 | Bacteria | 2453 |
| 1614 | Ga0268266_10025416 | 3300028379 | Bacteria | 5038 |
| 1615 | Ga0268266_10034228 | 3300028379 | Bacteria | 4320 |
| 1616 | Ga0268266_10620263 | 3300028379 | Bacteria | 1039 |
| 1617 | Ga0268266_10653343 | 3300028379 | Unclassified | 1012 |
| 1618 | Ga0268265_10007698 | 3300028380 | Bacteria | 7267 |
| 1619 | Ga0268265_10113922 | 3300028380 | Bacteria | 2213 |
| 1620 | Ga0268265_10303650 | 3300028380 | Unclassified | 1438 |
| 1621 | Ga0268265_10518643 | 3300028380 | Bacteria | 1126 |
| 1622 | Ga0268264_10023614 | 3300028381 | Bacteria | 5014 |
| 1623 | Ga0268264_10033663 | 3300028381 | Bacteria | 4212 |
| 1624 | Ga0268264_10040450 | 3300028381 | Unclassified | 3852 |
| 1625 | Ga0268264_10100512 | 3300028381 | Unclassified | 2512 |
| 1626 | Ga0268264_10106886 | 3300028381 | Unclassified | 2444 |
| 1627 | Ga0268264_10170313 | 3300028381 | Bacteria | 1969 |
| 1628 | Ga0268264_10218932 | 3300028381 | Bacteria | 1752 |
| 1629 | Ga0268264_10283254 | 3300028381 | Bacteria | 1553 |
| 1630 | Ga0268264_10412770 | 3300028381 | Unclassified | 1300 |
| 1631 | Ga0268264_10442144 | 3300028381 | Bacteria | 1258 |
| 1632 | Ga0268264_10465965 | 3300028381 | Bacteria | 1227 |
| 1633 | Ga0268264_10474394 | 3300028381 | Unclassified | 1216 |
| 1634 | Ga0268264_10618221 | 3300028381 | Unclassified | 1069 |
| 1635 | Ga0265338_10004755 | 3300028800 | Bacteria | 18166 |
| 1636 | Ga0265338_10012193 | 3300028800 | Bacteria | 9817 |
| 1637 | Ga0265338_10016288 | 3300028800 | Bacteria | 8099 |
| 1638 | Ga0265338_10130123 | 3300028800 | Bacteria | 1989 |
| 1639 | Ga0265338_10191619 | 3300028800 | Bacteria | 1549 |
| 1640 | Ga0265338_10201686 | 3300028800 | Bacteria | 1500 |
| 1641 | Ga0265338_10469426 | 3300028800 | Bacteria | 889 |
| 1642 | Ga0265762_1000242 | 3300030760 | Bacteria | 8878 |
| 1643 | Ga0265762_1008848 | 3300030760 | Bacteria | 1792 |
| 1644 | Ga0265762_1011729 | 3300030760 | Unclassified | 1567 |
| 1645 | Ga0265762_1023395 | 3300030760 | Bacteria | 1145 |
| 1646 | Ga0265762_1116552 | 3300030760 | Unclassified | 607 |
| 1647 | Ga0265775_109253 | 3300030762 | Bacteria | 608 |
| 1648 | Ga0265763_1016284 | 3300030763 | Unclassified | 745 |
| 1649 | Ga0265763_1018385 | 3300030763 | Unclassified | 716 |
| 1650 | Ga0265763_1019234 | 3300030763 | Bacteria | 706 |
| 1651 | Ga0265767_111050 | 3300030836 | Unclassified | 609 |
| 1652 | Ga0265777_102620 | 3300030877 | Unclassified | 1054 |
| 1653 | Ga0265777_105107 | 3300030877 | Unclassified | 858 |
| 1654 | Ga0265777_111016 | 3300030877 | Bacteria | 668 |
| 1655 | Ga0265777_113084 | 3300030877 | Unclassified | 630 |
| 1656 | Ga0265777_115292 | 3300030877 | Bacteria | 598 |
| 1657 | Ga0265777_115937 | 3300030877 | Unclassified | 590 |
| 1658 | Ga0265777_117193 | 3300030877 | Bacteria | 576 |
| 1659 | Ga0265765_1008932 | 3300030879 | Bacteria | 1097 |
| 1660 | Ga0265776_107676 | 3300030880 | Unclassified | 600 |
| 1661 | Ga0265776_108481 | 3300030880 | Unclassified | 585 |
| 1662 | Ga0265764_110209 | 3300030882 | Bacteria | 589 |
| 1663 | Ga0265764_110589 | 3300030882 | Unclassified | 584 |
| 1664 | Ga0265764_112725 | 3300030882 | Bacteria | 556 |
| 1665 | Ga0265769_116398 | 3300030888 | Bacteria | 559 |
| 1666 | Ga0265761_100689 | 3300030889 | Bacteria | 1341 |
| 1667 | Ga0265761_107450 | 3300030889 | Unclassified | 598 |
| 1668 | Ga0265761_107556 | 3300030889 | Unclassified | 595 |
| 1669 | Ga0265779_100488 | 3300031043 | Bacteria | 1485 |
| 1670 | Ga0265779_105062 | 3300031043 | Bacteria | 716 |
| 1671 | Ga0265779_108500 | 3300031043 | Bacteria | 601 |
| 1672 | Ga0265779_108718 | 3300031043 | Bacteria | 596 |
| 1673 | Ga0265760_10000259 | 3300031090 | Bacteria | 14542 |
| 1674 | Ga0265760_10001901 | 3300031090 | Bacteria | 6129 |
| 1675 | Ga0265760_10005311 | 3300031090 | Bacteria | 3693 |
| 1676 | Ga0265760_10009290 | 3300031090 | Bacteria | 2809 |
| 1677 | Ga0265760_10016102 | 3300031090 | Bacteria | 2144 |
| 1678 | Ga0265760_10028325 | 3300031090 | Bacteria | 1643 |
| 1679 | Ga0265760_10034633 | 3300031090 | Bacteria | 1494 |
| 1680 | Ga0265760_10043719 | 3300031090 | Bacteria | 1339 |
| 1681 | Ga0265760_10068076 | 3300031090 | Bacteria | 1089 |
| 1682 | Ga0265760_10090605 | 3300031090 | Unclassified | 957 |
| 1683 | Ga0265760_10125953 | 3300031090 | Unclassified | 826 |
| 1684 | Ga0265760_10147917 | 3300031090 | Bacteria | 769 |
| 1685 | Ga0265760_10151581 | 3300031090 | Bacteria | 761 |
| 1686 | Ga0265760_10272870 | 3300031090 | Bacteria | 592 |
| 1687 | Ga0265760_10290404 | 3300031090 | Bacteria | 577 |
| 1688 | Ga0265760_10301800 | 3300031090 | Bacteria | 567 |
| 1689 | Ga0265330_10003490 | 3300031235 | Bacteria | 8200 |
| 1690 | Ga0265328_10024365 | 3300031239 | Bacteria | 2287 |
| 1691 | Ga0265325_10011563 | 3300031241 | Bacteria | 5071 |
| 1692 | Ga0265325_10016810 | 3300031241 | Bacteria | 4082 |
| 1693 | Ga0265325_10244676 | 3300031241 | Bacteria | 814 |
| 1694 | Ga0265339_10009402 | 3300031249 | Bacteria | 6146 |
| 1695 | Ga0265339_10107640 | 3300031249 | Bacteria | 1445 |
| 1696 | Ga0265316_10020637 | 3300031344 | Bacteria | 5603 |
| 1697 | Ga0265316_10039960 | 3300031344 | Bacteria | 3764 |
| 1698 | Ga0307408_100900132 | 3300031548 | Bacteria | 810 |
| 1699 | Ga0310103_133604 | 3300031614 | Unclassified | 608 |
| 1700 | Ga0310107_131645 | 3300031615 | Bacteria | 584 |
| 1701 | Ga0310118_118915 | 3300031664 | Bacteria | 561 |
| 1702 | Ga0310119_128539 | 3300031686 | Bacteria | 581 |
| 1703 | Ga0265314_10008144 | 3300031711 | Bacteria | 9019 |
| 1704 | Ga0265314_10035950 | 3300031711 | Bacteria | 3606 |
| 1705 | Ga0265314_10159420 | 3300031711 | Bacteria | 1374 |
| 1706 | Ga0316044_124680 | 3300031810 | Unclassified | 598 |
| 1707 | Ga0316044_125414 | 3300031810 | Bacteria | 586 |
| 1708 | Ga0307413_10412938 | 3300031824 | Bacteria | 1061 |
| 1709 | Ga0307409_100012943 | 3300031995 | Bacteria | 5342 |
| 1710 | Ga0307409_102155518 | 3300031995 | Bacteria | 587 |
| 1711 | Ga0307416_100471271 | 3300032002 | Bacteria | 1313 |
| 1712 | Ga0316053_101773 | 3300032120 | Bacteria | 1178 |
| 1713 | Ga0316053_102283 | 3300032120 | Unclassified | 1080 |
| 1714 | Ga0316053_105472 | 3300032120 | Unclassified | 807 |
| 1715 | Ga0316053_106245 | 3300032120 | Unclassified | 772 |
| 1716 | Ga0316053_106614 | 3300032120 | Unclassified | 758 |
| 1717 | Ga0316053_106849 | 3300032120 | Unclassified | 749 |
| 1718 | Ga0316053_107485 | 3300032120 | Unclassified | 725 |
| 1719 | Ga0316053_109107 | 3300032120 | Unclassified | 678 |
| 1720 | Ga0316053_112627 | 3300032120 | Unclassified | 606 |
| 1721 | Ga0316053_112812 | 3300032120 | Bacteria | 603 |
| 1722 | Ga0316053_115065 | 3300032120 | Bacteria | 573 |
| 1723 | Ga0316053_116005 | 3300032120 | Unclassified | 561 |
| 1724 | Ga0316053_116783 | 3300032120 | Unclassified | 552 |
| 1725 | Ga0316214_1007824 | 3300033545 | Bacteria | 1433 |
| 1726 | Ga0316214_1023567 | 3300033545 | Bacteria | 865 |
| 1727 | Ga0373958_0023735 | 3300034819 | Bacteria | 1156 |
| 1728 | Ga0373938_0131147 | 3300034957 | Unclassified | 654 |
| 1729 | Ga0373926_0050013 | 3300035083 | Bacteria | 1506 |
| 1730 | Ga0373926_0084926 | 3300035083 | Bacteria | 1174 |
| 1731 | Ga0373934_0023872 | 3300035086 | Bacteria | 2364 |
| 1732 | Ga0373934_0163522 | 3300035086 | Unclassified | 913 |
| 1733 | Ga0373944_0048452 | 3300035089 | Unclassified | 1333 |
| 1734 | Ga0373949_0126529 | 3300035090 | Bacteria | 722 |
| 1735 | Ga0373952_0041827 | 3300035092 | Bacteria | 1062 |
| 1736 | Ga0373923_0005621 | 3300035111 | Unclassified | 4269 |
| 1737 | Ga0373923_0052112 | 3300035111 | Unclassified | 1719 |
| 1738 | Ga0373923_0101959 | 3300035111 | Unclassified | 1267 |
| 1739 | Ga0373936_0001996 | 3300035113 | Bacteria | 7554 |
| 1740 | Ga0373936_0005584 | 3300035113 | Bacteria | 4745 |
| 1741 | Ga0373936_0145589 | 3300035113 | Bacteria | 1025 |
| 1742 | Ga0373939_0013124 | 3300035114 | Bacteria | 2125 |
| 1743 | Ga0373939_0103719 | 3300035114 | Bacteria | 980 |
| 1744 | Ga0373945_0150469 | 3300035116 | Unclassified | 943 |
| 1745 | Ga0373953_0134759 | 3300035117 | Bacteria | 1054 |
| 1746 | Ga0373954_0029357 | 3300035118 | Bacteria | 2532 |
| 1747 | Ga0373956_0167129 | 3300035119 | Bacteria | 1038 |
| 1748 | Ga0373956_0332554 | 3300035119 | Bacteria | 724 |
| 1749 | Ga0373957_0042834 | 3300035120 | Bacteria | 1709 |
| 1750 | Ga0373957_0049245 | 3300035120 | Bacteria | 1608 |
| 1751 | Ga0373943_0000057 | 3300035170 | Bacteria | 38342 |
| 1752 | Ga0373943_0033938 | 3300035170 | Bacteria | 2433 |
| 1753 | Ga0373943_0045807 | 3300035170 | Bacteria | 2133 |
| 1754 | Ga0373943_0085962 | 3300035170 | Bacteria | 1621 |
| 1755 | Ga0373943_0105313 | 3300035170 | Bacteria | 1481 |
| 1756 | Ga0373943_0306956 | 3300035170 | Bacteria | 902 |
| 1757 | Ga0373946_0005397 | 3300035171 | Bacteria | 4609 |
| 1758 | Ga0373946_0053039 | 3300035171 | Bacteria | 1703 |
| 1759 | Ga0373955_0123844 | 3300035172 | Unclassified | 1504 |
| 1760 | Ga0373955_0124703 | 3300035172 | Bacteria | 1500 |
| 1761 | Ga0373955_0140224 | 3300035172 | Unclassified | 1417 |
| 1762 | Ga0373942_0049488 | 3300035207 | Bacteria | 1174 |
| 1763 | Ga0373961_0034420 | 3300035241 | Bacteria | 1432 |
| 1764 | Ga0373961_0097819 | 3300035241 | Bacteria | 946 |
| 1765 | Ga0373962_0142455 | 3300035242 | Unclassified | 780 |
| 1766 | Ga0373924_0069074 | 3300035410 | Unclassified | 1488 |
| 1767 | Ga0373924_0090910 | 3300035410 | Unclassified | 1306 |
| 1768 | Ga0373931_0016090 | 3300035691 | Bacteria | 3677 |
| 1769 | Ga0373931_0057236 | 3300035691 | Bacteria | 2090 |
| 1770 | Ga0373931_0093001 | 3300035691 | Bacteria | 1683 |
| 1771 | Ga0373931_0315221 | 3300035691 | Unclassified | 970 |
| 1772 | Ga0373935_0008903 | 3300035692 | Bacteria | 6007 |
| 1773 | Ga0373935_0012376 | 3300035692 | Bacteria | 5134 |
| 1774 | Ga0373935_0028352 | 3300035692 | Bacteria | 3461 |
| 1775 | Ga0373935_0050092 | 3300035692 | Bacteria | 2650 |
| 1776 | Ga0373935_0095949 | 3300035692 | Bacteria | 1948 |
| 1777 | Ga0373927_0001419 | 3300035695 | Bacteria | 18082 |
| 1778 | Ga0373927_0032471 | 3300035695 | Bacteria | 3400 |
| 1779 | Ga0373927_0119973 | 3300035695 | Unclassified | 1716 |
| 1780 | Ga0373927_0314707 | 3300035695 | Unclassified | 1031 |
| 1781 | Ga0373927_0445296 | 3300035695 | Bacteria | 855 |
| 1782 | Ga0373933_0036947 | 3300035724 | Unclassified | 2863 |
| 1783 | Ga0373933_0073960 | 3300035724 | Bacteria | 2077 |
| 1784 | Ga0373933_0142820 | 3300035724 | Bacteria | 1512 |
| 1785 | Ga0373947_0001930 | 3300035725 | Bacteria | 12690 |
| 1786 | Ga0373947_0008323 | 3300035725 | Bacteria | 5975 |
| 1787 | Ga0373947_0074205 | 3300035725 | Bacteria | 2092 |
| 1788 | Ga0373947_0076279 | 3300035725 | Bacteria | 2066 |
| 1789 | Ga0373947_0388189 | 3300035725 | Unclassified | 940 |
| 1790 | Ga0373937_0044091 | 3300036401 | Bacteria | 4073 |
| 1791 | Ga0373937_0047537 | 3300036401 | Unclassified | 3926 |
| 1792 | Ga0373937_0051164 | 3300036401 | Bacteria | 3786 |
| 1793 | Ga0373937_0090017 | 3300036401 | Bacteria | 2842 |
| 1794 | Ga0373937_0364592 | 3300036401 | Bacteria | 1369 |
| 1795 | Ga0373937_0467922 | 3300036401 | Bacteria | 1197 |
| 1796 | Ga0373937_1215939 | 3300036401 | Bacteria | 702 |
| 1797 | Ga0373937_1994953 | 3300036401 | Bacteria | 526 |
| 1798 | Ga0265778_016927 | 3300036457 | Unclassified | 877 |
| 1799 | Ga0265778_021175 | 3300036457 | Unclassified | 804 |
| 1800 | Ga0265778_021767 | 3300036457 | Bacteria | 796 |
| 1801 | Ga0265778_027719 | 3300036457 | Bacteria | 723 |
| 1802 | Ga0265778_027945 | 3300036457 | Unclassified | 721 |
| 1803 | Ga0265778_028006 | 3300036457 | Unclassified | 720 |
| 1804 | Ga0265778_030500 | 3300036457 | Unclassified | 696 |
| 1805 | Ga0265778_031047 | 3300036457 | Unclassified | 691 |
| 1806 | Ga0265778_032616 | 3300036457 | Unclassified | 677 |
| 1807 | Ga0265778_042290 | 3300036457 | Bacteria | 609 |
| 1808 | Ga0265778_042934 | 3300036457 | Bacteria | 605 |
| 1809 | Ga0265778_044176 | 3300036457 | Bacteria | 599 |
| 1810 | Ga0265778_047485 | 3300036457 | Unclassified | 582 |
| 1811 | Ga0265778_050163 | 3300036457 | Bacteria | 570 |
| 1812 | Ga0373925_0002410 | 3300037068 | Bacteria | 14999 |
| 1813 | Ga0373925_0004638 | 3300037068 | Bacteria | 10376 |
| 1814 | Ga0373925_0010010 | 3300037068 | Bacteria | 6884 |
| 1815 | Ga0373925_0016440 | 3300037068 | Bacteria | 5360 |
| 1816 | Ga0373925_0032411 | 3300037068 | Bacteria | 3846 |
| 1817 | Ga0373925_0066243 | 3300037068 | Bacteria | 2722 |
| 1818 | Ga0373925_0109860 | 3300037068 | Bacteria | 2128 |
| 1819 | Ga0373925_0137952 | 3300037068 | Bacteria | 1907 |
| 1820 | Ga0373925_0270824 | 3300037068 | Bacteria | 1366 |
| 1821 | Ga0373925_0448615 | 3300037068 | Bacteria | 1056 |
| 1822 | Ga0373925_1402586 | 3300037068 | Unclassified | 572 |
| 1823 | Ga0395900_1022284 | 3300037418 | Bacteria | 746 |
| 1824 | Ga0395905_1005228 | 3300037471 | Unclassified | 737 |
| 1825 | Ga0436365_1008019 | 3300039437 | Unclassified | 1230 |
| 1826 | Ga0436360_0576800 | 3300039438 | Bacteria | 1436 |
| 1827 | Ga0436360_1049509 | 3300039438 | Bacteria | 1038 |
| 1828 | Ga0436361_0555840 | 3300039447 | Unclassified | 544 |
| 1829 | Ga0436363_0174411 | 3300039450 | Bacteria | 1045 |
| 1830 | Ga0436363_0226302 | 3300039450 | Bacteria | 763 |
| 1831 | Ga0436363_1160955 | 3300039450 | Bacteria | 3403 |
| 1832 | Ga0436363_1335520 | 3300039450 | Unclassified | 3293 |
| 1833 | Ga0436362_0234917 | 3300039453 | Bacteria | 4854 |
| 1834 | Ga0439435_0067273 | 3300042436 | Unclassified | 1055 |
| 1835 | Ga0453683_0776196 | 3300044673 | Unclassified | 630 |
| 1836 | Ga0466965_0400106 | 3300044683 | Unclassified | 759 |
| 1837 | Ga0466963_0205948 | 3300044694 | Bacteria | 1376 |
| 1838 | Ga0466963_0310074 | 3300044694 | Unclassified | 1110 |
| 1839 | Ga0453684_0263559 | 3300044712 | Unclassified | 1973 |
| 1840 | Ga0453684_2008487 | 3300044712 | Bacteria | 582 |
| 1841 | Ga0466971_0146756 | 3300044719 | Bacteria | 1100 |
| 1842 | Ga0451576_0038538 | 3300045051 | Bacteria | 5058 |
| 1843 | Ga0451576_0291981 | 3300045051 | Bacteria | 1705 |
| 1844 | Ga0451576_0411379 | 3300045051 | Bacteria | 1419 |
| 1845 | Ga0451576_1617942 | 3300045051 | Unclassified | 672 |
| 1846 | Ga0451576_2048519 | 3300045051 | Bacteria | 589 |
| 1847 | Ga0466967_0005562 | 3300045976 | Bacteria | 8754 |
| 1848 | Ga0466967_0018548 | 3300045976 | Bacteria | 5565 |
| 1849 | Ga0466967_0413482 | 3300045976 | Bacteria | 1314 |
| 1850 | Ga0495629_0017374 | 3300046459 | Bacteria | 5155 |
| 1851 | Ga0495629_0032355 | 3300046459 | Bacteria | 3703 |
| 1852 | Ga0495629_0337817 | 3300046459 | Bacteria | 1029 |
| 1853 | Ga0495651_0550686 | 3300046462 | Bacteria | 733 |
| 1854 | Ga0495580_0000097 | 3300046472 | Bacteria | 58068 |
| 1855 | Ga0495580_0003126 | 3300046472 | Bacteria | 14184 |
| 1856 | Ga0495580_0003638 | 3300046472 | Bacteria | 13057 |
| 1857 | Ga0495580_0006916 | 3300046472 | Bacteria | 9163 |
| 1858 | Ga0495580_0007201 | 3300046472 | Bacteria | 8953 |
| 1859 | Ga0495580_0007572 | 3300046472 | Bacteria | 8711 |
| 1860 | Ga0495580_0017890 | 3300046472 | Bacteria | 5286 |
| 1861 | Ga0495580_0020025 | 3300046472 | Bacteria | 4959 |
| 1862 | Ga0495580_0103988 | 3300046472 | Bacteria | 1973 |
| 1863 | Ga0495580_0176565 | 3300046472 | Unclassified | 1475 |
| 1864 | Ga0495580_0296103 | 3300046472 | Bacteria | 1102 |
| 1865 | Ga0495582_0003332 | 3300046473 | Bacteria | 9031 |
| 1866 | Ga0495582_0017854 | 3300046473 | Bacteria | 3878 |
| 1867 | Ga0495582_0055458 | 3300046473 | Bacteria | 2184 |
| 1868 | Ga0495594_0084031 | 3300046499 | Unclassified | 1780 |
| 1869 | Ga0495630_0069470 | 3300046517 | Bacteria | 2650 |
| 1870 | Ga0495630_0323385 | 3300046517 | Unclassified | 1179 |
| 1871 | Ga0495630_0408682 | 3300046517 | Bacteria | 1040 |
| 1872 | Ga0495630_0437493 | 3300046517 | Bacteria | 1002 |
| 1873 | Ga0495665_0009301 | 3300046531 | Bacteria | 5321 |
| 1874 | Ga0495665_0189025 | 3300046531 | Bacteria | 1069 |
| 1875 | Ga0495665_0357436 | 3300046531 | Unclassified | 743 |
| 1876 | Ga0495622_0393989 | 3300046557 | Bacteria | 597 |
| 1877 | Ga0495611_0484731 | 3300046648 | Bacteria | 562 |
| 1878 | Ga0495623_0280655 | 3300046679 | Bacteria | 927 |
| 1879 | Ga0495646_0570472 | 3300046680 | Unclassified | 577 |
| 1880 | Ga0495647_0297547 | 3300046681 | Unclassified | 727 |
| 1881 | Ga0495658_0059141 | 3300046683 | Bacteria | 2194 |
| 1882 | Ga0495658_0165687 | 3300046683 | Unclassified | 1365 |
| 1883 | Ga0495658_0236553 | 3300046683 | Unclassified | 1146 |
| 1884 | Ga0495658_0262478 | 3300046683 | Unclassified | 1087 |
| 1885 | Ga0495669_0037624 | 3300046684 | Bacteria | 2142 |
| 1886 | Ga0495669_0121232 | 3300046684 | Unclassified | 1226 |
| 1887 | Ga0495669_0271875 | 3300046684 | Bacteria | 815 |
| 1888 | Ga0495669_0332002 | 3300046684 | Unclassified | 734 |
| 1889 | Ga0495669_0349385 | 3300046684 | Bacteria | 715 |
| 1890 | Ga0495624_0037970 | 3300046690 | Bacteria | 3097 |
| 1891 | Ga0495624_0105408 | 3300046690 | Bacteria | 1735 |
| 1892 | Ga0495670_0126055 | 3300046691 | Unclassified | 1333 |
| 1893 | Ga0495670_0295956 | 3300046691 | Bacteria | 867 |
| 1894 | Ga0495636_0138627 | 3300047318 | Bacteria | 1085 |
| 1895 | Ga0495674_0015358 | 3300047319 | Bacteria | 7162 |
| 1896 | Ga0495674_0181955 | 3300047319 | Unclassified | 1750 |
| 1897 | Ga0495674_0215086 | 3300047319 | Bacteria | 1591 |
| 1898 | Ga0495674_0258249 | 3300047319 | Unclassified | 1432 |
| 1899 | Ga0495674_0906658 | 3300047319 | Bacteria | 680 |
| 1900 | Ga0495676_0599347 | 3300047321 | Unclassified | 717 |
| 1901 | Ga0495675_0050462 | 3300047444 | Bacteria | 2645 |
| 1902 | Ga0495602_0135696 | 3300048088 | Bacteria | 1955 |
| 1903 | Ga0495602_0151307 | 3300048088 | Bacteria | 1824 |
| 1904 | Ga0495602_0181111 | 3300048088 | Bacteria | 1625 |
| 1905 | Ga0495614_0176059 | 3300048089 | Bacteria | 961 |
| 1906 | Ga0496100_0179894 | 3300048903 | Bacteria | 1529 |
| 1907 | Ga0496100_0310616 | 3300048903 | Bacteria | 1182 |
| 1908 | Ga0496100_0462787 | 3300048903 | Bacteria | 973 |
| 1909 | Ga0496100_0673457 | 3300048903 | Bacteria | 806 |
| 1910 | Ga0496100_0890675 | 3300048903 | Unclassified | 699 |
| 1911 | Ga0496101_0022155 | 3300048904 | Bacteria | 4371 |
| 1912 | Ga0496101_1209681 | 3300048904 | Unclassified | 592 |
| 1913 | Ga0496102_0001511 | 3300048905 | Bacteria | 20524 |
| 1914 | Ga0496102_0010031 | 3300048905 | Bacteria | 8146 |
| 1915 | Ga0496102_0134564 | 3300048905 | Bacteria | 2315 |
| 1916 | Ga0496102_0136567 | 3300048905 | Bacteria | 2298 |
| 1917 | Ga0496102_0222390 | 3300048905 | Bacteria | 1780 |
| 1918 | Ga0496102_0226248 | 3300048905 | Bacteria | 1764 |
| 1919 | Ga0496102_0313823 | 3300048905 | Bacteria | 1477 |
| 1920 | Ga0496102_0530461 | 3300048905 | Bacteria | 1100 |
| 1921 | Ga0496102_0798868 | 3300048905 | Unclassified | 866 |
| 1922 | Ga0496102_0948432 | 3300048905 | Unclassified | 781 |
| 1923 | Ga0496102_1786744 | 3300048905 | Unclassified | 532 |
| 1924 | Ga0496103_0001097 | 3300048906 | Bacteria | 18843 |
| 1925 | Ga0496103_0032816 | 3300048906 | Bacteria | 3170 |
| 1926 | Ga0496103_0733900 | 3300048906 | Bacteria | 625 |
| 1927 | Ga0496103_0856145 | 3300048906 | Unclassified | 571 |
| 1928 | Ga0496104_0033024 | 3300048907 | Bacteria | 4818 |
| 1929 | Ga0496104_0062952 | 3300048907 | Bacteria | 3518 |
| 1930 | Ga0496104_0077962 | 3300048907 | Bacteria | 3157 |
| 1931 | Ga0496104_0111393 | 3300048907 | Unclassified | 2624 |
| 1932 | Ga0496104_0139883 | 3300048907 | Bacteria | 2326 |
| 1933 | Ga0496104_0153089 | 3300048907 | Bacteria | 2213 |
| 1934 | Ga0496104_0356274 | 3300048907 | Unclassified | 1376 |
| 1935 | Ga0496104_0913892 | 3300048907 | Bacteria | 783 |
| 1936 | Ga0496105_0015361 | 3300048908 | Bacteria | 6101 |
| 1937 | Ga0496105_0035482 | 3300048908 | Bacteria | 4104 |
| 1938 | Ga0496105_0156288 | 3300048908 | Unclassified | 1873 |
| 1939 | Ga0496105_0267186 | 3300048908 | Unclassified | 1382 |
| 1940 | Ga0496105_0489842 | 3300048908 | Bacteria | 966 |
| 1941 | Ga0496105_0721274 | 3300048908 | Bacteria | 764 |
| 1942 | Ga0496106_0014899 | 3300048909 | Bacteria | 5751 |
| 1943 | Ga0496106_0036946 | 3300048909 | Bacteria | 3653 |
| 1944 | Ga0496106_0435574 | 3300048909 | Bacteria | 1053 |
| 1945 | Ga0496106_0604705 | 3300048909 | Bacteria | 878 |
| 1946 | Ga0496107_0228853 | 3300048910 | Unclassified | 1383 |
| 1947 | Ga0496107_0386765 | 3300048910 | Bacteria | 1041 |
| 1948 | Ga0496108_0005246 | 3300048911 | Bacteria | 10466 |
| 1949 | Ga0496108_0273886 | 3300048911 | Unclassified | 1469 |
| 1950 | Ga0496108_0365301 | 3300048911 | Bacteria | 1260 |
| 1951 | Ga0496108_0781152 | 3300048911 | Bacteria | 825 |
| 1952 | Ga0496109_0000018 | 3300048912 | Bacteria | 191977 |
| 1953 | Ga0496109_0152451 | 3300048912 | Bacteria | 2164 |
| 1954 | Ga0496109_0225492 | 3300048912 | Bacteria | 1763 |
| 1955 | Ga0496109_1075209 | 3300048912 | Bacteria | 742 |
| 1956 | Ga0496109_1524540 | 3300048912 | Unclassified | 603 |
| 1957 | Ga0496110_0001746 | 3300048913 | Bacteria | 16024 |
| 1958 | Ga0496111_0105480 | 3300048914 | Bacteria | 2074 |
| 1959 | Ga0496111_0338322 | 3300048914 | Unclassified | 1114 |
| 1960 | Ga0496112_0001173 | 3300048915 | Bacteria | 19637 |
| 1961 | Ga0496112_0004210 | 3300048915 | Bacteria | 12133 |
| 1962 | Ga0496112_0010111 | 3300048915 | Bacteria | 8543 |
| 1963 | Ga0496112_0014820 | 3300048915 | Bacteria | 7250 |
| 1964 | Ga0496112_0027455 | 3300048915 | Bacteria | 5488 |
| 1965 | Ga0496112_0040425 | 3300048915 | Bacteria | 4559 |
| 1966 | Ga0496112_0044472 | 3300048915 | Bacteria | 4351 |
| 1967 | Ga0496112_0049408 | 3300048915 | Bacteria | 4123 |
| 1968 | Ga0496112_0049706 | 3300048915 | Unclassified | 4110 |
| 1969 | Ga0496112_0062608 | 3300048915 | Bacteria | 3670 |
| 1970 | Ga0496112_0104136 | 3300048915 | Bacteria | 2808 |
| 1971 | Ga0496112_0129994 | 3300048915 | Bacteria | 2489 |
| 1972 | Ga0496112_0432320 | 3300048915 | Unclassified | 1255 |
| 1973 | Ga0496112_0652961 | 3300048915 | Unclassified | 981 |
| 1974 | Ga0496112_1479099 | 3300048915 | Unclassified | 593 |
| 1975 | Ga0496113_0002437 | 3300048916 | Bacteria | 10815 |
| 1976 | Ga0496113_0088299 | 3300048916 | Bacteria | 2385 |
| 1977 | Ga0496113_1250820 | 3300048916 | Unclassified | 578 |
| 1978 | Ga0496114_0158197 | 3300048917 | Bacteria | 1968 |
| 1979 | Ga0496114_0468935 | 3300048917 | Bacteria | 1114 |
| 1980 | Ga0496115_0008147 | 3300048918 | Bacteria | 7739 |
| 1981 | Ga0496115_0022883 | 3300048918 | Bacteria | 4847 |
| 1982 | Ga0496115_0043944 | 3300048918 | Unclassified | 3563 |
| 1983 | Ga0496115_0161411 | 3300048918 | Bacteria | 1852 |
| 1984 | Ga0501307_041700 | 3300049162 | Bacteria | 668 |
| 1985 | Ga0501298_033907 | 3300049521 | Bacteria | 1013 |
| 1986 | Ga0501299_089058 | 3300049522 | Bacteria | 698 |
| 1987 | Ga0501300_015905 | 3300049523 | Bacteria | 1098 |
| 1988 | Ga0501313_042309 | 3300049529 | Unclassified | 615 |
| 1989 | Ga0501315_055052 | 3300049531 | Bacteria | 633 |
| 1990 | Ga0501320_068058 | 3300049536 | Bacteria | 511 |
| 1991 | Ga0501335_035694 | 3300049551 | Bacteria | 574 |
| 1992 | Ga0501249_076369 | 3300049679 | Bacteria | 785 |
| 1993 | Ga0501083_0203545 | 3300049744 | Bacteria | 1291 |
| 1994 | nmdc:mga05p37_1331508_c1 | 3300050507 | Unclassified | 729 |
| 1995 | nmdc:mga05p37_14610_c1 | 3300050507 | Bacteria | 9432 |
| 1996 | nmdc:mga09592_42673_c1 | 3300050508 | Bacteria | 3815 |
| 1997 | nmdc:mga06r32_1043266_c1 | 3300050510 | Unclassified | 769 |
| 1998 | nmdc:mga06r32_266992_c1 | 3300050510 | Bacteria | 1699 |
| 1999 | nmdc:mga0n895_1371358_c1 | 3300050512 | Unclassified | 676 |
| 2000 | nmdc:mga0n895_187192_c1 | 3300050512 | Bacteria | 2101 |
| 2001 | nmdc:mga0n895_282718_c1 | 3300050512 | Bacteria | 1682 |
| 2002 | nmdc:mga0n895_29703_c1 | 3300050512 | Bacteria | 5217 |
| 2003 | nmdc:mga0n895_360_c1 | 3300050512 | Bacteria | 30630 |
| 2004 | nmdc:mga0n895_3638_c1 | 3300050512 | Bacteria | 12463 |
| 2005 | nmdc:mga0n895_483737_c1 | 3300050512 | Bacteria | 1248 |
| 2006 | nmdc:mga0n895_552639_c1 | 3300050512 | Unclassified | 1157 |
| 2007 | nmdc:mga0n895_79579_c1 | 3300050512 | Bacteria | 3264 |
| 2008 | nmdc:mga0n895_978132_c1 | 3300050512 | Unclassified | 828 |
| 2009 | nmdc:mga0rr50_1086895_c1 | 3300050513 | Unclassified | 681 |
| 2010 | nmdc:mga0rr50_20211_c1 | 3300050513 | Bacteria | 4514 |
| 2011 | nmdc:mga0rr50_24920_c1 | 3300050513 | Bacteria | 4152 |
| 2012 | nmdc:mga0rr50_31695_c1 | 3300050513 | Bacteria | 3758 |
| 2013 | nmdc:mga0rr50_404_c1 | 3300050513 | Bacteria | 23529 |
| 2014 | nmdc:mga0rr50_580027_c1 | 3300050513 | Unclassified | 955 |
| 2015 | nmdc:mga0rr50_6502_c1 | 3300050513 | Bacteria | 7122 |
| 2016 | nmdc:mga08x19_10367_c1 | 3300050514 | Bacteria | 5594 |
| 2017 | nmdc:mga08x19_11164_c1 | 3300050514 | Bacteria | 5407 |
| 2018 | nmdc:mga08x19_1163_c1 | 3300050514 | Bacteria | 16467 |
| 2019 | nmdc:mga08x19_233690_c1 | 3300050514 | Bacteria | 1266 |
| 2020 | nmdc:mga08x19_6920_c1 | 3300050514 | Bacteria | 6735 |
| 2021 | nmdc:mga08x19_730342_c1 | 3300050514 | Unclassified | 703 |
| 2022 | nmdc:mga08x19_758506_c1 | 3300050514 | Unclassified | 689 |
| 2023 | nmdc:mga0a205_139651_c1 | 3300050515 | Bacteria | 2323 |
| 2024 | nmdc:mga0a205_575_c1 | 3300050515 | Bacteria | 29128 |
| 2025 | Ga0495601_0085044 | 3300053077 | Bacteria | 2032 |
| 2026 | Ga0587084_048426 | 3300059477 | Bacteria | 745 |
| 2027 | Ga0587066_006102 | 3300059490 | Unclassified | 1575 |
| 2028 | Ga0587066_051450 | 3300059490 | Bacteria | 812 |
| 2029 | Ga0587066_099333 | 3300059490 | Unclassified | 659 |
| 2030 | Ga0587070_082415 | 3300059491 | Unclassified | 708 |
| 2031 | Ga0587073_0049671 | 3300059492 | Bacteria | 946 |
| 2032 | Ga0587073_0050941 | 3300059492 | Bacteria | 938 |
| 2033 | Ga0587073_0068844 | 3300059492 | Bacteria | 850 |
| 2034 | Ga0587073_0085500 | 3300059492 | Unclassified | 792 |
| 2035 | Ga0587073_0088165 | 3300059492 | Bacteria | 784 |
| 2036 | Ga0587073_0117414 | 3300059492 | Bacteria | 714 |
| 2037 | Ga0587073_0119232 | 3300059492 | Unclassified | 710 |
| 2038 | Ga0587077_094612 | 3300059493 | Unclassified | 708 |
| 2039 | Ga0587082_061893 | 3300059504 | Bacteria | 740 |
| 2040 | Ga0587082_070743 | 3300059504 | Unclassified | 708 |
| 2041 | Ga0587082_074890 | 3300059504 | Unclassified | 695 |
| 2042 | Ga0587083_0103872 | 3300059505 | Unclassified | 712 |
| 2043 | Ga0587083_0116468 | 3300059505 | Bacteria | 685 |
| 2044 | Ga0587086_055544 | 3300059507 | Unclassified | 648 |
| 2045 | Ga0587088_004577 | 3300059508 | Bacteria | 1761 |
| 2046 | Ga0587088_075790 | 3300059508 | Unclassified | 710 |
| 2047 | Ga0587088_090394 | 3300059508 | Unclassified | 669 |
| 2048 | Ga0587089_040309 | 3300059509 | Unclassified | 720 |
| 2049 | Ga0587090_064898 | 3300059510 | Unclassified | 701 |
| 2050 | Ga0587091_087884 | 3300059511 | Unclassified | 709 |
| 2051 | Ga0587092_086784 | 3300059512 | Unclassified | 626 |
| 2052 | Ga0587094_045709 | 3300059513 | Bacteria | 727 |
| 2053 | Ga0587094_056560 | 3300059513 | Unclassified | 677 |
| 2054 | Ga0587121_08969 | 3300059606 | Unclassified | 614 |
| 2055 | Ga0587129_011463 | 3300059608 | Unclassified | 698 |
| 2056 | Ga0587131_008218 | 3300059609 | Unclassified | 709 |
| 2057 | Ga0587099_018135 | 3300059622 | Bacteria | 774 |
| 2058 | Ga0587099_023707 | 3300059622 | Unclassified | 709 |
| 2059 | Ga0587099_026657 | 3300059622 | Bacteria | 683 |
| 2060 | Ga0587113_010040 | 3300059625 | Bacteria | 867 |
| 2061 | Ga0587115_047789 | 3300059626 | Unclassified | 687 |
| 2062 | Ga0587122_015010 | 3300059628 | Unclassified | 787 |
| 2063 | Ga0587122_016420 | 3300059628 | Bacteria | 766 |
| 2064 | Ga0587122_034277 | 3300059628 | Unclassified | 609 |
| 2065 | Ga0587122_039757 | 3300059628 | Unclassified | 581 |
| 2066 | Ga0587122_044820 | 3300059628 | Unclassified | 559 |
| 2067 | Ga0587128_004969 | 3300059630 | Unclassified | 1569 |
| 2068 | Ga0587128_005724 | 3300059630 | Unclassified | 1500 |
| 2069 | Ga0587128_030029 | 3300059630 | Unclassified | 895 |
| 2070 | Ga0587128_035107 | 3300059630 | Bacteria | 851 |
| 2071 | Ga0587128_039092 | 3300059630 | Unclassified | 822 |
| 2072 | Ga0587128_039536 | 3300059630 | Unclassified | 819 |
| 2073 | Ga0587128_053408 | 3300059630 | Bacteria | 744 |
| 2074 | Ga0587128_058495 | 3300059630 | Bacteria | 722 |
| 2075 | Ga0587128_061286 | 3300059630 | Unclassified | 711 |
| 2076 | Ga0587067_069253 | 3300059640 | Unclassified | 757 |
| 2077 | Ga0587067_083987 | 3300059640 | Unclassified | 710 |
| 2078 | Ga0587067_087297 | 3300059640 | Bacteria | 701 |
| 2079 | Ga0587067_105380 | 3300059640 | Unclassified | 658 |
| 2080 | Ga0587069_050467 | 3300059642 | Bacteria | 739 |
| 2081 | Ga0587069_057327 | 3300059642 | Unclassified | 709 |
| 2082 | Ga0587069_069663 | 3300059642 | Unclassified | 665 |
| 2083 | Ga0587072_066198 | 3300059643 | Bacteria | 754 |
| 2084 | Ga0587075_016855 | 3300059644 | Bacteria | 1044 |
| 2085 | Ga0587075_031727 | 3300059644 | Bacteria | 844 |
| 2086 | Ga0587075_040534 | 3300059644 | Bacteria | 778 |
| 2087 | Ga0587075_041886 | 3300059644 | Unclassified | 770 |
| 2088 | Ga0587075_043963 | 3300059644 | Bacteria | 759 |
| 2089 | Ga0587075_048255 | 3300059644 | Unclassified | 735 |
| 2090 | Ga0587075_053736 | 3300059644 | Unclassified | 710 |
| 2091 | Ga0587075_055872 | 3300059644 | Unclassified | 701 |
| 2092 | Ga0587075_057572 | 3300059644 | Bacteria | 693 |
| 2093 | Ga0587075_062860 | 3300059644 | Unclassified | 673 |
| 2094 | Ga0587076_075626 | 3300059645 | Unclassified | 708 |
| 2095 | Ga0587079_081106 | 3300059647 | Unclassified | 742 |
| 2096 | Ga0587079_089487 | 3300059647 | Unclassified | 718 |
| 2097 | Ga0587079_151780 | 3300059647 | Unclassified | 599 |
| 2098 | Ga0587102_020634 | 3300059649 | Unclassified | 741 |
| 2099 | Ga0587107_046134 | 3300059652 | Unclassified | 722 |
| 2100 | Ga0587114_002824 | 3300059655 | Bacteria | 1664 |
| 2101 | Ga0587114_005179 | 3300059655 | Unclassified | 1397 |
| 2102 | Ga0587114_019613 | 3300059655 | Unclassified | 940 |
| 2103 | Ga0587114_041348 | 3300059655 | Bacteria | 748 |
| 2104 | Ga0587114_041750 | 3300059655 | Unclassified | 746 |
| 2105 | Ga0587114_052464 | 3300059655 | Unclassified | 694 |
| 2106 | Ga0587114_056960 | 3300059655 | Bacteria | 676 |
| 2107 | Ga0587060_011822 | 3300060243 | Bacteria | 759 |
| 2108 | Ga0587071_068074 | 3300060344 | Unclassified | 770 |
| 2109 | Ga0587071_075232 | 3300060344 | Bacteria | 743 |
| 2110 | Ga0587071_077253 | 3300060344 | Bacteria | 736 |
| 2111 | Ga0587071_080255 | 3300060344 | Unclassified | 725 |
| 2112 | Ga0587111_0108101 | 3300060346 | Unclassified | 701 |
| 2113 | Ga0070699_100001262 | |||
| 2114 | MRS1b_contig_499290 | |||
| 2115 | LJNas_1000100 | |||
| 2116 | LJNas_1000764 | |||
| 2117 | JGI24737J22298_10040989 | |||
| 2118 | JGI24743J22301_10016817 | |||
| 2119 | JGI24735J21928_10144745 | |||
| 2120 | JGI24748J21848_1012010 | |||
| 2121 | JGI24738J21930_10042458 | |||
| 2122 | JGI24034J26672_10000846 | |||
| 2123 | JGI24751J29686_10003056 | |||
| 2124 | Ga0006770J48903_1043594 | |||
| 2125 | Ga0007417J51691_1078715 | |||
| 2126 | Ga0007416J51690_1049252 | |||
| 2127 | Ga0006780_1026440 | |||
| 2128 | Ga0058859_10038725 | |||
| 2129 | Ga0058859_11598358 | |||
| 2130 | Ga0058863_11538588 | |||
| 2131 | Ga0058863_11605465 | |||
| 2132 | Ga0058863_11931210 | |||
| 2133 | Ga0058863_11950456 | |||
| 2134 | Ga0058861_10036912 | |||
| 2135 | Ga0058861_11296361 | |||
| 2136 | Ga0058861_11575201 | |||
| 2137 | Ga0058861_11708729 | |||
| 2138 | Ga0058860_10071064 | |||
| 2139 | Ga0058860_10074548 | |||
| 2140 | Ga0058860_11005499 | |||
| 2141 | Ga0058860_11998714 | |||
| 2142 | Ga0058862_10015289 | |||
| 2143 | Ga0058862_12198476 | |||
| 2144 | Ga0058862_12282851 | |||
| 2145 | Ga0058862_12675983 | |||
| 2146 | Ga0058862_12840414 | |||
| 2147 | Ga0065712_10113216 | |||
| 2148 | Ga0065712_10124491 | |||
| 2149 | Ga0065712_10141052 | |||
| 2150 | Ga0065712_10239745 | |||
| 2151 | Ga0065712_10506342 | |||
| 2152 | Ga0065715_10263171 | |||
| 2153 | Ga0065707_10123107 | |||
| 2154 | Ga0070658_10015965 | |||
| 2155 | Ga0070658_11323806 | |||
| 2156 | Ga0070676_10008546 | |||
| 2157 | Ga0070676_10076670 | |||
| 2158 | Ga0070676_10127578 | |||
| 2159 | Ga0070676_10141413 | |||
| 2160 | Ga0070683_100001654 | |||
| 2161 | Ga0070683_100052982 | |||
| 2162 | Ga0070683_100059458 | |||
| 2163 | Ga0070683_100175031 | |||
| 2164 | Ga0070683_100188021 | |||
| 2165 | Ga0070683_100293618 | |||
| 2166 | Ga0070683_100533823 | |||
| 2167 | Ga0070683_100654461 | |||
| 2168 | Ga0070690_100022284 | |||
| 2169 | Ga0070690_100044309 | |||
| 2170 | Ga0070690_100208291 | |||
| 2171 | Ga0070690_100742659 | |||
| 2172 | Ga0070670_100001229 | |||
| 2173 | Ga0070670_100004866 | |||
| 2174 | Ga0070670_100345515 | |||
| 2175 | Ga0070670_100365080 | |||
| 2176 | Ga0070670_100507913 | |||
| 2177 | Ga0070670_100579488 | |||
| 2178 | Ga0070670_101085664 | |||
| 2179 | Ga0070677_10004176 | |||
| 2180 | Ga0070677_10027851 | |||
| 2181 | Ga0068869_100011004 | |||
| 2182 | Ga0068869_100169745 | |||
| 2183 | Ga0070666_10028622 | |||
| 2184 | Ga0070666_10093657 | |||
| 2185 | Ga0070680_100086435 | |||
| 2186 | Ga0070680_100087048 | |||
| 2187 | Ga0070680_100103263 | |||
| 2188 | Ga0070680_100260332 | |||
| 2189 | Ga0070680_100363823 | |||
| 2190 | Ga0070680_100472491 | |||
| 2191 | Ga0070682_100032714 | |||
| 2192 | Ga0070682_100038345 | |||
| 2193 | Ga0070682_100168724 | |||
| 2194 | Ga0070682_100379264 | |||
| 2195 | Ga0070682_100774875 | |||
| 2196 | Ga0068868_100005644 | |||
| 2197 | Ga0068868_100006335 | |||
| 2198 | Ga0068868_100009828 | |||
| 2199 | Ga0068868_100011480 | |||
| 2200 | Ga0068868_100036023 | |||
| 2201 | Ga0068868_100060463 | |||
| 2202 | Ga0068868_100063303 | |||
| 2203 | Ga0068868_100126790 | |||
| 2204 | Ga0068868_100172257 | |||
| 2205 | Ga0068868_100403293 | |||
| 2206 | Ga0068868_100418555 | |||
| 2207 | Ga0070660_100003182 | |||
| 2208 | Ga0070660_100123147 | |||
| 2209 | Ga0070660_100293639 | |||
| 2210 | Ga0070660_100331052 | |||
| 2211 | Ga0070689_100225918 | |||
| 2212 | Ga0070689_100372378 | |||
| 2213 | Ga0070689_100562121 | |||
| 2214 | Ga0070689_100727431 | |||
| 2215 | Ga0070691_10029763 | |||
| 2216 | Ga0070691_10247336 | |||
| 2217 | Ga0070691_10649673 | |||
| 2218 | Ga0070661_100009132 | |||
| 2219 | Ga0070661_100045709 | |||
| 2220 | Ga0070661_100049730 | |||
| 2221 | Ga0070661_100202816 | |||
| 2222 | Ga0070661_100303435 | |||
| 2223 | Ga0070661_101039651 | |||
| 2224 | Ga0070692_10080466 | |||
| 2225 | Ga0070692_10826867 | |||
| 2226 | Ga0070668_100017062 | |||
| 2227 | Ga0070668_100175143 | |||
| 2228 | Ga0070668_100193198 | |||
| 2229 | Ga0070669_100021818 | |||
| 2230 | Ga0070669_100037244 | |||
| 2231 | Ga0070669_100288951 | |||
| 2232 | Ga0070669_100384576 | |||
| 2233 | Ga0070669_100388557 | |||
| 2234 | Ga0070669_100851531 | |||
| 2235 | Ga0070675_100020968 | |||
| 2236 | Ga0070675_100090245 | |||
| 2237 | Ga0070675_100093809 | |||
| 2238 | Ga0070675_100161541 | |||
| 2239 | Ga0070675_100196375 | |||
| 2240 | Ga0070675_100201064 | |||
| 2241 | Ga0070675_101869748 | |||
| 2242 | Ga0070671_100142129 | |||
| 2243 | Ga0070671_100170413 | |||
| 2244 | Ga0070671_100393174 | |||
| 2245 | Ga0070671_101485425 | |||
| 2246 | Ga0070674_100177804 | |||
| 2247 | Ga0070674_100524557 | |||
| 2248 | Ga0070674_100733154 | |||
| 2249 | Ga0070673_100028368 | |||
| 2250 | Ga0070673_100056891 | |||
| 2251 | Ga0070673_100057392 | |||
| 2252 | Ga0070673_100310560 | |||
| 2253 | Ga0070688_100016967 | |||
| 2254 | Ga0070688_100409436 | |||
| 2255 | Ga0070659_100008280 | |||
| 2256 | Ga0070659_100094209 | |||
| 2257 | Ga0070659_100134607 | |||
| 2258 | Ga0070659_100856807 | |||
| 2259 | Ga0070667_100038354 | |||
| 2260 | Ga0070667_100245753 | |||
| 2261 | Ga0070667_100433027 | |||
| 2262 | Ga0070667_100795621 | |||
| 2263 | Ga0070709_10006962 | |||
| 2264 | Ga0070709_10012446 | |||
| 2265 | Ga0070709_10143436 | |||
| 2266 | Ga0070709_10284094 | |||
| 2267 | Ga0070709_10335172 | |||
| 2268 | Ga0070709_10883797 | |||
| 2269 | Ga0070709_11163454 | |||
| 2270 | Ga0070709_11224058 | |||
| 2271 | Ga0070714_100000186 | |||
| 2272 | Ga0070714_100016776 | |||
| 2273 | Ga0070714_100042467 | |||
| 2274 | Ga0070714_100099024 | |||
| 2275 | Ga0070714_100149680 | |||
| 2276 | Ga0070714_100157080 | |||
| 2277 | Ga0070714_100179169 | |||
| 2278 | Ga0070714_100203760 | |||
| 2279 | Ga0070714_100230678 | |||
| 2280 | Ga0070714_100297792 | |||
| 2281 | Ga0070714_100299040 | |||
| 2282 | Ga0070714_100409956 | |||
| 2283 | Ga0070714_100491102 | |||
| 2284 | Ga0070714_100516538 | |||
| 2285 | Ga0070714_100543703 | |||
| 2286 | Ga0070714_100572671 | |||
| 2287 | Ga0070714_100581141 | |||
| 2288 | Ga0070713_100000117 | |||
| 2289 | Ga0070713_100001059 | |||
| 2290 | Ga0070713_100004152 | |||
| 2291 | Ga0070713_100004649 | |||
| 2292 | Ga0070713_100016285 | |||
| 2293 | Ga0070713_100036385 | |||
| 2294 | Ga0070713_100046743 | |||
| 2295 | Ga0070713_100052366 | |||
| 2296 | Ga0070713_100074763 | |||
| 2297 | Ga0070713_100075817 | |||
| 2298 | Ga0070713_100109450 | |||
| 2299 | Ga0070713_100126554 | |||
| 2300 | Ga0070713_100129384 | |||
| 2301 | Ga0070713_100148717 | |||
| 2302 | Ga0070713_100158380 | |||
| 2303 | Ga0070713_100221359 | |||
| 2304 | Ga0070713_100238077 | |||
| 2305 | Ga0070713_100357060 | |||
| 2306 | Ga0070713_100375706 | |||
| 2307 | Ga0070713_100433450 | |||
| 2308 | Ga0070713_100472338 | |||
| 2309 | Ga0070713_100480418 | |||
| 2310 | Ga0070713_100481843 | |||
| 2311 | Ga0070713_100537792 | |||
| 2312 | Ga0070713_100636489 | |||
| 2313 | Ga0070713_100741326 | |||
| 2314 | Ga0070713_100760265 | |||
| 2315 | Ga0070713_100808713 | |||
| 2316 | Ga0070713_101083587 | |||
| 2317 | Ga0070713_101162407 | |||
| 2318 | Ga0070710_10015633 | |||
| 2319 | Ga0070710_10017745 | |||
| 2320 | Ga0070710_10021719 | |||
| 2321 | Ga0070710_10028294 | |||
| 2322 | Ga0070710_10068784 | |||
| 2323 | Ga0070710_10162273 | |||
| 2324 | Ga0070710_10238171 | |||
| 2325 | Ga0070710_10254505 | |||
| 2326 | Ga0070710_10430059 | |||
| 2327 | Ga0070710_10884248 | |||
| 2328 | Ga0070710_10888030 | |||
| 2329 | Ga0070701_10292121 | |||
| 2330 | Ga0070701_10310086 | |||
| 2331 | Ga0070711_100001103 | |||
| 2332 | Ga0070711_100004752 | |||
| 2333 | Ga0070711_100020447 | |||
| 2334 | Ga0070711_100030422 | |||
| 2335 | Ga0070711_100046688 | |||
| 2336 | Ga0070711_100088555 | |||
| 2337 | Ga0070711_100114487 | |||
| 2338 | Ga0070711_100122039 | |||
| 2339 | Ga0070711_100201069 | |||
| 2340 | Ga0070711_100222807 | |||
| 2341 | Ga0070711_100273761 | |||
| 2342 | Ga0070711_100375946 | |||
| 2343 | Ga0070711_100485689 | |||
| 2344 | Ga0070711_100553458 | |||
| 2345 | Ga0070711_100672705 | |||
| 2346 | Ga0070711_100789548 | |||
| 2347 | Ga0070711_100931047 | |||
| 2348 | Ga0070705_100334214 | |||
| 2349 | Ga0070705_100418645 | |||
| 2350 | Ga0070705_101346757 | |||
| 2351 | Ga0070694_100333374 | |||
| 2352 | Ga0070708_100000178 | |||
| 2353 | Ga0070708_100003771 | |||
| 2354 | Ga0070708_100010668 | |||
| 2355 | Ga0070708_100018556 | |||
| 2356 | Ga0070708_100019661 | |||
| 2357 | Ga0070708_100019711 | |||
| 2358 | Ga0070708_100033368 | |||
| 2359 | Ga0070708_100037136 | |||
| 2360 | Ga0070708_100053835 | |||
| 2361 | Ga0070708_100058833 | |||
| 2362 | Ga0070708_100070219 | |||
| 2363 | Ga0070708_100083298 | |||
| 2364 | Ga0070708_100105508 | |||
| 2365 | Ga0070708_100127490 | |||
| 2366 | Ga0070708_100319929 | |||
| 2367 | Ga0070708_100531462 | |||
| 2368 | Ga0070663_100010546 | |||
| 2369 | Ga0070663_100158984 | |||
| 2370 | Ga0070663_100362014 | |||
| 2371 | Ga0070678_100020766 | |||
| 2372 | Ga0070678_100269813 | |||
| 2373 | Ga0070678_100336612 | |||
| 2374 | Ga0070678_100729229 | |||
| 2375 | Ga0070678_101150850 | |||
| 2376 | Ga0070678_101213479 | |||
| 2377 | Ga0070662_100001840 | |||
| 2378 | Ga0070662_100013854 | |||
| 2379 | Ga0070662_100048772 | |||
| 2380 | Ga0070662_100115951 | |||
| 2381 | Ga0070681_10000242 | |||
| 2382 | Ga0070681_10001052 | |||
| 2383 | Ga0070681_10007304 | |||
| 2384 | Ga0070681_10037476 | |||
| 2385 | Ga0070681_10058089 | |||
| 2386 | Ga0070681_10149255 | |||
| 2387 | Ga0070681_10239335 | |||
| 2388 | Ga0070681_10559122 | |||
| 2389 | Ga0070681_10575054 | |||
| 2390 | Ga0070681_10673814 | |||
| 2391 | Ga0070681_11019370 | |||
| 2392 | Ga0068867_100002152 | |||
| 2393 | Ga0068867_100005036 | |||
| 2394 | Ga0068867_100007869 | |||
| 2395 | Ga0068867_100019151 | |||
| 2396 | Ga0068867_100127446 | |||
| 2397 | Ga0068867_100135238 | |||
| 2398 | Ga0068867_100242809 | |||
| 2399 | Ga0068867_100370711 | |||
| 2400 | Ga0068867_100449975 | |||
| 2401 | Ga0068867_100471519 | |||
| 2402 | Ga0068867_100484797 | |||
| 2403 | Ga0068867_100959091 | |||
| 2404 | Ga0070685_10011180 | |||
| 2405 | Ga0070685_10018085 | |||
| 2406 | Ga0070685_10363433 | |||
| 2407 | Ga0070706_100000430 | |||
| 2408 | Ga0070706_100000710 | |||
| 2409 | Ga0070706_100001963 | |||
| 2410 | Ga0070706_100002303 | |||
| 2411 | Ga0070706_100021815 | |||
| 2412 | Ga0070706_100026942 | |||
| 2413 | Ga0070706_100087906 | |||
| 2414 | Ga0070706_100139595 | |||
| 2415 | Ga0070706_100466111 | |||
| 2416 | Ga0070706_100479761 | |||
| 2417 | Ga0070706_100588595 | |||
| 2418 | Ga0070706_100651896 | |||
| 2419 | Ga0070707_100000607 | |||
| 2420 | Ga0070707_100000704 | |||
| 2421 | Ga0070707_100052713 | |||
| 2422 | Ga0070707_100106828 | |||
| 2423 | Ga0070707_100137114 | |||
| 2424 | Ga0070707_100160971 | |||
| 2425 | Ga0070707_100182686 | |||
| 2426 | Ga0070707_100236862 | |||
| 2427 | Ga0070707_100285897 | |||
| 2428 | Ga0070707_100330999 | |||
| 2429 | Ga0070707_100605953 | |||
| 2430 | Ga0070707_100793948 | |||
| 2431 | Ga0070698_100000091 | |||
| 2432 | Ga0070698_100003170 | |||
| 2433 | Ga0070698_100031612 | |||
| 2434 | Ga0070698_100216266 | |||
| 2435 | Ga0070698_100477767 | |||
| 2436 | Ga0070698_100638627 | |||
| 2437 | Ga0070698_100643587 | |||
| 2438 | Ga0070698_100871691 | |||
| 2439 | Ga0070699_100000556 | |||
| 2440 | Ga0070699_100074244 | |||
| 2441 | Ga0070699_100109392 | |||
| 2442 | Ga0070699_100131242 | |||
| 2443 | Ga0070699_101011671 | |||
| 2444 | Ga0070699_101361066 | |||
| 2445 | Ga0070679_100001381 | |||
| 2446 | Ga0070679_100025670 | |||
| 2447 | Ga0070679_100096995 | |||
| 2448 | Ga0070679_100098873 | |||
| 2449 | Ga0070679_100142669 | |||
| 2450 | Ga0070679_100180698 | |||
| 2451 | Ga0070679_100194609 | |||
| 2452 | Ga0070679_100413690 | |||
| 2453 | Ga0070679_100459801 | |||
| 2454 | Ga0070679_100973591 | |||
| 2455 | Ga0070684_100006558 | |||
| 2456 | Ga0070684_100007287 | |||
| 2457 | Ga0070684_100023353 | |||
| 2458 | Ga0070684_100027979 | |||
| 2459 | Ga0070684_100038647 | |||
| 2460 | Ga0070684_100041911 | |||
| 2461 | Ga0070684_100054241 | |||
| 2462 | Ga0070684_100057501 | |||
| 2463 | Ga0070684_100558673 | |||
| 2464 | Ga0070684_100825161 | |||
| 2465 | Ga0070697_100000111 | |||
| 2466 | Ga0070697_100000114 | |||
| 2467 | Ga0070697_100001108 | |||
| 2468 | Ga0070697_100001219 | |||
| 2469 | Ga0070697_100001461 | |||
| 2470 | Ga0070697_100006660 | |||
| 2471 | Ga0070697_100040910 | |||
| 2472 | Ga0070697_100059463 | |||
| 2473 | Ga0070697_100092278 | |||
| 2474 | Ga0070697_100141093 | |||
| 2475 | Ga0070697_100163163 | |||
| 2476 | Ga0070697_100166616 | |||
| 2477 | Ga0070697_100183765 | |||
| 2478 | Ga0070697_100242415 | |||
| 2479 | Ga0070697_100322984 | |||
| 2480 | Ga0070697_100583539 | |||
| 2481 | Ga0070697_101266263 | |||
| 2482 | Ga0068853_100011730 | |||
| 2483 | Ga0068853_100084923 | |||
| 2484 | Ga0068853_100089325 | |||
| 2485 | Ga0068853_100117335 | |||
| 2486 | Ga0068853_100123336 | |||
| 2487 | Ga0068853_100175087 | |||
| 2488 | Ga0068853_100490549 | |||
| 2489 | Ga0068853_100509924 | |||
| 2490 | Ga0070672_100295377 | |||
| 2491 | Ga0070686_100000992 | |||
| 2492 | Ga0070686_100329382 | |||
| 2493 | Ga0070686_101682734 | |||
| 2494 | Ga0070695_100132508 | |||
| 2495 | Ga0070695_100209500 | |||
| 2496 | Ga0070695_100475251 | |||
| 2497 | Ga0070696_100124015 | |||
| 2498 | Ga0070696_100165620 | |||
| 2499 | Ga0070693_100021527 | |||
| 2500 | Ga0070693_100076244 | |||
| 2501 | Ga0070693_100237398 | |||
| 2502 | Ga0070693_100251013 | |||
| 2503 | Ga0070693_100480445 | |||
| 2504 | Ga0070693_100992902 | |||
| 2505 | Ga0070665_100004447 | |||
| 2506 | Ga0070665_100052292 | |||
| 2507 | Ga0070665_100326174 | |||
| 2508 | Ga0070665_100335376 | |||
| 2509 | Ga0070665_100503023 | |||
| 2510 | Ga0070665_100661090 | |||
| 2511 | Ga0068855_100000722 | |||
| 2512 | Ga0068855_100001560 | |||
| 2513 | Ga0068855_100004114 | |||
| 2514 | Ga0068855_100014007 | |||
| 2515 | Ga0068855_100031428 | |||
| 2516 | Ga0068855_100061459 | |||
| 2517 | Ga0068855_100107535 | |||
| 2518 | Ga0068855_100152779 | |||
| 2519 | Ga0068855_100226813 | |||
| 2520 | Ga0068855_100244096 | |||
| 2521 | Ga0068855_100294204 | |||
| 2522 | Ga0068855_101073574 | |||
| 2523 | Ga0070664_100003973 | |||
| 2524 | Ga0070664_100008728 | |||
| 2525 | Ga0070664_100035323 | |||
| 2526 | Ga0070664_100075959 | |||
| 2527 | Ga0070664_100091351 | |||
| 2528 | Ga0070664_100139034 | |||
| 2529 | Ga0070664_100178614 | |||
| 2530 | Ga0070664_100201464 | |||
| 2531 | Ga0070664_101186033 | |||
| 2532 | Ga0068857_100000430 | |||
| 2533 | Ga0068857_100000538 | |||
| 2534 | Ga0068857_100006903 | |||
| 2535 | Ga0068857_100018258 | |||
| 2536 | Ga0068857_100043047 | |||
| 2537 | Ga0068857_100064768 | |||
| 2538 | Ga0068857_100074902 | |||
| 2539 | Ga0068857_100110225 | |||
| 2540 | Ga0068857_100225005 | |||
| 2541 | Ga0068857_100240545 | |||
| 2542 | Ga0068857_100459544 | |||
| 2543 | Ga0068857_100542422 | |||
| 2544 | Ga0068854_100010535 | |||
| 2545 | Ga0068854_100028598 | |||
| 2546 | Ga0068854_100073521 | |||
| 2547 | Ga0068854_100092927 | |||
| 2548 | Ga0068854_100263231 | |||
| 2549 | Ga0068854_101289047 | |||
| 2550 | Ga0068856_100000618 | |||
| 2551 | Ga0068856_100000893 | |||
| 2552 | Ga0068856_100004426 | |||
| 2553 | Ga0068856_100005515 | |||
| 2554 | Ga0068856_100009769 | |||
| 2555 | Ga0068856_100016707 | |||
| 2556 | Ga0068856_100018332 | |||
| 2557 | Ga0068856_100035221 | |||
| 2558 | Ga0068856_100052289 | |||
| 2559 | Ga0068856_100134565 | |||
| 2560 | Ga0068856_100174564 | |||
| 2561 | Ga0068856_100266068 | |||
| 2562 | Ga0068856_100273735 | |||
| 2563 | Ga0068856_100318831 | |||
| 2564 | Ga0068856_100445536 | |||
| 2565 | Ga0068856_100623635 | |||
| 2566 | Ga0070702_100008267 | |||
| 2567 | Ga0070702_100117046 | |||
| 2568 | Ga0070702_100578343 | |||
| 2569 | Ga0068852_100052727 | |||
| 2570 | Ga0068852_100073031 | |||
| 2571 | Ga0068852_100078382 | |||
| 2572 | Ga0068852_100091322 | |||
| 2573 | Ga0068852_100148485 | |||
| 2574 | Ga0068852_100153539 | |||
| 2575 | Ga0068852_100523010 | |||
| 2576 | Ga0068852_100531833 | |||
| 2577 | Ga0068852_100698552 | |||
| 2578 | Ga0068852_101160900 | |||
| 2579 | Ga0068852_101628556 | |||
| 2580 | Ga0068859_100012661 | |||
| 2581 | Ga0068859_100020364 | |||
| 2582 | Ga0068859_100064830 | |||
| 2583 | Ga0068859_100129661 | |||
| 2584 | Ga0068859_100511823 | |||
| 2585 | Ga0068859_101089392 | |||
| 2586 | Ga0068859_101177054 | |||
| 2587 | Ga0068864_100001201 | |||
| 2588 | Ga0068864_100016519 | |||
| 2589 | Ga0068864_100018035 | |||
| 2590 | Ga0068864_100053666 | |||
| 2591 | Ga0068864_100265879 | |||
| 2592 | Ga0068864_100553209 | |||
| 2593 | Ga0068864_100710051 | |||
| 2594 | Ga0068866_10004569 | |||
| 2595 | Ga0068866_10006928 | |||
| 2596 | Ga0068866_10011478 | |||
| 2597 | Ga0068866_10021108 | |||
| 2598 | Ga0068866_10052758 | |||
| 2599 | Ga0068866_10159124 | |||
| 2600 | Ga0068866_10242928 | |||
| 2601 | Ga0068866_10243876 | |||
| 2602 | Ga0068861_100111519 | |||
| 2603 | Ga0068861_101246502 | |||
| 2604 | Ga0068851_10000768 | |||
| 2605 | Ga0068851_10010134 | |||
| 2606 | Ga0068851_10031502 | |||
| 2607 | Ga0068851_10077006 | |||
| 2608 | Ga0068870_10003013 | |||
| 2609 | Ga0068870_10128130 | |||
| 2610 | Ga0068870_10228920 | |||
| 2611 | Ga0068863_100030358 | |||
| 2612 | Ga0068863_100072368 | |||
| 2613 | Ga0068863_100072387 | |||
| 2614 | Ga0068863_100091923 | |||
| 2615 | Ga0068863_100225206 | |||
| 2616 | Ga0068863_100356631 | |||
| 2617 | Ga0068863_100424164 | |||
| 2618 | Ga0068863_100786600 | |||
| 2619 | Ga0068858_100001918 | |||
| 2620 | Ga0068858_100004951 | |||
| 2621 | Ga0068858_100011743 | |||
| 2622 | Ga0068858_100015080 | |||
| 2623 | Ga0068858_100015573 | |||
| 2624 | Ga0068858_100044143 | |||
| 2625 | Ga0068858_100067719 | |||
| 2626 | Ga0068858_100136778 | |||
| 2627 | Ga0068858_100157154 | |||
| 2628 | Ga0068858_100244776 | |||
| 2629 | Ga0068860_100009019 | |||
| 2630 | Ga0068860_100020415 | |||
| 2631 | Ga0068860_100031193 | |||
| 2632 | Ga0068860_100039235 | |||
| 2633 | Ga0068860_100043099 | |||
| 2634 | Ga0068860_100071482 | |||
| 2635 | Ga0068860_100167531 | |||
| 2636 | Ga0068860_100196125 | |||
| 2637 | Ga0068860_100328244 | |||
| 2638 | Ga0068860_100361747 | |||
| 2639 | Ga0068860_100429487 | |||
| 2640 | Ga0068860_100462054 | |||
| 2641 | Ga0068860_100676324 | |||
| 2642 | Ga0068862_100062550 | |||
| 2643 | Ga0068862_100159946 | |||
| 2644 | Ga0068862_100185764 | |||
| 2645 | Ga0070717_10000706 | |||
| 2646 | Ga0070717_10005162 | |||
| 2647 | Ga0070717_10005425 | |||
| 2648 | Ga0070717_10011062 | |||
| 2649 | Ga0070717_10017266 | |||
| 2650 | Ga0070717_10025423 | |||
| 2651 | Ga0070717_10034487 | |||
| 2652 | Ga0070717_10039339 | |||
| 2653 | Ga0070717_10045761 | |||
| 2654 | Ga0070717_10066177 | |||
| 2655 | Ga0070717_10079516 | |||
| 2656 | Ga0070717_10083277 | |||
| 2657 | Ga0070717_10136092 | |||
| 2658 | Ga0070717_10163120 | |||
| 2659 | Ga0070717_10163928 | |||
| 2660 | Ga0070717_10172318 | |||
| 2661 | Ga0070717_10203065 | |||
| 2662 | Ga0070717_10221909 | |||
| 2663 | Ga0070717_10234313 | |||
| 2664 | Ga0070717_10235901 | |||
| 2665 | Ga0070717_10288492 | |||
| 2666 | Ga0070717_10366748 | |||
| 2667 | Ga0070717_10452837 | |||
| 2668 | Ga0070717_10576470 | |||
| 2669 | Ga0070717_10762338 | |||
| 2670 | Ga0070717_10911947 | |||
| 2671 | Ga0070717_10916983 | |||
| 2672 | Ga0070717_10980203 | |||
| 2673 | Ga0070715_10003791 | |||
| 2674 | Ga0070715_10006634 | |||
| 2675 | Ga0070715_10037422 | |||
| 2676 | Ga0070715_10084753 | |||
| 2677 | Ga0070715_10091611 | |||
| 2678 | Ga0070715_10126251 | |||
| 2679 | Ga0070715_10405407 | |||
| 2680 | Ga0070715_10478559 | |||
| 2681 | Ga0070716_100000053 | |||
| 2682 | Ga0070716_100001666 | |||
| 2683 | Ga0070716_100002780 | |||
| 2684 | Ga0070716_100004145 | |||
| 2685 | Ga0070716_100004434 | |||
| 2686 | Ga0070716_100022462 | |||
| 2687 | Ga0070716_100032373 | |||
| 2688 | Ga0070716_100038836 | |||
| 2689 | Ga0070716_100043243 | |||
| 2690 | Ga0070716_100075532 | |||
| 2691 | Ga0070716_100148197 | |||
| 2692 | Ga0070716_100159551 | |||
| 2693 | Ga0070716_100174715 | |||
| 2694 | Ga0070716_100430404 | |||
| 2695 | Ga0070716_100441167 | |||
| 2696 | Ga0070716_100503756 | |||
| 2697 | Ga0070716_100781908 | |||
| 2698 | Ga0070716_100923378 | |||
| 2699 | Ga0070716_101335274 | |||
| 2700 | Ga0070712_100000245 | |||
| 2701 | Ga0070712_100000883 | |||
| 2702 | Ga0070712_100001242 | |||
| 2703 | Ga0070712_100001620 | |||
| 2704 | Ga0070712_100002079 | |||
| 2705 | Ga0070712_100003518 | |||
| 2706 | Ga0070712_100004827 | |||
| 2707 | Ga0070712_100016276 | |||
| 2708 | Ga0070712_100023337 | |||
| 2709 | Ga0070712_100027410 | |||
| 2710 | Ga0070712_100051755 | |||
| 2711 | Ga0070712_100062286 | |||
| 2712 | Ga0070712_100107575 | |||
| 2713 | Ga0070712_100177853 | |||
| 2714 | Ga0070712_100231151 | |||
| 2715 | Ga0070712_100268367 | |||
| 2716 | Ga0070712_100289223 | |||
| 2717 | Ga0070712_100451364 | |||
| 2718 | Ga0070712_100489346 | |||
| 2719 | Ga0070712_100522873 | |||
| 2720 | Ga0070712_100612454 | |||
| 2721 | Ga0070712_100944647 | |||
| 2722 | Ga0070712_101087706 | |||
| 2723 | Ga0070712_101402608 | |||
| 2724 | Ga0097621_100000058 | |||
| 2725 | Ga0097621_100000214 | |||
| 2726 | Ga0097621_100000258 | |||
| 2727 | Ga0097621_100000912 | |||
| 2728 | Ga0097621_100007274 | |||
| 2729 | Ga0097621_100017536 | |||
| 2730 | Ga0097621_100019462 | |||
| 2731 | Ga0097621_100028897 | |||
| 2732 | Ga0097621_100073050 | |||
| 2733 | Ga0097621_100074005 | |||
| 2734 | Ga0097621_100100674 | |||
| 2735 | Ga0097621_100128639 | |||
| 2736 | Ga0097621_100233594 | |||
| 2737 | Ga0097621_100289597 | |||
| 2738 | Ga0097621_100466076 | |||
| 2739 | Ga0097621_100468894 | |||
| 2740 | Ga0097621_100617046 | |||
| 2741 | Ga0068871_100000167 | |||
| 2742 | Ga0068871_100001429 | |||
| 2743 | Ga0068871_100002785 | |||
| 2744 | Ga0068871_100005906 | |||
| 2745 | Ga0068871_100006017 | |||
| 2746 | Ga0068871_100008022 | |||
| 2747 | Ga0068871_100019578 | |||
| 2748 | Ga0068871_100026119 | |||
| 2749 | Ga0068871_100055484 | |||
| 2750 | Ga0068871_100073483 | |||
| 2751 | Ga0068871_100155421 | |||
| 2752 | Ga0068871_100197694 | |||
| 2753 | Ga0068871_100662049 | |||
| 2754 | Ga0075433_10000887 | |||
| 2755 | Ga0075433_10048044 | |||
| 2756 | Ga0075433_10127073 | |||
| 2757 | Ga0075433_10139473 | |||
| 2758 | Ga0075433_10253992 | |||
| 2759 | Ga0075434_100000143 | |||
| 2760 | Ga0075434_100000462 | |||
| 2761 | Ga0075434_100017865 | |||
| 2762 | Ga0075434_100020014 | |||
| 2763 | Ga0075434_100050988 | |||
| 2764 | Ga0075434_100075591 | |||
| 2765 | Ga0075434_100084874 | |||
| 2766 | Ga0075434_100120080 | |||
| 2767 | Ga0075434_100623995 | |||
| 2768 | Ga0075429_100561199 | |||
| 2769 | Ga0068865_100007234 | |||
| 2770 | Ga0068865_100017624 | |||
| 2771 | Ga0068865_100040411 | |||
| 2772 | Ga0068865_100067336 | |||
| 2773 | Ga0068865_100082206 | |||
| 2774 | Ga0068865_100142863 | |||
| 2775 | Ga0068865_100217276 | |||
| 2776 | Ga0068865_100297623 | |||
| 2777 | Ga0068865_100655626 | |||
| 2778 | Ga0075436_100006013 | |||
| 2779 | Ga0075436_100019838 | |||
| 2780 | Ga0075436_100123796 | |||
| 2781 | Ga0075436_100125432 | |||
| 2782 | Ga0075436_100295295 | |||
| 2783 | Ga0075436_100401618 | |||
| 2784 | Ga0075436_100728590 | |||
| 2785 | Ga0075436_101101299 | |||
| 2786 | Ga0097620_100012661 | |||
| 2787 | Ga0097620_100020363 | |||
| 2788 | Ga0097620_100064832 | |||
| 2789 | Ga0097620_100129653 | |||
| 2790 | Ga0097620_100511815 | |||
| 2791 | Ga0097620_101089426 | |||
| 2792 | Ga0097620_101177455 | |||
| 2793 | Ga0075435_100000097 | |||
| 2794 | Ga0075435_100008506 | |||
| 2795 | Ga0075435_100019078 | |||
| 2796 | Ga0075435_100047665 | |||
| 2797 | Ga0075435_100048854 | |||
| 2798 | Ga0075435_100069224 | |||
| 2799 | Ga0075435_100326260 | |||
| 2800 | Ga0075435_101628623 | |||
| 2801 | Ga0099794_10121978 | |||
| 2802 | Ga0099795_10065329 | |||
| 2803 | Ga0105251_10300231 | |||
| 2804 | Ga0105250_10260091 | |||
| 2805 | Ga0105240_10009153 | |||
| 2806 | Ga0105240_10025327 | |||
| 2807 | Ga0105240_10047077 | |||
| 2808 | Ga0105240_10106642 | |||
| 2809 | Ga0105240_10163926 | |||
| 2810 | Ga0105240_10166929 | |||
| 2811 | Ga0105240_10293490 | |||
| 2812 | Ga0105240_10397030 | |||
| 2813 | Ga0105240_10718666 | |||
| 2814 | Ga0105240_11160838 | |||
| 2815 | Ga0111539_11219315 | |||
| 2816 | Ga0105245_10000435 | |||
| 2817 | Ga0105245_10014444 | |||
| 2818 | Ga0105245_10082441 | |||
| 2819 | Ga0105245_10143086 | |||
| 2820 | Ga0105245_10220745 | |||
| 2821 | Ga0105245_10421157 | |||
| 2822 | Ga0105247_10006697 | |||
| 2823 | Ga0105247_10027839 | |||
| 2824 | Ga0105247_10031755 | |||
| 2825 | Ga0105247_10135865 | |||
| 2826 | Ga0105247_10152677 | |||
| 2827 | Ga0105247_10273797 | |||
| 2828 | Ga0114129_10010746 | |||
| 2829 | Ga0114129_12261013 | |||
| 2830 | Ga0105243_10069911 | |||
| 2831 | Ga0105243_10603415 | |||
| 2832 | Ga0105241_10000938 | |||
| 2833 | Ga0105241_10015728 | |||
| 2834 | Ga0105241_10025197 | |||
| 2835 | Ga0105241_10032232 | |||
| 2836 | Ga0105241_10078333 | |||
| 2837 | Ga0105241_10082499 | |||
| 2838 | Ga0105241_10126781 | |||
| 2839 | Ga0105241_10131715 | |||
| 2840 | Ga0105241_10233286 | |||
| 2841 | Ga0105241_10264100 | |||
| 2842 | Ga0105241_10536205 | |||
| 2843 | Ga0105241_10778362 | |||
| 2844 | Ga0105241_10985699 | |||
| 2845 | Ga0105241_11284358 | |||
| 2846 | Ga0105242_10017283 | |||
| 2847 | Ga0105242_10052411 | |||
| 2848 | Ga0105242_10133098 | |||
| 2849 | Ga0105242_10461366 | |||
| 2850 | Ga0105248_10020678 | |||
| 2851 | Ga0105248_10028479 | |||
| 2852 | Ga0105248_10062653 | |||
| 2853 | Ga0105248_10139012 | |||
| 2854 | Ga0105248_10187701 | |||
| 2855 | Ga0105248_10220322 | |||
| 2856 | Ga0105248_10260008 | |||
| 2857 | Ga0105248_10348587 | |||
| 2858 | Ga0105248_10478995 | |||
| 2859 | Ga0105248_10635874 | |||
| 2860 | Ga0105248_10829756 | |||
| 2861 | Ga0105237_10064690 | |||
| 2862 | Ga0105237_10086868 | |||
| 2863 | Ga0105237_10120324 | |||
| 2864 | Ga0105237_10125221 | |||
| 2865 | Ga0105237_10132307 | |||
| 2866 | Ga0105237_10138112 | |||
| 2867 | Ga0105237_10200533 | |||
| 2868 | Ga0105237_10262432 | |||
| 2869 | Ga0105237_10268576 | |||
| 2870 | Ga0105237_10283368 | |||
| 2871 | Ga0105237_10472028 | |||
| 2872 | Ga0105237_10472404 | |||
| 2873 | Ga0105237_10496256 | |||
| 2874 | Ga0105237_10527855 | |||
| 2875 | Ga0105237_10868981 | |||
| 2876 | Ga0105237_10948345 | |||
| 2877 | Ga0105237_10991107 | |||
| 2878 | Ga0105237_11034034 | |||
| 2879 | Ga0105237_11296670 | |||
| 2880 | Ga0105238_10000552 | |||
| 2881 | Ga0105238_10028704 | |||
| 2882 | Ga0105238_10040557 | |||
| 2883 | Ga0105238_10070810 | |||
| 2884 | Ga0105238_10158398 | |||
| 2885 | Ga0105238_10380117 | |||
| 2886 | Ga0105238_10417173 | |||
| 2887 | Ga0105238_10839222 | |||
| 2888 | Ga0105238_11765441 | |||
| 2889 | Ga0105249_10063330 | |||
| 2890 | Ga0105249_10102027 | |||
| 2891 | Ga0105249_10255672 | |||
| 2892 | Ga0105249_10850205 | |||
| 2893 | Ga0099796_10131439 | |||
| 2894 | Ga0105239_10052078 | |||
| 2895 | Ga0105239_10099794 | |||
| 2896 | Ga0105239_10137305 | |||
| 2897 | Ga0105239_10155368 | |||
| 2898 | Ga0105239_10174907 | |||
| 2899 | Ga0105239_10206191 | |||
| 2900 | Ga0105239_10230253 | |||
| 2901 | Ga0105239_10379772 | |||
| 2902 | Ga0105239_10765117 | |||
| 2903 | Ga0105239_10826520 | |||
| 2904 | Ga0105239_10849721 | |||
| 2905 | Ga0105239_10931041 | |||
| 2906 | Ga0105246_10008782 | |||
| 2907 | Ga0105246_10025952 | |||
| 2908 | Ga0105246_10165923 | |||
| 2909 | Ga0105246_10187967 | |||
| 2910 | Ga0105246_10596240 | |||
| 2911 | Ga0157342_1008036 | |||
| 2912 | Ga0154016_121265 | |||
| 2913 | Ga0157373_10002001 | |||
| 2914 | Ga0157373_10012901 | |||
| 2915 | Ga0157373_10013891 | |||
| 2916 | Ga0157373_10020693 | |||
| 2917 | Ga0157373_10033416 | |||
| 2918 | Ga0157373_10036182 | |||
| 2919 | Ga0157373_10049697 | |||
| 2920 | Ga0157373_10310322 | |||
| 2921 | Ga0157373_10317153 | |||
| 2922 | Ga0157373_10356713 | |||
| 2923 | Ga0157371_10031090 | |||
| 2924 | Ga0157371_10034360 | |||
| 2925 | Ga0157371_10097836 | |||
| 2926 | Ga0157371_10634512 | |||
| 2927 | Ga0157370_10153738 | |||
| 2928 | Ga0157370_10174783 | |||
| 2929 | Ga0157370_10542901 | |||
| 2930 | Ga0157370_10667322 | |||
| 2931 | Ga0157370_10702637 | |||
| 2932 | Ga0157370_10849127 | |||
| 2933 | Ga0157369_10000592 | |||
| 2934 | Ga0157369_10010252 | |||
| 2935 | Ga0157369_10010541 | |||
| 2936 | Ga0157369_10107692 | |||
| 2937 | Ga0157369_10220070 | |||
| 2938 | Ga0157369_10333976 | |||
| 2939 | Ga0157369_10395093 | |||
| 2940 | Ga0157369_10543616 | |||
| 2941 | Ga0157369_10563591 | |||
| 2942 | Ga0157369_10585342 | |||
| 2943 | Ga0157369_10708217 | |||
| 2944 | Ga0157369_11462205 | |||
| 2945 | Ga0157374_10000181 | |||
| 2946 | Ga0157374_10000441 | |||
| 2947 | Ga0157374_10000669 | |||
| 2948 | Ga0157374_10002847 | |||
| 2949 | Ga0157374_10003184 | |||
| 2950 | Ga0157374_10004152 | |||
| 2951 | Ga0157374_10010585 | |||
| 2952 | Ga0157374_10024679 | |||
| 2953 | Ga0157374_10050889 | |||
| 2954 | Ga0157374_10063644 | |||
| 2955 | Ga0157374_10085882 | |||
| 2956 | Ga0157374_10090359 | |||
| 2957 | Ga0157374_10092356 | |||
| 2958 | Ga0157374_10267208 | |||
| 2959 | Ga0157374_10365133 | |||
| 2960 | Ga0157374_10372812 | |||
| 2961 | Ga0157374_10619788 | |||
| 2962 | Ga0157374_11082467 | |||
| 2963 | Ga0157378_10000183 | |||
| 2964 | Ga0157378_10000680 | |||
| 2965 | Ga0157378_10000980 | |||
| 2966 | Ga0157378_10003268 | |||
| 2967 | Ga0157378_10007887 | |||
| 2968 | Ga0157378_10045247 | |||
| 2969 | Ga0157378_10048288 | |||
| 2970 | Ga0157378_10091209 | |||
| 2971 | Ga0157378_10151675 | |||
| 2972 | Ga0157378_10167510 | |||
| 2973 | Ga0157378_10169798 | |||
| 2974 | Ga0157378_10276505 | |||
| 2975 | Ga0157378_10311172 | |||
| 2976 | Ga0157378_10342546 | |||
| 2977 | Ga0157378_10675456 | |||
| 2978 | Ga0157378_11107315 | |||
| 2979 | Ga0157378_12122956 | |||
| 2980 | Ga0163162_10005932 | |||
| 2981 | Ga0163162_10010650 | |||
| 2982 | Ga0163162_10012073 | |||
| 2983 | Ga0163162_10014846 | |||
| 2984 | Ga0163162_10048730 | |||
| 2985 | Ga0163162_10089492 | |||
| 2986 | Ga0163162_10328458 | |||
| 2987 | Ga0163162_11366272 | |||
| 2988 | Ga0157372_10000685 | |||
| 2989 | Ga0157372_10001790 | |||
| 2990 | Ga0157372_10007825 | |||
| 2991 | Ga0157372_10010095 | |||
| 2992 | Ga0157372_10013222 | |||
| 2993 | Ga0157372_10020965 | |||
| 2994 | Ga0157372_10091930 | |||
| 2995 | Ga0157372_10119777 | |||
| 2996 | Ga0157372_10155597 | |||
| 2997 | Ga0157372_10213541 | |||
| 2998 | Ga0157372_10300787 | |||
| 2999 | Ga0157372_10328273 | |||
| 3000 | Ga0157372_10332101 | |||
| 3001 | Ga0157372_10349444 | |||
| 3002 | Ga0157372_10365769 | |||
| 3003 | Ga0157372_10652478 | |||
| 3004 | Ga0157372_11590608 | |||
| 3005 | Ga0157375_10008727 | |||
| 3006 | Ga0157375_10028055 | |||
| 3007 | Ga0157375_10045953 | |||
| 3008 | Ga0157375_10132623 | |||
| 3009 | Ga0157375_10232146 | |||
| 3010 | Ga0157375_10396784 | |||
| 3011 | Ga0157375_10868750 | |||
| 3012 | Ga0157375_11132831 | |||
| 3013 | Ga0157375_11572232 | |||
| 3014 | Ga0157375_11883865 | |||
| 3015 | Ga0157375_12034875 | |||
| 3016 | Ga0163163_10058592 | |||
| 3017 | Ga0163163_10097583 | |||
| 3018 | Ga0163163_10183345 | |||
| 3019 | Ga0163163_10186510 | |||
| 3020 | Ga0163163_10191165 | |||
| 3021 | Ga0163163_10192881 | |||
| 3022 | Ga0163163_10225225 | |||
| 3023 | Ga0163163_10242306 | |||
| 3024 | Ga0163163_10424392 | |||
| 3025 | Ga0163163_11548357 | |||
| 3026 | Ga0157380_10044130 | |||
| 3027 | Ga0157380_10802759 | |||
| 3028 | Ga0182008_10099708 | |||
| 3029 | Ga0182008_10169143 | |||
| 3030 | Ga0182008_10252772 | |||
| 3031 | Ga0157377_10004630 | |||
| 3032 | Ga0157377_10127287 | |||
| 3033 | Ga0157377_10237372 | |||
| 3034 | Ga0157377_10686572 | |||
| 3035 | Ga0157379_10029300 | |||
| 3036 | Ga0157379_10033714 | |||
| 3037 | Ga0157379_10048814 | |||
| 3038 | Ga0157379_10151334 | |||
| 3039 | Ga0157379_10179925 | |||
| 3040 | Ga0157379_10201322 | |||
| 3041 | Ga0157379_10392664 | |||
| 3042 | Ga0157379_10400093 | |||
| 3043 | Ga0157379_10447080 | |||
| 3044 | Ga0157376_10046987 | |||
| 3045 | Ga0157376_10056221 | |||
| 3046 | Ga0157376_10081575 | |||
| 3047 | Ga0157376_10150690 | |||
| 3048 | Ga0157376_10197089 | |||
| 3049 | Ga0182006_1077007 | |||
| 3050 | Ga0182007_10009581 | |||
| 3051 | Ga0182007_10046823 | |||
| 3052 | Ga0182007_10050526 | |||
| 3053 | Ga0182005_1023597 | |||
| 3054 | Ga0163161_10013876 | |||
| 3055 | Ga0163161_10366939 | |||
| 3056 | Ga0184602_106269 | |||
| 3057 | Ga0184602_109861 | |||
| 3058 | Ga0184595_120694 | |||
| 3059 | Ga0184598_100081 | |||
| 3060 | Ga0184598_115043 | |||
| 3061 | Ga0184598_145996 | |||
| 3062 | Ga0184601_107723 | |||
| 3063 | Ga0184601_129239 | |||
| 3064 | Ga0184601_130551 | |||
| 3065 | Ga0184599_102866 | |||
| 3066 | Ga0184599_103104 | |||
| 3067 | Ga0184599_110615 | |||
| 3068 | Ga0184599_124047 | |||
| 3069 | Ga0184599_131861 | |||
| 3070 | Ga0184599_142771 | |||
| 3071 | Ga0184600_119842 | |||
| 3072 | Ga0184600_120803 | |||
| 3073 | Ga0184600_123884 | |||
| 3074 | Ga0184600_126708 | |||
| 3075 | Ga0184600_137157 | |||
| 3076 | Ga0184600_142494 | |||
| 3077 | Ga0184600_143183 | |||
| 3078 | Ga0184603_105345 | |||
| 3079 | Ga0184603_114215 | |||
| 3080 | Ga0184603_117323 | |||
| 3081 | Ga0184603_131582 | |||
| 3082 | Ga0184603_138916 | |||
| 3083 | Ga0184603_140924 | |||
| 3084 | Ga0184603_142059 | |||
| 3085 | Ga0184603_152573 | |||
| 3086 | Ga0197907_10084420 | |||
| 3087 | Ga0197907_10564868 | |||
| 3088 | Ga0197907_10936568 | |||
| 3089 | Ga0197907_10983481 | |||
| 3090 | Ga0197907_11085293 | |||
| 3091 | Ga0197907_11105990 | |||
| 3092 | Ga0197907_11112728 | |||
| 3093 | Ga0197907_11170937 | |||
| 3094 | Ga0197907_11172515 | |||
| 3095 | Ga0197907_11195871 | |||
| 3096 | Ga0206356_10441556 | |||
| 3097 | Ga0206356_10570719 | |||
| 3098 | Ga0206356_10822215 | |||
| 3099 | Ga0206356_11185349 | |||
| 3100 | Ga0206356_11295561 | |||
| 3101 | Ga0206356_11671056 | |||
| 3102 | Ga0206356_11683825 | |||
| 3103 | Ga0206356_11883121 | |||
| 3104 | Ga0206349_1015588 | |||
| 3105 | Ga0206349_1037644 | |||
| 3106 | Ga0206349_1456218 | |||
| 3107 | Ga0206349_1460947 | |||
| 3108 | Ga0206349_1563308 | |||
| 3109 | Ga0206349_1719180 | |||
| 3110 | Ga0206349_1834150 | |||
| 3111 | Ga0206355_1009431 | |||
| 3112 | Ga0206355_1153129 | |||
| 3113 | Ga0206355_1230871 | |||
| 3114 | Ga0206355_1416264 | |||
| 3115 | Ga0206355_1553201 | |||
| 3116 | Ga0206355_1690397 | |||
| 3117 | Ga0206355_1710496 | |||
| 3118 | Ga0206355_1716887 | |||
| 3119 | Ga0206351_10014578 | |||
| 3120 | Ga0206351_10056875 | |||
| 3121 | Ga0206351_10303508 | |||
| 3122 | Ga0206351_10350621 | |||
| 3123 | Ga0206351_10354870 | |||
| 3124 | Ga0206351_10363783 | |||
| 3125 | Ga0206351_10430873 | |||
| 3126 | Ga0206351_10442687 | |||
| 3127 | Ga0206351_10507452 | |||
| 3128 | Ga0206351_10517272 | |||
| 3129 | Ga0206351_10536639 | |||
| 3130 | Ga0206351_10578521 | |||
| 3131 | Ga0206351_10715667 | |||
| 3132 | Ga0206351_10758291 | |||
| 3133 | Ga0206351_11004638 | |||
| 3134 | Ga0206352_10117765 | |||
| 3135 | Ga0206352_10169050 | |||
| 3136 | Ga0206352_10258708 | |||
| 3137 | Ga0206352_10339657 | |||
| 3138 | Ga0206352_10363745 | |||
| 3139 | Ga0206352_10454458 | |||
| 3140 | Ga0206352_10496089 | |||
| 3141 | Ga0206352_11082821 | |||
| 3142 | Ga0206352_11288835 | |||
| 3143 | Ga0206352_11362225 | |||
| 3144 | Ga0206350_10168586 | |||
| 3145 | Ga0206350_10198168 | |||
| 3146 | Ga0206350_10307226 | |||
| 3147 | Ga0206350_10387789 | |||
| 3148 | Ga0206350_10556898 | |||
| 3149 | Ga0206350_10670875 | |||
| 3150 | Ga0206350_10758558 | |||
| 3151 | Ga0206350_10854374 | |||
| 3152 | Ga0206350_11244989 | |||
| 3153 | Ga0206350_11276827 | |||
| 3154 | Ga0206350_11568119 | |||
| 3155 | Ga0206354_10075735 | |||
| 3156 | Ga0206354_10183032 | |||
| 3157 | Ga0206354_10709426 | |||
| 3158 | Ga0206354_10740595 | |||
| 3159 | Ga0206354_11316437 | |||
| 3160 | Ga0206354_11541019 | |||
| 3161 | Ga0206353_10170859 | |||
| 3162 | Ga0206353_10359605 | |||
| 3163 | Ga0206353_10638938 | |||
| 3164 | Ga0206353_10702936 | |||
| 3165 | Ga0206353_11510999 | |||
| 3166 | Ga0154015_1009788 | |||
| 3167 | Ga0154015_1327883 | |||
| 3168 | Ga0154015_1328348 | |||
| 3169 | Ga0154015_1401913 | |||
| 3170 | Ga0154015_1415416 | |||
| 3171 | Ga0154015_1448305 | |||
| 3172 | Ga0154015_1545072 | |||
| 3173 | Ga0154015_1632807 | |||
| 3174 | Ga0213876_10357091 | |||
| 3175 | Ga0213871_10148271 | |||
| 3176 | Ga0224712_10008765 | |||
| 3177 | Ga0224712_10102778 | |||
| 3178 | Ga0224712_10126991 | |||
| 3179 | Ga0224712_10164097 | |||
| 3180 | Ga0224712_10165116 | |||
| 3181 | Ga0224712_10226632 | |||
| 3182 | Ga0224712_10245654 | |||
| 3183 | Ga0224712_10245664 | |||
| 3184 | Ga0224712_10262616 | |||
| 3185 | Ga0224712_10274837 | |||
| 3186 | Ga0224712_10277683 | |||
| 3187 | Ga0224712_10292094 | |||
| 3188 | Ga0224712_10313110 | |||
| 3189 | Ga0224712_10355767 | |||
| 3190 | Ga0224712_10362880 | |||
| 3191 | Ga0224712_10371925 | |||
| 3192 | Ga0224712_10493541 | |||
| 3193 | Ga0224712_10517472 | |||
| 3194 | Ga0224712_10566993 | |||
| 3195 | Ga0224570_100259 | |||
| 3196 | Ga0224569_100095 | |||
| 3197 | Ga0224571_100363 | |||
| 3198 | Ga0247552_101548 | |||
| 3199 | Ga0247555_100282 | |||
| 3200 | Ga0247555_100656 | |||
| 3201 | Ga0247555_101592 | |||
| 3202 | Ga0247555_101933 | |||
| 3203 | Ga0247555_102612 | |||
| 3204 | Ga0247555_102616 | |||
| 3205 | Ga0247554_100243 | |||
| 3206 | Ga0247554_103375 | |||
| 3207 | Ga0247527_112489 | |||
| 3208 | Ga0247525_115464 | |||
| 3209 | Ga0247553_101269 | |||
| 3210 | Ga0247553_103670 | |||
| 3211 | Ga0247553_104285 | |||
| 3212 | Ga0247553_104650 | |||
| 3213 | Ga0247553_104670 | |||
| 3214 | Ga0247553_106330 | |||
| 3215 | Ga0247553_106912 | |||
| 3216 | Ga0247553_108607 | |||
| 3217 | Ga0247553_108613 | |||
| 3218 | Ga0247553_108659 | |||
| 3219 | Ga0247553_109550 | |||
| 3220 | Ga0224572_1000054 | |||
| 3221 | Ga0224572_1004413 | |||
| 3222 | Ga0228598_1000204 | |||
| 3223 | Ga0228598_1001159 | |||
| 3224 | Ga0228598_1002707 | |||
| 3225 | Ga0228598_1009508 | |||
| 3226 | Ga0207697_10008045 | |||
| 3227 | Ga0207697_10062920 | |||
| 3228 | Ga0207697_10103769 | |||
| 3229 | Ga0207656_10010107 | |||
| 3230 | Ga0207656_10057008 | |||
| 3231 | Ga0207656_10174310 | |||
| 3232 | Ga0207656_10325353 | |||
| 3233 | Ga0207653_10257307 | |||
| 3234 | Ga0207682_10006790 | |||
| 3235 | Ga0207682_10053388 | |||
| 3236 | Ga0207692_10009832 | |||
| 3237 | Ga0207692_10068561 | |||
| 3238 | Ga0207692_10072825 | |||
| 3239 | Ga0207692_10135856 | |||
| 3240 | Ga0207692_10246757 | |||
| 3241 | Ga0207692_10252754 | |||
| 3242 | Ga0207692_10356218 | |||
| 3243 | Ga0207692_10379170 | |||
| 3244 | Ga0207642_10002007 | |||
| 3245 | Ga0207642_10015311 | |||
| 3246 | Ga0207642_10017593 | |||
| 3247 | Ga0207642_10038264 | |||
| 3248 | Ga0207642_10082480 | |||
| 3249 | Ga0207642_10317888 | |||
| 3250 | Ga0207642_10336917 | |||
| 3251 | Ga0207642_10599328 | |||
| 3252 | Ga0207710_10021795 | |||
| 3253 | Ga0207710_10048477 | |||
| 3254 | Ga0207710_10208466 | |||
| 3255 | Ga0207688_10059967 | |||
| 3256 | Ga0207680_10022725 | |||
| 3257 | Ga0207680_10031045 | |||
| 3258 | Ga0207680_10037411 | |||
| 3259 | Ga0207680_10742990 | |||
| 3260 | Ga0207647_10000781 | |||
| 3261 | Ga0207647_10003191 | |||
| 3262 | Ga0207647_10009223 | |||
| 3263 | Ga0207647_10011030 | |||
| 3264 | Ga0207647_10022166 | |||
| 3265 | Ga0207647_10028145 | |||
| 3266 | Ga0207647_10031771 | |||
| 3267 | Ga0207647_10054509 | |||
| 3268 | Ga0207647_10236607 | |||
| 3269 | Ga0207685_10026203 | |||
| 3270 | Ga0207685_10046253 | |||
| 3271 | Ga0207685_10054998 | |||
| 3272 | Ga0207699_10000556 | |||
| 3273 | Ga0207699_10003478 | |||
| 3274 | Ga0207699_10028506 | |||
| 3275 | Ga0207699_10052070 | |||
| 3276 | Ga0207699_10131141 | |||
| 3277 | Ga0207699_10169117 | |||
| 3278 | Ga0207699_10247286 | |||
| 3279 | Ga0207699_10328435 | |||
| 3280 | Ga0207699_10395687 | |||
| 3281 | Ga0207699_10535046 | |||
| 3282 | Ga0207699_10550860 | |||
| 3283 | Ga0207699_10653275 | |||
| 3284 | Ga0207699_10795924 | |||
| 3285 | Ga0207699_10974849 | |||
| 3286 | Ga0207699_11360676 | |||
| 3287 | Ga0207645_10002790 | |||
| 3288 | Ga0207645_10013861 | |||
| 3289 | Ga0207645_10089272 | |||
| 3290 | Ga0207645_10095633 | |||
| 3291 | Ga0207645_10371457 | |||
| 3292 | Ga0207643_10000928 | |||
| 3293 | Ga0207643_10162239 | |||
| 3294 | Ga0207643_10187176 | |||
| 3295 | Ga0207705_10179141 | |||
| 3296 | Ga0207705_10529067 | |||
| 3297 | Ga0207684_10000274 | |||
| 3298 | Ga0207684_10000383 | |||
| 3299 | Ga0207684_10003435 | |||
| 3300 | Ga0207684_10003824 | |||
| 3301 | Ga0207684_10013210 | |||
| 3302 | Ga0207684_10150842 | |||
| 3303 | Ga0207684_10197581 | |||
| 3304 | Ga0207684_10711199 | |||
| 3305 | Ga0207684_10856164 | |||
| 3306 | Ga0207684_10907632 | |||
| 3307 | Ga0207684_10937339 | |||
| 3308 | Ga0207654_10003606 | |||
| 3309 | Ga0207654_10008365 | |||
| 3310 | Ga0207654_10014332 | |||
| 3311 | Ga0207654_10017010 | |||
| 3312 | Ga0207654_10032108 | |||
| 3313 | Ga0207654_10043207 | |||
| 3314 | Ga0207654_10060143 | |||
| 3315 | Ga0207654_10097311 | |||
| 3316 | Ga0207654_10100694 | |||
| 3317 | Ga0207654_10253004 | |||
| 3318 | Ga0207707_10000479 | |||
| 3319 | Ga0207707_10008797 | |||
| 3320 | Ga0207707_10021477 | |||
| 3321 | Ga0207707_10034359 | |||
| 3322 | Ga0207707_10035532 | |||
| 3323 | Ga0207707_10078779 | |||
| 3324 | Ga0207707_10080729 | |||
| 3325 | Ga0207707_10309375 | |||
| 3326 | Ga0207707_10409363 | |||
| 3327 | Ga0207707_10409795 | |||
| 3328 | Ga0207707_10419830 | |||
| 3329 | Ga0207695_10004679 | |||
| 3330 | Ga0207695_10019767 | |||
| 3331 | Ga0207695_10075734 | |||
| 3332 | Ga0207695_10117291 | |||
| 3333 | Ga0207695_10235323 | |||
| 3334 | Ga0207695_10254606 | |||
| 3335 | Ga0207695_10405336 | |||
| 3336 | Ga0207695_11337049 | |||
| 3337 | Ga0207671_10075337 | |||
| 3338 | Ga0207671_10083169 | |||
| 3339 | Ga0207671_10086889 | |||
| 3340 | Ga0207671_10118872 | |||
| 3341 | Ga0207671_10262791 | |||
| 3342 | Ga0207671_10611268 | |||
| 3343 | Ga0207671_10693801 | |||
| 3344 | Ga0207693_10000121 | |||
| 3345 | Ga0207693_10000187 | |||
| 3346 | Ga0207693_10000204 | |||
| 3347 | Ga0207693_10000268 | |||
| 3348 | Ga0207693_10002043 | |||
| 3349 | Ga0207693_10005199 | |||
| 3350 | Ga0207693_10007003 | |||
| 3351 | Ga0207693_10008027 | |||
| 3352 | Ga0207693_10021770 | |||
| 3353 | Ga0207693_10034963 | |||
| 3354 | Ga0207693_10045505 | |||
| 3355 | Ga0207693_10061906 | |||
| 3356 | Ga0207693_10064769 | |||
| 3357 | Ga0207693_10067871 | |||
| 3358 | Ga0207693_10068545 | |||
| 3359 | Ga0207693_10098700 | |||
| 3360 | Ga0207693_10230545 | |||
| 3361 | Ga0207693_10246047 | |||
| 3362 | Ga0207693_10306322 | |||
| 3363 | Ga0207693_10385706 | |||
| 3364 | Ga0207693_10506567 | |||
| 3365 | Ga0207693_10684566 | |||
| 3366 | Ga0207693_10893764 | |||
| 3367 | Ga0207693_11090953 | |||
| 3368 | Ga0207663_10003935 | |||
| 3369 | Ga0207663_10009060 | |||
| 3370 | Ga0207663_10012361 | |||
| 3371 | Ga0207663_10014515 | |||
| 3372 | Ga0207663_10015574 | |||
| 3373 | Ga0207663_10053182 | |||
| 3374 | Ga0207663_10108458 | |||
| 3375 | Ga0207663_10149130 | |||
| 3376 | Ga0207663_10174466 | |||
| 3377 | Ga0207663_10291507 | |||
| 3378 | Ga0207663_10388614 | |||
| 3379 | Ga0207663_10498119 | |||
| 3380 | Ga0207660_10054923 | |||
| 3381 | Ga0207660_10069221 | |||
| 3382 | Ga0207660_10088172 | |||
| 3383 | Ga0207660_10089064 | |||
| 3384 | Ga0207660_10234318 | |||
| 3385 | Ga0207660_10387130 | |||
| 3386 | Ga0207660_10549454 | |||
| 3387 | Ga0207657_10002968 | |||
| 3388 | Ga0207657_10062196 | |||
| 3389 | Ga0207649_10000349 | |||
| 3390 | Ga0207649_10011591 | |||
| 3391 | Ga0207649_10070582 | |||
| 3392 | Ga0207649_10171795 | |||
| 3393 | Ga0207649_10807425 | |||
| 3394 | Ga0207649_10939534 | |||
| 3395 | Ga0207652_10003809 | |||
| 3396 | Ga0207652_10109677 | |||
| 3397 | Ga0207652_10135571 | |||
| 3398 | Ga0207652_10158205 | |||
| 3399 | Ga0207652_10158494 | |||
| 3400 | Ga0207652_10305402 | |||
| 3401 | Ga0207652_10408692 | |||
| 3402 | Ga0207652_10541816 | |||
| 3403 | Ga0207652_10727257 | |||
| 3404 | Ga0207646_10000229 | |||
| 3405 | Ga0207646_10000240 | |||
| 3406 | Ga0207646_10044631 | |||
| 3407 | Ga0207646_10046578 | |||
| 3408 | Ga0207646_10057735 | |||
| 3409 | Ga0207646_10085901 | |||
| 3410 | Ga0207646_10128216 | |||
| 3411 | Ga0207646_10159864 | |||
| 3412 | Ga0207646_10236349 | |||
| 3413 | Ga0207646_10255937 | |||
| 3414 | Ga0207646_10298918 | |||
| 3415 | Ga0207646_10369849 | |||
| 3416 | Ga0207646_10415702 | |||
| 3417 | Ga0207646_10515480 | |||
| 3418 | Ga0207646_10680670 | |||
| 3419 | Ga0207646_10855972 | |||
| 3420 | Ga0207646_10882243 | |||
| 3421 | Ga0207646_11057775 | |||
| 3422 | Ga0207681_10014793 | |||
| 3423 | Ga0207681_10221319 | |||
| 3424 | Ga0207681_10361278 | |||
| 3425 | Ga0207694_10002906 | |||
| 3426 | Ga0207694_10004143 | |||
| 3427 | Ga0207694_10052740 | |||
| 3428 | Ga0207694_10116914 | |||
| 3429 | Ga0207694_10155653 | |||
| 3430 | Ga0207694_10318085 | |||
| 3431 | Ga0207694_10440321 | |||
| 3432 | Ga0207694_10763210 | |||
| 3433 | Ga0207694_10775602 | |||
| 3434 | Ga0207650_10000104 | |||
| 3435 | Ga0207650_10008455 | |||
| 3436 | Ga0207650_10337877 | |||
| 3437 | Ga0207650_10621598 | |||
| 3438 | Ga0207650_11183854 | |||
| 3439 | Ga0207659_10013254 | |||
| 3440 | Ga0207659_10087080 | |||
| 3441 | Ga0207659_10244531 | |||
| 3442 | Ga0207659_10295690 | |||
| 3443 | Ga0207659_10526408 | |||
| 3444 | Ga0207687_10001100 | |||
| 3445 | Ga0207687_10012648 | |||
| 3446 | Ga0207687_10030137 | |||
| 3447 | Ga0207687_10082531 | |||
| 3448 | Ga0207687_10108967 | |||
| 3449 | Ga0207687_10202918 | |||
| 3450 | Ga0207687_10251635 | |||
| 3451 | Ga0207687_10299649 | |||
| 3452 | Ga0207687_10610907 | |||
| 3453 | Ga0207687_10738437 | |||
| 3454 | Ga0207700_10000064 | |||
| 3455 | Ga0207700_10003344 | |||
| 3456 | Ga0207700_10023819 | |||
| 3457 | Ga0207700_10027658 | |||
| 3458 | Ga0207700_10037210 | |||
| 3459 | Ga0207700_10060705 | |||
| 3460 | Ga0207700_10066784 | |||
| 3461 | Ga0207700_10067742 | |||
| 3462 | Ga0207700_10139398 | |||
| 3463 | Ga0207700_10155052 | |||
| 3464 | Ga0207700_10209102 | |||
| 3465 | Ga0207700_10257144 | |||
| 3466 | Ga0207700_10262558 | |||
| 3467 | Ga0207700_10286965 | |||
| 3468 | Ga0207700_10376791 | |||
| 3469 | Ga0207700_10392253 | |||
| 3470 | Ga0207700_10554989 | |||
| 3471 | Ga0207700_10565870 | |||
| 3472 | Ga0207700_10578027 | |||
| 3473 | Ga0207700_10582115 | |||
| 3474 | Ga0207700_10603792 | |||
| 3475 | Ga0207700_10632881 | |||
| 3476 | Ga0207700_10669988 | |||
| 3477 | Ga0207700_10679607 | |||
| 3478 | Ga0207700_10722522 | |||
| 3479 | Ga0207700_10724579 | |||
| 3480 | Ga0207700_10777840 | |||
| 3481 | Ga0207700_10780569 | |||
| 3482 | Ga0207700_10849345 | |||
| 3483 | Ga0207700_11081718 | |||
| 3484 | Ga0207700_11135980 | |||
| 3485 | Ga0207700_11672568 | |||
| 3486 | Ga0207664_10000086 | |||
| 3487 | Ga0207664_10021010 | |||
| 3488 | Ga0207664_10056601 | |||
| 3489 | Ga0207664_10068590 | |||
| 3490 | Ga0207664_10079803 | |||
| 3491 | Ga0207664_10109332 | |||
| 3492 | Ga0207664_10268603 | |||
| 3493 | Ga0207664_10317277 | |||
| 3494 | Ga0207664_10334143 | |||
| 3495 | Ga0207664_10343361 | |||
| 3496 | Ga0207664_10404931 | |||
| 3497 | Ga0207664_10411831 | |||
| 3498 | Ga0207664_10868868 | |||
| 3499 | Ga0207664_11104282 | |||
| 3500 | Ga0207664_11349142 | |||
| 3501 | Ga0207664_11502492 | |||
| 3502 | Ga0207664_11746338 | |||
| 3503 | Ga0207644_10055757 | |||
| 3504 | Ga0207644_10230824 | |||
| 3505 | Ga0207644_10840605 | |||
| 3506 | Ga0207690_10144065 | |||
| 3507 | Ga0207690_10167704 | |||
| 3508 | Ga0207690_10344940 | |||
| 3509 | Ga0207690_11023767 | |||
| 3510 | Ga0207690_11594604 | |||
| 3511 | Ga0207706_10000880 | |||
| 3512 | Ga0207706_10003401 | |||
| 3513 | Ga0207706_10068202 | |||
| 3514 | Ga0207706_10103438 | |||
| 3515 | Ga0207706_10287030 | |||
| 3516 | Ga0207706_10836725 | |||
| 3517 | Ga0207686_10031182 | |||
| 3518 | Ga0207686_10175997 | |||
| 3519 | Ga0207686_10312097 | |||
| 3520 | Ga0207686_10318805 | |||
| 3521 | Ga0207686_10387757 | |||
| 3522 | Ga0207686_10508602 | |||
| 3523 | Ga0207709_10764939 | |||
| 3524 | Ga0207670_10018169 | |||
| 3525 | Ga0207670_10193382 | |||
| 3526 | Ga0207670_11117445 | |||
| 3527 | Ga0207669_10049161 | |||
| 3528 | Ga0207669_10067199 | |||
| 3529 | Ga0207669_10178716 | |||
| 3530 | Ga0207669_10271533 | |||
| 3531 | Ga0207669_10968232 | |||
| 3532 | Ga0207704_10024042 | |||
| 3533 | Ga0207704_10052608 | |||
| 3534 | Ga0207704_10092013 | |||
| 3535 | Ga0207704_10241515 | |||
| 3536 | Ga0207704_10483583 | |||
| 3537 | Ga0207704_10977233 | |||
| 3538 | Ga0207704_11607387 | |||
| 3539 | Ga0207665_10000061 | |||
| 3540 | Ga0207665_10000644 | |||
| 3541 | Ga0207665_10002034 | |||
| 3542 | Ga0207665_10004612 | |||
| 3543 | Ga0207665_10010539 | |||
| 3544 | Ga0207665_10014394 | |||
| 3545 | Ga0207665_10014395 | |||
| 3546 | Ga0207665_10016008 | |||
| 3547 | Ga0207665_10067922 | |||
| 3548 | Ga0207665_10149186 | |||
| 3549 | Ga0207665_10177168 | |||
| 3550 | Ga0207665_10213450 | |||
| 3551 | Ga0207665_10253799 | |||
| 3552 | Ga0207665_10501966 | |||
| 3553 | Ga0207665_10583481 | |||
| 3554 | Ga0207665_10655174 | |||
| 3555 | Ga0207665_10851076 | |||
| 3556 | Ga0207691_10000280 | |||
| 3557 | Ga0207691_10019171 | |||
| 3558 | Ga0207691_10502496 | |||
| 3559 | Ga0207691_10633763 | |||
| 3560 | Ga0207711_10001004 | |||
| 3561 | Ga0207711_10013268 | |||
| 3562 | Ga0207711_10025020 | |||
| 3563 | Ga0207711_10042451 | |||
| 3564 | Ga0207711_10228350 | |||
| 3565 | Ga0207711_10467363 | |||
| 3566 | Ga0207689_10003173 | |||
| 3567 | Ga0207689_10007450 | |||
| 3568 | Ga0207689_10019778 | |||
| 3569 | Ga0207689_10027617 | |||
| 3570 | Ga0207689_10149514 | |||
| 3571 | Ga0207689_11379009 | |||
| 3572 | Ga0207661_10000869 | |||
| 3573 | Ga0207661_10040740 | |||
| 3574 | Ga0207661_10061357 | |||
| 3575 | Ga0207661_10068509 | |||
| 3576 | Ga0207661_10471738 | |||
| 3577 | Ga0207661_10651991 | |||
| 3578 | Ga0207661_11177870 | |||
| 3579 | Ga0207661_11247554 | |||
| 3580 | Ga0207679_10000089 | |||
| 3581 | Ga0207679_10076974 | |||
| 3582 | Ga0207679_10098561 | |||
| 3583 | Ga0207679_10132011 | |||
| 3584 | Ga0207679_10333464 | |||
| 3585 | Ga0207679_10759098 | |||
| 3586 | Ga0207667_10001950 | |||
| 3587 | Ga0207667_10008435 | |||
| 3588 | Ga0207667_10012807 | |||
| 3589 | Ga0207667_10049344 | |||
| 3590 | Ga0207667_10053450 | |||
| 3591 | Ga0207667_10106220 | |||
| 3592 | Ga0207667_10107581 | |||
| 3593 | Ga0207667_10375514 | |||
| 3594 | Ga0207667_10469133 | |||
| 3595 | Ga0207667_10536481 | |||
| 3596 | Ga0207667_10654960 | |||
| 3597 | Ga0207667_10952378 | |||
| 3598 | Ga0207667_10968355 | |||
| 3599 | Ga0207651_10032281 | |||
| 3600 | Ga0207651_10199810 | |||
| 3601 | Ga0207651_11461751 | |||
| 3602 | Ga0207712_10008211 | |||
| 3603 | Ga0207712_10389207 | |||
| 3604 | Ga0207712_12118143 | |||
| 3605 | Ga0207668_10062611 | |||
| 3606 | Ga0207668_10142677 | |||
| 3607 | Ga0207640_10005064 | |||
| 3608 | Ga0207640_10037552 | |||
| 3609 | Ga0207640_10091977 | |||
| 3610 | Ga0207640_10114901 | |||
| 3611 | Ga0207640_10514553 | |||
| 3612 | Ga0207640_11113873 | |||
| 3613 | Ga0207658_10266994 | |||
| 3614 | Ga0207658_10315047 | |||
| 3615 | Ga0207658_10546186 | |||
| 3616 | Ga0207658_10847366 | |||
| 3617 | Ga0207677_10001630 | |||
| 3618 | Ga0207677_10002011 | |||
| 3619 | Ga0207677_10005802 | |||
| 3620 | Ga0207677_10009433 | |||
| 3621 | Ga0207677_10014013 | |||
| 3622 | Ga0207677_10016609 | |||
| 3623 | Ga0207677_10036531 | |||
| 3624 | Ga0207677_10051327 | |||
| 3625 | Ga0207677_10079159 | |||
| 3626 | Ga0207677_10270822 | |||
| 3627 | Ga0207677_10304266 | |||
| 3628 | Ga0207677_10738684 | |||
| 3629 | Ga0207677_11123477 | |||
| 3630 | Ga0207703_10004581 | |||
| 3631 | Ga0207703_10005202 | |||
| 3632 | Ga0207703_10011631 | |||
| 3633 | Ga0207703_10027012 | |||
| 3634 | Ga0207703_10030655 | |||
| 3635 | Ga0207703_10044458 | |||
| 3636 | Ga0207703_10047169 | |||
| 3637 | Ga0207703_10089227 | |||
| 3638 | Ga0207703_11213281 | |||
| 3639 | Ga0207639_10054676 | |||
| 3640 | Ga0207639_10197587 | |||
| 3641 | Ga0207639_10202061 | |||
| 3642 | Ga0207639_10373302 | |||
| 3643 | Ga0207639_10451333 | |||
| 3644 | Ga0207639_10876233 | |||
| 3645 | Ga0207639_10923359 | |||
| 3646 | Ga0207639_10973471 | |||
| 3647 | Ga0207678_10001258 | |||
| 3648 | Ga0207678_10005442 | |||
| 3649 | Ga0207678_10393753 | |||
| 3650 | Ga0207708_10116375 | |||
| 3651 | Ga0207708_10869681 | |||
| 3652 | Ga0207702_10000150 | |||
| 3653 | Ga0207702_10000962 | |||
| 3654 | Ga0207702_10000989 | |||
| 3655 | Ga0207702_10001145 | |||
| 3656 | Ga0207702_10003770 | |||
| 3657 | Ga0207702_10009489 | |||
| 3658 | Ga0207702_10017829 | |||
| 3659 | Ga0207702_10020248 | |||
| 3660 | Ga0207702_10055616 | |||
| 3661 | Ga0207702_10070610 | |||
| 3662 | Ga0207702_10165647 | |||
| 3663 | Ga0207702_10180807 | |||
| 3664 | Ga0207702_10316519 | |||
| 3665 | Ga0207702_11040013 | |||
| 3666 | Ga0207702_11488751 | |||
| 3667 | Ga0207641_10000020 | |||
| 3668 | Ga0207641_10002104 | |||
| 3669 | Ga0207641_10031762 | |||
| 3670 | Ga0207641_10038990 | |||
| 3671 | Ga0207641_10051991 | |||
| 3672 | Ga0207641_10140422 | |||
| 3673 | Ga0207641_10389539 | |||
| 3674 | Ga0207641_10733180 | |||
| 3675 | Ga0207641_11339885 | |||
| 3676 | Ga0207641_11455863 | |||
| 3677 | Ga0207648_10003740 | |||
| 3678 | Ga0207648_10007359 | |||
| 3679 | Ga0207648_10012154 | |||
| 3680 | Ga0207648_10018733 | |||
| 3681 | Ga0207648_10051316 | |||
| 3682 | Ga0207648_10129412 | |||
| 3683 | Ga0207648_10147488 | |||
| 3684 | Ga0207648_10149221 | |||
| 3685 | Ga0207648_10268893 | |||
| 3686 | Ga0207648_10668015 | |||
| 3687 | Ga0207676_10000108 | |||
| 3688 | Ga0207676_10011432 | |||
| 3689 | Ga0207676_10046865 | |||
| 3690 | Ga0207676_10051851 | |||
| 3691 | Ga0207676_10717111 | |||
| 3692 | Ga0207676_10836942 | |||
| 3693 | Ga0207676_11403199 | |||
| 3694 | Ga0207674_10000512 | |||
| 3695 | Ga0207674_10000867 | |||
| 3696 | Ga0207674_10003236 | |||
| 3697 | Ga0207674_10012313 | |||
| 3698 | Ga0207674_10032234 | |||
| 3699 | Ga0207674_10058525 | |||
| 3700 | Ga0207674_10065236 | |||
| 3701 | Ga0207674_10100496 | |||
| 3702 | Ga0207674_10345228 | |||
| 3703 | Ga0207674_10358184 | |||
| 3704 | Ga0207675_100027917 | |||
| 3705 | Ga0207675_100032646 | |||
| 3706 | Ga0207675_100382341 | |||
| 3707 | Ga0207683_10000338 | |||
| 3708 | Ga0207683_10021015 | |||
| 3709 | Ga0207683_10093104 | |||
| 3710 | Ga0207683_10221220 | |||
| 3711 | Ga0207683_10805691 | |||
| 3712 | Ga0207683_11040461 | |||
| 3713 | Ga0207698_10014736 | |||
| 3714 | Ga0207698_10037545 | |||
| 3715 | Ga0207698_10088714 | |||
| 3716 | Ga0207698_10100426 | |||
| 3717 | Ga0207698_10106264 | |||
| 3718 | Ga0207698_10744112 | |||
| 3719 | Ga0207698_10884004 | |||
| 3720 | Ga0207698_11345984 | |||
| 3721 | Ga0265354_1009212 | |||
| 3722 | Ga0265356_1000074 | |||
| 3723 | Ga0265356_1001335 | |||
| 3724 | Ga0265357_1007736 | |||
| 3725 | Ga0265355_1000278 | |||
| 3726 | Ga0268266_10025416 | |||
| 3727 | Ga0268266_10034228 | |||
| 3728 | Ga0268266_10620263 | |||
| 3729 | Ga0268266_10653343 | |||
| 3730 | Ga0268265_10007698 | |||
| 3731 | Ga0268265_10113922 | |||
| 3732 | Ga0268265_10303650 | |||
| 3733 | Ga0268265_10518643 | |||
| 3734 | Ga0268264_10023614 | |||
| 3735 | Ga0268264_10033663 | |||
| 3736 | Ga0268264_10040450 | |||
| 3737 | Ga0268264_10100512 | |||
| 3738 | Ga0268264_10106886 | |||
| 3739 | Ga0268264_10170313 | |||
| 3740 | Ga0268264_10218932 | |||
| 3741 | Ga0268264_10283254 | |||
| 3742 | Ga0268264_10412770 | |||
| 3743 | Ga0268264_10442144 | |||
| 3744 | Ga0268264_10465965 | |||
| 3745 | Ga0268264_10474394 | |||
| 3746 | Ga0268264_10618221 | |||
| 3747 | Ga0265338_10004755 | |||
| 3748 | Ga0265338_10012193 | |||
| 3749 | Ga0265338_10016288 | |||
| 3750 | Ga0265338_10130123 | |||
| 3751 | Ga0265338_10191619 | |||
| 3752 | Ga0265338_10201686 | |||
| 3753 | Ga0265338_10469426 | |||
| 3754 | Ga0265762_1000242 | |||
| 3755 | Ga0265762_1008848 | |||
| 3756 | Ga0265762_1011729 | |||
| 3757 | Ga0265762_1023395 | |||
| 3758 | Ga0265762_1116552 | |||
| 3759 | Ga0265775_109253 | |||
| 3760 | Ga0265763_1016284 | |||
| 3761 | Ga0265763_1018385 | |||
| 3762 | Ga0265763_1019234 | |||
| 3763 | Ga0265767_111050 | |||
| 3764 | Ga0265777_102620 | |||
| 3765 | Ga0265777_105107 | |||
| 3766 | Ga0265777_111016 | |||
| 3767 | Ga0265777_113084 | |||
| 3768 | Ga0265777_115292 | |||
| 3769 | Ga0265777_115937 | |||
| 3770 | Ga0265777_117193 | |||
| 3771 | Ga0265765_1008932 | |||
| 3772 | Ga0265776_107676 | |||
| 3773 | Ga0265776_108481 | |||
| 3774 | Ga0265764_110209 | |||
| 3775 | Ga0265764_110589 | |||
| 3776 | Ga0265764_112725 | |||
| 3777 | Ga0265769_116398 | |||
| 3778 | Ga0265761_100689 | |||
| 3779 | Ga0265761_107450 | |||
| 3780 | Ga0265761_107556 | |||
| 3781 | Ga0265779_100488 | |||
| 3782 | Ga0265779_105062 | |||
| 3783 | Ga0265779_108500 | |||
| 3784 | Ga0265779_108718 | |||
| 3785 | Ga0265760_10000259 | |||
| 3786 | Ga0265760_10001901 | |||
| 3787 | Ga0265760_10005311 | |||
| 3788 | Ga0265760_10009290 | |||
| 3789 | Ga0265760_10016102 | |||
| 3790 | Ga0265760_10028325 | |||
| 3791 | Ga0265760_10034633 | |||
| 3792 | Ga0265760_10043719 | |||
| 3793 | Ga0265760_10068076 | |||
| 3794 | Ga0265760_10090605 | |||
| 3795 | Ga0265760_10125953 | |||
| 3796 | Ga0265760_10147917 | |||
| 3797 | Ga0265760_10151581 | |||
| 3798 | Ga0265760_10272870 | |||
| 3799 | Ga0265760_10290404 | |||
| 3800 | Ga0265760_10301800 | |||
| 3801 | Ga0265330_10003490 | |||
| 3802 | Ga0265328_10024365 | |||
| 3803 | Ga0265325_10011563 | |||
| 3804 | Ga0265325_10016810 | |||
| 3805 | Ga0265325_10244676 | |||
| 3806 | Ga0265339_10009402 | |||
| 3807 | Ga0265339_10107640 | |||
| 3808 | Ga0265316_10020637 | |||
| 3809 | Ga0265316_10039960 | |||
| 3810 | Ga0307408_100900132 | |||
| 3811 | Ga0310103_133604 | |||
| 3812 | Ga0310107_131645 | |||
| 3813 | Ga0310118_118915 | |||
| 3814 | Ga0310119_128539 | |||
| 3815 | Ga0265314_10008144 | |||
| 3816 | Ga0265314_10035950 | |||
| 3817 | Ga0265314_10159420 | |||
| 3818 | Ga0316044_124680 | |||
| 3819 | Ga0316044_125414 | |||
| 3820 | Ga0307413_10412938 | |||
| 3821 | Ga0307409_100012943 | |||
| 3822 | Ga0307409_102155518 | |||
| 3823 | Ga0307416_100471271 | |||
| 3824 | Ga0316053_101773 | |||
| 3825 | Ga0316053_102283 | |||
| 3826 | Ga0316053_105472 | |||
| 3827 | Ga0316053_106245 | |||
| 3828 | Ga0316053_106614 | |||
| 3829 | Ga0316053_106849 | |||
| 3830 | Ga0316053_107485 | |||
| 3831 | Ga0316053_109107 | |||
| 3832 | Ga0316053_112627 | |||
| 3833 | Ga0316053_112812 | |||
| 3834 | Ga0316053_115065 | |||
| 3835 | Ga0316053_116005 | |||
| 3836 | Ga0316053_116783 | |||
| 3837 | Ga0316214_1007824 | |||
| 3838 | Ga0316214_1023567 | |||
| 3839 | Ga0373958_0023735 | |||
| 3840 | Ga0373938_0131147 | |||
| 3841 | Ga0373926_0050013 | |||
| 3842 | Ga0373926_0084926 | |||
| 3843 | Ga0373934_0023872 | |||
| 3844 | Ga0373934_0163522 | |||
| 3845 | Ga0373944_0048452 | |||
| 3846 | Ga0373949_0126529 | |||
| 3847 | Ga0373952_0041827 | |||
| 3848 | Ga0373923_0005621 | |||
| 3849 | Ga0373923_0052112 | |||
| 3850 | Ga0373923_0101959 | |||
| 3851 | Ga0373936_0001996 | |||
| 3852 | Ga0373936_0005584 | |||
| 3853 | Ga0373936_0145589 | |||
| 3854 | Ga0373939_0013124 | |||
| 3855 | Ga0373939_0103719 | |||
| 3856 | Ga0373945_0150469 | |||
| 3857 | Ga0373953_0134759 | |||
| 3858 | Ga0373954_0029357 | |||
| 3859 | Ga0373956_0167129 | |||
| 3860 | Ga0373956_0332554 | |||
| 3861 | Ga0373957_0042834 | |||
| 3862 | Ga0373957_0049245 | |||
| 3863 | Ga0373943_0000057 | |||
| 3864 | Ga0373943_0033938 | |||
| 3865 | Ga0373943_0045807 | |||
| 3866 | Ga0373943_0085962 | |||
| 3867 | Ga0373943_0105313 | |||
| 3868 | Ga0373943_0306956 | |||
| 3869 | Ga0373946_0005397 | |||
| 3870 | Ga0373946_0053039 | |||
| 3871 | Ga0373955_0123844 | |||
| 3872 | Ga0373955_0124703 | |||
| 3873 | Ga0373955_0140224 | |||
| 3874 | Ga0373942_0049488 | |||
| 3875 | Ga0373961_0034420 | |||
| 3876 | Ga0373961_0097819 | |||
| 3877 | Ga0373962_0142455 | |||
| 3878 | Ga0373924_0069074 | |||
| 3879 | Ga0373924_0090910 | |||
| 3880 | Ga0373931_0016090 | |||
| 3881 | Ga0373931_0057236 | |||
| 3882 | Ga0373931_0093001 | |||
| 3883 | Ga0373931_0315221 | |||
| 3884 | Ga0373935_0008903 | |||
| 3885 | Ga0373935_0012376 | |||
| 3886 | Ga0373935_0028352 | |||
| 3887 | Ga0373935_0050092 | |||
| 3888 | Ga0373935_0095949 | |||
| 3889 | Ga0373927_0001419 | |||
| 3890 | Ga0373927_0032471 | |||
| 3891 | Ga0373927_0119973 | |||
| 3892 | Ga0373927_0314707 | |||
| 3893 | Ga0373927_0445296 | |||
| 3894 | Ga0373933_0036947 | |||
| 3895 | Ga0373933_0073960 | |||
| 3896 | Ga0373933_0142820 | |||
| 3897 | Ga0373947_0001930 | |||
| 3898 | Ga0373947_0008323 | |||
| 3899 | Ga0373947_0074205 | |||
| 3900 | Ga0373947_0076279 | |||
| 3901 | Ga0373947_0388189 | |||
| 3902 | Ga0373937_0044091 | |||
| 3903 | Ga0373937_0047537 | |||
| 3904 | Ga0373937_0051164 | |||
| 3905 | Ga0373937_0090017 | |||
| 3906 | Ga0373937_0364592 | |||
| 3907 | Ga0373937_0467922 | |||
| 3908 | Ga0373937_1215939 | |||
| 3909 | Ga0373937_1994953 | |||
| 3910 | Ga0265778_016927 | |||
| 3911 | Ga0265778_021175 | |||
| 3912 | Ga0265778_021767 | |||
| 3913 | Ga0265778_027719 | |||
| 3914 | Ga0265778_027945 | |||
| 3915 | Ga0265778_028006 | |||
| 3916 | Ga0265778_030500 | |||
| 3917 | Ga0265778_031047 | |||
| 3918 | Ga0265778_032616 | |||
| 3919 | Ga0265778_042290 | |||
| 3920 | Ga0265778_042934 | |||
| 3921 | Ga0265778_044176 | |||
| 3922 | Ga0265778_047485 | |||
| 3923 | Ga0265778_050163 | |||
| 3924 | Ga0373925_0002410 | |||
| 3925 | Ga0373925_0004638 | |||
| 3926 | Ga0373925_0010010 | |||
| 3927 | Ga0373925_0016440 | |||
| 3928 | Ga0373925_0032411 | |||
| 3929 | Ga0373925_0066243 | |||
| 3930 | Ga0373925_0109860 | |||
| 3931 | Ga0373925_0137952 | |||
| 3932 | Ga0373925_0270824 | |||
| 3933 | Ga0373925_0448615 | |||
| 3934 | Ga0373925_1402586 | |||
| 3935 | Ga0395900_1022284 | |||
| 3936 | Ga0395905_1005228 | |||
| 3937 | Ga0436365_1008019 | |||
| 3938 | Ga0436360_0576800 | |||
| 3939 | Ga0436360_1049509 | |||
| 3940 | Ga0436361_0555840 | |||
| 3941 | Ga0436363_0174411 | |||
| 3942 | Ga0436363_0226302 | |||
| 3943 | Ga0436363_1160955 | |||
| 3944 | Ga0436363_1335520 | |||
| 3945 | Ga0436362_0234917 | |||
| 3946 | Ga0439435_0067273 | |||
| 3947 | Ga0453683_0776196 | |||
| 3948 | Ga0466965_0400106 | |||
| 3949 | Ga0466963_0205948 | |||
| 3950 | Ga0466963_0310074 | |||
| 3951 | Ga0453684_0263559 | |||
| 3952 | Ga0453684_2008487 | |||
| 3953 | Ga0466971_0146756 | |||
| 3954 | Ga0451576_0038538 | |||
| 3955 | Ga0451576_0291981 | |||
| 3956 | Ga0451576_0411379 | |||
| 3957 | Ga0451576_1617942 | |||
| 3958 | Ga0451576_2048519 | |||
| 3959 | Ga0466967_0005562 | |||
| 3960 | Ga0466967_0018548 | |||
| 3961 | Ga0466967_0413482 | |||
| 3962 | Ga0495629_0017374 | |||
| 3963 | Ga0495629_0032355 | |||
| 3964 | Ga0495629_0337817 | |||
| 3965 | Ga0495651_0550686 | |||
| 3966 | Ga0495580_0000097 | |||
| 3967 | Ga0495580_0003126 | |||
| 3968 | Ga0495580_0003638 | |||
| 3969 | Ga0495580_0006916 | |||
| 3970 | Ga0495580_0007201 | |||
| 3971 | Ga0495580_0007572 | |||
| 3972 | Ga0495580_0017890 | |||
| 3973 | Ga0495580_0020025 | |||
| 3974 | Ga0495580_0103988 | |||
| 3975 | Ga0495580_0176565 | |||
| 3976 | Ga0495580_0296103 | |||
| 3977 | Ga0495582_0003332 | |||
| 3978 | Ga0495582_0017854 | |||
| 3979 | Ga0495582_0055458 | |||
| 3980 | Ga0495594_0084031 | |||
| 3981 | Ga0495630_0069470 | |||
| 3982 | Ga0495630_0323385 | |||
| 3983 | Ga0495630_0408682 | |||
| 3984 | Ga0495630_0437493 | |||
| 3985 | Ga0495665_0009301 | |||
| 3986 | Ga0495665_0189025 | |||
| 3987 | Ga0495665_0357436 | |||
| 3988 | Ga0495622_0393989 | |||
| 3989 | Ga0495611_0484731 | |||
| 3990 | Ga0495623_0280655 | |||
| 3991 | Ga0495646_0570472 | |||
| 3992 | Ga0495647_0297547 | |||
| 3993 | Ga0495658_0059141 | |||
| 3994 | Ga0495658_0165687 | |||
| 3995 | Ga0495658_0236553 | |||
| 3996 | Ga0495658_0262478 | |||
| 3997 | Ga0495669_0037624 | |||
| 3998 | Ga0495669_0121232 | |||
| 3999 | Ga0495669_0271875 | |||
| 4000 | Ga0495669_0332002 | |||
| 4001 | Ga0495669_0349385 | |||
| 4002 | Ga0495624_0037970 | |||
| 4003 | Ga0495624_0105408 | |||
| 4004 | Ga0495670_0126055 | |||
| 4005 | Ga0495670_0295956 | |||
| 4006 | Ga0495636_0138627 | |||
| 4007 | Ga0495674_0015358 | |||
| 4008 | Ga0495674_0181955 | |||
| 4009 | Ga0495674_0215086 | |||
| 4010 | Ga0495674_0258249 | |||
| 4011 | Ga0495674_0906658 | |||
| 4012 | Ga0495676_0599347 | |||
| 4013 | Ga0495675_0050462 | |||
| 4014 | Ga0495602_0135696 | |||
| 4015 | Ga0495602_0151307 | |||
| 4016 | Ga0495602_0181111 | |||
| 4017 | Ga0495614_0176059 | |||
| 4018 | Ga0496100_0179894 | |||
| 4019 | Ga0496100_0310616 | |||
| 4020 | Ga0496100_0462787 | |||
| 4021 | Ga0496100_0673457 | |||
| 4022 | Ga0496100_0890675 | |||
| 4023 | Ga0496101_0022155 | |||
| 4024 | Ga0496101_1209681 | |||
| 4025 | Ga0496102_0001511 | |||
| 4026 | Ga0496102_0010031 | |||
| 4027 | Ga0496102_0134564 | |||
| 4028 | Ga0496102_0136567 | |||
| 4029 | Ga0496102_0222390 | |||
| 4030 | Ga0496102_0226248 | |||
| 4031 | Ga0496102_0313823 | |||
| 4032 | Ga0496102_0530461 | |||
| 4033 | Ga0496102_0798868 | |||
| 4034 | Ga0496102_0948432 | |||
| 4035 | Ga0496102_1786744 | |||
| 4036 | Ga0496103_0001097 | |||
| 4037 | Ga0496103_0032816 | |||
| 4038 | Ga0496103_0733900 | |||
| 4039 | Ga0496103_0856145 | |||
| 4040 | Ga0496104_0033024 | |||
| 4041 | Ga0496104_0062952 | |||
| 4042 | Ga0496104_0077962 | |||
| 4043 | Ga0496104_0111393 | |||
| 4044 | Ga0496104_0139883 | |||
| 4045 | Ga0496104_0153089 | |||
| 4046 | Ga0496104_0356274 | |||
| 4047 | Ga0496104_0913892 | |||
| 4048 | Ga0496105_0015361 | |||
| 4049 | Ga0496105_0035482 | |||
| 4050 | Ga0496105_0156288 | |||
| 4051 | Ga0496105_0267186 | |||
| 4052 | Ga0496105_0489842 | |||
| 4053 | Ga0496105_0721274 | |||
| 4054 | Ga0496106_0014899 | |||
| 4055 | Ga0496106_0036946 | |||
| 4056 | Ga0496106_0435574 | |||
| 4057 | Ga0496106_0604705 | |||
| 4058 | Ga0496107_0228853 | |||
| 4059 | Ga0496107_0386765 | |||
| 4060 | Ga0496108_0005246 | |||
| 4061 | Ga0496108_0273886 | |||
| 4062 | Ga0496108_0365301 | |||
| 4063 | Ga0496108_0781152 | |||
| 4064 | Ga0496109_0000018 | |||
| 4065 | Ga0496109_0152451 | |||
| 4066 | Ga0496109_0225492 | |||
| 4067 | Ga0496109_1075209 | |||
| 4068 | Ga0496109_1524540 | |||
| 4069 | Ga0496110_0001746 | |||
| 4070 | Ga0496111_0105480 | |||
| 4071 | Ga0496111_0338322 | |||
| 4072 | Ga0496112_0001173 | |||
| 4073 | Ga0496112_0004210 | |||
| 4074 | Ga0496112_0010111 | |||
| 4075 | Ga0496112_0014820 | |||
| 4076 | Ga0496112_0027455 | |||
| 4077 | Ga0496112_0040425 | |||
| 4078 | Ga0496112_0044472 | |||
| 4079 | Ga0496112_0049408 | |||
| 4080 | Ga0496112_0049706 | |||
| 4081 | Ga0496112_0062608 | |||
| 4082 | Ga0496112_0104136 | |||
| 4083 | Ga0496112_0129994 | |||
| 4084 | Ga0496112_0432320 | |||
| 4085 | Ga0496112_0652961 | |||
| 4086 | Ga0496112_1479099 | |||
| 4087 | Ga0496113_0002437 | |||
| 4088 | Ga0496113_0088299 | |||
| 4089 | Ga0496113_1250820 | |||
| 4090 | Ga0496114_0158197 | |||
| 4091 | Ga0496114_0468935 | |||
| 4092 | Ga0496115_0008147 | |||
| 4093 | Ga0496115_0022883 | |||
| 4094 | Ga0496115_0043944 | |||
| 4095 | Ga0496115_0161411 | |||
| 4096 | Ga0501307_041700 | |||
| 4097 | Ga0501298_033907 | |||
| 4098 | Ga0501299_089058 | |||
| 4099 | Ga0501300_015905 | |||
| 4100 | Ga0501313_042309 | |||
| 4101 | Ga0501315_055052 | |||
| 4102 | Ga0501320_068058 | |||
| 4103 | Ga0501335_035694 | |||
| 4104 | Ga0501249_076369 | |||
| 4105 | Ga0501083_0203545 | |||
| 4106 | nmdc:mga05p37_1331508_c1 | |||
| 4107 | nmdc:mga05p37_14610_c1 | |||
| 4108 | nmdc:mga09592_42673_c1 | |||
| 4109 | nmdc:mga06r32_1043266_c1 | |||
| 4110 | nmdc:mga06r32_266992_c1 | |||
| 4111 | nmdc:mga0n895_1371358_c1 | |||
| 4112 | nmdc:mga0n895_187192_c1 | |||
| 4113 | nmdc:mga0n895_282718_c1 | |||
| 4114 | nmdc:mga0n895_29703_c1 | |||
| 4115 | nmdc:mga0n895_360_c1 | |||
| 4116 | nmdc:mga0n895_3638_c1 | |||
| 4117 | nmdc:mga0n895_483737_c1 | |||
| 4118 | nmdc:mga0n895_552639_c1 | |||
| 4119 | nmdc:mga0n895_79579_c1 | |||
| 4120 | nmdc:mga0n895_978132_c1 | |||
| 4121 | nmdc:mga0rr50_1086895_c1 | |||
| 4122 | nmdc:mga0rr50_20211_c1 | |||
| 4123 | nmdc:mga0rr50_24920_c1 | |||
| 4124 | nmdc:mga0rr50_31695_c1 | |||
| 4125 | nmdc:mga0rr50_404_c1 | |||
| 4126 | nmdc:mga0rr50_580027_c1 | |||
| 4127 | nmdc:mga0rr50_6502_c1 | |||
| 4128 | nmdc:mga08x19_10367_c1 | |||
| 4129 | nmdc:mga08x19_11164_c1 | |||
| 4130 | nmdc:mga08x19_1163_c1 | |||
| 4131 | nmdc:mga08x19_233690_c1 | |||
| 4132 | nmdc:mga08x19_6920_c1 | |||
| 4133 | nmdc:mga08x19_730342_c1 | |||
| 4134 | nmdc:mga08x19_758506_c1 | |||
| 4135 | nmdc:mga0a205_139651_c1 | |||
| 4136 | nmdc:mga0a205_575_c1 | |||
| 4137 | Ga0495601_0085044 | |||
| 4138 | Ga0587084_048426 | |||
| 4139 | Ga0587066_006102 | |||
| 4140 | Ga0587066_051450 | |||
| 4141 | Ga0587066_099333 | |||
| 4142 | Ga0587070_082415 | |||
| 4143 | Ga0587073_0049671 | |||
| 4144 | Ga0587073_0050941 | |||
| 4145 | Ga0587073_0068844 | |||
| 4146 | Ga0587073_0085500 | |||
| 4147 | Ga0587073_0088165 | |||
| 4148 | Ga0587073_0117414 | |||
| 4149 | Ga0587073_0119232 | |||
| 4150 | Ga0587077_094612 | |||
| 4151 | Ga0587082_061893 | |||
| 4152 | Ga0587082_070743 | |||
| 4153 | Ga0587082_074890 | |||
| 4154 | Ga0587083_0103872 | |||
| 4155 | Ga0587083_0116468 | |||
| 4156 | Ga0587086_055544 | |||
| 4157 | Ga0587088_004577 | |||
| 4158 | Ga0587088_075790 | |||
| 4159 | Ga0587088_090394 | |||
| 4160 | Ga0587089_040309 | |||
| 4161 | Ga0587090_064898 | |||
| 4162 | Ga0587091_087884 | |||
| 4163 | Ga0587092_086784 | |||
| 4164 | Ga0587094_045709 | |||
| 4165 | Ga0587094_056560 | |||
| 4166 | Ga0587121_08969 | |||
| 4167 | Ga0587129_011463 | |||
| 4168 | Ga0587131_008218 | |||
| 4169 | Ga0587099_018135 | |||
| 4170 | Ga0587099_023707 | |||
| 4171 | Ga0587099_026657 | |||
| 4172 | Ga0587113_010040 | |||
| 4173 | Ga0587115_047789 | |||
| 4174 | Ga0587122_015010 | |||
| 4175 | Ga0587122_016420 | |||
| 4176 | Ga0587122_034277 | |||
| 4177 | Ga0587122_039757 | |||
| 4178 | Ga0587122_044820 | |||
| 4179 | Ga0587128_004969 | |||
| 4180 | Ga0587128_005724 | |||
| 4181 | Ga0587128_030029 | |||
| 4182 | Ga0587128_035107 | |||
| 4183 | Ga0587128_039092 | |||
| 4184 | Ga0587128_039536 | |||
| 4185 | Ga0587128_053408 | |||
| 4186 | Ga0587128_058495 | |||
| 4187 | Ga0587128_061286 | |||
| 4188 | Ga0587067_069253 | |||
| 4189 | Ga0587067_083987 | |||
| 4190 | Ga0587067_087297 | |||
| 4191 | Ga0587067_105380 | |||
| 4192 | Ga0587069_050467 | |||
| 4193 | Ga0587069_057327 | |||
| 4194 | Ga0587069_069663 | |||
| 4195 | Ga0587072_066198 | |||
| 4196 | Ga0587075_016855 | |||
| 4197 | Ga0587075_031727 | |||
| 4198 | Ga0587075_040534 | |||
| 4199 | Ga0587075_041886 | |||
| 4200 | Ga0587075_043963 | |||
| 4201 | Ga0587075_048255 | |||
| 4202 | Ga0587075_053736 | |||
| 4203 | Ga0587075_055872 | |||
| 4204 | Ga0587075_057572 | |||
| 4205 | Ga0587075_062860 | |||
| 4206 | Ga0587076_075626 | |||
| 4207 | Ga0587079_081106 | |||
| 4208 | Ga0587079_089487 | |||
| 4209 | Ga0587079_151780 | |||
| 4210 | Ga0587102_020634 | |||
| 4211 | Ga0587107_046134 | |||
| 4212 | Ga0587114_002824 | |||
| 4213 | Ga0587114_005179 | |||
| 4214 | Ga0587114_019613 | |||
| 4215 | Ga0587114_041348 | |||
| 4216 | Ga0587114_041750 | |||
| 4217 | Ga0587114_052464 | |||
| 4218 | Ga0587114_056960 | |||
| 4219 | Ga0587060_011822 | |||
| 4220 | Ga0587071_068074 | |||
| 4221 | Ga0587071_075232 | |||
| 4222 | Ga0587071_077253 | |||
| 4223 | Ga0587071_080255 | |||
| 4224 | Ga0587111_0108101 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8829 | 41 | 133 |
| 2h50-assembly1.cif.gz_P | multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 | 0.8762 | 43 | 133 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.8654 | 41 | 133 |
| 5zul-assembly1.cif.gz_E-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.8634 | 42 | 132 |
| 2y1z-assembly1.cif.gz_A | human alphab crystallin acd r120g | 0.8544 | 45 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MKZ4_1_104_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9072 | 40 | 135 | 2.60.40.790 |
| af_Q8S1F2_1_96_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9062 | 40 | 138 | 2.60.40.790 |
| af_A0A0R0GKS6_4_99_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9041 | 40 | 127 | 2.60.40.790 |
| af_I1M7E1_1_101_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9001 | 40 | 133 | 2.60.40.790 |
| af_F4K6X6_3_101_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8966 | 40 | 133 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F3RD98-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8919 | 40 | 145 |
GO:0009408
|
| AF-A0A0F3RD98-F1-model_v4 | Hsp20/alpha crystallin family protein | 0.8761 | 40 | 145 |
GO:0009408
|
| AF-A0A258ZKY2-F1-model_v4 | SHSP domain-containing protein | 0.8656 | 45 | 145 |
|
| AF-T0Y0C5-F1-model_v4 | Low molecular weight heat shock protein | 0.8635 | 43 | 145 |
|
| AF-A0A137QCN7-F1-model_v4 | Uncharacterized protein | 0.8528 | 42 | 140 |
|