metagRoot

F496388

General Info

Members	Datasets	Scaffolds	Average Seq Length
2096	403	2096	175

Family's Representative Sequence

Representative Sequence	3300039447\|Ga0436361_1007716\|Ga0436361_1007716_118_750
Length	197
Sequence	LSRRETARQIKDSNMAVTKAKKIEQVEKLSAEFKDASHAIVGTFSKLTVEKDFELRKAVRSAGGRYRVLKNTLAERAAEGTKVADALKGLAGVTSIAYTAGDPVALAKALSKYAKDNPEYTFKAGVVEGRVIQIRDIDALASMPSKEEIYSKLLFLISAPAQRLVTAINAVGRNVAVVLNQGVEQKKFGGAAEAAQA

Samples

	Sample ID	Description	Type	Environment
1	2124908026	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Metagenome	Rhizosphere
4	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
7	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
8	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
9	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
10	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
11	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
12	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
13	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
14	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
15	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
16	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
17	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
18	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
19	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
20	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
21	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
22	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
23	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
24	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
25	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
26	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
27	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
30	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
31	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
32	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
33	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
34	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
35	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
36	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
37	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
38	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
39	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
40	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
41	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
42	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
45	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
46	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
47	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
48	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
49	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
50	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
51	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
52	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
53	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
54	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
55	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
56	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
57	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
58	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
59	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
60	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
61	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
62	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
63	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
64	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
65	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
66	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
67	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
68	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
69	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
70	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
71	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
72	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
73	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
74	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
75	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
76	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
77	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
78	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
79	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
80	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
81	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
82	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
83	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
84	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
85	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
86	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
87	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
88	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
89	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
90	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
91	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
92	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
93	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
94	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
95	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
96	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
97	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
98	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
99	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
100	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
101	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
102	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
103	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
104	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
105	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
106	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
107	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
108	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
109	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
110	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
111	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
112	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
113	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
115	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
116	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
117	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
118	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
119	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
120	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
121	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
122	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
123	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
124	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
125	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
126	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
127	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
128	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
129	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
130	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
131	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
132	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
133	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
134	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
135	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
136	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
137	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
138	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
139	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
140	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
141	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
142	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
143	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
144	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
145	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
146	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
147	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
148	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
149	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
150	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
151	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
152	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
153	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
154	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
155	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
156	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
157	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
230	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
234	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
235	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
236	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
237	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
238	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
239	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
240	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
241	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
242	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
243	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
244	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
245	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
246	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
247	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
248	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
249	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
250	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
251	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
252	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
253	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
254	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
255	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
256	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
257	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
258	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
259	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
260	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
261	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
262	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
263	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
264	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
265	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
266	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
267	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
268	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
269	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
270	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
271	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
272	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
273	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
274	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
275	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
276	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
277	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
278	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
279	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
280	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
281	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
282	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
283	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
284	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
285	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
286	3300038699	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26	Metagenome	Rhizosphere
287	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
288	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
289	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
290	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
291	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
292	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
293	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
294	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
295	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
296	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
297	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
298	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
299	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
300	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
301	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
302	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
303	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
304	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
305	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
306	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
307	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
308	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
309	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
310	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
311	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
312	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
313	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
314	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
315	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
316	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
317	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
318	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
319	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
320	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
321	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
322	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
323	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
324	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
325	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
326	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
327	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
328	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
329	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
330	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
331	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
332	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
333	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
334	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
335	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
336	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
337	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
338	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
339	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
340	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
341	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
342	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
343	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
344	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
345	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
346	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
347	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
348	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
349	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
350	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
351	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
352	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
353	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
354	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
355	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
356	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
357	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
358	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
359	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
360	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
361	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
362	3300049655	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought	Metagenome	Rhizosphere
363	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
364	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
365	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
366	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
367	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
368	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
369	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
370	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
371	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
372	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
373	3300049684	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control	Metagenome	Rhizosphere
374	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
375	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
376	3300049689	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought	Metagenome	Rhizosphere
377	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
378	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
379	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
380	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
381	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
382	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
383	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
384	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
385	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
386	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
387	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
388	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
389	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
390	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
391	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
392	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
393	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
394	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
395	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
396	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
397	3300059490	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
398	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
399	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
400	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
401	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
402	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
403	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.19
Metatranscriptomes	0.81
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	3.15
Rhizosphere	95.94
Stem	0
Stem Tuber	0
Unclassified	0.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS1a_Contig_3184	2124908026	Unclassified	749
2	SwRhRL2b_contig_1471343	2162886007	Bacteria	2664
3	SwRhRL2b_contig_3202780	2162886007	Unclassified	1231
4	SwRhRL2b_contig_331316	2162886007	Bacteria	1214
5	CNAas_1001813	3300000532	Bacteria	1666
6	JGI24752J21851_1008213	3300001976	Bacteria	1359
7	JGI24737J22298_10073496	3300001990	Bacteria	1020
8	JGI24748J21848_1000014	3300002074	Bacteria	147126
9	JGI24738J21930_10031920	3300002075	Unclassified	1074
10	JGI24749J21850_1017302	3300002076	Bacteria	1014
11	JGI24034J26672_10000012	3300002239	Bacteria	146139
12	JGI24034J26672_10001165	3300002239	Bacteria	3435
13	JGI24742J22300_10026635	3300002244	Bacteria	1000
14	JGI24751J29686_10000074	3300002459	Bacteria	56035
15	JGI25406J46586_10014740	3300003203	Bacteria	3318
16	Ga0058863_10052666	3300004799	Bacteria	4400
17	Ga0058861_11995602	3300004800	Bacteria	1544
18	Ga0058862_10076498	3300004803	Bacteria	2590
19	Ga0058862_10237797	3300004803	Bacteria	1538
20	Ga0065714_10064450	3300005288	Bacteria	77548
21	Ga0065704_10002971	3300005289	Bacteria	6761
22	Ga0065704_10097529	3300005289	Bacteria	2390
23	Ga0065712_10001740	3300005290	Bacteria	6000
24	Ga0065712_10004552	3300005290	Bacteria	6010
25	Ga0065712_10015500	3300005290	Bacteria	3002
26	Ga0065712_10018916	3300005290	Bacteria	2374
27	Ga0065712_10022326	3300005290	Bacteria	2083
28	Ga0065712_10039581	3300005290	Bacteria	1038
29	Ga0065712_10056019	3300005290	Bacteria	652
30	Ga0065712_10072502	3300005290	Bacteria	4727
31	Ga0065712_10098443	3300005290	Bacteria	2119
32	Ga0065712_10280400	3300005290	Bacteria	897
33	Ga0065715_10005007	3300005293	Bacteria	3558
34	Ga0065715_10094215	3300005293	Bacteria	4402
35	Ga0065715_10095075	3300005293	Bacteria	4174
36	Ga0065715_10097309	3300005293	Bacteria	3683
37	Ga0065715_10170832	3300005293	Bacteria	1537
38	Ga0065715_10195388	3300005293	Bacteria	1389
39	Ga0065715_10247294	3300005293	Unclassified	1179
40	Ga0065715_10261085	3300005293	Bacteria	1138
41	Ga0065715_10296380	3300005293	Bacteria	1051
42	Ga0065715_10309029	3300005293	Bacteria	1024
43	Ga0065715_10481798	3300005293	Bacteria	796
44	Ga0065715_10483441	3300005293	Unclassified	795
45	Ga0065715_10600629	3300005293	Bacteria	708
46	Ga0065715_10652001	3300005293	Unclassified	678
47	Ga0065715_10716518	3300005293	Bacteria	645
48	Ga0065707_10005254	3300005295	Bacteria	2904
49	Ga0065707_10008773	3300005295	Bacteria	2186
50	Ga0065707_10442393	3300005295	Unclassified	809
51	Ga0065707_10526176	3300005295	Unclassified	730
52	Ga0065707_10569210	3300005295	Unclassified	709
53	Ga0070658_10059350	3300005327	Bacteria	3115
54	Ga0070676_10006703	3300005328	Bacteria	6170
55	Ga0070676_10233544	3300005328	Bacteria	1220
56	Ga0070676_10302461	3300005328	Unclassified	1085
57	Ga0070676_10303708	3300005328	Unclassified	1083
58	Ga0070683_100007337	3300005329	Bacteria	9312
59	Ga0070683_100034134	3300005329	Bacteria	4645
60	Ga0070683_100083622	3300005329	Bacteria	2990
61	Ga0070683_100112701	3300005329	Bacteria	2567
62	Ga0070683_100337914	3300005329	Bacteria	1434
63	Ga0070683_101030726	3300005329	Unclassified	790
64	Ga0070690_100004097	3300005330	Bacteria	8069
65	Ga0070690_100006277	3300005330	Bacteria	6743
66	Ga0070690_100007637	3300005330	Bacteria	6195
67	Ga0070690_100014199	3300005330	Bacteria	4722
68	Ga0070690_100020351	3300005330	Bacteria	4042
69	Ga0070690_100172963	3300005330	Bacteria	1487
70	Ga0070690_100596306	3300005330	Bacteria	838
71	Ga0070670_100013886	3300005331	Bacteria	6907
72	Ga0070670_100015850	3300005331	Bacteria	6468
73	Ga0070670_100039282	3300005331	Bacteria	4070
74	Ga0070670_100152402	3300005331	Bacteria	2001
75	Ga0070670_100228883	3300005331	Bacteria	1618
76	Ga0070670_100240950	3300005331	Bacteria	1574
77	Ga0070670_100292895	3300005331	Bacteria	1423
78	Ga0070670_100406101	3300005331	Bacteria	1203
79	Ga0070670_100558767	3300005331	Bacteria	1021
80	Ga0070670_100681590	3300005331	Unclassified	923
81	Ga0070677_10002420	3300005333	Bacteria	5954
82	Ga0070677_10126361	3300005333	Bacteria	1161
83	Ga0070677_10453567	3300005333	Bacteria	686
84	Ga0068869_100008056	3300005334	Bacteria	6771
85	Ga0068869_100010725	3300005334	Bacteria	5983
86	Ga0068869_100028941	3300005334	Bacteria	3876
87	Ga0068869_100050225	3300005334	Bacteria	3022
88	Ga0068869_100076695	3300005334	Bacteria	2485
89	Ga0068869_100161670	3300005334	Unclassified	1744
90	Ga0068869_100162748	3300005334	Bacteria	1738
91	Ga0068869_100198039	3300005334	Bacteria	1583
92	Ga0068869_100322598	3300005334	Bacteria	1253
93	Ga0068869_100346184	3300005334	Bacteria	1210
94	Ga0068869_100365579	3300005334	Bacteria	1179
95	Ga0068869_100381261	3300005334	Bacteria	1156
96	Ga0068869_100492108	3300005334	Bacteria	1022
97	Ga0068869_100529047	3300005334	Unclassified	988
98	Ga0068869_100570592	3300005334	Bacteria	953
99	Ga0068869_100782407	3300005334	Unclassified	819
100	Ga0070666_10017381	3300005335	Bacteria	4611
101	Ga0070666_10018717	3300005335	Bacteria	4459
102	Ga0070666_10026396	3300005335	Bacteria	3794
103	Ga0070666_10075987	3300005335	Bacteria	2291
104	Ga0070666_10280663	3300005335	Bacteria	1184
105	Ga0070666_10301954	3300005335	Bacteria	1140
106	Ga0070666_10640633	3300005335	Bacteria	777
107	Ga0070680_100098232	3300005336	Bacteria	2428
108	Ga0070680_100114879	3300005336	Bacteria	2243
109	Ga0070680_100134655	3300005336	Bacteria	2069
110	Ga0070680_100137262	3300005336	Bacteria	2049
111	Ga0070680_100165034	3300005336	Bacteria	1862
112	Ga0070680_100266504	3300005336	Bacteria	1450
113	Ga0070680_100448137	3300005336	Bacteria	1102
114	Ga0070680_100500388	3300005336	Bacteria	1040
115	Ga0070680_100788298	3300005336	Unclassified	819
116	Ga0070682_100007986	3300005337	Bacteria	5954
117	Ga0070682_100019793	3300005337	Bacteria	3953
118	Ga0070682_100158124	3300005337	Bacteria	1562
119	Ga0070682_100268355	3300005337	Bacteria	1238
120	Ga0070682_100637552	3300005337	Bacteria	846
121	Ga0068868_100038684	3300005338	Bacteria	3703
122	Ga0068868_100059588	3300005338	Bacteria	3020
123	Ga0068868_100067192	3300005338	Bacteria	2853
124	Ga0068868_100115997	3300005338	Bacteria	2180
125	Ga0068868_100118747	3300005338	Bacteria	2155
126	Ga0068868_100463947	3300005338	Unclassified	1104
127	Ga0068868_100475953	3300005338	Bacteria	1090
128	Ga0068868_100537718	3300005338	Bacteria	1028
129	Ga0068868_100638186	3300005338	Unclassified	947
130	Ga0068868_101399458	3300005338	Bacteria	652
131	Ga0070660_100011939	3300005339	Bacteria	6198
132	Ga0070660_100027710	3300005339	Bacteria	4230
133	Ga0070660_100177145	3300005339	Bacteria	1725
134	Ga0070660_100363806	3300005339	Unclassified	1192
135	Ga0070689_100020570	3300005340	Bacteria	4899
136	Ga0070689_100029871	3300005340	Bacteria	4132
137	Ga0070689_100038497	3300005340	Bacteria	3659
138	Ga0070689_100057269	3300005340	Bacteria	3025
139	Ga0070689_100096393	3300005340	Bacteria	2338
140	Ga0070689_100156596	3300005340	Bacteria	1839
141	Ga0070691_10044158	3300005341	Bacteria	2113
142	Ga0070691_10045685	3300005341	Bacteria	2079
143	Ga0070687_100002413	3300005343	Bacteria	6986
144	Ga0070687_100002977	3300005343	Bacteria	6502
145	Ga0070687_100045207	3300005343	Bacteria	2247
146	Ga0070661_100004429	3300005344	Bacteria	9681
147	Ga0070661_100009094	3300005344	Bacteria	6871
148	Ga0070661_100029191	3300005344	Bacteria	3980
149	Ga0070661_100033024	3300005344	Bacteria	3748
150	Ga0070661_100293198	3300005344	Unclassified	1265
151	Ga0070661_100697899	3300005344	Bacteria	827
152	Ga0070661_100833731	3300005344	Bacteria	758
153	Ga0070692_10007532	3300005345	Bacteria	4800
154	Ga0070692_10088217	3300005345	Bacteria	1682
155	Ga0070692_10139716	3300005345	Bacteria	1370
156	Ga0070692_10183700	3300005345	Bacteria	1214
157	Ga0070692_10271914	3300005345	Bacteria	1023
158	Ga0070692_10441774	3300005345	Unclassified	831
159	Ga0070692_10516707	3300005345	Unclassified	777
160	Ga0070668_100021234	3300005347	Bacteria	4908
161	Ga0070668_100435187	3300005347	Bacteria	1125
162	Ga0070669_100004517	3300005353	Bacteria	10040
163	Ga0070669_100018533	3300005353	Bacteria	4973
164	Ga0070669_100028322	3300005353	Bacteria	4034
165	Ga0070669_100050463	3300005353	Bacteria	3039
166	Ga0070669_100053168	3300005353	Bacteria	2964
167	Ga0070669_100055779	3300005353	Bacteria	2895
168	Ga0070669_100095460	3300005353	Bacteria	2236
169	Ga0070669_100195972	3300005353	Bacteria	1587
170	Ga0070669_100200086	3300005353	Bacteria	1571
171	Ga0070669_100224956	3300005353	Bacteria	1485
172	Ga0070669_100468616	3300005353	Bacteria	1040
173	Ga0070669_100913094	3300005353	Bacteria	750
174	Ga0070669_100971602	3300005353	Unclassified	728
175	Ga0070675_100043088	3300005354	Bacteria	3687
176	Ga0070675_100057665	3300005354	Bacteria	3202
177	Ga0070675_100187501	3300005354	Unclassified	1791
178	Ga0070675_100606768	3300005354	Bacteria	993
179	Ga0070675_100646216	3300005354	Bacteria	961
180	Ga0070675_100837164	3300005354	Unclassified	842
181	Ga0070671_100007852	3300005355	Bacteria	8529
182	Ga0070671_100033071	3300005355	Bacteria	4275
183	Ga0070671_100051494	3300005355	Bacteria	3424
184	Ga0070671_100053621	3300005355	Bacteria	3352
185	Ga0070671_100101509	3300005355	Bacteria	2414
186	Ga0070671_100369320	3300005355	Bacteria	1225
187	Ga0070671_100390926	3300005355	Bacteria	1189
188	Ga0070671_100461707	3300005355	Bacteria	1090
189	Ga0070671_100468296	3300005355	Bacteria	1082
190	Ga0070671_100680769	3300005355	Bacteria	891
191	Ga0070674_100020536	3300005356	Bacteria	4223
192	Ga0070674_100076800	3300005356	Bacteria	2376
193	Ga0070674_100303700	3300005356	Bacteria	1273
194	Ga0070674_101072296	3300005356	Bacteria	710
195	Ga0070673_100028099	3300005364	Bacteria	4179
196	Ga0070673_100070911	3300005364	Bacteria	2798
197	Ga0070673_100137469	3300005364	Bacteria	2058
198	Ga0070673_100176116	3300005364	Bacteria	1828
199	Ga0070673_100206610	3300005364	Bacteria	1693
200	Ga0070673_100264116	3300005364	Unclassified	1505
201	Ga0070673_100335331	3300005364	Bacteria	1339
202	Ga0070673_100622213	3300005364	Bacteria	986
203	Ga0070673_100716303	3300005364	Unclassified	920
204	Ga0070673_100765982	3300005364	Bacteria	889
205	Ga0070673_100797725	3300005364	Bacteria	872
206	Ga0070673_100952404	3300005364	Unclassified	798
207	Ga0070673_101260204	3300005364	Unclassified	694
208	Ga0070688_100003329	3300005365	Bacteria	8238
209	Ga0070688_100007474	3300005365	Bacteria	5896
210	Ga0070688_100173360	3300005365	Bacteria	1491
211	Ga0070688_100295204	3300005365	Bacteria	1169
212	Ga0070688_100886081	3300005365	Bacteria	703
213	Ga0070659_100003564	3300005366	Bacteria	11083
214	Ga0070659_100107817	3300005366	Bacteria	2246
215	Ga0070659_100351961	3300005366	Bacteria	1236
216	Ga0070667_100026302	3300005367	Bacteria	4839
217	Ga0070667_100036777	3300005367	Bacteria	4105
218	Ga0070667_100224692	3300005367	Bacteria	1672
219	Ga0070667_100331731	3300005367	Bacteria	1374
220	Ga0070667_100909521	3300005367	Bacteria	819
221	Ga0070667_101125373	3300005367	Bacteria	734
222	Ga0070703_10000193	3300005406	Bacteria	29596
223	Ga0070703_10006781	3300005406	Bacteria	3214
224	Ga0070703_10032886	3300005406	Bacteria	1577
225	Ga0070703_10044631	3300005406	Bacteria	1394
226	Ga0070703_10175455	3300005406	Unclassified	824
227	Ga0070709_10037238	3300005434	Bacteria	2969
228	Ga0070709_10069524	3300005434	Bacteria	2268
229	Ga0070709_10617696	3300005434	Bacteria	836
230	Ga0070714_100082228	3300005435	Bacteria	2805
231	Ga0070714_100239293	3300005435	Bacteria	1675
232	Ga0070714_100366265	3300005435	Viruses	1356
233	Ga0070714_100488968	3300005435	Bacteria	1172
234	Ga0070714_100954376	3300005435	Bacteria	834
235	Ga0070713_100053130	3300005436	Bacteria	3356
236	Ga0070713_100062925	3300005436	Bacteria	3109
237	Ga0070713_100080113	3300005436	Bacteria	2783
238	Ga0070713_100120470	3300005436	Bacteria	2300
239	Ga0070713_100160901	3300005436	Bacteria	2004
240	Ga0070713_100402895	3300005436	Bacteria	1278
241	Ga0070713_100510039	3300005436	Unclassified	1136
242	Ga0070713_101298053	3300005436	Unclassified	705
243	Ga0070710_10050598	3300005437	Bacteria	2330
244	Ga0070710_10060760	3300005437	Bacteria	2150
245	Ga0070701_10013118	3300005438	Bacteria	3760
246	Ga0070701_10049658	3300005438	Bacteria	2170
247	Ga0070701_10117539	3300005438	Bacteria	1494
248	Ga0070701_10237032	3300005438	Bacteria	1095
249	Ga0070701_10473109	3300005438	Bacteria	808
250	Ga0070711_100001451	3300005439	Bacteria	13031
251	Ga0070711_100046806	3300005439	Bacteria	2949
252	Ga0070711_100118000	3300005439	Bacteria	1958
253	Ga0070711_100232762	3300005439	Bacteria	1437
254	Ga0070711_100235266	3300005439	Bacteria	1430
255	Ga0070711_100289338	3300005439	Bacteria	1299
256	Ga0070711_100371046	3300005439	Bacteria	1155
257	Ga0070711_100642538	3300005439	Unclassified	889
258	Ga0070711_101416158	3300005439	Unclassified	605
259	Ga0070705_100000982	3300005440	Bacteria	15936
260	Ga0070705_100062699	3300005440	Bacteria	2214
261	Ga0070705_100083730	3300005440	Bacteria	1966
262	Ga0070705_100195004	3300005440	Bacteria	1384
263	Ga0070705_100314616	3300005440	Bacteria	1127
264	Ga0070705_100329915	3300005440	Unclassified	1105
265	Ga0070705_100453499	3300005440	Bacteria	963
266	Ga0070705_100550383	3300005440	Bacteria	884
267	Ga0070705_100567585	3300005440	Bacteria	873
268	Ga0070705_100595260	3300005440	Bacteria	854
269	Ga0070705_100628297	3300005440	Bacteria	834
270	Ga0070705_100763118	3300005440	Unclassified	766
271	Ga0070700_100005796	3300005441	Bacteria	6556
272	Ga0070700_100010746	3300005441	Bacteria	5058
273	Ga0070700_100022969	3300005441	Bacteria	3645
274	Ga0070700_100041257	3300005441	Bacteria	2829
275	Ga0070700_100148708	3300005441	Bacteria	1600
276	Ga0070700_100213780	3300005441	Bacteria	1362
277	Ga0070700_100226761	3300005441	Bacteria	1327
278	Ga0070700_100236265	3300005441	Bacteria	1303
279	Ga0070700_100743765	3300005441	Unclassified	784
280	Ga0070694_100015866	3300005444	Bacteria	4739
281	Ga0070694_100021679	3300005444	Bacteria	4110
282	Ga0070694_100025894	3300005444	Bacteria	3798
283	Ga0070694_100032476	3300005444	Bacteria	3428
284	Ga0070694_100055794	3300005444	Bacteria	2680
285	Ga0070694_100078456	3300005444	Bacteria	2291
286	Ga0070694_100079786	3300005444	Bacteria	2273
287	Ga0070694_100082443	3300005444	Bacteria	2240
288	Ga0070694_100090985	3300005444	Bacteria	2140
289	Ga0070694_100122794	3300005444	Bacteria	1866
290	Ga0070694_100226597	3300005444	Bacteria	1404
291	Ga0070694_100332023	3300005444	Bacteria	1173
292	Ga0070694_100591527	3300005444	Unclassified	892
293	Ga0070694_100598336	3300005444	Bacteria	888
294	Ga0070694_100947673	3300005444	Unclassified	712
295	Ga0070708_100001743	3300005445	Bacteria	16700
296	Ga0070708_100046385	3300005445	Bacteria	3834
297	Ga0070708_100046478	3300005445	Bacteria	3830
298	Ga0070708_100050740	3300005445	Bacteria	3674
299	Ga0070708_100066816	3300005445	Bacteria	3227
300	Ga0070708_100077627	3300005445	Bacteria	3001
301	Ga0070708_100166524	3300005445	Bacteria	2056
302	Ga0070708_100247773	3300005445	Bacteria	1673
303	Ga0070708_100249882	3300005445	Bacteria	1666
304	Ga0070708_100280955	3300005445	Bacteria	1567
305	Ga0070708_100311833	3300005445	Bacteria	1482
306	Ga0070708_100345933	3300005445	Unclassified	1401
307	Ga0070708_100526433	3300005445	Bacteria	1115
308	Ga0070708_100676616	3300005445	Bacteria	972
309	Ga0070708_100710304	3300005445	Bacteria	946
310	Ga0070708_100748259	3300005445	Unclassified	919
311	Ga0070708_101342541	3300005445	Bacteria	667
312	Ga0070663_100057682	3300005455	Bacteria	2786
313	Ga0070663_100165926	3300005455	Bacteria	1703
314	Ga0070678_100036409	3300005456	Bacteria	3445
315	Ga0070678_100075781	3300005456	Bacteria	2532
316	Ga0070678_100473060	3300005456	Bacteria	1101
317	Ga0070678_100630919	3300005456	Bacteria	959
318	Ga0070662_100004105	3300005457	Bacteria	9147
319	Ga0070662_100028499	3300005457	Bacteria	3886
320	Ga0070662_100029069	3300005457	Bacteria	3855
321	Ga0070662_100084929	3300005457	Bacteria	2365
322	Ga0070662_100111787	3300005457	Bacteria	2082
323	Ga0070662_100608439	3300005457	Unclassified	920
324	Ga0070681_10000095	3300005458	Bacteria	65410
325	Ga0070681_10006380	3300005458	Bacteria	11465
326	Ga0070681_10024410	3300005458	Bacteria	6086
327	Ga0070681_10027357	3300005458	Bacteria	5733
328	Ga0070681_10061399	3300005458	Bacteria	3733
329	Ga0070681_10135324	3300005458	Bacteria	2395
330	Ga0070681_10187931	3300005458	Bacteria	1985
331	Ga0070681_10514294	3300005458	Bacteria	1110
332	Ga0070681_10604969	3300005458	Bacteria	1010
333	Ga0070681_10638121	3300005458	Bacteria	980
334	Ga0068867_100011116	3300005459	Bacteria	6350
335	Ga0068867_100018373	3300005459	Bacteria	4970
336	Ga0068867_100027874	3300005459	Bacteria	4063
337	Ga0068867_100139144	3300005459	Bacteria	1896
338	Ga0068867_100164642	3300005459	Bacteria	1751
339	Ga0068867_100175345	3300005459	Bacteria	1701
340	Ga0068867_100334414	3300005459	Bacteria	1259
341	Ga0068867_100428047	3300005459	Unclassified	1123
342	Ga0068867_100640120	3300005459	Bacteria	932
343	Ga0068867_100683829	3300005459	Bacteria	904
344	Ga0068867_100925933	3300005459	Bacteria	786
345	Ga0070685_10016850	3300005466	Bacteria	3900
346	Ga0070685_10061109	3300005466	Bacteria	2205
347	Ga0070685_10470986	3300005466	Bacteria	884
348	Ga0070685_10827157	3300005466	Bacteria	684
349	Ga0070706_100000792	3300005467	Bacteria	35324
350	Ga0070706_100000920	3300005467	Bacteria	32204
351	Ga0070706_100001933	3300005467	Bacteria	21354
352	Ga0070706_100004637	3300005467	Bacteria	13195
353	Ga0070706_100005925	3300005467	Bacteria	11570
354	Ga0070706_100020710	3300005467	Bacteria	6058
355	Ga0070706_100028797	3300005467	Bacteria	5116
356	Ga0070706_100039495	3300005467	Bacteria	4357
357	Ga0070706_100131054	3300005467	Bacteria	2340
358	Ga0070706_100131556	3300005467	Bacteria	2335
359	Ga0070706_100150458	3300005467	Unclassified	2173
360	Ga0070706_100152848	3300005467	Bacteria	2155
361	Ga0070706_100492380	3300005467	Unclassified	1141
362	Ga0070706_100645592	3300005467	Bacteria	983
363	Ga0070706_100683703	3300005467	Bacteria	952
364	Ga0070706_101133857	3300005467	Unclassified	719
365	Ga0070707_100003296	3300005468	Bacteria	15256
366	Ga0070707_100009892	3300005468	Bacteria	8877
367	Ga0070707_100011873	3300005468	Bacteria	8132
368	Ga0070707_100014408	3300005468	Bacteria	7412
369	Ga0070707_100071010	3300005468	Bacteria	3354
370	Ga0070707_100083781	3300005468	Bacteria	3081
371	Ga0070707_100105313	3300005468	Bacteria	2735
372	Ga0070707_100108612	3300005468	Bacteria	2691
373	Ga0070707_100137855	3300005468	Bacteria	2374
374	Ga0070707_100196794	3300005468	Bacteria	1965
375	Ga0070707_100204552	3300005468	Bacteria	1924
376	Ga0070707_100208109	3300005468	Unclassified	1907
377	Ga0070707_100320014	3300005468	Bacteria	1507
378	Ga0070707_100404667	3300005468	Unclassified	1325
379	Ga0070707_100469021	3300005468	Bacteria	1220
380	Ga0070707_100535548	3300005468	Unclassified	1133
381	Ga0070707_100584573	3300005468	Bacteria	1079
382	Ga0070707_100629363	3300005468	Bacteria	1036
383	Ga0070707_100771435	3300005468	Unclassified	925
384	Ga0070698_100000374	3300005471	Bacteria	46633
385	Ga0070698_100003274	3300005471	Bacteria	17790
386	Ga0070698_100005496	3300005471	Bacteria	13834
387	Ga0070698_100005600	3300005471	Bacteria	13738
388	Ga0070698_100016601	3300005471	Bacteria	7770
389	Ga0070698_100034875	3300005471	Bacteria	5205
390	Ga0070698_100035264	3300005471	Bacteria	5174
391	Ga0070698_100035463	3300005471	Bacteria	5159
392	Ga0070698_100062710	3300005471	Bacteria	3750
393	Ga0070698_100066401	3300005471	Bacteria	3631
394	Ga0070698_100074362	3300005471	Bacteria	3403
395	Ga0070698_100374031	3300005471	Bacteria	1357
396	Ga0070699_100019115	3300005518	Bacteria	5894
397	Ga0070699_100024460	3300005518	Bacteria	5205
398	Ga0070699_100026662	3300005518	Bacteria	4984
399	Ga0070699_100033373	3300005518	Bacteria	4446
400	Ga0070699_100038208	3300005518	Bacteria	4156
401	Ga0070699_100059963	3300005518	Bacteria	3296
402	Ga0070699_100062651	3300005518	Bacteria	3224
403	Ga0070699_100177821	3300005518	Bacteria	1887
404	Ga0070699_100195455	3300005518	Unclassified	1798
405	Ga0070699_100222360	3300005518	Unclassified	1683
406	Ga0070699_100269386	3300005518	Bacteria	1524
407	Ga0070699_100826691	3300005518	Bacteria	848
408	Ga0070699_100872000	3300005518	Bacteria	824
409	Ga0070699_100922045	3300005518	Unclassified	800
410	Ga0070679_100000661	3300005530	Bacteria	29364
411	Ga0070679_100034483	3300005530	Bacteria	5016
412	Ga0070679_100037178	3300005530	Bacteria	4835
413	Ga0070679_100181525	3300005530	Bacteria	2077
414	Ga0070679_100303607	3300005530	Bacteria	1547
415	Ga0070679_100672538	3300005530	Bacteria	978
416	Ga0070679_101055467	3300005530	Unclassified	757
417	Ga0070684_100001288	3300005535	Bacteria	17957
418	Ga0070684_100098582	3300005535	Bacteria	2607
419	Ga0070697_100000283	3300005536	Bacteria	41017
420	Ga0070697_100000761	3300005536	Bacteria	24116
421	Ga0070697_100002791	3300005536	Bacteria	13453
422	Ga0070697_100003995	3300005536	Bacteria	11317
423	Ga0070697_100012955	3300005536	Bacteria	6534
424	Ga0070697_100055352	3300005536	Bacteria	3225
425	Ga0070697_100078640	3300005536	Bacteria	2714
426	Ga0070697_100081051	3300005536	Bacteria	2674
427	Ga0070697_100292422	3300005536	Unclassified	1399
428	Ga0070697_100301799	3300005536	Bacteria	1377
429	Ga0070697_100333250	3300005536	Unclassified	1308
430	Ga0070697_100419287	3300005536	Bacteria	1163
431	Ga0070697_100714406	3300005536	Bacteria	884
432	Ga0070697_101497093	3300005536	Unclassified	603
433	Ga0068853_100008387	3300005539	Bacteria	8299
434	Ga0068853_100018774	3300005539	Bacteria	5726
435	Ga0068853_100049752	3300005539	Bacteria	3603
436	Ga0068853_100101661	3300005539	Bacteria	2542
437	Ga0068853_100107608	3300005539	Bacteria	2472
438	Ga0068853_100181150	3300005539	Unclassified	1911
439	Ga0068853_100231044	3300005539	Bacteria	1692
440	Ga0068853_101556095	3300005539	Unclassified	640
441	Ga0070672_100026540	3300005543	Bacteria	4312
442	Ga0070672_100266328	3300005543	Unclassified	1446
443	Ga0070672_100466908	3300005543	Bacteria	1089
444	Ga0070672_100794691	3300005543	Bacteria	832
445	Ga0070672_101443001	3300005543	Unclassified	616
446	Ga0070686_100001416	3300005544	Bacteria	13538
447	Ga0070686_100005785	3300005544	Bacteria	6854
448	Ga0070686_100013995	3300005544	Bacteria	4610
449	Ga0070686_100021492	3300005544	Bacteria	3837
450	Ga0070686_100046653	3300005544	Bacteria	2735
451	Ga0070686_100353308	3300005544	Bacteria	1105
452	Ga0070686_100467594	3300005544	Bacteria	973
453	Ga0070686_100614166	3300005544	Bacteria	858
454	Ga0070686_100631658	3300005544	Unclassified	847
455	Ga0070695_100033900	3300005545	Bacteria	3196
456	Ga0070695_100076334	3300005545	Bacteria	2207
457	Ga0070695_100083578	3300005545	Bacteria	2116
458	Ga0070695_100170312	3300005545	Bacteria	1536
459	Ga0070695_100239110	3300005545	Unclassified	1316
460	Ga0070695_100241506	3300005545	Bacteria	1310
461	Ga0070695_100247538	3300005545	Bacteria	1296
462	Ga0070695_100271852	3300005545	Bacteria	1242
463	Ga0070695_100573436	3300005545	Bacteria	882
464	Ga0070695_100927126	3300005545	Unclassified	705
465	Ga0070696_100047947	3300005546	Bacteria	2965
466	Ga0070696_100053664	3300005546	Bacteria	2807
467	Ga0070696_100133532	3300005546	Bacteria	1808
468	Ga0070696_100182939	3300005546	Unclassified	1556
469	Ga0070696_100210087	3300005546	Bacteria	1456
470	Ga0070696_100319937	3300005546	Bacteria	1194
471	Ga0070696_100332780	3300005546	Bacteria	1172
472	Ga0070696_100342720	3300005546	Unclassified	1155
473	Ga0070696_100594350	3300005546	Unclassified	892
474	Ga0070696_100955153	3300005546	Bacteria	714
475	Ga0070693_100003410	3300005547	Bacteria	7407
476	Ga0070693_100015864	3300005547	Bacteria	3887
477	Ga0070693_100021759	3300005547	Bacteria	3401
478	Ga0070693_100077904	3300005547	Unclassified	1969
479	Ga0070693_100093271	3300005547	Bacteria	1819
480	Ga0070693_100117588	3300005547	Bacteria	1645
481	Ga0070693_100123487	3300005547	Bacteria	1609
482	Ga0070693_100164869	3300005547	Bacteria	1414
483	Ga0070693_100228684	3300005547	Unclassified	1222
484	Ga0070693_100241335	3300005547	Unclassified	1193
485	Ga0070693_100286351	3300005547	Bacteria	1105
486	Ga0070665_100031578	3300005548	Bacteria	5331
487	Ga0070665_100088492	3300005548	Bacteria	3103
488	Ga0070665_101107420	3300005548	Bacteria	803
489	Ga0070665_101552980	3300005548	Bacteria	670
490	Ga0070704_100013577	3300005549	Bacteria	5060
491	Ga0070704_100013963	3300005549	Bacteria	5004
492	Ga0070704_100018581	3300005549	Bacteria	4449
493	Ga0070704_100034482	3300005549	Bacteria	3433
494	Ga0070704_100078833	3300005549	Bacteria	2418
495	Ga0070704_100347699	3300005549	Bacteria	1251
496	Ga0070704_100379334	3300005549	Bacteria	1201
497	Ga0070704_100541756	3300005549	Bacteria	1016
498	Ga0070704_100573230	3300005549	Bacteria	989
499	Ga0070704_100799388	3300005549	Unclassified	843
500	Ga0070704_100879586	3300005549	Bacteria	805
501	Ga0070704_100965041	3300005549	Unclassified	769
502	Ga0070704_101134990	3300005549	Unclassified	711
503	Ga0068855_100017602	3300005563	Bacteria	8593
504	Ga0068855_100040905	3300005563	Bacteria	5498
505	Ga0068855_100060816	3300005563	Bacteria	4415
506	Ga0068855_100196578	3300005563	Bacteria	2272
507	Ga0068855_100261345	3300005563	Bacteria	1928
508	Ga0068855_100323508	3300005563	Bacteria	1704
509	Ga0068855_100552004	3300005563	Bacteria	1247
510	Ga0068855_100912091	3300005563	Bacteria	928
511	Ga0070664_100003167	3300005564	Bacteria	13297
512	Ga0070664_100031709	3300005564	Bacteria	4418
513	Ga0070664_100074406	3300005564	Bacteria	2915
514	Ga0070664_100525104	3300005564	Bacteria	1093
515	Ga0070664_100557912	3300005564	Bacteria	1059
516	Ga0070664_101131234	3300005564	Unclassified	738
517	Ga0070664_101150120	3300005564	Bacteria	731
518	Ga0068857_100004001	3300005577	Bacteria	12421
519	Ga0068857_100016539	3300005577	Bacteria	6462
520	Ga0068857_100034641	3300005577	Bacteria	4466
521	Ga0068857_100256564	3300005577	Bacteria	1604
522	Ga0068857_100363121	3300005577	Bacteria	1342
523	Ga0068857_100475405	3300005577	Bacteria	1171
524	Ga0068857_100499467	3300005577	Bacteria	1141
525	Ga0068857_100557366	3300005577	Bacteria	1080
526	Ga0068857_100907066	3300005577	Bacteria	845
527	Ga0068857_101139707	3300005577	Bacteria	754
528	Ga0068857_101223917	3300005577	Unclassified	727
529	Ga0068857_101307355	3300005577	Unclassified	704
530	Ga0068854_100008033	3300005578	Bacteria	6763
531	Ga0068854_100014168	3300005578	Bacteria	5249
532	Ga0068854_100020758	3300005578	Bacteria	4451
533	Ga0068854_100042280	3300005578	Bacteria	3225
534	Ga0068854_100149254	3300005578	Bacteria	1801
535	Ga0068854_100169796	3300005578	Bacteria	1696
536	Ga0068854_100201158	3300005578	Bacteria	1566
537	Ga0068854_100392510	3300005578	Bacteria	1146
538	Ga0068854_100467496	3300005578	Bacteria	1057
539	Ga0068854_100876391	3300005578	Bacteria	787
540	Ga0068854_101116844	3300005578	Unclassified	703
541	Ga0068856_100001110	3300005614	Bacteria	28423
542	Ga0068856_100018558	3300005614	Bacteria	6740
543	Ga0068856_100035194	3300005614	Bacteria	4907
544	Ga0068856_100042765	3300005614	Bacteria	4458
545	Ga0068856_100121599	3300005614	Bacteria	2612
546	Ga0068856_100297013	3300005614	Unclassified	1633
547	Ga0068856_100903766	3300005614	Bacteria	902
548	Ga0070702_100003139	3300005615	Bacteria	7321
549	Ga0070702_100015413	3300005615	Bacteria	3903
550	Ga0070702_100036883	3300005615	Bacteria	2712
551	Ga0070702_100039137	3300005615	Bacteria	2644
552	Ga0070702_100049917	3300005615	Bacteria	2388
553	Ga0070702_100219565	3300005615	Bacteria	1270
554	Ga0070702_100446062	3300005615	Bacteria	938
555	Ga0070702_100483483	3300005615	Unclassified	905
556	Ga0070702_100629482	3300005615	Bacteria	808
557	Ga0068852_100013666	3300005616	Bacteria	6219
558	Ga0068852_100041438	3300005616	Bacteria	3892
559	Ga0068852_100065431	3300005616	Bacteria	3171
560	Ga0068852_100087406	3300005616	Bacteria	2781
561	Ga0068852_100451609	3300005616	Bacteria	1272
562	Ga0068859_100007438	3300005617	Bacteria	11114
563	Ga0068859_100025384	3300005617	Bacteria	5944
564	Ga0068859_100056053	3300005617	Bacteria	3966
565	Ga0068859_100067591	3300005617	Bacteria	3608
566	Ga0068859_100122037	3300005617	Bacteria	2672
567	Ga0068859_100129114	3300005617	Bacteria	2598
568	Ga0068859_100156767	3300005617	Bacteria	2354
569	Ga0068859_100160322	3300005617	Bacteria	2328
570	Ga0068859_100237255	3300005617	Bacteria	1912
571	Ga0068859_100240688	3300005617	Bacteria	1899
572	Ga0068859_100296389	3300005617	Bacteria	1710
573	Ga0068859_100505664	3300005617	Bacteria	1303
574	Ga0068859_100574158	3300005617	Bacteria	1221
575	Ga0068859_100607627	3300005617	Bacteria	1186
576	Ga0068859_100627616	3300005617	Bacteria	1167
577	Ga0068859_100628635	3300005617	Bacteria	1166
578	Ga0068859_100648908	3300005617	Bacteria	1147
579	Ga0068859_100701481	3300005617	Bacteria	1103
580	Ga0068859_100802930	3300005617	Bacteria	1028
581	Ga0068859_100823490	3300005617	Bacteria	1015
582	Ga0068864_100021548	3300005618	Bacteria	5398
583	Ga0068864_100022179	3300005618	Bacteria	5324
584	Ga0068864_100023022	3300005618	Bacteria	5228
585	Ga0068864_100037009	3300005618	Bacteria	4162
586	Ga0068864_100049121	3300005618	Bacteria	3629
587	Ga0068864_100051844	3300005618	Bacteria	3536
588	Ga0068864_100051845	3300005618	Bacteria	3536
589	Ga0068864_100056009	3300005618	Bacteria	3406
590	Ga0068864_100063202	3300005618	Bacteria	3208
591	Ga0068864_100155094	3300005618	Bacteria	2078
592	Ga0068864_100167996	3300005618	Bacteria	1998
593	Ga0068864_100450029	3300005618	Bacteria	1231
594	Ga0068864_100589813	3300005618	Bacteria	1077
595	Ga0068864_100624825	3300005618	Bacteria	1047
596	Ga0068864_100636501	3300005618	Bacteria	1037
597	Ga0068864_100663371	3300005618	Bacteria	1016
598	Ga0068864_100864761	3300005618	Unclassified	891
599	Ga0068864_101708072	3300005618	Bacteria	634
600	Ga0068866_10012121	3300005718	Bacteria	3751
601	Ga0068866_10012501	3300005718	Bacteria	3700
602	Ga0068866_10025187	3300005718	Bacteria	2794
603	Ga0068866_10026741	3300005718	Bacteria	2729
604	Ga0068866_10071399	3300005718	Bacteria	1836
605	Ga0068866_10197950	3300005718	Bacteria	1198
606	Ga0068866_10261452	3300005718	Bacteria	1064
607	Ga0068866_10422302	3300005718	Unclassified	865
608	Ga0068861_100027368	3300005719	Bacteria	4151
609	Ga0068861_100040453	3300005719	Bacteria	3487
610	Ga0068861_100048259	3300005719	Bacteria	3218
611	Ga0068861_100048837	3300005719	Bacteria	3201
612	Ga0068861_100096363	3300005719	Bacteria	2344
613	Ga0068861_100175821	3300005719	Bacteria	1778
614	Ga0068861_100212775	3300005719	Bacteria	1629
615	Ga0068861_100385293	3300005719	Bacteria	1240
616	Ga0068851_10005401	3300005834	Bacteria	5797
617	Ga0068851_10016669	3300005834	Bacteria	3520
618	Ga0068851_10036164	3300005834	Bacteria	2472
619	Ga0068851_10067532	3300005834	Bacteria	1844
620	Ga0068851_10217424	3300005834	Bacteria	1072
621	Ga0068851_10224954	3300005834	Bacteria	1056
622	Ga0068851_10274486	3300005834	Bacteria	962
623	Ga0068870_10003394	3300005840	Bacteria	6750
624	Ga0068870_10009612	3300005840	Bacteria	4406
625	Ga0068870_10024974	3300005840	Bacteria	2962
626	Ga0068870_10063049	3300005840	Bacteria	1998
627	Ga0068870_10122892	3300005840	Bacteria	1498
628	Ga0068870_10212506	3300005840	Bacteria	1179
629	Ga0068870_10314956	3300005840	Bacteria	992
630	Ga0068870_10359188	3300005840	Unclassified	937
631	Ga0068863_100019878	3300005841	Bacteria	6423
632	Ga0068863_100042226	3300005841	Bacteria	4333
633	Ga0068863_100082290	3300005841	Bacteria	3050
634	Ga0068863_100121531	3300005841	Bacteria	2491
635	Ga0068863_100178956	3300005841	Bacteria	2036
636	Ga0068863_100272885	3300005841	Bacteria	1637
637	Ga0068863_100283162	3300005841	Unclassified	1606
638	Ga0068863_100313690	3300005841	Bacteria	1522
639	Ga0068863_100319729	3300005841	Bacteria	1507
640	Ga0068863_100447147	3300005841	Unclassified	1268
641	Ga0068863_100488454	3300005841	Bacteria	1212
642	Ga0068863_100596160	3300005841	Bacteria	1093
643	Ga0068863_100644338	3300005841	Bacteria	1050
644	Ga0068863_101061708	3300005841	Unclassified	814
645	Ga0068863_101956510	3300005841	Unclassified	596
646	Ga0068858_100006289	3300005842	Bacteria	11564
647	Ga0068858_100008879	3300005842	Bacteria	9636
648	Ga0068858_100036870	3300005842	Bacteria	4533
649	Ga0068858_100039391	3300005842	Bacteria	4382
650	Ga0068858_100056365	3300005842	Bacteria	3633
651	Ga0068858_100083972	3300005842	Bacteria	2962
652	Ga0068858_100110403	3300005842	Bacteria	2568
653	Ga0068858_100147989	3300005842	Bacteria	2207
654	Ga0068858_100292735	3300005842	Bacteria	1552
655	Ga0068858_100370683	3300005842	Bacteria	1373
656	Ga0068858_100405918	3300005842	Bacteria	1309
657	Ga0068858_100668083	3300005842	Bacteria	1010
658	Ga0068858_101096284	3300005842	Unclassified	782
659	Ga0068860_100029103	3300005843	Bacteria	5313
660	Ga0068860_100042911	3300005843	Bacteria	4316
661	Ga0068860_100057451	3300005843	Bacteria	3699
662	Ga0068860_100097518	3300005843	Bacteria	2803
663	Ga0068860_100102558	3300005843	Bacteria	2730
664	Ga0068860_100171331	3300005843	Bacteria	2097
665	Ga0068860_100195919	3300005843	Unclassified	1956
666	Ga0068860_100203029	3300005843	Bacteria	1921
667	Ga0068860_100213149	3300005843	Bacteria	1874
668	Ga0068860_100254033	3300005843	Bacteria	1712
669	Ga0068860_100383690	3300005843	Bacteria	1387
670	Ga0068860_100824708	3300005843	Bacteria	941
671	Ga0068860_100896885	3300005843	Unclassified	902
672	Ga0068860_101447307	3300005843	Bacteria	708
673	Ga0068860_101794202	3300005843	Bacteria	635
674	Ga0068860_102147369	3300005843	Unclassified	579
675	Ga0068862_100009823	3300005844	Bacteria	7905
676	Ga0068862_100022289	3300005844	Bacteria	5297
677	Ga0068862_100040176	3300005844	Bacteria	3976
678	Ga0068862_100040779	3300005844	Bacteria	3947
679	Ga0068862_100131758	3300005844	Bacteria	2212
680	Ga0068862_100172950	3300005844	Bacteria	1934
681	Ga0068862_100176622	3300005844	Bacteria	1915
682	Ga0068862_100247456	3300005844	Bacteria	1623
683	Ga0068862_100261716	3300005844	Unclassified	1579
684	Ga0068862_100922131	3300005844	Bacteria	860
685	Ga0068862_101364053	3300005844	Unclassified	712
686	Ga0081455_10148747	3300005937	Bacteria	1808
687	Ga0081539_10000976	3300005985	Bacteria	53364
688	Ga0081539_10002683	3300005985	Bacteria	24194
689	Ga0081539_10003361	3300005985	Bacteria	19802
690	Ga0081539_10005422	3300005985	Bacteria	13033
691	Ga0081539_10064018	3300005985	Bacteria	2003
692	Ga0081539_10081902	3300005985	Bacteria	1694
693	Ga0081539_10184922	3300005985	Unclassified	974
694	Ga0070717_10005974	3300006028	Bacteria	8915
695	Ga0070717_10027475	3300006028	Bacteria	4548
696	Ga0070717_10028758	3300006028	Bacteria	4453
697	Ga0070717_10044840	3300006028	Bacteria	3613
698	Ga0070717_10047509	3300006028	Bacteria	3517
699	Ga0070717_10085168	3300006028	Bacteria	2659
700	Ga0070717_10279820	3300006028	Unclassified	1479
701	Ga0070717_10320448	3300006028	Bacteria	1381
702	Ga0070717_10330372	3300006028	Bacteria	1360
703	Ga0070717_11004287	3300006028	Bacteria	760
704	Ga0075432_10109492	3300006058	Bacteria	1028
705	Ga0070715_10000039	3300006163	Bacteria	66918
706	Ga0070715_10051924	3300006163	Bacteria	1767
707	Ga0070716_100000014	3300006173	Bacteria	92762
708	Ga0070716_100024110	3300006173	Bacteria	3235
709	Ga0070716_100054581	3300006173	Bacteria	2283
710	Ga0070716_100084084	3300006173	Bacteria	1908
711	Ga0070716_100096014	3300006173	Bacteria	1806
712	Ga0070716_100215686	3300006173	Bacteria	1286
713	Ga0070712_100023609	3300006175	Bacteria	4065
714	Ga0070712_100035148	3300006175	Bacteria	3400
715	Ga0070712_100139388	3300006175	Bacteria	1849
716	Ga0070712_100375595	3300006175	Bacteria	1169
717	Ga0097621_100001595	3300006237	Bacteria	15516
718	Ga0097621_100061660	3300006237	Bacteria	3076
719	Ga0097621_100073961	3300006237	Bacteria	2822
720	Ga0097621_100087801	3300006237	Bacteria	2597
721	Ga0097621_100112658	3300006237	Bacteria	2300
722	Ga0097621_100141716	3300006237	Bacteria	2054
723	Ga0097621_100203401	3300006237	Bacteria	1720
724	Ga0097621_100355292	3300006237	Bacteria	1304
725	Ga0097621_100357264	3300006237	Bacteria	1301
726	Ga0068871_100005005	3300006358	Bacteria	9259
727	Ga0068871_100008540	3300006358	Bacteria	7362
728	Ga0068871_100016458	3300006358	Bacteria	5569
729	Ga0068871_100032343	3300006358	Bacteria	4132
730	Ga0068871_100042420	3300006358	Bacteria	3652
731	Ga0068871_100088882	3300006358	Bacteria	2571
732	Ga0068871_100143008	3300006358	Bacteria	2035
733	Ga0068871_100233684	3300006358	Bacteria	1596
734	Ga0068871_100352551	3300006358	Bacteria	1302
735	Ga0068871_100937186	3300006358	Bacteria	804
736	Ga0068871_101723853	3300006358	Unclassified	594
737	Ga0075428_100025823	3300006844	Bacteria	6505
738	Ga0075428_100038516	3300006844	Bacteria	5261
739	Ga0075428_100078443	3300006844	Bacteria	3605
740	Ga0075428_100081117	3300006844	Bacteria	3541
741	Ga0075428_100202372	3300006844	Bacteria	2146
742	Ga0075428_100281008	3300006844	Bacteria	1791
743	Ga0075428_100347989	3300006844	Bacteria	1591
744	Ga0075430_100514321	3300006846	Unclassified	988
745	Ga0075431_100031478	3300006847	Bacteria	5464
746	Ga0075431_100126819	3300006847	Bacteria	2633
747	Ga0075431_100172905	3300006847	Bacteria	2219
748	Ga0075431_100347777	3300006847	Bacteria	1491
749	Ga0075431_100700515	3300006847	Unclassified	990
750	Ga0075431_101067865	3300006847	Bacteria	773
751	Ga0075433_10022574	3300006852	Bacteria	5284
752	Ga0075433_10032041	3300006852	Bacteria	4499
753	Ga0075433_10036894	3300006852	Bacteria	4213
754	Ga0075433_10092313	3300006852	Bacteria	2678
755	Ga0075433_10113009	3300006852	Bacteria	2409
756	Ga0075433_10131178	3300006852	Bacteria	2226
757	Ga0075433_10168639	3300006852	Bacteria	1948
758	Ga0075433_10191599	3300006852	Bacteria	1819
759	Ga0075433_10231432	3300006852	Bacteria	1641
760	Ga0075433_10233774	3300006852	Bacteria	1632
761	Ga0075433_10288014	3300006852	Bacteria	1455
762	Ga0075433_10338685	3300006852	Bacteria	1329
763	Ga0075433_10385303	3300006852	Bacteria	1237
764	Ga0075433_10556371	3300006852	Bacteria	1008
765	Ga0075433_10588799	3300006852	Bacteria	977
766	Ga0075433_10763596	3300006852	Unclassified	845
767	Ga0075433_10980620	3300006852	Bacteria	736
768	Ga0075433_11070422	3300006852	Unclassified	701
769	Ga0075434_100000359	3300006871	Bacteria	33102
770	Ga0075434_100007514	3300006871	Bacteria	10089
771	Ga0075434_100017958	3300006871	Bacteria	6825
772	Ga0075434_100034935	3300006871	Bacteria	4968
773	Ga0075434_100062820	3300006871	Bacteria	3697
774	Ga0075434_100191749	3300006871	Unclassified	2064
775	Ga0075434_100223276	3300006871	Bacteria	1904
776	Ga0075434_100238187	3300006871	Bacteria	1840
777	Ga0075434_100440591	3300006871	Bacteria	1324
778	Ga0075434_100484928	3300006871	Bacteria	1257
779	Ga0075434_100526883	3300006871	Bacteria	1202
780	Ga0075434_100531129	3300006871	Bacteria	1197
781	Ga0075434_100822142	3300006871	Unclassified	945
782	Ga0075429_100029946	3300006880	Bacteria	4728
783	Ga0075429_100049604	3300006880	Bacteria	3650
784	Ga0075429_100210297	3300006880	Bacteria	1704
785	Ga0075429_100253705	3300006880	Bacteria	1540
786	Ga0075429_100349361	3300006880	Bacteria	1295
787	Ga0068865_100012683	3300006881	Bacteria	5311
788	Ga0068865_100030443	3300006881	Bacteria	3590
789	Ga0068865_100047442	3300006881	Bacteria	2951
790	Ga0068865_100073227	3300006881	Bacteria	2435
791	Ga0068865_100165590	3300006881	Bacteria	1690
792	Ga0068865_100229398	3300006881	Bacteria	1456
793	Ga0068865_100374594	3300006881	Bacteria	1159
794	Ga0068865_100460913	3300006881	Bacteria	1053
795	Ga0068865_100540083	3300006881	Bacteria	978
796	Ga0068865_100624907	3300006881	Unclassified	913
797	Ga0068865_101123268	3300006881	Unclassified	693
798	Ga0075436_100015347	3300006914	Bacteria	5247
799	Ga0075436_100038672	3300006914	Bacteria	3293
800	Ga0075436_100166191	3300006914	Unclassified	1557
801	Ga0075436_100187748	3300006914	Bacteria	1462
802	Ga0075436_100231379	3300006914	Bacteria	1313
803	Ga0075436_100549200	3300006914	Unclassified	848
804	Ga0097620_100007438	3300006931	Bacteria	11114
805	Ga0097620_100025387	3300006931	Bacteria	5944
806	Ga0097620_100056054	3300006931	Bacteria	3966
807	Ga0097620_100067591	3300006931	Bacteria	3608
808	Ga0097620_100122030	3300006931	Bacteria	2672
809	Ga0097620_100129107	3300006931	Bacteria	2598
810	Ga0097620_100156772	3300006931	Bacteria	2354
811	Ga0097620_100160305	3300006931	Bacteria	2328
812	Ga0097620_100237249	3300006931	Bacteria	1912
813	Ga0097620_100240675	3300006931	Bacteria	1899
814	Ga0097620_100296397	3300006931	Bacteria	1710
815	Ga0097620_100505645	3300006931	Bacteria	1303
816	Ga0097620_100574152	3300006931	Bacteria	1221
817	Ga0097620_100607639	3300006931	Bacteria	1186
818	Ga0097620_100627728	3300006931	Bacteria	1167
819	Ga0097620_100628693	3300006931	Bacteria	1166
820	Ga0097620_100648968	3300006931	Bacteria	1147
821	Ga0097620_100701410	3300006931	Bacteria	1103
822	Ga0097620_100802961	3300006931	Bacteria	1028
823	Ga0097620_100823713	3300006931	Bacteria	1015
824	Ga0075435_100020792	3300007076	Bacteria	5037
825	Ga0075435_100036375	3300007076	Bacteria	3912
826	Ga0075435_100064802	3300007076	Bacteria	2970
827	Ga0075435_100108872	3300007076	Bacteria	2303
828	Ga0075435_100579486	3300007076	Bacteria	972
829	Ga0099794_10002610	3300007265	Bacteria	6699
830	Ga0099794_10045761	3300007265	Bacteria	2094
831	Ga0099794_10188392	3300007265	Bacteria	1055
832	Ga0099794_10215139	3300007265	Unclassified	986
833	Ga0105251_10039112	3300009011	Bacteria	2319
834	Ga0105251_10079822	3300009011	Bacteria	1514
835	Ga0105251_10151642	3300009011	Bacteria	1047
836	Ga0105250_10009785	3300009092	Bacteria	4025
837	Ga0105250_10202184	3300009092	Bacteria	838
838	Ga0105250_10223871	3300009092	Unclassified	798
839	Ga0105240_10068598	3300009093	Bacteria	4391
840	Ga0105240_10078306	3300009093	Bacteria	4071
841	Ga0105240_10171414	3300009093	Bacteria	2570
842	Ga0105240_10205176	3300009093	Bacteria	2308
843	Ga0105240_10207073	3300009093	Bacteria	2295
844	Ga0105240_10223897	3300009093	Unclassified	2190
845	Ga0105240_10267492	3300009093	Bacteria	1970
846	Ga0105240_10444187	3300009093	Bacteria	1453
847	Ga0105240_10644182	3300009093	Unclassified	1162
848	Ga0105240_10848642	3300009093	Bacteria	986
849	Ga0105240_11159552	3300009093	Unclassified	820
850	Ga0105240_11646154	3300009093	Bacteria	671
851	Ga0111539_10022660	3300009094	Bacteria	7715
852	Ga0111539_10111096	3300009094	Bacteria	3216
853	Ga0111539_10155362	3300009094	Bacteria	2677
854	Ga0111539_10265512	3300009094	Unclassified	1998
855	Ga0111539_10528383	3300009094	Bacteria	1374
856	Ga0111539_10556309	3300009094	Bacteria	1336
857	Ga0111539_10735728	3300009094	Bacteria	1148
858	Ga0111539_10793350	3300009094	Bacteria	1102
859	Ga0111539_11184195	3300009094	Bacteria	888
860	Ga0105245_10018594	3300009098	Bacteria	6078
861	Ga0105245_10026029	3300009098	Bacteria	5148
862	Ga0105245_10027941	3300009098	Bacteria	4972
863	Ga0105245_10029207	3300009098	Bacteria	4869
864	Ga0105245_10164407	3300009098	Bacteria	2108
865	Ga0105245_10632950	3300009098	Bacteria	1099
866	Ga0105245_11292432	3300009098	Unclassified	778
867	Ga0105247_10000050	3300009101	Bacteria	146183
868	Ga0105247_10013031	3300009101	Bacteria	4986
869	Ga0105247_10057749	3300009101	Bacteria	2399
870	Ga0105247_10104474	3300009101	Unclassified	1815
871	Ga0105247_10225572	3300009101	Bacteria	1270
872	Ga0105247_10429993	3300009101	Unclassified	947
873	Ga0105247_11222697	3300009101	Bacteria	599
874	Ga0114129_10033278	3300009147	Bacteria	7285
875	Ga0114129_10051383	3300009147	Bacteria	5787
876	Ga0114129_10060754	3300009147	Bacteria	5283
877	Ga0114129_10066829	3300009147	Bacteria	5014
878	Ga0114129_10134336	3300009147	Bacteria	3396
879	Ga0114129_10152363	3300009147	Bacteria	3163
880	Ga0114129_10198455	3300009147	Bacteria	2719
881	Ga0114129_10253970	3300009147	Bacteria	2359
882	Ga0114129_10263223	3300009147	Bacteria	2310
883	Ga0114129_10302270	3300009147	Bacteria	2132
884	Ga0114129_10304753	3300009147	Unclassified	2122
885	Ga0114129_10309888	3300009147	Unclassified	2101
886	Ga0114129_10468658	3300009147	Bacteria	1650
887	Ga0114129_10483108	3300009147	Bacteria	1620
888	Ga0114129_10605425	3300009147	Bacteria	1419
889	Ga0114129_10807822	3300009147	Bacteria	1196
890	Ga0114129_10902480	3300009147	Unclassified	1119
891	Ga0114129_10995219	3300009147	Bacteria	1056
892	Ga0114129_11902443	3300009147	Unclassified	721
893	Ga0105243_10007055	3300009148	Bacteria	8639
894	Ga0105243_10010720	3300009148	Bacteria	6943
895	Ga0105243_10030797	3300009148	Bacteria	4134
896	Ga0105243_10038543	3300009148	Bacteria	3722
897	Ga0105243_10146690	3300009148	Bacteria	2019
898	Ga0105243_10430471	3300009148	Bacteria	1233
899	Ga0105243_10583269	3300009148	Bacteria	1074
900	Ga0105243_10674589	3300009148	Bacteria	1004
901	Ga0105243_11008496	3300009148	Unclassified	836
902	Ga0105243_11464994	3300009148	Unclassified	705
903	Ga0105243_12048625	3300009148	Unclassified	607
904	Ga0105243_12305990	3300009148	Bacteria	576
905	Ga0105241_10002176	3300009174	Bacteria	14766
906	Ga0105241_10012886	3300009174	Bacteria	6135
907	Ga0105241_10101528	3300009174	Bacteria	2287
908	Ga0105241_10130789	3300009174	Bacteria	2032
909	Ga0105241_10142240	3300009174	Bacteria	1955
910	Ga0105241_10173075	3300009174	Bacteria	1785
911	Ga0105241_10191319	3300009174	Unclassified	1704
912	Ga0105241_10204548	3300009174	Bacteria	1651
913	Ga0105241_10317229	3300009174	Bacteria	1343
914	Ga0105241_10331647	3300009174	Bacteria	1315
915	Ga0105241_10541301	3300009174	Bacteria	1044
916	Ga0105241_10605393	3300009174	Bacteria	990
917	Ga0105241_10697392	3300009174	Bacteria	926
918	Ga0105241_10756812	3300009174	Unclassified	891
919	Ga0105241_11221401	3300009174	Unclassified	713
920	Ga0105242_10003471	3300009176	Bacteria	12255
921	Ga0105242_10004367	3300009176	Bacteria	11004
922	Ga0105242_10022250	3300009176	Bacteria	4983
923	Ga0105242_10029837	3300009176	Bacteria	4353
924	Ga0105242_10034629	3300009176	Bacteria	4049
925	Ga0105242_10106044	3300009176	Bacteria	2388
926	Ga0105242_10131561	3300009176	Bacteria	2161
927	Ga0105242_10137514	3300009176	Bacteria	2116
928	Ga0105242_10870585	3300009176	Unclassified	898
929	Ga0105248_10015006	3300009177	Bacteria	8528
930	Ga0105248_10043401	3300009177	Bacteria	5041
931	Ga0105248_10053458	3300009177	Bacteria	4532
932	Ga0105248_10055715	3300009177	Bacteria	4435
933	Ga0105248_10066472	3300009177	Bacteria	4048
934	Ga0105248_10074288	3300009177	Bacteria	3821
935	Ga0105248_10092476	3300009177	Bacteria	3407
936	Ga0105248_10121996	3300009177	Bacteria	2940
937	Ga0105248_10129394	3300009177	Bacteria	2848
938	Ga0105248_10168767	3300009177	Bacteria	2466
939	Ga0105248_10314274	3300009177	Bacteria	1764
940	Ga0105248_10399639	3300009177	Bacteria	1547
941	Ga0105248_10604351	3300009177	Bacteria	1237
942	Ga0105248_10683183	3300009177	Bacteria	1158
943	Ga0105248_10867975	3300009177	Bacteria	1019
944	Ga0105248_10910753	3300009177	Bacteria	993
945	Ga0105248_10916648	3300009177	Bacteria	989
946	Ga0105248_11063481	3300009177	Bacteria	914
947	Ga0105248_11191312	3300009177	Bacteria	861
948	Ga0105248_11656695	3300009177	Bacteria	725
949	Ga0105248_11663858	3300009177	Unclassified	723
950	Ga0105237_10007174	3300009545	Bacteria	12244
951	Ga0105237_10021684	3300009545	Bacteria	6602
952	Ga0105237_10062079	3300009545	Bacteria	3735
953	Ga0105237_10085791	3300009545	Bacteria	3138
954	Ga0105237_10164351	3300009545	Bacteria	2218
955	Ga0105237_10220127	3300009545	Bacteria	1898
956	Ga0105237_10327578	3300009545	Bacteria	1535
957	Ga0105237_10347120	3300009545	Bacteria	1488
958	Ga0105237_10504430	3300009545	Bacteria	1216
959	Ga0105237_10636126	3300009545	Unclassified	1074
960	Ga0105237_10779234	3300009545	Bacteria	963
961	Ga0105237_10865959	3300009545	Unclassified	910
962	Ga0105238_10020606	3300009551	Bacteria	6716
963	Ga0105238_10036920	3300009551	Bacteria	4969
964	Ga0105238_10039975	3300009551	Bacteria	4754
965	Ga0105238_10465198	3300009551	Bacteria	1263
966	Ga0105238_10576782	3300009551	Bacteria	1131
967	Ga0105238_10848506	3300009551	Unclassified	930
968	Ga0105238_11036234	3300009551	Bacteria	842
969	Ga0105249_10012680	3300009553	Bacteria	7434
970	Ga0105249_10013119	3300009553	Bacteria	7312
971	Ga0105249_10025118	3300009553	Bacteria	5362
972	Ga0105249_10026857	3300009553	Bacteria	5191
973	Ga0105249_10044804	3300009553	Bacteria	4022
974	Ga0105249_10098274	3300009553	Bacteria	2749
975	Ga0105249_10100720	3300009553	Bacteria	2717
976	Ga0105249_10111457	3300009553	Bacteria	2587
977	Ga0105249_10161894	3300009553	Bacteria	2163
978	Ga0105249_10225670	3300009553	Bacteria	1845
979	Ga0105249_10388407	3300009553	Bacteria	1423
980	Ga0105249_10991684	3300009553	Bacteria	909
981	Ga0105239_10042332	3300010375	Bacteria	4991
982	Ga0105239_10088575	3300010375	Bacteria	3413
983	Ga0105239_10201039	3300010375	Bacteria	2232
984	Ga0105239_10229775	3300010375	Bacteria	2081
985	Ga0105239_10298472	3300010375	Bacteria	1814
986	Ga0105239_10454772	3300010375	Bacteria	1453
987	Ga0105239_10571672	3300010375	Bacteria	1288
988	Ga0105239_11363792	3300010375	Unclassified	818
989	Ga0105239_11515390	3300010375	Unclassified	775
990	Ga0105246_10011795	3300011119	Bacteria	5431
991	Ga0105246_10015588	3300011119	Bacteria	4802
992	Ga0105246_10090082	3300011119	Bacteria	2208
993	Ga0105246_10205203	3300011119	Bacteria	1535
994	Ga0105246_10374897	3300011119	Bacteria	1174
995	Ga0105246_10402874	3300011119	Unclassified	1137
996	Ga0105246_10545206	3300011119	Bacteria	993
997	Ga0157373_10021532	3300013100	Bacteria	4682
998	Ga0157373_10026972	3300013100	Bacteria	4146
999	Ga0157373_10033463	3300013100	Bacteria	3698
1000	Ga0157373_10041447	3300013100	Bacteria	3294
1001	Ga0157373_10052446	3300013100	Bacteria	2902
1002	Ga0157373_10150539	3300013100	Bacteria	1637
1003	Ga0157373_10686916	3300013100	Unclassified	749
1004	Ga0157373_10775384	3300013100	Unclassified	706
1005	Ga0157371_10014568	3300013102	Bacteria	5929
1006	Ga0157371_10020354	3300013102	Bacteria	4882
1007	Ga0157370_10060881	3300013104	Bacteria	3583
1008	Ga0157370_10135365	3300013104	Bacteria	2297
1009	Ga0157370_10532238	3300013104	Bacteria	1078
1010	Ga0157370_11050157	3300013104	Bacteria	737
1011	Ga0157369_10000674	3300013105	Bacteria	44019
1012	Ga0157369_10025145	3300013105	Bacteria	6612
1013	Ga0157369_10052158	3300013105	Bacteria	4426
1014	Ga0157369_10106782	3300013105	Bacteria	2979
1015	Ga0157369_10227210	3300013105	Bacteria	1952
1016	Ga0157369_10271417	3300013105	Bacteria	1767
1017	Ga0157369_10342047	3300013105	Bacteria	1554
1018	Ga0157369_10637165	3300013105	Bacteria	1100
1019	Ga0157374_10006374	3300013296	Bacteria	10011
1020	Ga0157374_10014289	3300013296	Bacteria	6947
1021	Ga0157374_10047190	3300013296	Bacteria	3993
1022	Ga0157374_10050453	3300013296	Bacteria	3868
1023	Ga0157374_10054821	3300013296	Bacteria	3720
1024	Ga0157374_10087217	3300013296	Bacteria	2970
1025	Ga0157374_10104758	3300013296	Bacteria	2716
1026	Ga0157374_10206052	3300013296	Bacteria	1927
1027	Ga0157374_10242207	3300013296	Bacteria	1773
1028	Ga0157374_10493812	3300013296	Bacteria	1228
1029	Ga0157374_10592691	3300013296	Bacteria	1118
1030	Ga0157374_10695585	3300013296	Bacteria	1029
1031	Ga0157374_10847136	3300013296	Bacteria	931
1032	Ga0157374_11111452	3300013296	Unclassified	811
1033	Ga0157378_10000855	3300013297	Bacteria	28249
1034	Ga0157378_10020155	3300013297	Bacteria	5865
1035	Ga0157378_10026642	3300013297	Bacteria	5095
1036	Ga0157378_10037612	3300013297	Bacteria	4288
1037	Ga0157378_10096692	3300013297	Bacteria	2691
1038	Ga0157378_10129961	3300013297	Bacteria	2331
1039	Ga0157378_10135288	3300013297	Bacteria	2284
1040	Ga0157378_10195734	3300013297	Bacteria	1909
1041	Ga0157378_10222069	3300013297	Bacteria	1797
1042	Ga0157378_10264479	3300013297	Bacteria	1652
1043	Ga0157378_10289908	3300013297	Unclassified	1581
1044	Ga0157378_10396034	3300013297	Bacteria	1359
1045	Ga0157378_10924579	3300013297	Bacteria	904
1046	Ga0157378_11080359	3300013297	Bacteria	839
1047	Ga0157378_11497435	3300013297	Unclassified	719
1048	Ga0157378_11751836	3300013297	Unclassified	669
1049	Ga0163162_10000784	3300013306	Bacteria	29548
1050	Ga0163162_10004596	3300013306	Bacteria	13298
1051	Ga0163162_10006687	3300013306	Bacteria	11182
1052	Ga0163162_10019277	3300013306	Bacteria	6688
1053	Ga0163162_10033025	3300013306	Bacteria	5141
1054	Ga0163162_10041843	3300013306	Bacteria	4584
1055	Ga0163162_10051628	3300013306	Bacteria	4126
1056	Ga0163162_10112004	3300013306	Bacteria	2827
1057	Ga0163162_10126133	3300013306	Bacteria	2666
1058	Ga0163162_10211754	3300013306	Bacteria	2068
1059	Ga0163162_10229337	3300013306	Bacteria	1987
1060	Ga0163162_10294931	3300013306	Bacteria	1753
1061	Ga0163162_10337071	3300013306	Bacteria	1640
1062	Ga0163162_10366884	3300013306	Unclassified	1573
1063	Ga0163162_10602090	3300013306	Bacteria	1225
1064	Ga0163162_10659949	3300013306	Bacteria	1169
1065	Ga0163162_10742703	3300013306	Bacteria	1101
1066	Ga0163162_10849181	3300013306	Bacteria	1028
1067	Ga0163162_11809328	3300013306	Unclassified	698
1068	Ga0163162_11912310	3300013306	Unclassified	679
1069	Ga0163162_11988140	3300013306	Bacteria	666
1070	Ga0157372_10001167	3300013307	Bacteria	28410
1071	Ga0157372_10009122	3300013307	Bacteria	10538
1072	Ga0157372_10069921	3300013307	Bacteria	3949
1073	Ga0157372_10077586	3300013307	Bacteria	3752
1074	Ga0157372_10095280	3300013307	Bacteria	3391
1075	Ga0157372_10157564	3300013307	Bacteria	2623
1076	Ga0157372_10194152	3300013307	Unclassified	2352
1077	Ga0157372_10197816	3300013307	Bacteria	2328
1078	Ga0157372_10204237	3300013307	Bacteria	2289
1079	Ga0157372_10737375	3300013307	Bacteria	1146
1080	Ga0157372_11012108	3300013307	Unclassified	962
1081	Ga0157372_11102110	3300013307	Bacteria	918
1082	Ga0157372_11788512	3300013307	Bacteria	707
1083	Ga0157372_12099004	3300013307	Unclassified	649
1084	Ga0157375_10011888	3300013308	Bacteria	7702
1085	Ga0157375_10045126	3300013308	Bacteria	4289
1086	Ga0157375_10069063	3300013308	Bacteria	3538
1087	Ga0157375_10079178	3300013308	Bacteria	3321
1088	Ga0157375_10094256	3300013308	Bacteria	3062
1089	Ga0157375_10094340	3300013308	Bacteria	3061
1090	Ga0157375_10148350	3300013308	Bacteria	2478
1091	Ga0157375_10302145	3300013308	Bacteria	1764
1092	Ga0157375_10427214	3300013308	Bacteria	1491
1093	Ga0157375_10588695	3300013308	Bacteria	1272
1094	Ga0157375_10664268	3300013308	Bacteria	1198
1095	Ga0157375_10712280	3300013308	Bacteria	1157
1096	Ga0157375_10820618	3300013308	Bacteria	1078
1097	Ga0157375_10934404	3300013308	Bacteria	1010
1098	Ga0157375_11159455	3300013308	Bacteria	906
1099	Ga0157375_11786749	3300013308	Bacteria	729
1100	Ga0163163_10006543	3300014325	Bacteria	10202
1101	Ga0163163_10011579	3300014325	Bacteria	8011
1102	Ga0163163_10022985	3300014325	Bacteria	5911
1103	Ga0163163_10037229	3300014325	Bacteria	4732
1104	Ga0163163_10040192	3300014325	Bacteria	4567
1105	Ga0163163_10058422	3300014325	Bacteria	3814
1106	Ga0163163_10061741	3300014325	Bacteria	3713
1107	Ga0163163_10085731	3300014325	Bacteria	3158
1108	Ga0163163_10201208	3300014325	Bacteria	2040
1109	Ga0163163_10364932	3300014325	Bacteria	1501
1110	Ga0163163_10590925	3300014325	Bacteria	1173
1111	Ga0163163_10599812	3300014325	Bacteria	1164
1112	Ga0163163_10629947	3300014325	Bacteria	1136
1113	Ga0163163_10667057	3300014325	Bacteria	1103
1114	Ga0163163_10707198	3300014325	Bacteria	1071
1115	Ga0163163_10858168	3300014325	Unclassified	971
1116	Ga0163163_11109869	3300014325	Bacteria	854
1117	Ga0163163_11700163	3300014325	Unclassified	692
1118	Ga0157380_10005145	3300014326	Bacteria	9138
1119	Ga0157380_10006345	3300014326	Bacteria	8316
1120	Ga0157380_10019969	3300014326	Bacteria	5001
1121	Ga0157380_10027308	3300014326	Bacteria	4341
1122	Ga0157380_10027759	3300014326	Bacteria	4307
1123	Ga0157380_10073876	3300014326	Bacteria	2766
1124	Ga0157380_10102702	3300014326	Bacteria	2384
1125	Ga0157380_10166756	3300014326	Bacteria	1920
1126	Ga0157380_10335029	3300014326	Bacteria	1409
1127	Ga0157380_10402047	3300014326	Bacteria	1300
1128	Ga0157380_10583962	3300014326	Bacteria	1102
1129	Ga0157380_10677329	3300014326	Bacteria	1033
1130	Ga0157380_12235335	3300014326	Unclassified	611
1131	Ga0157377_10011651	3300014745	Bacteria	4396
1132	Ga0157377_10018901	3300014745	Bacteria	3591
1133	Ga0157377_10051456	3300014745	Bacteria	2323
1134	Ga0157377_10142932	3300014745	Bacteria	1472
1135	Ga0157377_10170622	3300014745	Bacteria	1360
1136	Ga0157377_10267660	3300014745	Bacteria	1115
1137	Ga0157377_10475508	3300014745	Bacteria	868
1138	Ga0157379_10021619	3300014968	Bacteria	5698
1139	Ga0157379_10037517	3300014968	Bacteria	4322
1140	Ga0157379_10050490	3300014968	Bacteria	3713
1141	Ga0157379_10074309	3300014968	Bacteria	3043
1142	Ga0157379_10327934	3300014968	Bacteria	1398
1143	Ga0157379_10624856	3300014968	Bacteria	1007
1144	Ga0157376_10009083	3300014969	Bacteria	7202
1145	Ga0157376_10041954	3300014969	Bacteria	3749
1146	Ga0157376_10048142	3300014969	Bacteria	3523
1147	Ga0157376_10238019	3300014969	Bacteria	1695
1148	Ga0157376_10456533	3300014969	Bacteria	1247
1149	Ga0157376_10538613	3300014969	Bacteria	1153
1150	Ga0157376_10580882	3300014969	Bacteria	1113
1151	Ga0157376_11224680	3300014969	Bacteria	779
1152	Ga0157376_12022807	3300014969	Bacteria	614
1153	Ga0182006_1061365	3300015261	Bacteria	1417
1154	Ga0182007_10010258	3300015262	Bacteria	3715
1155	Ga0182007_10036578	3300015262	Bacteria	1651
1156	Ga0182005_1008054	3300015265	Bacteria	3126
1157	Ga0163161_10013647	3300017792	Bacteria	5657
1158	Ga0163161_10023268	3300017792	Bacteria	4370
1159	Ga0163161_10153829	3300017792	Bacteria	1750
1160	Ga0163161_10183133	3300017792	Bacteria	1607
1161	Ga0163161_10400164	3300017792	Unclassified	1101
1162	Ga0206356_11060192	3300020070	Bacteria	1302
1163	Ga0206352_10591876	3300020078	Bacteria	2760
1164	Ga0206350_11076356	3300020080	Bacteria	1814
1165	Ga0213873_10030496	3300021358	Bacteria	1335
1166	Ga0213874_10037257	3300021377	Bacteria	1438
1167	Ga0213876_10000189	3300021384	Bacteria	64122
1168	Ga0213876_10012169	3300021384	Bacteria	4582
1169	Ga0213876_10043703	3300021384	Bacteria	2368
1170	Ga0224712_10051733	3300022467	Bacteria	1601
1171	Ga0207672_1000149	3300025223	Bacteria	9525
1172	Ga0207697_10014874	3300025315	Bacteria	3223
1173	Ga0207697_10133692	3300025315	Bacteria	1073
1174	Ga0207697_10268127	3300025315	Unclassified	756
1175	Ga0207656_10012132	3300025321	Bacteria	3271
1176	Ga0207656_10015866	3300025321	Bacteria	2922
1177	Ga0207656_10130078	3300025321	Bacteria	1179
1178	Ga0207656_10130615	3300025321	Bacteria	1176
1179	Ga0207656_10137654	3300025321	Bacteria	1149
1180	Ga0207656_10478572	3300025321	Bacteria	631
1181	Ga0207696_1041022	3300025711	Bacteria	1354
1182	Ga0207713_1069991	3300025735	Bacteria	1298
1183	Ga0207653_10000289	3300025885	Bacteria	29336
1184	Ga0207653_10013041	3300025885	Bacteria	2599
1185	Ga0207682_10002386	3300025893	Bacteria	8447
1186	Ga0207682_10122471	3300025893	Bacteria	1155
1187	Ga0207682_10170621	3300025893	Bacteria	989
1188	Ga0207692_10163273	3300025898	Bacteria	1285
1189	Ga0207692_10186257	3300025898	Bacteria	1212
1190	Ga0207692_10635491	3300025898	Unclassified	689
1191	Ga0207642_10004059	3300025899	Bacteria	4689
1192	Ga0207642_10026936	3300025899	Bacteria	2347
1193	Ga0207642_10077867	3300025899	Bacteria	1601
1194	Ga0207642_10091246	3300025899	Bacteria	1505
1195	Ga0207642_10111098	3300025899	Bacteria	1396
1196	Ga0207642_10267722	3300025899	Bacteria	977
1197	Ga0207710_10000003	3300025900	Bacteria	1071597
1198	Ga0207710_10008744	3300025900	Bacteria	4267
1199	Ga0207710_10047115	3300025900	Bacteria	1926
1200	Ga0207710_10251183	3300025900	Bacteria	884
1201	Ga0207710_10392801	3300025900	Bacteria	711
1202	Ga0207688_10002903	3300025901	Bacteria	9319
1203	Ga0207680_10018084	3300025903	Bacteria	3738
1204	Ga0207680_10023352	3300025903	Bacteria	3376
1205	Ga0207680_10050712	3300025903	Bacteria	2478
1206	Ga0207680_10228326	3300025903	Bacteria	1279
1207	Ga0207647_10003885	3300025904	Bacteria	11167
1208	Ga0207647_10038561	3300025904	Bacteria	3020
1209	Ga0207647_10119899	3300025904	Unclassified	1551
1210	Ga0207647_10127059	3300025904	Bacteria	1500
1211	Ga0207647_10156058	3300025904	Bacteria	1333
1212	Ga0207685_10000024	3300025905	Bacteria	113741
1213	Ga0207685_10000997	3300025905	Bacteria	5485
1214	Ga0207699_10075310	3300025906	Bacteria	2076
1215	Ga0207699_10076935	3300025906	Bacteria	2057
1216	Ga0207699_10145008	3300025906	Bacteria	1564
1217	Ga0207699_10178852	3300025906	Bacteria	1424
1218	Ga0207699_10559844	3300025906	Bacteria	830
1219	Ga0207699_10619954	3300025906	Bacteria	789
1220	Ga0207645_10000633	3300025907	Bacteria	29178
1221	Ga0207645_10062300	3300025907	Bacteria	2383
1222	Ga0207645_10063229	3300025907	Bacteria	2365
1223	Ga0207645_10207778	3300025907	Bacteria	1289
1224	Ga0207645_10246753	3300025907	Unclassified	1181
1225	Ga0207645_10312806	3300025907	Bacteria	1047
1226	Ga0207643_10001566	3300025908	Bacteria	13004
1227	Ga0207643_10020369	3300025908	Bacteria	3640
1228	Ga0207643_10080369	3300025908	Bacteria	1888
1229	Ga0207643_10111642	3300025908	Bacteria	1611
1230	Ga0207643_10164355	3300025908	Bacteria	1337
1231	Ga0207643_10312662	3300025908	Bacteria	979
1232	Ga0207705_10161671	3300025909	Bacteria	1683
1233	Ga0207684_10000085	3300025910	Bacteria	175922
1234	Ga0207684_10002829	3300025910	Bacteria	17248
1235	Ga0207684_10003150	3300025910	Bacteria	16233
1236	Ga0207684_10004560	3300025910	Bacteria	13015
1237	Ga0207684_10004885	3300025910	Bacteria	12525
1238	Ga0207684_10032580	3300025910	Bacteria	4430
1239	Ga0207684_10133583	3300025910	Bacteria	2130
1240	Ga0207684_10152026	3300025910	Unclassified	1992
1241	Ga0207684_10152505	3300025910	Bacteria	1988
1242	Ga0207684_10312572	3300025910	Bacteria	1354
1243	Ga0207684_10339878	3300025910	Bacteria	1293
1244	Ga0207684_10485217	3300025910	Unclassified	1060
1245	Ga0207684_10584102	3300025910	Bacteria	955
1246	Ga0207684_10595082	3300025910	Bacteria	945
1247	Ga0207684_10649481	3300025910	Unclassified	899
1248	Ga0207654_10013384	3300025911	Bacteria	4221
1249	Ga0207654_10053275	3300025911	Bacteria	2335
1250	Ga0207654_10068145	3300025911	Bacteria	2104
1251	Ga0207654_10090678	3300025911	Bacteria	1863
1252	Ga0207654_10095000	3300025911	Bacteria	1825
1253	Ga0207654_10110300	3300025911	Bacteria	1711
1254	Ga0207654_10139038	3300025911	Bacteria	1546
1255	Ga0207654_10162856	3300025911	Bacteria	1442
1256	Ga0207654_10421333	3300025911	Unclassified	932
1257	Ga0207654_10465344	3300025911	Bacteria	889
1258	Ga0207654_10530501	3300025911	Bacteria	834
1259	Ga0207707_10000503	3300025912	Bacteria	40256
1260	Ga0207707_10005075	3300025912	Bacteria	11550
1261	Ga0207707_10050582	3300025912	Bacteria	3619
1262	Ga0207707_10061041	3300025912	Bacteria	3280
1263	Ga0207707_10070690	3300025912	Bacteria	3041
1264	Ga0207707_10129092	3300025912	Bacteria	2211
1265	Ga0207707_10481828	3300025912	Bacteria	1060
1266	Ga0207707_10538546	3300025912	Bacteria	993
1267	Ga0207707_10723253	3300025912	Bacteria	834
1268	Ga0207695_10024406	3300025913	Bacteria	6806
1269	Ga0207695_10034528	3300025913	Bacteria	5499
1270	Ga0207695_10081076	3300025913	Bacteria	3285
1271	Ga0207695_10208695	3300025913	Bacteria	1865
1272	Ga0207695_10250144	3300025913	Unclassified	1672
1273	Ga0207671_10004181	3300025914	Bacteria	13939
1274	Ga0207671_10047624	3300025914	Bacteria	3173
1275	Ga0207671_10561469	3300025914	Bacteria	910
1276	Ga0207671_10670849	3300025914	Bacteria	825
1277	Ga0207671_11330819	3300025914	Unclassified	559
1278	Ga0207693_10000766	3300025915	Bacteria	28858
1279	Ga0207693_10092059	3300025915	Bacteria	2377
1280	Ga0207693_10312743	3300025915	Bacteria	1230
1281	Ga0207693_10344654	3300025915	Bacteria	1166
1282	Ga0207693_10401094	3300025915	Bacteria	1072
1283	Ga0207693_10583879	3300025915	Bacteria	870
1284	Ga0207663_10000490	3300025916	Bacteria	17231
1285	Ga0207663_10041328	3300025916	Bacteria	2810
1286	Ga0207663_10234834	3300025916	Bacteria	1342
1287	Ga0207663_10418406	3300025916	Bacteria	1028
1288	Ga0207663_10490542	3300025916	Unclassified	953
1289	Ga0207663_10667772	3300025916	Unclassified	821
1290	Ga0207663_10825163	3300025916	Unclassified	739
1291	Ga0207660_10001058	3300025917	Bacteria	18239
1292	Ga0207660_10027520	3300025917	Bacteria	3881
1293	Ga0207660_10045886	3300025917	Bacteria	3081
1294	Ga0207660_10087937	3300025917	Bacteria	2297
1295	Ga0207660_10219028	3300025917	Bacteria	1493
1296	Ga0207660_10232337	3300025917	Bacteria	1450
1297	Ga0207660_10354914	3300025917	Bacteria	1175
1298	Ga0207660_10378817	3300025917	Bacteria	1137
1299	Ga0207660_10577025	3300025917	Bacteria	915
1300	Ga0207662_10002944	3300025918	Bacteria	8650
1301	Ga0207662_10005060	3300025918	Bacteria	6986
1302	Ga0207662_10040549	3300025918	Bacteria	2738
1303	Ga0207662_10071042	3300025918	Bacteria	2107
1304	Ga0207662_10315033	3300025918	Bacteria	1043
1305	Ga0207657_10001396	3300025919	Bacteria	25733
1306	Ga0207657_10007204	3300025919	Bacteria	11418
1307	Ga0207657_10013013	3300025919	Bacteria	8176
1308	Ga0207657_10084649	3300025919	Bacteria	2657
1309	Ga0207657_10180415	3300025919	Bacteria	1707
1310	Ga0207649_10000654	3300025920	Bacteria	23095
1311	Ga0207649_10024546	3300025920	Bacteria	3506
1312	Ga0207649_10026589	3300025920	Bacteria	3387
1313	Ga0207649_10031612	3300025920	Bacteria	3147
1314	Ga0207649_10467322	3300025920	Bacteria	955
1315	Ga0207652_10000427	3300025921	Bacteria	43779
1316	Ga0207652_10033139	3300025921	Bacteria	4348
1317	Ga0207652_10039350	3300025921	Bacteria	4013
1318	Ga0207652_10161023	3300025921	Bacteria	2012
1319	Ga0207652_10164293	3300025921	Bacteria	1990
1320	Ga0207652_10497452	3300025921	Bacteria	1098
1321	Ga0207652_10923511	3300025921	Bacteria	770
1322	Ga0207652_10935711	3300025921	Bacteria	764
1323	Ga0207646_10001665	3300025922	Bacteria	27152
1324	Ga0207646_10002175	3300025922	Bacteria	23385
1325	Ga0207646_10005737	3300025922	Bacteria	13012
1326	Ga0207646_10005747	3300025922	Bacteria	13005
1327	Ga0207646_10032750	3300025922	Bacteria	4702
1328	Ga0207646_10034371	3300025922	Bacteria	4581
1329	Ga0207646_10077846	3300025922	Bacteria	2963
1330	Ga0207646_10094915	3300025922	Bacteria	2671
1331	Ga0207646_10114002	3300025922	Bacteria	2427
1332	Ga0207646_10159720	3300025922	Bacteria	2033
1333	Ga0207646_10168208	3300025922	Bacteria	1979
1334	Ga0207646_10197615	3300025922	Bacteria	1816
1335	Ga0207646_10235765	3300025922	Bacteria	1653
1336	Ga0207646_10651264	3300025922	Bacteria	944
1337	Ga0207646_10681496	3300025922	Unclassified	920
1338	Ga0207646_10751411	3300025922	Unclassified	870
1339	Ga0207646_10868639	3300025922	Bacteria	801
1340	Ga0207646_10984774	3300025922	Unclassified	746
1341	Ga0207646_11148744	3300025922	Bacteria	682
1342	Ga0207681_10004264	3300025923	Bacteria	8825
1343	Ga0207681_10005504	3300025923	Bacteria	7776
1344	Ga0207681_10023090	3300025923	Bacteria	3973
1345	Ga0207681_10026409	3300025923	Bacteria	3746
1346	Ga0207681_10109364	3300025923	Bacteria	2008
1347	Ga0207681_10150053	3300025923	Bacteria	1746
1348	Ga0207681_10349313	3300025923	Bacteria	1183
1349	Ga0207694_10004209	3300025924	Bacteria	11267
1350	Ga0207694_10011633	3300025924	Bacteria	6640
1351	Ga0207694_10070744	3300025924	Bacteria	2726
1352	Ga0207694_10373070	3300025924	Bacteria	1183
1353	Ga0207650_10000028	3300025925	Bacteria	236867
1354	Ga0207650_10000440	3300025925	Bacteria	35713
1355	Ga0207650_10002078	3300025925	Bacteria	14001
1356	Ga0207650_10012026	3300025925	Bacteria	5966
1357	Ga0207650_10161094	3300025925	Bacteria	1778
1358	Ga0207650_10194481	3300025925	Bacteria	1622
1359	Ga0207650_10215666	3300025925	Bacteria	1543
1360	Ga0207650_10485295	3300025925	Bacteria	1031
1361	Ga0207650_10801472	3300025925	Unclassified	798
1362	Ga0207650_11042385	3300025925	Bacteria	696
1363	Ga0207659_10035349	3300025926	Bacteria	3453
1364	Ga0207659_10049731	3300025926	Bacteria	2975
1365	Ga0207659_10293103	3300025926	Bacteria	1334
1366	Ga0207659_10334152	3300025926	Bacteria	1254
1367	Ga0207659_11285655	3300025926	Unclassified	628
1368	Ga0207687_10006149	3300025927	Bacteria	7942
1369	Ga0207687_10018361	3300025927	Bacteria	4615
1370	Ga0207687_10053920	3300025927	Bacteria	2811
1371	Ga0207687_10096174	3300025927	Bacteria	2170
1372	Ga0207687_10505701	3300025927	Bacteria	1009
1373	Ga0207687_10589967	3300025927	Unclassified	936
1374	Ga0207687_10857361	3300025927	Bacteria	776
1375	Ga0207700_10016045	3300025928	Bacteria	4965
1376	Ga0207700_10055198	3300025928	Bacteria	2985
1377	Ga0207700_10115902	3300025928	Bacteria	2164
1378	Ga0207700_10121855	3300025928	Bacteria	2116
1379	Ga0207700_10161959	3300025928	Bacteria	1859
1380	Ga0207700_10246028	3300025928	Unclassified	1526
1381	Ga0207700_10665638	3300025928	Bacteria	928
1382	Ga0207700_10810877	3300025928	Bacteria	837
1383	Ga0207700_10864000	3300025928	Bacteria	809
1384	Ga0207664_10041492	3300025929	Bacteria	3585
1385	Ga0207664_10074984	3300025929	Bacteria	2734
1386	Ga0207664_10102750	3300025929	Bacteria	2364
1387	Ga0207664_10384177	3300025929	Bacteria	1247
1388	Ga0207664_10419013	3300025929	Bacteria	1193
1389	Ga0207664_10445585	3300025929	Unclassified	1155
1390	Ga0207664_10790201	3300025929	Unclassified	854
1391	Ga0207644_10001958	3300025931	Bacteria	13331
1392	Ga0207644_10003226	3300025931	Bacteria	10516
1393	Ga0207644_10034752	3300025931	Bacteria	3528
1394	Ga0207644_10092764	3300025931	Bacteria	2253
1395	Ga0207644_10334205	3300025931	Bacteria	1227
1396	Ga0207644_10355917	3300025931	Bacteria	1190
1397	Ga0207644_10553655	3300025931	Bacteria	952
1398	Ga0207644_10793403	3300025931	Bacteria	792
1399	Ga0207644_10959262	3300025931	Bacteria	717
1400	Ga0207690_10003154	3300025932	Bacteria	9900
1401	Ga0207690_10015582	3300025932	Bacteria	4609
1402	Ga0207690_10216295	3300025932	Bacteria	1464
1403	Ga0207690_10287700	3300025932	Bacteria	1282
1404	Ga0207706_10000595	3300025933	Bacteria	38424
1405	Ga0207706_10005136	3300025933	Bacteria	12215
1406	Ga0207706_10050740	3300025933	Bacteria	3666
1407	Ga0207706_10095417	3300025933	Bacteria	2616
1408	Ga0207706_10195623	3300025933	Unclassified	1774
1409	Ga0207706_10495057	3300025933	Bacteria	1055
1410	Ga0207706_10733675	3300025933	Bacteria	842
1411	Ga0207686_10000496	3300025934	Bacteria	25802
1412	Ga0207686_10010563	3300025934	Bacteria	5030
1413	Ga0207686_10021357	3300025934	Bacteria	3715
1414	Ga0207686_10121904	3300025934	Bacteria	1776
1415	Ga0207686_10167796	3300025934	Bacteria	1545
1416	Ga0207709_10001154	3300025935	Bacteria	19226
1417	Ga0207709_10034818	3300025935	Bacteria	2972
1418	Ga0207709_10045264	3300025935	Bacteria	2664
1419	Ga0207709_10053093	3300025935	Bacteria	2493
1420	Ga0207709_10076474	3300025935	Bacteria	2143
1421	Ga0207709_10101498	3300025935	Bacteria	1903
1422	Ga0207709_10239338	3300025935	Bacteria	1319
1423	Ga0207709_10249276	3300025935	Bacteria	1296
1424	Ga0207709_10377747	3300025935	Bacteria	1077
1425	Ga0207709_10713006	3300025935	Unclassified	804
1426	Ga0207670_10002963	3300025936	Bacteria	8965
1427	Ga0207670_10003677	3300025936	Bacteria	8139
1428	Ga0207670_10037877	3300025936	Bacteria	3145
1429	Ga0207670_10073135	3300025936	Bacteria	2376
1430	Ga0207670_10182241	3300025936	Bacteria	1583
1431	Ga0207669_10012017	3300025937	Bacteria	4240
1432	Ga0207669_10661708	3300025937	Bacteria	855
1433	Ga0207669_10895068	3300025937	Bacteria	741
1434	Ga0207704_10010523	3300025938	Bacteria	4518
1435	Ga0207704_10013468	3300025938	Bacteria	4092
1436	Ga0207704_10027024	3300025938	Bacteria	3158
1437	Ga0207704_10254067	3300025938	Bacteria	1321
1438	Ga0207704_10366929	3300025938	Bacteria	1126
1439	Ga0207704_10544038	3300025938	Bacteria	943
1440	Ga0207704_10785521	3300025938	Unclassified	794
1441	Ga0207704_10808493	3300025938	Bacteria	783
1442	Ga0207704_10875557	3300025938	Bacteria	754
1443	Ga0207704_11221550	3300025938	Bacteria	641
1444	Ga0207665_10000029	3300025939	Bacteria	95174
1445	Ga0207665_10001401	3300025939	Bacteria	16209
1446	Ga0207665_10011629	3300025939	Bacteria	5783
1447	Ga0207665_10142584	3300025939	Bacteria	1710
1448	Ga0207665_10160343	3300025939	Bacteria	1617
1449	Ga0207665_10160959	3300025939	Bacteria	1614
1450	Ga0207665_10167575	3300025939	Bacteria	1584
1451	Ga0207665_10174814	3300025939	Unclassified	1553
1452	Ga0207665_10176933	3300025939	Unclassified	1544
1453	Ga0207665_10247473	3300025939	Bacteria	1316
1454	Ga0207665_10867855	3300025939	Unclassified	715
1455	Ga0207691_10000404	3300025940	Bacteria	43190
1456	Ga0207691_10032538	3300025940	Bacteria	4862
1457	Ga0207691_10189982	3300025940	Bacteria	1791
1458	Ga0207691_10201269	3300025940	Bacteria	1733
1459	Ga0207691_10935689	3300025940	Bacteria	725
1460	Ga0207691_11142529	3300025940	Unclassified	647
1461	Ga0207711_10019539	3300025941	Bacteria	5639
1462	Ga0207711_10076819	3300025941	Bacteria	2909
1463	Ga0207711_10087939	3300025941	Bacteria	2727
1464	Ga0207711_10208116	3300025941	Bacteria	1787
1465	Ga0207711_10216030	3300025941	Bacteria	1752
1466	Ga0207711_10230622	3300025941	Bacteria	1696
1467	Ga0207711_10252940	3300025941	Bacteria	1618
1468	Ga0207711_10292012	3300025941	Bacteria	1503
1469	Ga0207711_10561578	3300025941	Bacteria	1065
1470	Ga0207711_10672611	3300025941	Bacteria	966
1471	Ga0207711_10891264	3300025941	Bacteria	827
1472	Ga0207711_11140907	3300025941	Unclassified	720
1473	Ga0207711_11549348	3300025941	Bacteria	606
1474	Ga0207689_10013420	3300025942	Bacteria	6995
1475	Ga0207689_10018281	3300025942	Bacteria	5916
1476	Ga0207689_10028316	3300025942	Bacteria	4687
1477	Ga0207689_10035003	3300025942	Bacteria	4172
1478	Ga0207689_10037371	3300025942	Bacteria	4027
1479	Ga0207689_10042361	3300025942	Bacteria	3767
1480	Ga0207689_10080229	3300025942	Bacteria	2682
1481	Ga0207689_10080358	3300025942	Bacteria	2680
1482	Ga0207689_10110965	3300025942	Bacteria	2254
1483	Ga0207689_10122089	3300025942	Bacteria	2142
1484	Ga0207689_10172622	3300025942	Bacteria	1782
1485	Ga0207689_10237491	3300025942	Unclassified	1506
1486	Ga0207689_10237669	3300025942	Bacteria	1506
1487	Ga0207689_10278931	3300025942	Bacteria	1384
1488	Ga0207689_10280489	3300025942	Bacteria	1380
1489	Ga0207689_10290694	3300025942	Bacteria	1354
1490	Ga0207689_10385936	3300025942	Bacteria	1166
1491	Ga0207689_10851905	3300025942	Bacteria	769
1492	Ga0207661_10000196	3300025944	Bacteria	39288
1493	Ga0207661_10009739	3300025944	Bacteria	6901
1494	Ga0207661_10028024	3300025944	Bacteria	4310
1495	Ga0207661_10041485	3300025944	Bacteria	3623
1496	Ga0207661_10146636	3300025944	Bacteria	2037
1497	Ga0207661_10906947	3300025944	Unclassified	812
1498	Ga0207661_11279824	3300025944	Bacteria	674
1499	Ga0207679_10000567	3300025945	Bacteria	24879
1500	Ga0207679_10009388	3300025945	Bacteria	6266
1501	Ga0207679_10028225	3300025945	Bacteria	3891
1502	Ga0207679_10057001	3300025945	Bacteria	2888
1503	Ga0207679_10199021	3300025945	Bacteria	1672
1504	Ga0207679_10333863	3300025945	Unclassified	1316
1505	Ga0207679_10782311	3300025945	Bacteria	869
1506	Ga0207667_10003999	3300025949	Bacteria	18107
1507	Ga0207667_10010952	3300025949	Bacteria	10568
1508	Ga0207667_10024863	3300025949	Bacteria	6567
1509	Ga0207667_10117868	3300025949	Bacteria	2736
1510	Ga0207667_10281602	3300025949	Bacteria	1699
1511	Ga0207667_10338922	3300025949	Bacteria	1534
1512	Ga0207667_10383176	3300025949	Bacteria	1432
1513	Ga0207667_10477970	3300025949	Bacteria	1265
1514	Ga0207667_10662543	3300025949	Bacteria	1048
1515	Ga0207651_10026556	3300025960	Bacteria	3620
1516	Ga0207651_10039615	3300025960	Unclassified	3109
1517	Ga0207651_10040679	3300025960	Bacteria	3078
1518	Ga0207651_10145313	3300025960	Bacteria	1838
1519	Ga0207651_10165890	3300025960	Bacteria	1736
1520	Ga0207651_10366495	3300025960	Bacteria	1218
1521	Ga0207651_10569912	3300025960	Bacteria	986
1522	Ga0207651_10748301	3300025960	Bacteria	864
1523	Ga0207712_10000586	3300025961	Bacteria	29417
1524	Ga0207712_10020659	3300025961	Bacteria	4316
1525	Ga0207712_10034322	3300025961	Bacteria	3438
1526	Ga0207712_10064063	3300025961	Bacteria	2619
1527	Ga0207712_10072928	3300025961	Bacteria	2474
1528	Ga0207712_10502962	3300025961	Bacteria	1036
1529	Ga0207712_10766939	3300025961	Bacteria	846
1530	Ga0207668_10009419	3300025972	Bacteria	5854
1531	Ga0207668_10344865	3300025972	Bacteria	1243
1532	Ga0207640_10015301	3300025981	Bacteria	4438
1533	Ga0207640_10019897	3300025981	Bacteria	3975
1534	Ga0207640_10027709	3300025981	Bacteria	3455
1535	Ga0207640_10080394	3300025981	Bacteria	2225
1536	Ga0207640_10199540	3300025981	Bacteria	1515
1537	Ga0207640_10427000	3300025981	Bacteria	1086
1538	Ga0207640_10849164	3300025981	Unclassified	794
1539	Ga0207658_10006283	3300025986	Bacteria	8116
1540	Ga0207658_10100263	3300025986	Bacteria	2267
1541	Ga0207658_10133133	3300025986	Bacteria	2000
1542	Ga0207658_10767280	3300025986	Bacteria	874
1543	Ga0207677_10001140	3300026023	Bacteria	14484
1544	Ga0207677_10009783	3300026023	Bacteria	5403
1545	Ga0207677_10038376	3300026023	Bacteria	3140
1546	Ga0207677_10081470	3300026023	Bacteria	2322
1547	Ga0207677_10128719	3300026023	Bacteria	1918
1548	Ga0207677_10298154	3300026023	Unclassified	1331
1549	Ga0207677_10419304	3300026023	Bacteria	1140
1550	Ga0207677_10471948	3300026023	Bacteria	1079
1551	Ga0207677_10625008	3300026023	Bacteria	948
1552	Ga0207677_11039491	3300026023	Unclassified	744
1553	Ga0207677_11405609	3300026023	Unclassified	643
1554	Ga0207703_10000355	3300026035	Bacteria	49221
1555	Ga0207703_10006284	3300026035	Bacteria	9500
1556	Ga0207703_10077821	3300026035	Bacteria	2754
1557	Ga0207703_10086633	3300026035	Bacteria	2624
1558	Ga0207703_10121236	3300026035	Bacteria	2245
1559	Ga0207703_10132983	3300026035	Bacteria	2150
1560	Ga0207703_10141082	3300026035	Bacteria	2091
1561	Ga0207703_10268536	3300026035	Bacteria	1545
1562	Ga0207703_10391198	3300026035	Bacteria	1288
1563	Ga0207639_10010188	3300026041	Bacteria	6503
1564	Ga0207639_10013858	3300026041	Bacteria	5654
1565	Ga0207639_10026412	3300026041	Bacteria	4220
1566	Ga0207639_10062615	3300026041	Bacteria	2877
1567	Ga0207639_10132216	3300026041	Bacteria	2067
1568	Ga0207639_10163272	3300026041	Unclassified	1879
1569	Ga0207639_10258038	3300026041	Unclassified	1523
1570	Ga0207639_10375957	3300026041	Bacteria	1275
1571	Ga0207678_10006654	3300026067	Bacteria	10245
1572	Ga0207678_10011947	3300026067	Bacteria	7626
1573	Ga0207678_10458936	3300026067	Bacteria	1108
1574	Ga0207708_10008557	3300026075	Bacteria	7571
1575	Ga0207708_10011438	3300026075	Bacteria	6610
1576	Ga0207708_10020009	3300026075	Bacteria	5047
1577	Ga0207708_10054210	3300026075	Bacteria	3057
1578	Ga0207708_10151221	3300026075	Unclassified	1827
1579	Ga0207708_10310291	3300026075	Bacteria	1285
1580	Ga0207708_10609226	3300026075	Bacteria	926
1581	Ga0207702_10001220	3300026078	Bacteria	26059
1582	Ga0207702_10002504	3300026078	Bacteria	17340
1583	Ga0207702_10003231	3300026078	Bacteria	15058
1584	Ga0207702_10058548	3300026078	Bacteria	3279
1585	Ga0207702_10075923	3300026078	Bacteria	2904
1586	Ga0207702_10555769	3300026078	Bacteria	1123
1587	Ga0207641_10000127	3300026088	Bacteria	111663
1588	Ga0207641_10019534	3300026088	Bacteria	5562
1589	Ga0207641_10060418	3300026088	Bacteria	3231
1590	Ga0207641_10063545	3300026088	Bacteria	3153
1591	Ga0207641_10118073	3300026088	Unclassified	2362
1592	Ga0207641_10239501	3300026088	Unclassified	1690
1593	Ga0207641_10248156	3300026088	Bacteria	1661
1594	Ga0207641_10280753	3300026088	Bacteria	1566
1595	Ga0207641_10294981	3300026088	Bacteria	1529
1596	Ga0207641_10302882	3300026088	Bacteria	1510
1597	Ga0207641_10359165	3300026088	Bacteria	1390
1598	Ga0207641_10376052	3300026088	Bacteria	1359
1599	Ga0207641_10820941	3300026088	Bacteria	920
1600	Ga0207641_11118733	3300026088	Bacteria	786
1601	Ga0207648_10005227	3300026089	Bacteria	13130
1602	Ga0207648_10013711	3300026089	Bacteria	7524
1603	Ga0207648_10044873	3300026089	Bacteria	3878
1604	Ga0207648_10050189	3300026089	Bacteria	3649
1605	Ga0207648_10052615	3300026089	Bacteria	3561
1606	Ga0207648_10079277	3300026089	Bacteria	2865
1607	Ga0207648_10136552	3300026089	Bacteria	2160
1608	Ga0207648_10149950	3300026089	Bacteria	2057
1609	Ga0207648_10164570	3300026089	Bacteria	1960
1610	Ga0207648_10177275	3300026089	Bacteria	1885
1611	Ga0207648_10283313	3300026089	Bacteria	1482
1612	Ga0207648_10304941	3300026089	Bacteria	1429
1613	Ga0207648_10471313	3300026089	Bacteria	1146
1614	Ga0207648_10605076	3300026089	Bacteria	1010
1615	Ga0207648_10674594	3300026089	Bacteria	956
1616	Ga0207676_10000746	3300026095	Bacteria	25490
1617	Ga0207676_10005954	3300026095	Bacteria	8600
1618	Ga0207676_10029900	3300026095	Bacteria	4082
1619	Ga0207676_10031106	3300026095	Bacteria	4012
1620	Ga0207676_10040297	3300026095	Bacteria	3579
1621	Ga0207676_10044163	3300026095	Bacteria	3436
1622	Ga0207676_10101239	3300026095	Bacteria	2388
1623	Ga0207676_10113804	3300026095	Bacteria	2269
1624	Ga0207676_10128702	3300026095	Bacteria	2149
1625	Ga0207676_10130284	3300026095	Bacteria	2137
1626	Ga0207676_10226274	3300026095	Bacteria	1669
1627	Ga0207676_10402017	3300026095	Bacteria	1280
1628	Ga0207676_10509903	3300026095	Bacteria	1143
1629	Ga0207676_10644674	3300026095	Unclassified	1022
1630	Ga0207676_10759798	3300026095	Bacteria	943
1631	Ga0207676_10959310	3300026095	Bacteria	841
1632	Ga0207676_11177210	3300026095	Bacteria	759
1633	Ga0207676_11606978	3300026095	Bacteria	648
1634	Ga0207674_10001125	3300026116	Bacteria	34685
1635	Ga0207674_10001827	3300026116	Bacteria	27162
1636	Ga0207674_10006877	3300026116	Bacteria	13328
1637	Ga0207674_10055913	3300026116	Bacteria	4009
1638	Ga0207674_10143411	3300026116	Bacteria	2347
1639	Ga0207674_10215525	3300026116	Bacteria	1868
1640	Ga0207674_10221279	3300026116	Bacteria	1841
1641	Ga0207674_10228609	3300026116	Bacteria	1808
1642	Ga0207674_10395314	3300026116	Bacteria	1336
1643	Ga0207674_10443842	3300026116	Bacteria	1254
1644	Ga0207674_10700726	3300026116	Bacteria	978
1645	Ga0207674_10723021	3300026116	Bacteria	961
1646	Ga0207674_11020522	3300026116	Unclassified	796
1647	Ga0207674_11405496	3300026116	Unclassified	667
1648	Ga0207675_100008945	3300026118	Bacteria	9396
1649	Ga0207675_100014206	3300026118	Bacteria	7425
1650	Ga0207675_100014977	3300026118	Bacteria	7238
1651	Ga0207675_100017801	3300026118	Bacteria	6629
1652	Ga0207675_100047591	3300026118	Bacteria	4003
1653	Ga0207675_100057101	3300026118	Bacteria	3642
1654	Ga0207675_100126066	3300026118	Bacteria	2425
1655	Ga0207675_100215370	3300026118	Bacteria	1849
1656	Ga0207675_100232587	3300026118	Bacteria	1778
1657	Ga0207675_100342914	3300026118	Bacteria	1463
1658	Ga0207675_100355291	3300026118	Bacteria	1437
1659	Ga0207675_100479938	3300026118	Unclassified	1235
1660	Ga0207675_100535036	3300026118	Bacteria	1169
1661	Ga0207675_101156931	3300026118	Unclassified	794
1662	Ga0207683_10002052	3300026121	Bacteria	17828
1663	Ga0207683_10289050	3300026121	Bacteria	1499
1664	Ga0207683_10466057	3300026121	Bacteria	1165
1665	Ga0207683_10837396	3300026121	Unclassified	854
1666	Ga0207683_10876969	3300026121	Unclassified	833
1667	Ga0207698_10003475	3300026142	Bacteria	9495
1668	Ga0207698_10027727	3300026142	Bacteria	4026
1669	Ga0207698_10076537	3300026142	Bacteria	2679
1670	Ga0207698_10236230	3300026142	Bacteria	1663
1671	Ga0207698_10425608	3300026142	Bacteria	1275
1672	Ga0209588_1005410	3300027671	Bacteria	3660
1673	Ga0207428_10008641	3300027907	Bacteria	9197
1674	Ga0207428_10054154	3300027907	Bacteria	3196
1675	Ga0207428_10057402	3300027907	Bacteria	3090
1676	Ga0268266_10015266	3300028379	Bacteria	6592
1677	Ga0268266_10020432	3300028379	Bacteria	5644
1678	Ga0268266_10237614	3300028379	Bacteria	1680
1679	Ga0268266_11004151	3300028379	Bacteria	807
1680	Ga0268265_10003583	3300028380	Bacteria	11093
1681	Ga0268265_10016285	3300028380	Bacteria	5103
1682	Ga0268265_10035479	3300028380	Bacteria	3644
1683	Ga0268265_10108820	3300028380	Bacteria	2257
1684	Ga0268265_10124634	3300028380	Bacteria	2129
1685	Ga0268265_10292582	3300028380	Bacteria	1463
1686	Ga0268265_10655372	3300028380	Bacteria	1010
1687	Ga0268265_11354444	3300028380	Unclassified	713
1688	Ga0268265_11372894	3300028380	Unclassified	708
1689	Ga0268264_10067613	3300028381	Bacteria	3016
1690	Ga0268264_10073195	3300028381	Bacteria	2907
1691	Ga0268264_10184993	3300028381	Bacteria	1895
1692	Ga0268264_10189595	3300028381	Bacteria	1873
1693	Ga0268264_10249740	3300028381	Bacteria	1647
1694	Ga0268264_10280493	3300028381	Bacteria	1560
1695	Ga0268264_10298256	3300028381	Bacteria	1516
1696	Ga0268264_10342386	3300028381	Bacteria	1421
1697	Ga0268264_10350351	3300028381	Bacteria	1405
1698	Ga0268264_10544341	3300028381	Bacteria	1138
1699	Ga0268264_11253416	3300028381	Unclassified	751
1700	Ga0307515_10396462	3300028794	Bacteria	1007
1701	Ga0314311_1142362	3300030733	Bacteria	1154
1702	Ga0316178_1013849	3300030735	Bacteria	641
1703	Ga0316182_1305458	3300030745	Unclassified	829
1704	Ga0265760_10010411	3300031090	Bacteria	2655
1705	Ga0265760_10083129	3300031090	Bacteria	994
1706	Ga0265330_10104264	3300031235	Bacteria	1213
1707	Ga0265325_10041652	3300031241	Bacteria	2405
1708	Ga0265340_10055043	3300031247	Bacteria	1917
1709	Ga0265340_10107850	3300031247	Bacteria	1290
1710	Ga0265340_10230034	3300031247	Bacteria	829
1711	Ga0265339_10034999	3300031249	Bacteria	2820
1712	Ga0265339_10118673	3300031249	Bacteria	1362
1713	Ga0265339_10332870	3300031249	Bacteria	718
1714	Ga0265331_10077990	3300031250	Bacteria	1542
1715	Ga0265316_10015143	3300031344	Bacteria	6754
1716	Ga0265316_10026470	3300031344	Bacteria	4823
1717	Ga0307513_10006106	3300031456	Bacteria	15813
1718	Ga0307408_100045088	3300031548	Bacteria	3147
1719	Ga0307408_100050299	3300031548	Bacteria	2997
1720	Ga0307408_100097520	3300031548	Bacteria	2233
1721	Ga0307408_100103992	3300031548	Bacteria	2169
1722	Ga0307408_100507813	3300031548	Bacteria	1056
1723	Ga0307408_100653105	3300031548	Bacteria	941
1724	Ga0307408_100749384	3300031548	Bacteria	882
1725	Ga0307408_101802700	3300031548	Bacteria	585
1726	Ga0265313_10006242	3300031595	Bacteria	8507
1727	Ga0265314_10005730	3300031711	Bacteria	11141
1728	Ga0265314_10101998	3300031711	Bacteria	1842
1729	Ga0307405_10016948	3300031731	Bacteria	3987
1730	Ga0307405_10255097	3300031731	Bacteria	1307
1731	Ga0307405_10348430	3300031731	Bacteria	1141
1732	Ga0307405_10908049	3300031731	Unclassified	745
1733	Ga0307405_11292208	3300031731	Bacteria	634
1734	Ga0307413_10028600	3300031824	Bacteria	3107
1735	Ga0307406_10017514	3300031901	Bacteria	4173
1736	Ga0307406_10457724	3300031901	Bacteria	1025
1737	Ga0307407_10295179	3300031903	Bacteria	1128
1738	Ga0307407_11014576	3300031903	Unclassified	642
1739	Ga0307412_10010192	3300031911	Bacteria	5408
1740	Ga0307412_10094052	3300031911	Bacteria	2104
1741	Ga0307412_10162625	3300031911	Bacteria	1660
1742	Ga0307412_10463771	3300031911	Unclassified	1047
1743	Ga0307412_10508801	3300031911	Bacteria	1004
1744	Ga0307412_11031933	3300031911	Bacteria	728
1745	Ga0307409_100632192	3300031995	Bacteria	1062
1746	Ga0307416_100022083	3300032002	Bacteria	4584
1747	Ga0307416_100030319	3300032002	Bacteria	4056
1748	Ga0307416_100169744	3300032002	Bacteria	2029
1749	Ga0307416_100399173	3300032002	Unclassified	1412
1750	Ga0307416_100631449	3300032002	Bacteria	1154
1751	Ga0307414_10162799	3300032004	Bacteria	1774
1752	Ga0307414_10223760	3300032004	Bacteria	1546
1753	Ga0307414_10264523	3300032004	Bacteria	1437
1754	Ga0307411_10510658	3300032005	Bacteria	1018
1755	Ga0307411_10629083	3300032005	Bacteria	926
1756	Ga0307411_10718692	3300032005	Unclassified	872
1757	Ga0307415_100016722	3300032126	Bacteria	4379
1758	Ga0307415_100103517	3300032126	Bacteria	2095
1759	Ga0373959_0055552	3300034820	Unclassified	865
1760	Ga0373929_0150756	3300035085	Unclassified	623
1761	Ga0373934_0023209	3300035086	Bacteria	2397
1762	Ga0373940_0081003	3300035088	Bacteria	960
1763	Ga0373940_0108313	3300035088	Bacteria	850
1764	Ga0373940_0218729	3300035088	Unclassified	632
1765	Ga0373949_0018355	3300035090	Bacteria	1585
1766	Ga0373949_0200573	3300035090	Bacteria	599
1767	Ga0373951_0010761	3300035091	Bacteria	2055
1768	Ga0373951_0033561	3300035091	Bacteria	1217
1769	Ga0373952_0074469	3300035092	Bacteria	855
1770	Ga0373952_0080650	3300035092	Unclassified	830
1771	Ga0373952_0091156	3300035092	Bacteria	792
1772	Ga0373923_0160374	3300035111	Bacteria	1026
1773	Ga0373932_0040024	3300035112	Bacteria	1347
1774	Ga0373932_0068578	3300035112	Bacteria	1095
1775	Ga0373932_0139352	3300035112	Bacteria	824
1776	Ga0373936_0005614	3300035113	Bacteria	4730
1777	Ga0373936_0107463	3300035113	Bacteria	1182
1778	Ga0373941_0057046	3300035115	Bacteria	1260
1779	Ga0373954_0037048	3300035118	Bacteria	2266
1780	Ga0373960_0022439	3300035121	Bacteria	1690
1781	Ga0373960_0149300	3300035121	Bacteria	797
1782	Ga0373943_0429809	3300035170	Bacteria	765
1783	Ga0373946_0175227	3300035171	Bacteria	1015
1784	Ga0373955_0643724	3300035172	Unclassified	650
1785	Ga0373961_0015753	3300035241	Bacteria	1938
1786	Ga0373961_0076900	3300035241	Bacteria	1043
1787	Ga0373961_0174625	3300035241	Unclassified	745
1788	Ga0373961_0208613	3300035241	Unclassified	692
1789	Ga0373962_0151943	3300035242	Bacteria	759
1790	Ga0373931_0014675	3300035691	Bacteria	3834
1791	Ga0373931_0050692	3300035691	Bacteria	2209
1792	Ga0373931_0088778	3300035691	Bacteria	1719
1793	Ga0373931_0119749	3300035691	Bacteria	1503
1794	Ga0373931_0264833	3300035691	Bacteria	1050
1795	Ga0373935_0346171	3300035692	Bacteria	1059
1796	Ga0373927_0189655	3300035695	Bacteria	1349
1797	Ga0373927_0667655	3300035695	Unclassified	687
1798	Ga0373947_0510128	3300035725	Bacteria	817
1799	Ga0373947_0733943	3300035725	Bacteria	674
1800	Ga0373937_0036128	3300036401	Bacteria	4501
1801	Ga0373937_0097348	3300036401	Unclassified	2729
1802	Ga0373937_0179423	3300036401	Bacteria	1988
1803	Ga0373937_0405405	3300036401	Bacteria	1294
1804	Ga0373937_0637115	3300036401	Unclassified	1011
1805	Ga0373937_0916487	3300036401	Unclassified	825
1806	Ga0373925_0004879	3300037068	Bacteria	10092
1807	Ga0373925_0209857	3300037068	Bacteria	1551
1808	Ga0395898_0243037	3300037466	Bacteria	1717
1809	Ga0395898_0323356	3300037466	Bacteria	1471
1810	Ga0395905_0056292	3300037471	Bacteria	3679
1811	Ga0395905_0181892	3300037471	Unclassified	1974
1812	Ga0395905_0399121	3300037471	Bacteria	1270
1813	Ga0436364_0421540	3300037853	Bacteria	950
1814	Ga0436364_0946147	3300037853	Unclassified	1725
1815	Ga0436364_1279038	3300037853	Bacteria	1890
1816	Ga0395901_0352272	3300038443	Bacteria	1519
1817	Ga0395901_0359431	3300038443	Bacteria	1502
1818	Ga0395901_1053981	3300038443	Unclassified	786
1819	Ga0242422_00217	3300038699	Bacteria	3314
1820	Ga0242422_03893	3300038699	Bacteria	959
1821	Ga0242420_007506	3300038996	Unclassified	1750
1822	Ga0242420_014230	3300038996	Bacteria	1363
1823	Ga0242420_113678	3300038996	Bacteria	585
1824	Ga0436365_0357466	3300039437	Bacteria	3219
1825	Ga0436365_0668830	3300039437	Bacteria	6208
1826	Ga0436365_0725137	3300039437	Unclassified	1226
1827	Ga0436365_0952695	3300039437	Bacteria	2584
1828	Ga0436365_1052004	3300039437	Bacteria	3676
1829	Ga0436365_1324789	3300039437	Bacteria	7439
1830	Ga0436360_1281904	3300039438	Unclassified	679
1831	Ga0436361_1007716	3300039447	Bacteria	1557
1832	Ga0436363_0765179	3300039450	Bacteria	1698
1833	Ga0436363_1337972	3300039450	Bacteria	1276
1834	Ga0436363_1448379	3300039450	Bacteria	2250
1835	Ga0436363_1536649	3300039450	Bacteria	4133
1836	Ga0436362_0706503	3300039453	Bacteria	7300
1837	Ga0436362_1063671	3300039453	Bacteria	1058
1838	Ga0439439_0008101	3300041406	Bacteria	2472
1839	Ga0439439_0027813	3300041406	Bacteria	1430
1840	Ga0439433_0047291	3300041999	Bacteria	1010
1841	Ga0439437_004698	3300042000	Bacteria	1494
1842	Ga0450923_040278	3300042125	Bacteria	980
1843	Ga0450890_005734	3300042127	Bacteria	1597
1844	Ga0439446_0061788	3300042156	Bacteria	1134
1845	Ga0439434_0034549	3300042435	Bacteria	1544
1846	Ga0451577_0173054	3300042876	Bacteria	1946
1847	Ga0453683_0339298	3300044673	Unclassified	964
1848	Ga0453683_0451691	3300044673	Bacteria	831
1849	Ga0466966_0217215	3300044684	Bacteria	1155
1850	Ga0466963_0483849	3300044694	Viruses	874
1851	Ga0453684_0135319	3300044712	Bacteria	2952
1852	Ga0453684_0441443	3300044712	Bacteria	1450
1853	Ga0451576_0042679	3300045051	Bacteria	4787
1854	Ga0451576_0123757	3300045051	Bacteria	2694
1855	Ga0451576_0259285	3300045051	Bacteria	1817
1856	Ga0451576_0274702	3300045051	Bacteria	1762
1857	Ga0451576_0665725	3300045051	Bacteria	1094
1858	Ga0451576_1029128	3300045051	Bacteria	863
1859	Ga0466967_0047934	3300045976	Bacteria	3728
1860	Ga0466967_0193442	3300045976	Bacteria	1923
1861	Ga0466967_0493370	3300045976	Bacteria	1201
1862	Ga0495592_0196398	3300046454	Bacteria	1364
1863	Ga0495592_0206103	3300046454	Bacteria	1324
1864	Ga0495603_0178500	3300046455	Bacteria	1229
1865	Ga0495590_0150301	3300046457	Bacteria	844
1866	Ga0495629_0334932	3300046459	Bacteria	1034
1867	Ga0495580_0004582	3300046472	Bacteria	11601
1868	Ga0495580_0022519	3300046472	Bacteria	4636
1869	Ga0495580_0046829	3300046472	Bacteria	3067
1870	Ga0495580_0084166	3300046472	Bacteria	2216
1871	Ga0495580_0128741	3300046472	Bacteria	1756
1872	Ga0495580_0164716	3300046472	Bacteria	1534
1873	Ga0495580_0182268	3300046472	Bacteria	1450
1874	Ga0495580_0225872	3300046472	Bacteria	1286
1875	Ga0495582_0448446	3300046473	Unclassified	745
1876	Ga0495605_0247890	3300046474	Unclassified	763
1877	Ga0495596_0113214	3300046500	Unclassified	1054
1878	Ga0495610_0044352	3300046512	Bacteria	2207
1879	Ga0495618_0185256	3300046514	Bacteria	1322
1880	Ga0495620_0062541	3300046515	Bacteria	1546
1881	Ga0495628_0362656	3300046516	Bacteria	1064
1882	Ga0495630_1064918	3300046517	Unclassified	614
1883	Ga0495632_0019657	3300046519	Bacteria	3674
1884	Ga0495643_0159221	3300046522	Bacteria	1112
1885	Ga0495663_0000620	3300046525	Bacteria	12368
1886	Ga0495652_0465213	3300046529	Unclassified	883
1887	Ga0495621_0002543	3300046539	Bacteria	4921
1888	Ga0495668_0001193	3300046616	Bacteria	26379
1889	Ga0495659_0212533	3300046664	Bacteria	796
1890	Ga0495623_0116982	3300046679	Bacteria	1610
1891	Ga0495658_0404813	3300046683	Unclassified	870
1892	Ga0495669_0284898	3300046684	Bacteria	795
1893	Ga0495636_0210967	3300047318	Unclassified	889
1894	Ga0495674_0118370	3300047319	Bacteria	2240
1895	Ga0495672_0245595	3300047320	Bacteria	872
1896	Ga0495672_0329296	3300047320	Unclassified	715
1897	Ga0495677_0088772	3300047445	Bacteria	1164
1898	Ga0496100_0124881	3300048903	Bacteria	1805
1899	Ga0496100_0344021	3300048903	Unclassified	1125
1900	Ga0496100_0951630	3300048903	Bacteria	675
1901	Ga0496101_0166866	3300048904	Bacteria	1690
1902	Ga0496101_0223547	3300048904	Bacteria	1461
1903	Ga0496101_0638641	3300048904	Unclassified	841
1904	Ga0496102_0020491	3300048905	Bacteria	5843
1905	Ga0496102_0157347	3300048905	Bacteria	2136
1906	Ga0496102_0219944	3300048905	Unclassified	1790
1907	Ga0496102_0250388	3300048905	Unclassified	1670
1908	Ga0496102_0258124	3300048905	Bacteria	1643
1909	Ga0496102_0434357	3300048905	Bacteria	1232
1910	Ga0496103_0016238	3300048906	Bacteria	4443
1911	Ga0496103_0016613	3300048906	Bacteria	4393
1912	Ga0496103_0102110	3300048906	Bacteria	1816
1913	Ga0496103_0108962	3300048906	Bacteria	1758
1914	Ga0496103_0303201	3300048906	Unclassified	1028
1915	Ga0496104_0046710	3300048907	Bacteria	4079
1916	Ga0496104_0063828	3300048907	Bacteria	3494
1917	Ga0496104_0128970	3300048907	Bacteria	2429
1918	Ga0496104_0358197	3300048907	Bacteria	1371
1919	Ga0496104_0391075	3300048907	Bacteria	1303
1920	Ga0496104_0467680	3300048907	Bacteria	1172
1921	Ga0496104_0490009	3300048907	Bacteria	1140
1922	Ga0496104_1330785	3300048907	Bacteria	621
1923	Ga0496105_0062509	3300048908	Bacteria	3073
1924	Ga0496105_0262090	3300048908	Bacteria	1398
1925	Ga0496106_0008373	3300048909	Bacteria	7653
1926	Ga0496106_0032266	3300048909	Bacteria	3905
1927	Ga0496106_0046093	3300048909	Bacteria	3276
1928	Ga0496106_0047854	3300048909	Bacteria	3219
1929	Ga0496106_0123767	3300048909	Bacteria	2023
1930	Ga0496106_0324189	3300048909	Unclassified	1236
1931	Ga0496106_0834712	3300048909	Bacteria	730
1932	Ga0496108_0000122	3300048911	Bacteria	77284
1933	Ga0496108_0047160	3300048911	Bacteria	3602
1934	Ga0496108_0050181	3300048911	Bacteria	3492
1935	Ga0496108_0108888	3300048911	Bacteria	2367
1936	Ga0496108_0137349	3300048911	Bacteria	2105
1937	Ga0496108_0220303	3300048911	Bacteria	1649
1938	Ga0496109_0000141	3300048912	Bacteria	71942
1939	Ga0496109_0377003	3300048912	Unclassified	1340
1940	Ga0496109_0423446	3300048912	Bacteria	1258
1941	Ga0496109_0596273	3300048912	Bacteria	1041
1942	Ga0496109_0863482	3300048912	Unclassified	843
1943	Ga0496109_1312833	3300048912	Bacteria	659
1944	Ga0496110_0018415	3300048913	Bacteria	5856
1945	Ga0496110_0430106	3300048913	Bacteria	1203
1946	Ga0496110_0434940	3300048913	Bacteria	1196
1947	Ga0496110_1475954	3300048913	Bacteria	590
1948	Ga0496111_0001139	3300048914	Bacteria	14751
1949	Ga0496111_0167432	3300048914	Bacteria	1632
1950	Ga0496111_0627063	3300048914	Unclassified	786
1951	Ga0496111_0649976	3300048914	Unclassified	769
1952	Ga0496112_0004753	3300048915	Bacteria	11580
1953	Ga0496112_0006950	3300048915	Bacteria	9990
1954	Ga0496112_0021716	3300048915	Bacteria	6107
1955	Ga0496112_0106330	3300048915	Bacteria	2776
1956	Ga0496112_0187229	3300048915	Bacteria	2033
1957	Ga0496112_0236835	3300048915	Bacteria	1779
1958	Ga0496112_0332263	3300048915	Bacteria	1464
1959	Ga0496113_0000253	3300048916	Bacteria	25196
1960	Ga0496113_0006814	3300048916	Bacteria	7284
1961	Ga0496113_0069556	3300048916	Bacteria	2674
1962	Ga0496113_0390096	3300048916	Unclassified	1118
1963	Ga0496115_0282745	3300048918	Bacteria	1362
1964	Ga0501291_002976	3300049514	Bacteria	2081
1965	Ga0501291_013499	3300049514	Bacteria	1210
1966	Ga0501292_027717	3300049515	Bacteria	940
1967	Ga0501298_004881	3300049521	Bacteria	2135
1968	Ga0501298_117482	3300049521	Unclassified	623
1969	Ga0501300_027896	3300049523	Bacteria	830
1970	Ga0501311_041297	3300049527	Unclassified	700
1971	Ga0501038_0039911	3300049574	Bacteria	4103
1972	Ga0501048_0488420	3300049582	Unclassified	883
1973	Ga0501067_0111671	3300049583	Bacteria	1520
1974	Ga0501071_0464584	3300049587	Unclassified	969
1975	Ga0501072_1010858	3300049588	Unclassified	648
1976	Ga0501075_0279457	3300049591	Bacteria	1272
1977	Ga0501076_0225035	3300049592	Bacteria	1533
1978	Ga0501202_013905	3300049652	Bacteria	1536
1979	Ga0501207_005674	3300049654	Bacteria	1734
1980	Ga0501208_035642	3300049655	Bacteria	900
1981	Ga0501208_045339	3300049655	Bacteria	825
1982	Ga0501211_015889	3300049658	Unclassified	761
1983	Ga0501216_023919	3300049660	Bacteria	1089
1984	Ga0501217_001526	3300049661	Bacteria	4361
1985	Ga0501217_005252	3300049661	Bacteria	2702
1986	Ga0501223_004673	3300049663	Bacteria	2913
1987	Ga0501227_000676	3300049665	Bacteria	7475
1988	Ga0501227_013089	3300049665	Bacteria	1823
1989	Ga0501233_003160	3300049668	Bacteria	2952
1990	Ga0501233_142808	3300049668	Unclassified	662
1991	Ga0501233_225015	3300049668	Unclassified	555
1992	Ga0501235_029363	3300049669	Bacteria	1237
1993	Ga0501239_018843	3300049672	Unclassified	832
1994	Ga0501243_083472	3300049675	Unclassified	625
1995	Ga0501249_043687	3300049679	Bacteria	1020
1996	Ga0501255_015872	3300049684	Unclassified	925
1997	Ga0501257_051495	3300049686	Bacteria	1027
1998	Ga0501257_168683	3300049686	Unclassified	613
1999	Ga0501259_030183	3300049688	Bacteria	1019
2000	Ga0501260_027685	3300049689	Bacteria	640
2001	Ga0501221_094256	3300049704	Bacteria	736
2002	Ga0501225_0006662	3300049705	Bacteria	3368
2003	Ga0501225_0008807	3300049705	Bacteria	2889
2004	Ga0501225_0133885	3300049705	Unclassified	745
2005	Ga0501234_005684	3300049707	Bacteria	1949
2006	Ga0501081_0116859	3300049743	Bacteria	1897
2007	Ga0501083_0153479	3300049744	Bacteria	1508
2008	Ga0501083_0232962	3300049744	Bacteria	1199
2009	Ga0501083_0512236	3300049744	Bacteria	781
2010	Ga0501232_026004	3300049757	Unclassified	785
2011	Ga0501268_002066	3300049765	Bacteria	2598
2012	Ga0501272_008067	3300049769	Bacteria	1151
2013	Ga0501283_000878	3300049779	Bacteria	3970
2014	Ga0501283_028080	3300049779	Unclassified	932
2015	nmdc:mga05p37_119270_c1	3300050507	Bacteria	3241
2016	nmdc:mga05p37_119901_c1	3300050507	Bacteria	3232
2017	nmdc:mga05p37_149322_c1	3300050507	Bacteria	2860
2018	nmdc:mga05p37_157963_c1	3300050507	Bacteria	2770
2019	nmdc:mga05p37_16987_c1	3300050507	Bacteria	8776
2020	nmdc:mga05p37_217007_c1	3300050507	Bacteria	2310
2021	nmdc:mga05p37_240436_c1	3300050507	Bacteria	2177
2022	nmdc:mga05p37_24636_c1	3300050507	Bacteria	7314
2023	nmdc:mga05p37_432396_c1	3300050507	Bacteria	1529
2024	nmdc:mga05p37_610443_c1	3300050507	Unclassified	1229
2025	nmdc:mga05p37_62370_c1	3300050507	Bacteria	4587
2026	nmdc:mga05p37_757128_c1	3300050507	Bacteria	1069
2027	nmdc:mga05p37_80215_c1	3300050507	Bacteria	4020
2028	nmdc:mga05p37_9408_c1	3300050507	Bacteria	11567
2029	nmdc:mga09592_136130_c1	3300050508	Bacteria	2116
2030	nmdc:mga09592_652482_c1	3300050508	Bacteria	898
2031	nmdc:mga09592_824948_c1	3300050508	Unclassified	783
2032	nmdc:mga09592_98736_c1	3300050508	Bacteria	2500
2033	nmdc:mga0qj67_19355_c1	3300050509	Bacteria	5200
2034	nmdc:mga06r32_1176561_c1	3300050510	Unclassified	714
2035	nmdc:mga06r32_119210_c1	3300050510	Bacteria	2602
2036	nmdc:mga06r32_34611_c1	3300050510	Bacteria	4764
2037	nmdc:mga06r32_393544_c1	3300050510	Bacteria	1368
2038	nmdc:mga06r32_50469_c1	3300050510	Bacteria	3980
2039	nmdc:mga06r32_924000_c1	3300050510	Unclassified	828
2040	nmdc:mga08y16_1031892_c1	3300050511	Unclassified	801
2041	nmdc:mga08y16_122568_c1	3300050511	Bacteria	2705
2042	nmdc:mga08y16_129151_c1	3300050511	Bacteria	2629
2043	nmdc:mga08y16_444034_c1	3300050511	Bacteria	1324
2044	nmdc:mga08y16_55017_c1	3300050511	Bacteria	4159
2045	nmdc:mga08y16_581064_c1	3300050511	Bacteria	1131
2046	nmdc:mga0n895_1178125_c1	3300050512	Bacteria	741
2047	nmdc:mga0n895_1369765_c1	3300050512	Bacteria	677
2048	nmdc:mga0n895_15771_c1	3300050512	Bacteria	6907
2049	nmdc:mga0n895_175683_c1	3300050512	Bacteria	2172
2050	nmdc:mga0n895_218271_c1	3300050512	Bacteria	1936
2051	nmdc:mga0n895_236290_c1	3300050512	Bacteria	1855
2052	nmdc:mga0n895_237760_c1	3300050512	Bacteria	1848
2053	nmdc:mga0n895_2900_c1	3300050512	Bacteria	13606
2054	nmdc:mga0n895_31929_c1	3300050512	Bacteria	5049
2055	nmdc:mga0n895_8040_c1	3300050512	Bacteria	9099
2056	nmdc:mga0n895_880477_c1	3300050512	Unclassified	882
2057	nmdc:mga0n895_922157_c1	3300050512	Unclassified	858
2058	nmdc:mga0n895_94842_c1	3300050512	Bacteria	2988
2059	nmdc:mga0rr50_1043031_c1	3300050513	Unclassified	696
2060	nmdc:mga0rr50_11339_c1	3300050513	Bacteria	5701
2061	nmdc:mga0rr50_416_c1	3300050513	Bacteria	23039
2062	nmdc:mga0rr50_432_c1	3300050513	Bacteria	22538
2063	nmdc:mga0rr50_66420_c1	3300050513	Bacteria	2736
2064	nmdc:mga0rr50_8964_c1	3300050513	Bacteria	6256
2065	nmdc:mga08x19_1070673_c1	3300050514	Unclassified	572
2066	nmdc:mga08x19_122684_c1	3300050514	Bacteria	1743
2067	nmdc:mga08x19_122910_c1	3300050514	Unclassified	1741
2068	nmdc:mga08x19_27_c1	3300050514	Bacteria	226652
2069	nmdc:mga08x19_30885_c1	3300050514	Bacteria	3367
2070	nmdc:mga0a205_103804_c1	3300050515	Bacteria	987
2071	nmdc:mga0a205_1195_c1	3300050515	Bacteria	21696
2072	nmdc:mga0a205_132567_c1	3300050515	Bacteria	2392
2073	nmdc:mga0a205_136547_c1	3300050515	Bacteria	2353
2074	nmdc:mga0a205_205687_c1	3300050515	Bacteria	1858
2075	nmdc:mga0a205_21169_c1	3300050515	Bacteria	6150
2076	nmdc:mga0a205_22524_c1	3300050515	Bacteria	5969
2077	nmdc:mga0a205_22736_c1	3300050515	Bacteria	5944
2078	nmdc:mga0a205_228815_c1	3300050515	Bacteria	1743
2079	nmdc:mga0a205_234372_c1	3300050515	Bacteria	1718
2080	nmdc:mga0a205_32992_c2	3300050515	Bacteria	1867
2081	nmdc:mga0a205_539802_c1	3300050515	Bacteria	1022
2082	nmdc:mga0a205_55769_c1	3300050515	Bacteria	3816
2083	nmdc:mga0a205_58905_c2	3300050515	Bacteria	2449
2084	nmdc:mga0a205_69391_c1	3300050515	Bacteria	3403
2085	Ga0495619_0466574	3300053085	Bacteria	870
2086	Ga0501084_0015029	3300054114	Bacteria	6419
2087	Ga0501084_1127218	3300054114	Bacteria	658
2088	Ga0587066_001427	3300059490	Bacteria	2392
2089	Ga0587073_0031495	3300059492	Unclassified	1098
2090	Ga0587077_049887	3300059493	Bacteria	872
2091	Ga0587082_050022	3300059504	Unclassified	794
2092	Ga0587082_060241	3300059504	Unclassified	747
2093	Ga0587075_008264	3300059644	Bacteria	1326
2094	Ga0501082_0125936	3300060353	Bacteria	2222
2095	Ga0501082_0812788	3300060353	Unclassified	818
2096	Ga0530510_0109649	3300061734	Bacteria	2021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050512	nmdc:mga0n895_1178125_c1	nmdc:mga0n895_1178125_c1_295_723	140
2	3300009148	Ga0105243_12048625	Ga0105243_120486251	150
3	3300047320	Ga0495672_0245595	Ga0495672_0245595_18_470	150
4	3300005530	Ga0070679_101055467	Ga0070679_1010554671	153
5	3300006237	Ga0097621_100203401	Ga0097621_1002034014	153
6	3300006358	Ga0068871_100032343	Ga0068871_1000323435	153
7	3300025921	Ga0207652_10497452	Ga0207652_104974521	153
8	3300035172	Ga0373955_0643724	Ga0373955_0643724_128_613	153
9	3300031548	Ga0307408_101802700	Ga0307408_1018027001	154
10	3300046616	Ga0495668_0001193	Ga0495668_0001193_19507_20304	154
11	3300006871	Ga0075434_100440591	Ga0075434_1004405912	155
12	3300009147	Ga0114129_10066829	Ga0114129_100668296	155
13	3300025922	Ga0207646_10681496	Ga0207646_106814961	155
14	3300031548	Ga0307408_100103992	Ga0307408_1001039922	155
15	3300050512	nmdc:mga0n895_175683_c1	nmdc:mga0n895_175683_c1_271_798	155
16	3300005290	Ga0065712_10056019	Ga0065712_100560191	156
17	3300005329	Ga0070683_100034134	Ga0070683_1000341342	156
18	3300005330	Ga0070690_100007637	Ga0070690_1000076377	156
19	3300005334	Ga0068869_100322598	Ga0068869_1003225981	156
20	3300005335	Ga0070666_10017381	Ga0070666_100173813	156
21	3300005336	Ga0070680_100098232	Ga0070680_1000982323	156
22	3300005337	Ga0070682_100268355	Ga0070682_1002683551	156
23	3300005338	Ga0068868_100059588	Ga0068868_1000595883	156
24	3300005339	Ga0070660_100027710	Ga0070660_1000277107	156
25	3300005341	Ga0070691_10044158	Ga0070691_100441582	156
26	3300005344	Ga0070661_100009094	Ga0070661_1000090943	156
27	3300005347	Ga0070668_100021234	Ga0070668_1000212343	156
28	3300005353	Ga0070669_100028322	Ga0070669_1000283228	156
29	3300005367	Ga0070667_100331731	Ga0070667_1003317312	156
30	3300005434	Ga0070709_10037238	Ga0070709_100372381	156
31	3300005436	Ga0070713_100062925	Ga0070713_1000629252	156
32	3300005436	Ga0070713_100160901	Ga0070713_1001609012	156
33	3300005437	Ga0070710_10060760	Ga0070710_100607603	156
34	3300005438	Ga0070701_10473109	Ga0070701_104731091	156
35	3300005439	Ga0070711_100001451	Ga0070711_1000014517	156
36	3300005439	Ga0070711_101416158	Ga0070711_1014161581	156
37	3300005444	Ga0070694_100078456	Ga0070694_1000784561	156
38	3300005455	Ga0070663_100057682	Ga0070663_1000576821	156
39	3300005457	Ga0070662_100004105	Ga0070662_1000041057	156
40	3300005458	Ga0070681_10187931	Ga0070681_101879311	156
41	3300005458	Ga0070681_10514294	Ga0070681_105142941	156
42	3300005459	Ga0068867_100164642	Ga0068867_1001646422	156
43	3300005466	Ga0070685_10827157	Ga0070685_108271571	156
44	3300005535	Ga0070684_100098582	Ga0070684_1000985822	156
45	3300005539	Ga0068853_100018774	Ga0068853_1000187743	156
46	3300005543	Ga0070672_100794691	Ga0070672_1007946912	156
47	3300005544	Ga0070686_100021492	Ga0070686_1000214928	156
48	3300005546	Ga0070696_100210087	Ga0070696_1002100871	156
49	3300005547	Ga0070693_100015864	Ga0070693_1000158648	156
50	3300005548	Ga0070665_100031578	Ga0070665_1000315785	156
51	3300005564	Ga0070664_100074406	Ga0070664_1000744062	156
52	3300005577	Ga0068857_100034641	Ga0068857_1000346412	156
53	3300005578	Ga0068854_100014168	Ga0068854_1000141683	156
54	3300005614	Ga0068856_100042765	Ga0068856_1000427658	156
55	3300005615	Ga0070702_100219565	Ga0070702_1002195652	156
56	3300005616	Ga0068852_100041438	Ga0068852_1000414381	156
57	3300005617	Ga0068859_100025384	Ga0068859_1000253848	156
58	3300005618	Ga0068864_100589813	Ga0068864_1005898132	156
59	3300005718	Ga0068866_10197950	Ga0068866_101979502	156
60	3300005719	Ga0068861_100027368	Ga0068861_1000273688	156
61	3300005834	Ga0068851_10016669	Ga0068851_100166698	156
62	3300005841	Ga0068863_100121531	Ga0068863_1001215312	156
63	3300005843	Ga0068860_100042911	Ga0068860_1000429112	156
64	3300005844	Ga0068862_100040176	Ga0068862_1000401762	156
65	3300006163	Ga0070715_10051924	Ga0070715_100519244	156
66	3300006175	Ga0070712_100023609	Ga0070712_1000236093	156
67	3300006237	Ga0097621_100141716	Ga0097621_1001417163	156
68	3300006237	Ga0097621_100357264	Ga0097621_1003572642	156
69	3300006358	Ga0068871_100143008	Ga0068871_1001430082	156
70	3300006852	Ga0075433_10022574	Ga0075433_100225743	156
71	3300006871	Ga0075434_100000359	Ga0075434_10000035923	156
72	3300006881	Ga0068865_100030443	Ga0068865_1000304433	156
73	3300006881	Ga0068865_100073227	Ga0068865_1000732272	156
74	3300006914	Ga0075436_100038672	Ga0075436_1000386723	156
75	3300006931	Ga0097620_100025387	Ga0097620_1000253874	156
76	3300009092	Ga0105250_10202184	Ga0105250_102021842	156
77	3300009093	Ga0105240_10207073	Ga0105240_102070732	156
78	3300009147	Ga0114129_10263223	Ga0114129_102632233	156
79	3300009148	Ga0105243_10030797	Ga0105243_100307978	156
80	3300009174	Ga0105241_10204548	Ga0105241_102045482	156
81	3300009176	Ga0105242_10029837	Ga0105242_100298372	156
82	3300009176	Ga0105242_10131561	Ga0105242_101315612	156
83	3300009177	Ga0105248_10055715	Ga0105248_100557158	156
84	3300009545	Ga0105237_10504430	Ga0105237_105044302	156
85	3300009551	Ga0105238_10039975	Ga0105238_100399753	156
86	3300009551	Ga0105238_10576782	Ga0105238_105767821	156
87	3300009551	Ga0105238_10848506	Ga0105238_108485062	156
88	3300009553	Ga0105249_10012680	Ga0105249_100126806	156
89	3300011119	Ga0105246_10545206	Ga0105246_105452061	156
90	3300013100	Ga0157373_10150539	Ga0157373_101505391	156
91	3300013102	Ga0157371_10014568	Ga0157371_100145685	156
92	3300013104	Ga0157370_10532238	Ga0157370_105322382	156
93	3300013105	Ga0157369_10052158	Ga0157369_100521588	156
94	3300013296	Ga0157374_10054821	Ga0157374_100548211	156
95	3300013296	Ga0157374_10087217	Ga0157374_100872172	156
96	3300013297	Ga0157378_10195734	Ga0157378_101957343	156
97	3300013306	Ga0163162_10019277	Ga0163162_100192778	156
98	3300013306	Ga0163162_10033025	Ga0163162_100330253	156
99	3300013307	Ga0157372_10077586	Ga0157372_100775861	156
100	3300013308	Ga0157375_10011888	Ga0157375_100118888	156
101	3300014325	Ga0163163_10040192	Ga0163163_100401923	156
102	3300014968	Ga0157379_10050490	Ga0157379_100504908	156
103	3300014969	Ga0157376_11224680	Ga0157376_112246801	156
104	3300025321	Ga0207656_10012132	Ga0207656_100121323	156
105	3300025899	Ga0207642_10267722	Ga0207642_102677221	156
106	3300025900	Ga0207710_10251183	Ga0207710_102511831	156
107	3300025903	Ga0207680_10018084	Ga0207680_100180842	156
108	3300025904	Ga0207647_10038561	Ga0207647_100385611	156
109	3300025906	Ga0207699_10075310	Ga0207699_100753103	156
110	3300025911	Ga0207654_10053275	Ga0207654_100532752	156
111	3300025911	Ga0207654_10421333	Ga0207654_104213331	156
112	3300025912	Ga0207707_10070690	Ga0207707_100706902	156
113	3300025912	Ga0207707_10481828	Ga0207707_104818281	156
114	3300025913	Ga0207695_10034528	Ga0207695_100345283	156
115	3300025914	Ga0207671_10047624	Ga0207671_100476243	156
116	3300025915	Ga0207693_10000766	Ga0207693_1000076618	156
117	3300025916	Ga0207663_10000490	Ga0207663_100004903	156
118	3300025917	Ga0207660_10232337	Ga0207660_102323372	156
119	3300025919	Ga0207657_10013013	Ga0207657_100130138	156
120	3300025920	Ga0207649_10031612	Ga0207649_100316121	156
121	3300025921	Ga0207652_10935711	Ga0207652_109357111	156
122	3300025923	Ga0207681_10109364	Ga0207681_101093643	156
123	3300025924	Ga0207694_10373070	Ga0207694_103730701	156
124	3300025927	Ga0207687_10006149	Ga0207687_100061493	156
125	3300025928	Ga0207700_10016045	Ga0207700_100160454	156
126	3300025928	Ga0207700_10115902	Ga0207700_101159024	156
127	3300025933	Ga0207706_10005136	Ga0207706_100051368	156
128	3300025934	Ga0207686_10021357	Ga0207686_100213576	156
129	3300025935	Ga0207709_10076474	Ga0207709_100764742	156
130	3300025937	Ga0207669_10661708	Ga0207669_106617082	156
131	3300025938	Ga0207704_10808493	Ga0207704_108084931	156
132	3300025938	Ga0207704_11221550	Ga0207704_112215501	156
133	3300025941	Ga0207711_10019539	Ga0207711_100195398	156
134	3300025944	Ga0207661_10009739	Ga0207661_100097393	156
135	3300025945	Ga0207679_10782311	Ga0207679_107823112	156
136	3300025949	Ga0207667_10010952	Ga0207667_100109524	156
137	3300025972	Ga0207668_10344865	Ga0207668_103448652	156
138	3300025981	Ga0207640_10019897	Ga0207640_100198978	156
139	3300026023	Ga0207677_10081470	Ga0207677_100814703	156
140	3300026023	Ga0207677_10625008	Ga0207677_106250081	156
141	3300026041	Ga0207639_10010188	Ga0207639_100101883	156
142	3300026067	Ga0207678_10011947	Ga0207678_100119473	156
143	3300026078	Ga0207702_10075923	Ga0207702_100759233	156
144	3300026088	Ga0207641_10019534	Ga0207641_100195343	156
145	3300026089	Ga0207648_10013711	Ga0207648_100137113	156
146	3300026089	Ga0207648_10304941	Ga0207648_103049411	156
147	3300026095	Ga0207676_10402017	Ga0207676_104020172	156
148	3300026116	Ga0207674_10055913	Ga0207674_100559132	156
149	3300026118	Ga0207675_100014206	Ga0207675_1000142063	156
150	3300026142	Ga0207698_10027727	Ga0207698_100277276	156
151	3300028379	Ga0268266_10020432	Ga0268266_100204328	156
152	3300028380	Ga0268265_10124634	Ga0268265_101246342	156
153	3300035090	Ga0373949_0200573	Ga0373949_0200573_22_555	156
154	3300035092	Ga0373952_0091156	Ga0373952_0091156_139_672	156
155	3300035112	Ga0373932_0040024	Ga0373932_0040024_111_644	156
156	3300035121	Ga0373960_0149300	Ga0373960_0149300_210_743	156
157	3300035691	Ga0373931_0014675	Ga0373931_0014675_2430_2963	156
158	3300046472	Ga0495580_0128741	Ga0495580_0128741_912_1439	156
159	3300048903	Ga0496100_0124881	Ga0496100_0124881_1104_1637	156
160	3300048903	Ga0496100_0951630	Ga0496100_0951630_116_649	156
161	3300048904	Ga0496101_0638641	Ga0496101_0638641_62_595	156
162	3300048905	Ga0496102_0157347	Ga0496102_0157347_731_1264	156
163	3300048906	Ga0496103_0108962	Ga0496103_0108962_699_1232	156
164	3300048909	Ga0496106_0032266	Ga0496106_0032266_624_1157	156
165	3300050507	nmdc:mga05p37_217007_c1	nmdc:mga05p37_217007_c1_1023_1571	156
166	3300050512	nmdc:mga0n895_31929_c1	nmdc:mga0n895_31929_c1_4173_4721	156
167	3300050513	nmdc:mga0rr50_416_c1	nmdc:mga0rr50_416_c1_3132_3680	156
168	3300050514	nmdc:mga08x19_30885_c1	nmdc:mga08x19_30885_c1_1758_2306	156
169	3300050515	nmdc:mga0a205_1195_c1	nmdc:mga0a205_1195_c1_3082_3630	156
170	3300046684	Ga0495669_0284898	Ga0495669_0284898_263_739	157
171	3300005334	Ga0068869_100365579	Ga0068869_1003655791	158
172	3300005367	Ga0070667_100224692	Ga0070667_1002246922	158
173	3300005435	Ga0070714_100366265	Ga0070714_1003662652	158
174	3300005436	Ga0070713_100120470	Ga0070713_1001204703	158
175	3300005618	Ga0068864_101708072	Ga0068864_1017080721	158
176	3300005718	Ga0068866_10026741	Ga0068866_100267414	158
177	3300006028	Ga0070717_10027475	Ga0070717_100274752	158
178	3300009177	Ga0105248_10066472	Ga0105248_100664722	158
179	3300010375	Ga0105239_10298472	Ga0105239_102984722	158
180	3300013296	Ga0157374_10847136	Ga0157374_108471362	158
181	3300013306	Ga0163162_10126133	Ga0163162_101261332	158
182	3300014969	Ga0157376_10238019	Ga0157376_102380192	158
183	3300025899	Ga0207642_10091246	Ga0207642_100912462	158
184	3300025927	Ga0207687_10018361	Ga0207687_100183611	158
185	3300025928	Ga0207700_10810877	Ga0207700_108108771	158
186	3300025929	Ga0207664_10041492	Ga0207664_100414924	158
187	3300026095	Ga0207676_11606978	Ga0207676_116069781	158
188	3300046457	Ga0495590_0150301	Ga0495590_0150301_136_684	158
189	3300048907	Ga0496104_0391075	Ga0496104_0391075_223_771	158
190	3300048915	Ga0496112_0106330	Ga0496112_0106330_26_574	158
191	3300039450	Ga0436363_1337972	Ga0436363_1337972_205_753	159
192	3300046454	Ga0495592_0196398	Ga0495592_0196398_268_795	159
193	3300046514	Ga0495618_0185256	Ga0495618_0185256_213_740	159
194	3300046516	Ga0495628_0362656	Ga0495628_0362656_514_1041	159
195	3300046529	Ga0495652_0465213	Ga0495652_0465213_136_663	159
196	3300005355	Ga0070671_100468296	Ga0070671_1004682962	160
197	3300005544	Ga0070686_100353308	Ga0070686_1003533082	160
198	3300006028	Ga0070717_10279820	Ga0070717_102798202	160
199	3300006844	Ga0075428_100202372	Ga0075428_1002023723	160
200	3300006847	Ga0075431_100700515	Ga0075431_1007005151	160
201	3300006852	Ga0075433_10191599	Ga0075433_101915993	160
202	3300006871	Ga0075434_100223276	Ga0075434_1002232763	160
203	3300006880	Ga0075429_100253705	Ga0075429_1002537052	160
204	3300006914	Ga0075436_100549200	Ga0075436_1005492001	160
205	3300009147	Ga0114129_10902480	Ga0114129_109024802	160
206	3300009147	Ga0114129_10995219	Ga0114129_109952191	160
207	3300013296	Ga0157374_10493812	Ga0157374_104938122	160
208	3300035691	Ga0373931_0119749	Ga0373931_0119749_720_1247	160
209	3300038996	Ga0242420_113678	Ga0242420_113678_88_570	160
210	3300050507	nmdc:mga05p37_119901_c1	nmdc:mga05p37_119901_c1_2346_2873	160
211	3300050507	nmdc:mga05p37_80215_c1	nmdc:mga05p37_80215_c1_1248_1775	160
212	3300050508	nmdc:mga09592_98736_c1	nmdc:mga09592_98736_c1_1902_2429	160
213	3300050510	nmdc:mga06r32_1176561_c1	nmdc:mga06r32_1176561_c1_51_578	160
214	3300050510	nmdc:mga06r32_924000_c1	nmdc:mga06r32_924000_c1_255_782	160
215	3300050514	nmdc:mga08x19_122910_c1	nmdc:mga08x19_122910_c1_86_613	160
216	3300050515	nmdc:mga0a205_69391_c1	nmdc:mga0a205_69391_c1_559_1086	160
217	3300005331	Ga0070670_100406101	Ga0070670_1004061012	161
218	3300005435	Ga0070714_100954376	Ga0070714_1009543761	161
219	3300005543	Ga0070672_101443001	Ga0070672_1014430011	161
220	3300006028	Ga0070717_10330372	Ga0070717_103303722	161
221	3300014325	Ga0163163_10629947	Ga0163163_106299472	161
222	3300025928	Ga0207700_10246028	Ga0207700_102460281	161
223	3300025929	Ga0207664_10419013	Ga0207664_104190131	161
224	3300025931	Ga0207644_10355917	Ga0207644_103559172	161
225	3300036401	Ga0373937_0405405	Ga0373937_0405405_654_1202	161
226	3300036401	Ga0373937_0916487	Ga0373937_0916487_231_758	161
227	3300042876	Ga0451577_0173054	Ga0451577_0173054_68_592	161
228	3300046517	Ga0495630_1064918	Ga0495630_1064918_34_561	161
229	3300053085	Ga0495619_0466574	Ga0495619_0466574_53_580	161
230	3300005444	Ga0070694_100332023	Ga0070694_1003320232	163
231	3300006880	Ga0075429_100349361	Ga0075429_1003493612	163
232	3300009177	Ga0105248_10867975	Ga0105248_108679752	163
233	3300005364	Ga0070673_100028099	Ga0070673_1000280992	164
234	3300005435	Ga0070714_100082228	Ga0070714_1000822283	164
235	3300005546	Ga0070696_100319937	Ga0070696_1003199371	164
236	3300025915	Ga0207693_10401094	Ga0207693_104010942	164
237	3300025929	Ga0207664_10102750	Ga0207664_101027503	164
238	3300025960	Ga0207651_10026556	Ga0207651_100265562	164
239	3300035241	Ga0373961_0208613	Ga0373961_0208613_90_623	164
240	3300047319	Ga0495674_0118370	Ga0495674_0118370_1459_2046	164
241	3300047320	Ga0495672_0329296	Ga0495672_0329296_92_628	164
242	3300005434	Ga0070709_10069524	Ga0070709_100695242	165
243	3300005436	Ga0070713_100402895	Ga0070713_1004028951	165
244	3300005439	Ga0070711_100642538	Ga0070711_1006425381	165
245	3300006173	Ga0070716_100054581	Ga0070716_1000545811	165
246	3300025915	Ga0207693_10583879	Ga0207693_105838792	165
247	3300025916	Ga0207663_10490542	Ga0207663_104905421	165
248	3300025939	Ga0207665_10142584	Ga0207665_101425842	165
249	3300046454	Ga0495592_0206103	Ga0495592_0206103_202_789	165
250	3300046473	Ga0495582_0448446	Ga0495582_0448446_111_698	165
251	3300037471	Ga0395905_0399121	Ga0395905_0399121_494_1030	167
252	3300038443	Ga0395901_0359431	Ga0395901_0359431_439_975	167
253	3300048907	Ga0496104_0063828	Ga0496104_0063828_1422_1982	167
254	3300035111	Ga0373923_0160374	Ga0373923_0160374_309_857	168
255	3300035171	Ga0373946_0175227	Ga0373946_0175227_309_857	168
256	3300035725	Ga0373947_0510128	Ga0373947_0510128_105_653	168
257	3300036401	Ga0373937_0179423	Ga0373937_0179423_1026_1574	168
258	3300005331	Ga0070670_100152402	Ga0070670_1001524023	170
259	3300005338	Ga0068868_100463947	Ga0068868_1004639472	170
260	3300005843	Ga0068860_100097518	Ga0068860_1000975183	170
261	3300013296	Ga0157374_10242207	Ga0157374_102422071	170
262	3300014325	Ga0163163_10201208	Ga0163163_102012082	170
263	3300025961	Ga0207712_10766939	Ga0207712_107669391	171
264	3300026023	Ga0207677_10009783	Ga0207677_100097833	171
265	3300048905	Ga0496102_0258124	Ga0496102_0258124_205_765	171
266	3300048915	Ga0496112_0187229	Ga0496112_0187229_358_918	171
267	3300005295	Ga0065707_10442393	Ga0065707_104423931	172
268	3300005336	Ga0070680_100165034	Ga0070680_1001650341	172
269	3300005355	Ga0070671_100390926	Ga0070671_1003909262	172
270	3300005468	Ga0070707_100469021	Ga0070707_1004690212	172
271	3300005471	Ga0070698_100374031	Ga0070698_1003740312	172
272	3300005718	Ga0068866_10422302	Ga0068866_104223022	172
273	3300005844	Ga0068862_100261716	Ga0068862_1002617161	172
274	3300005844	Ga0068862_100922131	Ga0068862_1009221311	172
275	3300006844	Ga0075428_100025823	Ga0075428_1000258234	172
276	3300006844	Ga0075428_100038516	Ga0075428_1000385163	172
277	3300006844	Ga0075428_100078443	Ga0075428_1000784432	172
278	3300006846	Ga0075430_100514321	Ga0075430_1005143212	172
279	3300006847	Ga0075431_100031478	Ga0075431_1000314783	172
280	3300006847	Ga0075431_101067865	Ga0075431_1010678651	172
281	3300006852	Ga0075433_10980620	Ga0075433_109806201	172
282	3300006871	Ga0075434_100822142	Ga0075434_1008221422	172
283	3300006880	Ga0075429_100210297	Ga0075429_1002102973	172
284	3300006914	Ga0075436_100231379	Ga0075436_1002313792	172
285	3300009094	Ga0111539_10265512	Ga0111539_102655123	172
286	3300009094	Ga0111539_10528383	Ga0111539_105283831	172
287	3300009147	Ga0114129_10060754	Ga0114129_100607547	172
288	3300009147	Ga0114129_10304753	Ga0114129_103047533	172
289	3300009148	Ga0105243_11464994	Ga0105243_114649941	172
290	3300009174	Ga0105241_10756812	Ga0105241_107568121	172
291	3300009177	Ga0105248_11191312	Ga0105248_111913122	172
292	3300013297	Ga0157378_11751836	Ga0157378_117518361	172
293	3300013306	Ga0163162_10294931	Ga0163162_102949313	172
294	3300025961	Ga0207712_10072928	Ga0207712_100729282	172
295	3300026121	Ga0207683_10876969	Ga0207683_108769692	172
296	3300027907	Ga0207428_10054154	Ga0207428_100541542	172
297	3300028380	Ga0268265_10292582	Ga0268265_102925821	172
298	3300028381	Ga0268264_10544341	Ga0268264_105443412	172
299	3300037853	Ga0436364_1279038	Ga0436364_1279038_1103_1672	172
300	3300039450	Ga0436363_1536649	Ga0436363_1536649_975_1544	172
301	3300045051	Ga0451576_0259285	Ga0451576_0259285_1063_1599	172
302	3300050510	nmdc:mga06r32_50469_c1	nmdc:mga06r32_50469_c1_2659_3183	172
303	3300050511	nmdc:mga08y16_122568_c1	nmdc:mga08y16_122568_c1_1684_2208	172
304	3300050511	nmdc:mga08y16_129151_c1	nmdc:mga08y16_129151_c1_547_1071	172
305	3300050512	nmdc:mga0n895_1369765_c1	nmdc:mga0n895_1369765_c1_127_651	172
306	3300050515	nmdc:mga0a205_103804_c1	nmdc:mga0a205_103804_c1_313_837	172
307	3300050515	nmdc:mga0a205_21169_c1	nmdc:mga0a205_21169_c1_3749_4273	172
308	3300001976	JGI24752J21851_1008213	JGI24752J21851_10082131	173
309	3300001990	JGI24737J22298_10073496	JGI24737J22298_100734961	173
310	3300002075	JGI24738J21930_10031920	JGI24738J21930_100319202	173
311	3300002076	JGI24749J21850_1017302	JGI24749J21850_10173021	173
312	3300002239	JGI24034J26672_10001165	JGI24034J26672_100011659	173
313	3300004799	Ga0058863_10052666	Ga0058863_100526664	173
314	3300004800	Ga0058861_11995602	Ga0058861_119956023	173
315	3300004803	Ga0058862_10076498	Ga0058862_100764983	173
316	3300004803	Ga0058862_10237797	Ga0058862_102377972	173
317	3300005290	Ga0065712_10098443	Ga0065712_100984431	173
318	3300005293	Ga0065715_10716518	Ga0065715_107165181	173
319	3300005327	Ga0070658_10059350	Ga0070658_100593504	173
320	3300005328	Ga0070676_10006703	Ga0070676_100067034	173
321	3300005329	Ga0070683_100007337	Ga0070683_1000073377	173
322	3300005329	Ga0070683_100083622	Ga0070683_1000836227	173
323	3300005329	Ga0070683_100112701	Ga0070683_1001127013	173
324	3300005329	Ga0070683_100337914	Ga0070683_1003379142	173
325	3300005330	Ga0070690_100006277	Ga0070690_1000062774	173
326	3300005330	Ga0070690_100014199	Ga0070690_1000141994	173
327	3300005331	Ga0070670_100015850	Ga0070670_1000158509	173
328	3300005331	Ga0070670_100681590	Ga0070670_1006815901	173
329	3300005333	Ga0070677_10002420	Ga0070677_100024201	173
330	3300005333	Ga0070677_10126361	Ga0070677_101263611	173
331	3300005334	Ga0068869_100008056	Ga0068869_1000080564	173
332	3300005334	Ga0068869_100028941	Ga0068869_1000289417	173
333	3300005335	Ga0070666_10026396	Ga0070666_100263968	173
334	3300005335	Ga0070666_10640633	Ga0070666_106406332	173
335	3300005336	Ga0070680_100134655	Ga0070680_1001346552	173
336	3300005336	Ga0070680_100266504	Ga0070680_1002665042	173
337	3300005336	Ga0070680_100448137	Ga0070680_1004481372	173
338	3300005337	Ga0070682_100158124	Ga0070682_1001581242	173
339	3300005337	Ga0070682_100637552	Ga0070682_1006375521	173
340	3300005338	Ga0068868_100038684	Ga0068868_1000386842	173
341	3300005338	Ga0068868_100067192	Ga0068868_1000671922	173
342	3300005338	Ga0068868_100537718	Ga0068868_1005377181	173
343	3300005338	Ga0068868_100638186	Ga0068868_1006381861	173
344	3300005338	Ga0068868_101399458	Ga0068868_1013994581	173
345	3300005339	Ga0070660_100363806	Ga0070660_1003638062	173
346	3300005340	Ga0070689_100029871	Ga0070689_1000298718	173
347	3300005340	Ga0070689_100096393	Ga0070689_1000963932	173
348	3300005341	Ga0070691_10045685	Ga0070691_100456852	173
349	3300005343	Ga0070687_100002977	Ga0070687_1000029774	173
350	3300005344	Ga0070661_100004429	Ga0070661_1000044293	173
351	3300005344	Ga0070661_100029191	Ga0070661_1000291918	173
352	3300005344	Ga0070661_100293198	Ga0070661_1002931981	173
353	3300005353	Ga0070669_100004517	Ga0070669_1000045174	173
354	3300005353	Ga0070669_100050463	Ga0070669_1000504631	173
355	3300005353	Ga0070669_100195972	Ga0070669_1001959721	173
356	3300005353	Ga0070669_100913094	Ga0070669_1009130941	173
357	3300005354	Ga0070675_100043088	Ga0070675_1000430882	173
358	3300005354	Ga0070675_100646216	Ga0070675_1006462161	173
359	3300005355	Ga0070671_100053621	Ga0070671_1000536214	173
360	3300005356	Ga0070674_100020536	Ga0070674_1000205364	173
361	3300005364	Ga0070673_100137469	Ga0070673_1001374692	173
362	3300005364	Ga0070673_100335331	Ga0070673_1003353311	173
363	3300005364	Ga0070673_100622213	Ga0070673_1006222131	173
364	3300005364	Ga0070673_100952404	Ga0070673_1009524042	173
365	3300005365	Ga0070688_100007474	Ga0070688_1000074747	173
366	3300005366	Ga0070659_100003564	Ga0070659_1000035645	173
367	3300005366	Ga0070659_100351961	Ga0070659_1003519611	173
368	3300005367	Ga0070667_100909521	Ga0070667_1009095211	173
369	3300005367	Ga0070667_101125373	Ga0070667_1011253731	173
370	3300005435	Ga0070714_100239293	Ga0070714_1002392932	173
371	3300005435	Ga0070714_100488968	Ga0070714_1004889682	173
372	3300005436	Ga0070713_100053130	Ga0070713_1000531302	173
373	3300005436	Ga0070713_100080113	Ga0070713_1000801132	173
374	3300005436	Ga0070713_100510039	Ga0070713_1005100392	173
375	3300005437	Ga0070710_10050598	Ga0070710_100505983	173
376	3300005438	Ga0070701_10049658	Ga0070701_100496583	173
377	3300005439	Ga0070711_100046806	Ga0070711_1000468062	173
378	3300005439	Ga0070711_100118000	Ga0070711_1001180002	173
379	3300005439	Ga0070711_100232762	Ga0070711_1002327622	173
380	3300005439	Ga0070711_100235266	Ga0070711_1002352661	173
381	3300005439	Ga0070711_100289338	Ga0070711_1002893382	173
382	3300005439	Ga0070711_100371046	Ga0070711_1003710463	173
383	3300005440	Ga0070705_100567585	Ga0070705_1005675851	173
384	3300005440	Ga0070705_100628297	Ga0070705_1006282971	173
385	3300005440	Ga0070705_100763118	Ga0070705_1007631181	173
386	3300005445	Ga0070708_100046385	Ga0070708_1000463857	173
387	3300005445	Ga0070708_100046478	Ga0070708_1000464782	173
388	3300005445	Ga0070708_100066816	Ga0070708_1000668163	173
389	3300005445	Ga0070708_100077627	Ga0070708_1000776272	173
390	3300005445	Ga0070708_100247773	Ga0070708_1002477732	173
391	3300005445	Ga0070708_100249882	Ga0070708_1002498822	173
392	3300005445	Ga0070708_100676616	Ga0070708_1006766161	173
393	3300005455	Ga0070663_100165926	Ga0070663_1001659262	173
394	3300005456	Ga0070678_100075781	Ga0070678_1000757814	173
395	3300005456	Ga0070678_100473060	Ga0070678_1004730601	173
396	3300005456	Ga0070678_100630919	Ga0070678_1006309191	173
397	3300005457	Ga0070662_100028499	Ga0070662_1000284998	173
398	3300005458	Ga0070681_10024410	Ga0070681_100244108	173
399	3300005458	Ga0070681_10061399	Ga0070681_100613997	173
400	3300005458	Ga0070681_10135324	Ga0070681_101353243	173
401	3300005458	Ga0070681_10604969	Ga0070681_106049692	173
402	3300005459	Ga0068867_100011116	Ga0068867_1000111166	173
403	3300005459	Ga0068867_100018373	Ga0068867_1000183736	173
404	3300005466	Ga0070685_10016850	Ga0070685_100168507	173
405	3300005467	Ga0070706_100000792	Ga0070706_1000007928	173
406	3300005467	Ga0070706_100001933	Ga0070706_1000019338	173
407	3300005467	Ga0070706_100028797	Ga0070706_1000287973	173
408	3300005467	Ga0070706_100645592	Ga0070706_1006455921	173
409	3300005468	Ga0070707_100011873	Ga0070707_1000118734	173
410	3300005468	Ga0070707_100071010	Ga0070707_1000710102	173
411	3300005468	Ga0070707_100105313	Ga0070707_1001053132	173
412	3300005468	Ga0070707_100196794	Ga0070707_1001967942	173
413	3300005468	Ga0070707_100204552	Ga0070707_1002045523	173
414	3300005468	Ga0070707_100629363	Ga0070707_1006293632	173
415	3300005471	Ga0070698_100003274	Ga0070698_1000032748	173
416	3300005471	Ga0070698_100062710	Ga0070698_1000627105	173
417	3300005518	Ga0070699_100033373	Ga0070699_1000333733	173
418	3300005518	Ga0070699_100177821	Ga0070699_1001778213	173
419	3300005518	Ga0070699_100222360	Ga0070699_1002223602	173
420	3300005530	Ga0070679_100034483	Ga0070679_1000344833	173
421	3300005530	Ga0070679_100037178	Ga0070679_1000371784	173
422	3300005530	Ga0070679_100181525	Ga0070679_1001815253	173
423	3300005530	Ga0070679_100672538	Ga0070679_1006725381	173
424	3300005535	Ga0070684_100001288	Ga0070684_1000012887	173
425	3300005536	Ga0070697_100000283	Ga0070697_1000002837	173
426	3300005536	Ga0070697_100003995	Ga0070697_1000039952	173
427	3300005536	Ga0070697_100055352	Ga0070697_1000553524	173
428	3300005536	Ga0070697_100078640	Ga0070697_1000786404	173
429	3300005536	Ga0070697_100081051	Ga0070697_1000810514	173
430	3300005536	Ga0070697_100292422	Ga0070697_1002924222	173
431	3300005536	Ga0070697_100301799	Ga0070697_1003017992	173
432	3300005536	Ga0070697_100333250	Ga0070697_1003332502	173
433	3300005536	Ga0070697_100714406	Ga0070697_1007144061	173
434	3300005539	Ga0068853_100008387	Ga0068853_1000083874	173
435	3300005539	Ga0068853_100049752	Ga0068853_1000497526	173
436	3300005539	Ga0068853_100107608	Ga0068853_1001076081	173
437	3300005543	Ga0070672_100266328	Ga0070672_1002663282	173
438	3300005544	Ga0070686_100001416	Ga0070686_1000014164	173
439	3300005545	Ga0070695_100271852	Ga0070695_1002718521	173
440	3300005546	Ga0070696_100342720	Ga0070696_1003427202	173
441	3300005547	Ga0070693_100123487	Ga0070693_1001234872	173
442	3300005547	Ga0070693_100241335	Ga0070693_1002413352	173
443	3300005548	Ga0070665_100088492	Ga0070665_1000884923	173
444	3300005549	Ga0070704_100013577	Ga0070704_1000135777	173
445	3300005549	Ga0070704_100965041	Ga0070704_1009650411	173
446	3300005563	Ga0068855_100017602	Ga0068855_1000176025	173
447	3300005563	Ga0068855_100040905	Ga0068855_1000409051	173
448	3300005563	Ga0068855_100060816	Ga0068855_1000608163	173
449	3300005563	Ga0068855_100196578	Ga0068855_1001965782	173
450	3300005564	Ga0070664_100031709	Ga0070664_1000317093	173
451	3300005577	Ga0068857_100004001	Ga0068857_1000040018	173
452	3300005577	Ga0068857_100016539	Ga0068857_1000165394	173
453	3300005577	Ga0068857_100557366	Ga0068857_1005573662	173
454	3300005577	Ga0068857_100907066	Ga0068857_1009070662	173
455	3300005577	Ga0068857_101139707	Ga0068857_1011397071	173
456	3300005578	Ga0068854_100008033	Ga0068854_10000803311	173
457	3300005578	Ga0068854_100042280	Ga0068854_1000422802	173
458	3300005578	Ga0068854_100149254	Ga0068854_1001492542	173
459	3300005578	Ga0068854_100201158	Ga0068854_1002011582	173
460	3300005578	Ga0068854_100392510	Ga0068854_1003925101	173
461	3300005578	Ga0068854_101116844	Ga0068854_1011168441	173
462	3300005614	Ga0068856_100001110	Ga0068856_10000111023	173
463	3300005614	Ga0068856_100018558	Ga0068856_1000185581	173
464	3300005614	Ga0068856_100035194	Ga0068856_1000351942	173
465	3300005614	Ga0068856_100297013	Ga0068856_1002970132	173
466	3300005614	Ga0068856_100903766	Ga0068856_1009037662	173
467	3300005615	Ga0070702_100003139	Ga0070702_1000031394	173
468	3300005615	Ga0070702_100049917	Ga0070702_1000499171	173
469	3300005615	Ga0070702_100629482	Ga0070702_1006294821	173
470	3300005616	Ga0068852_100013666	Ga0068852_1000136664	173
471	3300005616	Ga0068852_100065431	Ga0068852_1000654314	173
472	3300005617	Ga0068859_100007438	Ga0068859_1000074385	173
473	3300005617	Ga0068859_100160322	Ga0068859_1001603223	173
474	3300005617	Ga0068859_100627616	Ga0068859_1006276162	173
475	3300005618	Ga0068864_100022179	Ga0068864_1000221798	173
476	3300005618	Ga0068864_100023022	Ga0068864_1000230222	173
477	3300005618	Ga0068864_100624825	Ga0068864_1006248252	173
478	3300005718	Ga0068866_10012121	Ga0068866_100121212	173
479	3300005718	Ga0068866_10025187	Ga0068866_100251871	173
480	3300005719	Ga0068861_100040453	Ga0068861_1000404538	173
481	3300005719	Ga0068861_100385293	Ga0068861_1003852934	173
482	3300005834	Ga0068851_10005401	Ga0068851_100054014	173
483	3300005834	Ga0068851_10067532	Ga0068851_100675323	173
484	3300005834	Ga0068851_10274486	Ga0068851_102744862	173
485	3300005840	Ga0068870_10003394	Ga0068870_100033944	173
486	3300005840	Ga0068870_10212506	Ga0068870_102125062	173
487	3300005840	Ga0068870_10314956	Ga0068870_103149562	173
488	3300005841	Ga0068863_100178956	Ga0068863_1001789562	173
489	3300005841	Ga0068863_100319729	Ga0068863_1003197292	173
490	3300005841	Ga0068863_100596160	Ga0068863_1005961602	173
491	3300005841	Ga0068863_101061708	Ga0068863_1010617082	173
492	3300005842	Ga0068858_100006289	Ga0068858_1000062893	173
493	3300005842	Ga0068858_100036870	Ga0068858_1000368701	173
494	3300005842	Ga0068858_100056365	Ga0068858_1000563652	173
495	3300005842	Ga0068858_100370683	Ga0068858_1003706832	173
496	3300005843	Ga0068860_100029103	Ga0068860_1000291034	173
497	3300005843	Ga0068860_100171331	Ga0068860_1001713313	173
498	3300005843	Ga0068860_100203029	Ga0068860_1002030292	173
499	3300005843	Ga0068860_101794202	Ga0068860_1017942021	173
500	3300005844	Ga0068862_100009823	Ga0068862_10000982311	173
501	3300005844	Ga0068862_100172950	Ga0068862_1001729502	173
502	3300006028	Ga0070717_10005974	Ga0070717_100059748	173
503	3300006028	Ga0070717_10028758	Ga0070717_100287583	173
504	3300006028	Ga0070717_10044840	Ga0070717_100448403	173
505	3300006028	Ga0070717_10047509	Ga0070717_100475094	173
506	3300006028	Ga0070717_10085168	Ga0070717_100851681	173
507	3300006028	Ga0070717_10320448	Ga0070717_103204482	173
508	3300006028	Ga0070717_11004287	Ga0070717_110042871	173
509	3300006173	Ga0070716_100024110	Ga0070716_1000241102	173
510	3300006173	Ga0070716_100096014	Ga0070716_1000960141	173
511	3300006175	Ga0070712_100035148	Ga0070712_1000351484	173
512	3300006175	Ga0070712_100139388	Ga0070712_1001393883	173
513	3300006175	Ga0070712_100375595	Ga0070712_1003755952	173
514	3300006237	Ga0097621_100001595	Ga0097621_1000015956	173
515	3300006237	Ga0097621_100073961	Ga0097621_1000739613	173
516	3300006237	Ga0097621_100355292	Ga0097621_1003552922	173
517	3300006358	Ga0068871_100008540	Ga0068871_1000085405	173
518	3300006358	Ga0068871_100016458	Ga0068871_1000164588	173
519	3300006358	Ga0068871_100042420	Ga0068871_1000424204	173
520	3300006358	Ga0068871_100352551	Ga0068871_1003525512	173
521	3300006358	Ga0068871_100937186	Ga0068871_1009371862	173
522	3300006852	Ga0075433_10288014	Ga0075433_102880142	173
523	3300006852	Ga0075433_10556371	Ga0075433_105563712	173
524	3300006852	Ga0075433_10588799	Ga0075433_105887991	173
525	3300006871	Ga0075434_100007514	Ga0075434_1000075145	173
526	3300006871	Ga0075434_100062820	Ga0075434_1000628202	173
527	3300006871	Ga0075434_100526883	Ga0075434_1005268832	173
528	3300006881	Ga0068865_100165590	Ga0068865_1001655903	173
529	3300006881	Ga0068865_100229398	Ga0068865_1002293981	173
530	3300006914	Ga0075436_100187748	Ga0075436_1001877482	173
531	3300006931	Ga0097620_100007438	Ga0097620_1000074385	173
532	3300006931	Ga0097620_100160305	Ga0097620_1001603053	173
533	3300006931	Ga0097620_100627728	Ga0097620_1006277282	173
534	3300007076	Ga0075435_100064802	Ga0075435_1000648026	173
535	3300007265	Ga0099794_10045761	Ga0099794_100457611	173
536	3300007265	Ga0099794_10215139	Ga0099794_102151391	173
537	3300009011	Ga0105251_10151642	Ga0105251_101516422	173
538	3300009092	Ga0105250_10009785	Ga0105250_100097853	173
539	3300009093	Ga0105240_10068598	Ga0105240_100685984	173
540	3300009093	Ga0105240_10078306	Ga0105240_100783068	173
541	3300009093	Ga0105240_10205176	Ga0105240_102051764	173
542	3300009093	Ga0105240_10444187	Ga0105240_104441872	173
543	3300009093	Ga0105240_10644182	Ga0105240_106441822	173
544	3300009098	Ga0105245_10026029	Ga0105245_100260292	173
545	3300009098	Ga0105245_10027941	Ga0105245_100279411	173
546	3300009098	Ga0105245_10164407	Ga0105245_101644072	173
547	3300009101	Ga0105247_10013031	Ga0105247_100130318	173
548	3300009147	Ga0114129_10302270	Ga0114129_103022702	173
549	3300009174	Ga0105241_10002176	Ga0105241_100021768	173
550	3300009174	Ga0105241_10130789	Ga0105241_101307893	173
551	3300009174	Ga0105241_10173075	Ga0105241_101730752	173
552	3300009174	Ga0105241_10191319	Ga0105241_101913192	173
553	3300009174	Ga0105241_10331647	Ga0105241_103316472	173
554	3300009176	Ga0105242_10022250	Ga0105242_100222503	173
555	3300009176	Ga0105242_10106044	Ga0105242_101060442	173
556	3300009176	Ga0105242_10137514	Ga0105242_101375142	173
557	3300009177	Ga0105248_10074288	Ga0105248_100742887	173
558	3300009177	Ga0105248_10092476	Ga0105248_100924763	173
559	3300009177	Ga0105248_10121996	Ga0105248_101219963	173
560	3300009177	Ga0105248_10916648	Ga0105248_109166481	173
561	3300009545	Ga0105237_10021684	Ga0105237_100216843	173
562	3300009545	Ga0105237_10164351	Ga0105237_101643511	173
563	3300009545	Ga0105237_10327578	Ga0105237_103275782	173
564	3300009545	Ga0105237_10347120	Ga0105237_103471202	173
565	3300009545	Ga0105237_10779234	Ga0105237_107792341	173
566	3300009551	Ga0105238_10020606	Ga0105238_100206068	173
567	3300009551	Ga0105238_10465198	Ga0105238_104651982	173
568	3300009551	Ga0105238_11036234	Ga0105238_110362341	173
569	3300009553	Ga0105249_10044804	Ga0105249_100448048	173
570	3300009553	Ga0105249_10161894	Ga0105249_101618942	173
571	3300009553	Ga0105249_10225670	Ga0105249_102256702	173
572	3300010375	Ga0105239_10042332	Ga0105239_100423327	173
573	3300010375	Ga0105239_10229775	Ga0105239_102297752	173
574	3300010375	Ga0105239_10454772	Ga0105239_104547722	173
575	3300011119	Ga0105246_10011795	Ga0105246_100117953	173
576	3300011119	Ga0105246_10205203	Ga0105246_102052032	173
577	3300013100	Ga0157373_10026972	Ga0157373_100269727	173
578	3300013100	Ga0157373_10033463	Ga0157373_100334632	173
579	3300013102	Ga0157371_10020354	Ga0157371_100203542	173
580	3300013104	Ga0157370_10060881	Ga0157370_100608813	173
581	3300013104	Ga0157370_10135365	Ga0157370_101353652	173
582	3300013104	Ga0157370_11050157	Ga0157370_110501571	173
583	3300013105	Ga0157369_10000674	Ga0157369_1000067430	173
584	3300013105	Ga0157369_10025145	Ga0157369_100251456	173
585	3300013105	Ga0157369_10106782	Ga0157369_101067821	173
586	3300013105	Ga0157369_10227210	Ga0157369_102272102	173
587	3300013105	Ga0157369_10271417	Ga0157369_102714172	173
588	3300013105	Ga0157369_10342047	Ga0157369_103420472	173
589	3300013105	Ga0157369_10637165	Ga0157369_106371652	173
590	3300013296	Ga0157374_10006374	Ga0157374_100063748	173
591	3300013296	Ga0157374_10014289	Ga0157374_100142893	173
592	3300013296	Ga0157374_10047190	Ga0157374_100471902	173
593	3300013296	Ga0157374_10206052	Ga0157374_102060522	173
594	3300013296	Ga0157374_10592691	Ga0157374_105926912	173
595	3300013297	Ga0157378_10000855	Ga0157378_100008558	173
596	3300013297	Ga0157378_10020155	Ga0157378_100201553	173
597	3300013297	Ga0157378_10129961	Ga0157378_101299612	173
598	3300013297	Ga0157378_10222069	Ga0157378_102220693	173
599	3300013297	Ga0157378_10289908	Ga0157378_102899083	173
600	3300013297	Ga0157378_11080359	Ga0157378_110803592	173
601	3300013306	Ga0163162_11988140	Ga0163162_119881402	173
602	3300013307	Ga0157372_10001167	Ga0157372_1000116719	173
603	3300013307	Ga0157372_10009122	Ga0157372_100091228	173
604	3300013307	Ga0157372_10069921	Ga0157372_100699216	173
605	3300013307	Ga0157372_10157564	Ga0157372_101575644	173
606	3300013307	Ga0157372_10197816	Ga0157372_101978164	173
607	3300013307	Ga0157372_11012108	Ga0157372_110121081	173
608	3300013307	Ga0157372_11102110	Ga0157372_111021101	173
609	3300013308	Ga0157375_10069063	Ga0157375_100690632	173
610	3300013308	Ga0157375_10588695	Ga0157375_105886951	173
611	3300013308	Ga0157375_10664268	Ga0157375_106642681	173
612	3300014325	Ga0163163_10022985	Ga0163163_100229858	173
613	3300014325	Ga0163163_10364932	Ga0163163_103649322	173
614	3300014325	Ga0163163_10599812	Ga0163163_105998122	173
615	3300014325	Ga0163163_10667057	Ga0163163_106670572	173
616	3300014326	Ga0157380_10006345	Ga0157380_100063455	173
617	3300014326	Ga0157380_10027308	Ga0157380_100273088	173
618	3300014745	Ga0157377_10011651	Ga0157377_100116512	173
619	3300014968	Ga0157379_10021619	Ga0157379_100216197	173
620	3300014968	Ga0157379_10074309	Ga0157379_100743093	173
621	3300014969	Ga0157376_10041954	Ga0157376_100419543	173
622	3300014969	Ga0157376_10048142	Ga0157376_100481424	173
623	3300014969	Ga0157376_10456533	Ga0157376_104565332	173
624	3300015261	Ga0182006_1061365	Ga0182006_10613651	173
625	3300015262	Ga0182007_10010258	Ga0182007_100102588	173
626	3300015262	Ga0182007_10036578	Ga0182007_100365782	173
627	3300015265	Ga0182005_1008054	Ga0182005_10080543	173
628	3300017792	Ga0163161_10013647	Ga0163161_100136473	173
629	3300020070	Ga0206356_11060192	Ga0206356_110601922	173
630	3300020078	Ga0206352_10591876	Ga0206352_105918763	173
631	3300020080	Ga0206350_11076356	Ga0206350_110763563	173
632	3300021358	Ga0213873_10030496	Ga0213873_100304961	173
633	3300021377	Ga0213874_10037257	Ga0213874_100372573	173
634	3300022467	Ga0224712_10051733	Ga0224712_100517332	173
635	3300025315	Ga0207697_10014874	Ga0207697_100148746	173
636	3300025321	Ga0207656_10015866	Ga0207656_100158663	173
637	3300025321	Ga0207656_10137654	Ga0207656_101376542	173
638	3300025711	Ga0207696_1041022	Ga0207696_10410222	173
639	3300025893	Ga0207682_10002386	Ga0207682_1000238617	173
640	3300025898	Ga0207692_10163273	Ga0207692_101632733	173
641	3300025898	Ga0207692_10186257	Ga0207692_101862572	173
642	3300025898	Ga0207692_10635491	Ga0207692_106354911	173
643	3300025899	Ga0207642_10004059	Ga0207642_100040594	173
644	3300025899	Ga0207642_10026936	Ga0207642_100269364	173
645	3300025900	Ga0207710_10047115	Ga0207710_100471152	173
646	3300025901	Ga0207688_10002903	Ga0207688_100029032	173
647	3300025904	Ga0207647_10003885	Ga0207647_100038854	173
648	3300025904	Ga0207647_10127059	Ga0207647_101270592	173
649	3300025905	Ga0207685_10000997	Ga0207685_100009974	173
650	3300025906	Ga0207699_10076935	Ga0207699_100769354	173
651	3300025906	Ga0207699_10145008	Ga0207699_101450082	173
652	3300025906	Ga0207699_10559844	Ga0207699_105598441	173
653	3300025907	Ga0207645_10000633	Ga0207645_100006337	173
654	3300025908	Ga0207643_10001566	Ga0207643_100015664	173
655	3300025909	Ga0207705_10161671	Ga0207705_101616712	173
656	3300025910	Ga0207684_10002829	Ga0207684_100028298	173
657	3300025910	Ga0207684_10004560	Ga0207684_100045602	173
658	3300025910	Ga0207684_10032580	Ga0207684_100325808	173
659	3300025910	Ga0207684_10312572	Ga0207684_103125722	173
660	3300025910	Ga0207684_10595082	Ga0207684_105950822	173
661	3300025911	Ga0207654_10095000	Ga0207654_100950002	173
662	3300025911	Ga0207654_10162856	Ga0207654_101628562	173
663	3300025912	Ga0207707_10005075	Ga0207707_100050754	173
664	3300025912	Ga0207707_10061041	Ga0207707_100610413	173
665	3300025912	Ga0207707_10129092	Ga0207707_101290922	173
666	3300025912	Ga0207707_10723253	Ga0207707_107232532	173
667	3300025913	Ga0207695_10024406	Ga0207695_100244069	173
668	3300025914	Ga0207671_10561469	Ga0207671_105614692	173
669	3300025915	Ga0207693_10092059	Ga0207693_100920593	173
670	3300025915	Ga0207693_10312743	Ga0207693_103127432	173
671	3300025915	Ga0207693_10344654	Ga0207693_103446541	173
672	3300025916	Ga0207663_10041328	Ga0207663_100413284	173
673	3300025916	Ga0207663_10234834	Ga0207663_102348341	173
674	3300025916	Ga0207663_10418406	Ga0207663_104184062	173
675	3300025916	Ga0207663_10667772	Ga0207663_106677721	173
676	3300025916	Ga0207663_10825163	Ga0207663_108251632	173
677	3300025917	Ga0207660_10027520	Ga0207660_100275203	173
678	3300025917	Ga0207660_10045886	Ga0207660_100458863	173
679	3300025917	Ga0207660_10219028	Ga0207660_102190282	173
680	3300025918	Ga0207662_10002944	Ga0207662_100029449	173
681	3300025919	Ga0207657_10001396	Ga0207657_100013968	173
682	3300025919	Ga0207657_10007204	Ga0207657_100072048	173
683	3300025920	Ga0207649_10000654	Ga0207649_1000065416	173
684	3300025920	Ga0207649_10026589	Ga0207649_100265895	173
685	3300025921	Ga0207652_10033139	Ga0207652_100331393	173
686	3300025921	Ga0207652_10039350	Ga0207652_100393502	173
687	3300025921	Ga0207652_10161023	Ga0207652_101610233	173
688	3300025921	Ga0207652_10164293	Ga0207652_101642932	173
689	3300025922	Ga0207646_10001665	Ga0207646_100016658	173
690	3300025922	Ga0207646_10034371	Ga0207646_100343718	173
691	3300025922	Ga0207646_10077846	Ga0207646_100778462	173
692	3300025922	Ga0207646_10168208	Ga0207646_101682082	173
693	3300025922	Ga0207646_10197615	Ga0207646_101976153	173
694	3300025922	Ga0207646_10235765	Ga0207646_102357652	173
695	3300025922	Ga0207646_10651264	Ga0207646_106512642	173
696	3300025922	Ga0207646_10868639	Ga0207646_108686391	173
697	3300025923	Ga0207681_10023090	Ga0207681_100230902	173
698	3300025923	Ga0207681_10026409	Ga0207681_100264091	173
699	3300025924	Ga0207694_10011633	Ga0207694_100116333	173
700	3300025925	Ga0207650_10000440	Ga0207650_100004408	173
701	3300025925	Ga0207650_10012026	Ga0207650_100120262	173
702	3300025925	Ga0207650_10161094	Ga0207650_101610942	173
703	3300025925	Ga0207650_10215666	Ga0207650_102156661	173
704	3300025926	Ga0207659_10035349	Ga0207659_100353493	173
705	3300025926	Ga0207659_10334152	Ga0207659_103341522	173
706	3300025927	Ga0207687_10096174	Ga0207687_100961741	173
707	3300025927	Ga0207687_10589967	Ga0207687_105899672	173
708	3300025928	Ga0207700_10055198	Ga0207700_100551983	173
709	3300025928	Ga0207700_10121855	Ga0207700_101218551	173
710	3300025928	Ga0207700_10161959	Ga0207700_101619591	173
711	3300025928	Ga0207700_10665638	Ga0207700_106656382	173
712	3300025929	Ga0207664_10074984	Ga0207664_100749843	173
713	3300025929	Ga0207664_10384177	Ga0207664_103841772	173
714	3300025929	Ga0207664_10445585	Ga0207664_104455851	173
715	3300025929	Ga0207664_10790201	Ga0207664_107902011	173
716	3300025931	Ga0207644_10959262	Ga0207644_109592621	173
717	3300025932	Ga0207690_10015582	Ga0207690_100155823	173
718	3300025932	Ga0207690_10287700	Ga0207690_102877002	173
719	3300025933	Ga0207706_10000595	Ga0207706_1000059529	173
720	3300025933	Ga0207706_10495057	Ga0207706_104950571	173
721	3300025935	Ga0207709_10249276	Ga0207709_102492762	173
722	3300025936	Ga0207670_10003677	Ga0207670_100036774	173
723	3300025936	Ga0207670_10073135	Ga0207670_100731353	173
724	3300025937	Ga0207669_10012017	Ga0207669_100120178	173
725	3300025938	Ga0207704_10013468	Ga0207704_100134688	173
726	3300025938	Ga0207704_10027024	Ga0207704_100270242	173
727	3300025938	Ga0207704_10366929	Ga0207704_103669292	173
728	3300025939	Ga0207665_10001401	Ga0207665_100014019	173
729	3300025939	Ga0207665_10167575	Ga0207665_101675752	173
730	3300025939	Ga0207665_10174814	Ga0207665_101748141	173
731	3300025939	Ga0207665_10247473	Ga0207665_102474732	173
732	3300025939	Ga0207665_10867855	Ga0207665_108678551	173
733	3300025940	Ga0207691_10000404	Ga0207691_1000040435	173
734	3300025941	Ga0207711_10252940	Ga0207711_102529401	173
735	3300025941	Ga0207711_10292012	Ga0207711_102920122	173
736	3300025942	Ga0207689_10018281	Ga0207689_100182817	173
737	3300025942	Ga0207689_10035003	Ga0207689_100350038	173
738	3300025944	Ga0207661_10000196	Ga0207661_1000019629	173
739	3300025944	Ga0207661_10028024	Ga0207661_100280247	173
740	3300025944	Ga0207661_10041485	Ga0207661_100414852	173
741	3300025944	Ga0207661_10146636	Ga0207661_101466362	173
742	3300025945	Ga0207679_10000567	Ga0207679_100005678	173
743	3300025945	Ga0207679_10009388	Ga0207679_100093883	173
744	3300025945	Ga0207679_10199021	Ga0207679_101990214	173
745	3300025945	Ga0207679_10333863	Ga0207679_103338632	173
746	3300025949	Ga0207667_10003999	Ga0207667_100039997	173
747	3300025949	Ga0207667_10024863	Ga0207667_1002486311	173
748	3300025949	Ga0207667_10117868	Ga0207667_101178685	173
749	3300025949	Ga0207667_10383176	Ga0207667_103831762	173
750	3300025949	Ga0207667_10477970	Ga0207667_104779701	173
751	3300025949	Ga0207667_10662543	Ga0207667_106625432	173
752	3300025960	Ga0207651_10569912	Ga0207651_105699121	173
753	3300025961	Ga0207712_10034322	Ga0207712_100343222	173
754	3300025961	Ga0207712_10502962	Ga0207712_105029622	173
755	3300025981	Ga0207640_10015301	Ga0207640_100153013	173
756	3300025981	Ga0207640_10027709	Ga0207640_100277097	173
757	3300025981	Ga0207640_10080394	Ga0207640_100803943	173
758	3300025986	Ga0207658_10006283	Ga0207658_100062837	173
759	3300025986	Ga0207658_10767280	Ga0207658_107672801	173
760	3300026023	Ga0207677_10001140	Ga0207677_100011403	173
761	3300026023	Ga0207677_10128719	Ga0207677_101287193	173
762	3300026035	Ga0207703_10006284	Ga0207703_1000628410	173
763	3300026035	Ga0207703_10121236	Ga0207703_101212363	173
764	3300026035	Ga0207703_10391198	Ga0207703_103911982	173
765	3300026041	Ga0207639_10026412	Ga0207639_100264124	173
766	3300026041	Ga0207639_10062615	Ga0207639_100626154	173
767	3300026067	Ga0207678_10006654	Ga0207678_100066544	173
768	3300026078	Ga0207702_10001220	Ga0207702_1000122020	173
769	3300026078	Ga0207702_10002504	Ga0207702_1000250412	173
770	3300026078	Ga0207702_10058548	Ga0207702_100585483	173
771	3300026078	Ga0207702_10555769	Ga0207702_105557691	173
772	3300026088	Ga0207641_10000127	Ga0207641_100001277	173
773	3300026088	Ga0207641_10248156	Ga0207641_102481562	173
774	3300026088	Ga0207641_10359165	Ga0207641_103591651	173
775	3300026089	Ga0207648_10005227	Ga0207648_100052277	173
776	3300026089	Ga0207648_10044873	Ga0207648_100448733	173
777	3300026089	Ga0207648_10136552	Ga0207648_101365522	173
778	3300026089	Ga0207648_10164570	Ga0207648_101645703	173
779	3300026089	Ga0207648_10283313	Ga0207648_102833132	173
780	3300026095	Ga0207676_10000746	Ga0207676_100007464	173
781	3300026095	Ga0207676_10005954	Ga0207676_100059544	173
782	3300026095	Ga0207676_11177210	Ga0207676_111772101	173
783	3300026116	Ga0207674_10001125	Ga0207674_1000112525	173
784	3300026116	Ga0207674_10001827	Ga0207674_1000182717	173
785	3300026116	Ga0207674_10228609	Ga0207674_102286093	173
786	3300026116	Ga0207674_11020522	Ga0207674_110205221	173
787	3300026116	Ga0207674_11405496	Ga0207674_114054961	173
788	3300026118	Ga0207675_100008945	Ga0207675_1000089453	173
789	3300026121	Ga0207683_10002052	Ga0207683_100020529	173
790	3300026142	Ga0207698_10003475	Ga0207698_100034754	173
791	3300026142	Ga0207698_10076537	Ga0207698_100765372	173
792	3300026142	Ga0207698_10236230	Ga0207698_102362303	173
793	3300028379	Ga0268266_10015266	Ga0268266_100152663	173
794	3300028379	Ga0268266_10237614	Ga0268266_102376142	173
795	3300028380	Ga0268265_10003583	Ga0268265_100035834	173
796	3300028380	Ga0268265_10035479	Ga0268265_100354792	173
797	3300028380	Ga0268265_11354444	Ga0268265_113544441	173
798	3300028381	Ga0268264_10280493	Ga0268264_102804932	173
799	3300028381	Ga0268264_10342386	Ga0268264_103423861	173
800	3300031090	Ga0265760_10010411	Ga0265760_100104112	173
801	3300031090	Ga0265760_10083129	Ga0265760_100831292	173
802	3300031235	Ga0265330_10104264	Ga0265330_101042642	173
803	3300031241	Ga0265325_10041652	Ga0265325_100416522	173
804	3300031247	Ga0265340_10055043	Ga0265340_100550432	173
805	3300031247	Ga0265340_10107850	Ga0265340_101078502	173
806	3300031247	Ga0265340_10230034	Ga0265340_102300342	173
807	3300031249	Ga0265339_10034999	Ga0265339_100349992	173
808	3300031249	Ga0265339_10118673	Ga0265339_101186732	173
809	3300031249	Ga0265339_10332870	Ga0265339_103328701	173
810	3300031250	Ga0265331_10077990	Ga0265331_100779901	173
811	3300031344	Ga0265316_10015143	Ga0265316_100151438	173
812	3300031344	Ga0265316_10026470	Ga0265316_100264703	173
813	3300031548	Ga0307408_100050299	Ga0307408_1000502992	173
814	3300031595	Ga0265313_10006242	Ga0265313_100062428	173
815	3300031711	Ga0265314_10005730	Ga0265314_1000573012	173
816	3300031711	Ga0265314_10101998	Ga0265314_101019982	173
817	3300031731	Ga0307405_11292208	Ga0307405_112922081	173
818	3300031911	Ga0307412_11031933	Ga0307412_110319332	173
819	3300032002	Ga0307416_100631449	Ga0307416_1006314492	173
820	3300035085	Ga0373929_0150756	Ga0373929_0150756_13_561	173
821	3300035086	Ga0373934_0023209	Ga0373934_0023209_623_1171	173
822	3300035112	Ga0373932_0068578	Ga0373932_0068578_245_778	173
823	3300035113	Ga0373936_0005614	Ga0373936_0005614_314_865	173
824	3300035113	Ga0373936_0107463	Ga0373936_0107463_39_590	173
825	3300035118	Ga0373954_0037048	Ga0373954_0037048_793_1341	173
826	3300035121	Ga0373960_0022439	Ga0373960_0022439_1093_1641	173
827	3300035170	Ga0373943_0429809	Ga0373943_0429809_108_641	173
828	3300035691	Ga0373931_0050692	Ga0373931_0050692_643_1191	173
829	3300035691	Ga0373931_0088778	Ga0373931_0088778_805_1338	173
830	3300035691	Ga0373931_0264833	Ga0373931_0264833_89_622	173
831	3300035692	Ga0373935_0346171	Ga0373935_0346171_73_600	173
832	3300035695	Ga0373927_0189655	Ga0373927_0189655_353_901	173
833	3300035695	Ga0373927_0667655	Ga0373927_0667655_47_598	173
834	3300036401	Ga0373937_0036128	Ga0373937_0036128_782_1330	173
835	3300036401	Ga0373937_0637115	Ga0373937_0637115_86_634	173
836	3300037068	Ga0373925_0004879	Ga0373925_0004879_4866_5417	173
837	3300037068	Ga0373925_0209857	Ga0373925_0209857_875_1426	173
838	3300037853	Ga0436364_0421540	Ga0436364_0421540_32_559	173
839	3300038443	Ga0395901_1053981	Ga0395901_1053981_238_759	173
840	3300039437	Ga0436365_0725137	Ga0436365_0725137_607_1155	173
841	3300039437	Ga0436365_0952695	Ga0436365_0952695_306_854	173
842	3300039438	Ga0436360_1281904	Ga0436360_1281904_18_605	173
843	3300039447	Ga0436361_1007716	Ga0436361_1007716_118_750	173
844	3300039450	Ga0436363_0765179	Ga0436363_0765179_707_1240	173
845	3300039450	Ga0436363_1448379	Ga0436363_1448379_155_718	173
846	3300039453	Ga0436362_0706503	Ga0436362_0706503_3994_4542	173
847	3300039453	Ga0436362_1063671	Ga0436362_1063671_395_958	173
848	3300041406	Ga0439439_0008101	Ga0439439_0008101_1785_2306	173
849	3300041406	Ga0439439_0027813	Ga0439439_0027813_250_786	173
850	3300041999	Ga0439433_0047291	Ga0439433_0047291_474_995	173
851	3300042156	Ga0439446_0061788	Ga0439446_0061788_134_670	173
852	3300044673	Ga0453683_0451691	Ga0453683_0451691_288_821	173
853	3300044684	Ga0466966_0217215	Ga0466966_0217215_158_706	173
854	3300044694	Ga0466963_0483849	Ga0466963_0483849_89_637	173
855	3300044712	Ga0453684_0441443	Ga0453684_0441443_636_1163	173
856	3300045051	Ga0451576_0274702	Ga0451576_0274702_486_1034	173
857	3300045976	Ga0466967_0047934	Ga0466967_0047934_2560_3108	173
858	3300045976	Ga0466967_0193442	Ga0466967_0193442_934_1482	173
859	3300045976	Ga0466967_0493370	Ga0466967_0493370_440_1027	173
860	3300046455	Ga0495603_0178500	Ga0495603_0178500_621_1154	173
861	3300046472	Ga0495580_0004582	Ga0495580_0004582_5788_6321	173
862	3300046472	Ga0495580_0022519	Ga0495580_0022519_1073_1621	173
863	3300046472	Ga0495580_0046829	Ga0495580_0046829_1308_1841	173
864	3300046472	Ga0495580_0084166	Ga0495580_0084166_597_1142	173
865	3300046472	Ga0495580_0164716	Ga0495580_0164716_772_1320	173
866	3300046472	Ga0495580_0182268	Ga0495580_0182268_375_908	173
867	3300046472	Ga0495580_0225872	Ga0495580_0225872_465_1013	173
868	3300046664	Ga0495659_0212533	Ga0495659_0212533_108_641	173
869	3300046679	Ga0495623_0116982	Ga0495623_0116982_707_1255	173
870	3300046683	Ga0495658_0404813	Ga0495658_0404813_50_598	173
871	3300048903	Ga0496100_0344021	Ga0496100_0344021_363_911	173
872	3300048904	Ga0496101_0166866	Ga0496101_0166866_555_1103	173
873	3300048904	Ga0496101_0223547	Ga0496101_0223547_671_1231	173
874	3300048905	Ga0496102_0020491	Ga0496102_0020491_3932_4465	173
875	3300048905	Ga0496102_0250388	Ga0496102_0250388_779_1339	173
876	3300048905	Ga0496102_0434357	Ga0496102_0434357_489_1037	173
877	3300048906	Ga0496103_0016238	Ga0496103_0016238_1284_1817	173
878	3300048906	Ga0496103_0016613	Ga0496103_0016613_2729_3277	173
879	3300048907	Ga0496104_0046710	Ga0496104_0046710_1791_2339	173
880	3300048907	Ga0496104_0358197	Ga0496104_0358197_544_1089	173
881	3300048907	Ga0496104_0467680	Ga0496104_0467680_462_995	173
882	3300048908	Ga0496105_0062509	Ga0496105_0062509_22_570	173
883	3300048909	Ga0496106_0046093	Ga0496106_0046093_261_794	173
884	3300048911	Ga0496108_0000122	Ga0496108_0000122_73806_74366	173
885	3300048911	Ga0496108_0050181	Ga0496108_0050181_162_710	173
886	3300048911	Ga0496108_0137349	Ga0496108_0137349_37_570	173
887	3300048912	Ga0496109_0000141	Ga0496109_0000141_2787_3347	173
888	3300048912	Ga0496109_0596273	Ga0496109_0596273_320_898	173
889	3300048912	Ga0496109_0863482	Ga0496109_0863482_80_628	173
890	3300048912	Ga0496109_1312833	Ga0496109_1312833_53_601	173
891	3300048913	Ga0496110_0018415	Ga0496110_0018415_3506_4066	173
892	3300048914	Ga0496111_0001139	Ga0496111_0001139_1276_1836	173
893	3300048914	Ga0496111_0167432	Ga0496111_0167432_204_752	173
894	3300048915	Ga0496112_0004753	Ga0496112_0004753_2786_3346	173
895	3300048915	Ga0496112_0006950	Ga0496112_0006950_2775_3323	173
896	3300048915	Ga0496112_0021716	Ga0496112_0021716_3357_3902	173
897	3300048915	Ga0496112_0236835	Ga0496112_0236835_1021_1599	173
898	3300048916	Ga0496113_0000253	Ga0496113_0000253_24387_24947	173
899	3300048916	Ga0496113_0006814	Ga0496113_0006814_594_1142	173
900	3300048918	Ga0496115_0282745	Ga0496115_0282745_448_981	173
901	3300049583	Ga0501067_0111671	Ga0501067_0111671_769_1317	173
902	3300049744	Ga0501083_0153479	Ga0501083_0153479_16_549	173
903	3300049744	Ga0501083_0232962	Ga0501083_0232962_61_615	173
904	3300049744	Ga0501083_0512236	Ga0501083_0512236_188_721	173
905	3300050507	nmdc:mga05p37_157963_c1	nmdc:mga05p37_157963_c1_571_1098	173
906	3300050507	nmdc:mga05p37_757128_c1	nmdc:mga05p37_757128_c1_382_903	173
907	3300050512	nmdc:mga0n895_2900_c1	nmdc:mga0n895_2900_c1_11828_12361	173
908	3300050513	nmdc:mga0rr50_11339_c1	nmdc:mga0rr50_11339_c1_469_996	173
909	3300050514	nmdc:mga08x19_122684_c1	nmdc:mga08x19_122684_c1_471_1022	173
910	3300050515	nmdc:mga0a205_539802_c1	nmdc:mga0a205_539802_c1_383_910	173
911	3300050515	nmdc:mga0a205_58905_c2	nmdc:mga0a205_58905_c2_1382_1915	173
912	3300054114	Ga0501084_0015029	Ga0501084_0015029_1017_1571	173
913	3300054114	Ga0501084_1127218	Ga0501084_1127218_86_619	173
914	3300059490	Ga0587066_001427	Ga0587066_001427_1747_2295	173
915	3300059492	Ga0587073_0031495	Ga0587073_0031495_267_815	173
916	3300059504	Ga0587082_050022	Ga0587082_050022_175_753	173
917	3300059644	Ga0587075_008264	Ga0587075_008264_42_620	173
918	3300060353	Ga0501082_0125936	Ga0501082_0125936_676_1230	173
919	3300060353	Ga0501082_0812788	Ga0501082_0812788_176_703	173
920	2124908026	MRS1a_Contig_3184	MRS1a_00015830	174
921	2162886007	SwRhRL2b_contig_1471343	SwRhRL2b_0399.00003830	174
922	2162886007	SwRhRL2b_contig_3202780	SwRhRL2b_0104.00001490	174
923	2162886007	SwRhRL2b_contig_331316	SwRhRL2b_0841.00004350	174
924	3300000532	CNAas_1001813	CNAas_10018133	174
925	3300002074	JGI24748J21848_1000014	JGI24748J21848_1000014116	174
926	3300002239	JGI24034J26672_10000012	JGI24034J26672_100000128	174
927	3300002244	JGI24742J22300_10026635	JGI24742J22300_100266352	174
928	3300002459	JGI24751J29686_10000074	JGI24751J29686_100000748	174
929	3300003203	JGI25406J46586_10014740	JGI25406J46586_100147403	174
930	3300005288	Ga0065714_10064450	Ga0065714_1006445056	174
931	3300005289	Ga0065704_10002971	Ga0065704_100029712	174
932	3300005289	Ga0065704_10097529	Ga0065704_100975294	174
933	3300005290	Ga0065712_10001740	Ga0065712_100017409	174
934	3300005290	Ga0065712_10004552	Ga0065712_100045526	174
935	3300005290	Ga0065712_10015500	Ga0065712_100155004	174
936	3300005290	Ga0065712_10018916	Ga0065712_100189163	174
937	3300005290	Ga0065712_10022326	Ga0065712_100223261	174
938	3300005290	Ga0065712_10039581	Ga0065712_100395811	174
939	3300005290	Ga0065712_10072502	Ga0065712_100725022	174
940	3300005290	Ga0065712_10280400	Ga0065712_102804001	174
941	3300005293	Ga0065715_10005007	Ga0065715_100050073	174
942	3300005293	Ga0065715_10094215	Ga0065715_100942153	174
943	3300005293	Ga0065715_10095075	Ga0065715_100950757	174
944	3300005293	Ga0065715_10097309	Ga0065715_100973097	174
945	3300005293	Ga0065715_10170832	Ga0065715_101708322	174
946	3300005293	Ga0065715_10195388	Ga0065715_101953882	174
947	3300005293	Ga0065715_10247294	Ga0065715_102472942	174
948	3300005293	Ga0065715_10261085	Ga0065715_102610852	174
949	3300005293	Ga0065715_10296380	Ga0065715_102963802	174
950	3300005293	Ga0065715_10309029	Ga0065715_103090292	174
951	3300005293	Ga0065715_10481798	Ga0065715_104817981	174
952	3300005293	Ga0065715_10483441	Ga0065715_104834411	174
953	3300005293	Ga0065715_10600629	Ga0065715_106006291	174
954	3300005293	Ga0065715_10652001	Ga0065715_106520011	174
955	3300005295	Ga0065707_10005254	Ga0065707_100052543	174
956	3300005295	Ga0065707_10008773	Ga0065707_100087733	174
957	3300005295	Ga0065707_10526176	Ga0065707_105261761	174
958	3300005295	Ga0065707_10569210	Ga0065707_105692102	174
959	3300005328	Ga0070676_10233544	Ga0070676_102335441	174
960	3300005328	Ga0070676_10302461	Ga0070676_103024612	174
961	3300005328	Ga0070676_10303708	Ga0070676_103037082	174
962	3300005329	Ga0070683_101030726	Ga0070683_1010307261	174
963	3300005330	Ga0070690_100004097	Ga0070690_1000040978	174
964	3300005330	Ga0070690_100020351	Ga0070690_1000203511	174
965	3300005330	Ga0070690_100172963	Ga0070690_1001729632	174
966	3300005330	Ga0070690_100596306	Ga0070690_1005963061	174
967	3300005331	Ga0070670_100013886	Ga0070670_1000138868	174
968	3300005331	Ga0070670_100039282	Ga0070670_1000392823	174
969	3300005331	Ga0070670_100228883	Ga0070670_1002288832	174
970	3300005331	Ga0070670_100240950	Ga0070670_1002409502	174
971	3300005331	Ga0070670_100292895	Ga0070670_1002928952	174
972	3300005331	Ga0070670_100558767	Ga0070670_1005587672	174
973	3300005333	Ga0070677_10453567	Ga0070677_104535671	174
974	3300005334	Ga0068869_100010725	Ga0068869_1000107253	174
975	3300005334	Ga0068869_100050225	Ga0068869_1000502252	174
976	3300005334	Ga0068869_100076695	Ga0068869_1000766952	174
977	3300005334	Ga0068869_100161670	Ga0068869_1001616702	174
978	3300005334	Ga0068869_100162748	Ga0068869_1001627484	174
979	3300005334	Ga0068869_100198039	Ga0068869_1001980392	174
980	3300005334	Ga0068869_100346184	Ga0068869_1003461842	174
981	3300005334	Ga0068869_100381261	Ga0068869_1003812612	174
982	3300005334	Ga0068869_100492108	Ga0068869_1004921082	174
983	3300005334	Ga0068869_100529047	Ga0068869_1005290471	174
984	3300005334	Ga0068869_100570592	Ga0068869_1005705922	174
985	3300005334	Ga0068869_100782407	Ga0068869_1007824071	174
986	3300005335	Ga0070666_10018717	Ga0070666_100187173	174
987	3300005335	Ga0070666_10075987	Ga0070666_100759874	174
988	3300005335	Ga0070666_10280663	Ga0070666_102806632	174
989	3300005335	Ga0070666_10301954	Ga0070666_103019542	174
990	3300005336	Ga0070680_100114879	Ga0070680_1001148792	174
991	3300005336	Ga0070680_100137262	Ga0070680_1001372622	174
992	3300005336	Ga0070680_100500388	Ga0070680_1005003882	174
993	3300005336	Ga0070680_100788298	Ga0070680_1007882981	174
994	3300005337	Ga0070682_100007986	Ga0070682_1000079861	174
995	3300005337	Ga0070682_100019793	Ga0070682_1000197933	174
996	3300005338	Ga0068868_100115997	Ga0068868_1001159973	174
997	3300005338	Ga0068868_100118747	Ga0068868_1001187473	174
998	3300005338	Ga0068868_100475953	Ga0068868_1004759532	174
999	3300005339	Ga0070660_100011939	Ga0070660_1000119394	174
1000	3300005339	Ga0070660_100177145	Ga0070660_1001771453	174
1001	3300005340	Ga0070689_100020570	Ga0070689_1000205703	174
1002	3300005340	Ga0070689_100038497	Ga0070689_1000384977	174
1003	3300005340	Ga0070689_100057269	Ga0070689_1000572694	174
1004	3300005340	Ga0070689_100156596	Ga0070689_1001565962	174
1005	3300005343	Ga0070687_100002413	Ga0070687_1000024134	174
1006	3300005343	Ga0070687_100045207	Ga0070687_1000452072	174
1007	3300005344	Ga0070661_100033024	Ga0070661_1000330247	174
1008	3300005344	Ga0070661_100697899	Ga0070661_1006978991	174
1009	3300005344	Ga0070661_100833731	Ga0070661_1008337311	174
1010	3300005345	Ga0070692_10007532	Ga0070692_100075323	174
1011	3300005345	Ga0070692_10088217	Ga0070692_100882173	174
1012	3300005345	Ga0070692_10139716	Ga0070692_101397162	174
1013	3300005345	Ga0070692_10183700	Ga0070692_101837001	174
1014	3300005345	Ga0070692_10271914	Ga0070692_102719142	174
1015	3300005345	Ga0070692_10441774	Ga0070692_104417742	174
1016	3300005345	Ga0070692_10516707	Ga0070692_105167072	174
1017	3300005347	Ga0070668_100435187	Ga0070668_1004351872	174
1018	3300005353	Ga0070669_100018533	Ga0070669_1000185337	174
1019	3300005353	Ga0070669_100053168	Ga0070669_1000531681	174
1020	3300005353	Ga0070669_100055779	Ga0070669_1000557794	174
1021	3300005353	Ga0070669_100095460	Ga0070669_1000954602	174
1022	3300005353	Ga0070669_100200086	Ga0070669_1002000862	174
1023	3300005353	Ga0070669_100224956	Ga0070669_1002249562	174
1024	3300005353	Ga0070669_100468616	Ga0070669_1004686162	174
1025	3300005353	Ga0070669_100971602	Ga0070669_1009716021	174
1026	3300005354	Ga0070675_100057665	Ga0070675_1000576652	174
1027	3300005354	Ga0070675_100187501	Ga0070675_1001875013	174
1028	3300005354	Ga0070675_100606768	Ga0070675_1006067682	174
1029	3300005354	Ga0070675_100837164	Ga0070675_1008371641	174
1030	3300005355	Ga0070671_100007852	Ga0070671_1000078526	174
1031	3300005355	Ga0070671_100033071	Ga0070671_1000330713	174
1032	3300005355	Ga0070671_100051494	Ga0070671_1000514943	174
1033	3300005355	Ga0070671_100101509	Ga0070671_1001015093	174
1034	3300005355	Ga0070671_100369320	Ga0070671_1003693201	174
1035	3300005355	Ga0070671_100461707	Ga0070671_1004617072	174
1036	3300005355	Ga0070671_100680769	Ga0070671_1006807691	174
1037	3300005356	Ga0070674_100076800	Ga0070674_1000768002	174
1038	3300005356	Ga0070674_100303700	Ga0070674_1003037002	174
1039	3300005356	Ga0070674_101072296	Ga0070674_1010722961	174
1040	3300005364	Ga0070673_100070911	Ga0070673_1000709113	174
1041	3300005364	Ga0070673_100176116	Ga0070673_1001761162	174
1042	3300005364	Ga0070673_100206610	Ga0070673_1002066102	174
1043	3300005364	Ga0070673_100264116	Ga0070673_1002641161	174
1044	3300005364	Ga0070673_100716303	Ga0070673_1007163031	174
1045	3300005364	Ga0070673_100765982	Ga0070673_1007659821	174
1046	3300005364	Ga0070673_100797725	Ga0070673_1007977251	174
1047	3300005364	Ga0070673_101260204	Ga0070673_1012602041	174
1048	3300005365	Ga0070688_100003329	Ga0070688_1000033293	174
1049	3300005365	Ga0070688_100173360	Ga0070688_1001733602	174
1050	3300005365	Ga0070688_100295204	Ga0070688_1002952042	174
1051	3300005365	Ga0070688_100886081	Ga0070688_1008860811	174
1052	3300005366	Ga0070659_100107817	Ga0070659_1001078174	174
1053	3300005367	Ga0070667_100026302	Ga0070667_1000263023	174
1054	3300005367	Ga0070667_100036777	Ga0070667_1000367772	174
1055	3300005406	Ga0070703_10000193	Ga0070703_100001939	174
1056	3300005406	Ga0070703_10006781	Ga0070703_100067815	174
1057	3300005406	Ga0070703_10032886	Ga0070703_100328863	174
1058	3300005406	Ga0070703_10044631	Ga0070703_100446312	174
1059	3300005406	Ga0070703_10175455	Ga0070703_101754551	174
1060	3300005434	Ga0070709_10617696	Ga0070709_106176962	174
1061	3300005436	Ga0070713_101298053	Ga0070713_1012980531	174
1062	3300005438	Ga0070701_10013118	Ga0070701_100131184	174
1063	3300005438	Ga0070701_10117539	Ga0070701_101175392	174
1064	3300005438	Ga0070701_10237032	Ga0070701_102370322	174
1065	3300005440	Ga0070705_100000982	Ga0070705_1000009828	174
1066	3300005440	Ga0070705_100062699	Ga0070705_1000626993	174
1067	3300005440	Ga0070705_100083730	Ga0070705_1000837302	174
1068	3300005440	Ga0070705_100195004	Ga0070705_1001950042	174
1069	3300005440	Ga0070705_100314616	Ga0070705_1003146161	174
1070	3300005440	Ga0070705_100329915	Ga0070705_1003299152	174
1071	3300005440	Ga0070705_100453499	Ga0070705_1004534991	174
1072	3300005440	Ga0070705_100550383	Ga0070705_1005503831	174
1073	3300005440	Ga0070705_100595260	Ga0070705_1005952601	174
1074	3300005441	Ga0070700_100005796	Ga0070700_1000057963	174
1075	3300005441	Ga0070700_100010746	Ga0070700_1000107463	174
1076	3300005441	Ga0070700_100022969	Ga0070700_1000229692	174
1077	3300005441	Ga0070700_100041257	Ga0070700_1000412575	174
1078	3300005441	Ga0070700_100148708	Ga0070700_1001487083	174
1079	3300005441	Ga0070700_100213780	Ga0070700_1002137802	174
1080	3300005441	Ga0070700_100226761	Ga0070700_1002267611	174
1081	3300005441	Ga0070700_100236265	Ga0070700_1002362652	174
1082	3300005441	Ga0070700_100743765	Ga0070700_1007437652	174
1083	3300005444	Ga0070694_100015866	Ga0070694_1000158661	174
1084	3300005444	Ga0070694_100021679	Ga0070694_1000216793	174
1085	3300005444	Ga0070694_100025894	Ga0070694_1000258942	174
1086	3300005444	Ga0070694_100032476	Ga0070694_1000324767	174
1087	3300005444	Ga0070694_100055794	Ga0070694_1000557941	174
1088	3300005444	Ga0070694_100079786	Ga0070694_1000797863	174
1089	3300005444	Ga0070694_100082443	Ga0070694_1000824432	174
1090	3300005444	Ga0070694_100090985	Ga0070694_1000909852	174
1091	3300005444	Ga0070694_100122794	Ga0070694_1001227942	174
1092	3300005444	Ga0070694_100226597	Ga0070694_1002265972	174
1093	3300005444	Ga0070694_100591527	Ga0070694_1005915271	174
1094	3300005444	Ga0070694_100598336	Ga0070694_1005983362	174
1095	3300005444	Ga0070694_100947673	Ga0070694_1009476731	174
1096	3300005445	Ga0070708_100001743	Ga0070708_1000017437	174
1097	3300005445	Ga0070708_100050740	Ga0070708_1000507403	174
1098	3300005445	Ga0070708_100166524	Ga0070708_1001665242	174
1099	3300005445	Ga0070708_100280955	Ga0070708_1002809552	174
1100	3300005445	Ga0070708_100311833	Ga0070708_1003118331	174
1101	3300005445	Ga0070708_100345933	Ga0070708_1003459331	174
1102	3300005445	Ga0070708_100526433	Ga0070708_1005264332	174
1103	3300005445	Ga0070708_100710304	Ga0070708_1007103042	174
1104	3300005445	Ga0070708_100748259	Ga0070708_1007482591	174
1105	3300005445	Ga0070708_101342541	Ga0070708_1013425411	174
1106	3300005456	Ga0070678_100036409	Ga0070678_1000364092	174
1107	3300005457	Ga0070662_100029069	Ga0070662_1000290694	174
1108	3300005457	Ga0070662_100084929	Ga0070662_1000849293	174
1109	3300005457	Ga0070662_100111787	Ga0070662_1001117872	174
1110	3300005457	Ga0070662_100608439	Ga0070662_1006084392	174
1111	3300005458	Ga0070681_10000095	Ga0070681_100000957	174
1112	3300005458	Ga0070681_10006380	Ga0070681_100063803	174
1113	3300005458	Ga0070681_10027357	Ga0070681_100273573	174
1114	3300005458	Ga0070681_10638121	Ga0070681_106381212	174
1115	3300005459	Ga0068867_100027874	Ga0068867_1000278743	174
1116	3300005459	Ga0068867_100139144	Ga0068867_1001391442	174
1117	3300005459	Ga0068867_100175345	Ga0068867_1001753453	174
1118	3300005459	Ga0068867_100334414	Ga0068867_1003344142	174
1119	3300005459	Ga0068867_100428047	Ga0068867_1004280472	174
1120	3300005459	Ga0068867_100640120	Ga0068867_1006401202	174
1121	3300005459	Ga0068867_100683829	Ga0068867_1006838292	174
1122	3300005459	Ga0068867_100925933	Ga0068867_1009259331	174
1123	3300005466	Ga0070685_10061109	Ga0070685_100611092	174
1124	3300005466	Ga0070685_10470986	Ga0070685_104709862	174
1125	3300005467	Ga0070706_100000920	Ga0070706_10000092022	174
1126	3300005467	Ga0070706_100004637	Ga0070706_1000046375	174
1127	3300005467	Ga0070706_100005925	Ga0070706_1000059258	174
1128	3300005467	Ga0070706_100020710	Ga0070706_1000207103	174
1129	3300005467	Ga0070706_100039495	Ga0070706_1000394951	174
1130	3300005467	Ga0070706_100131054	Ga0070706_1001310542	174
1131	3300005467	Ga0070706_100131556	Ga0070706_1001315562	174
1132	3300005467	Ga0070706_100150458	Ga0070706_1001504583	174
1133	3300005467	Ga0070706_100152848	Ga0070706_1001528483	174
1134	3300005467	Ga0070706_100492380	Ga0070706_1004923802	174
1135	3300005467	Ga0070706_100683703	Ga0070706_1006837032	174
1136	3300005467	Ga0070706_101133857	Ga0070706_1011338571	174
1137	3300005468	Ga0070707_100003296	Ga0070707_1000032969	174
1138	3300005468	Ga0070707_100009892	Ga0070707_1000098924	174
1139	3300005468	Ga0070707_100014408	Ga0070707_1000144085	174
1140	3300005468	Ga0070707_100083781	Ga0070707_1000837812	174
1141	3300005468	Ga0070707_100108612	Ga0070707_1001086122	174
1142	3300005468	Ga0070707_100137855	Ga0070707_1001378552	174
1143	3300005468	Ga0070707_100208109	Ga0070707_1002081093	174
1144	3300005468	Ga0070707_100320014	Ga0070707_1003200141	174
1145	3300005468	Ga0070707_100404667	Ga0070707_1004046672	174
1146	3300005468	Ga0070707_100535548	Ga0070707_1005355482	174
1147	3300005468	Ga0070707_100584573	Ga0070707_1005845732	174
1148	3300005468	Ga0070707_100771435	Ga0070707_1007714351	174
1149	3300005471	Ga0070698_100000374	Ga0070698_1000003748	174
1150	3300005471	Ga0070698_100005496	Ga0070698_1000054968	174
1151	3300005471	Ga0070698_100005600	Ga0070698_1000056007	174
1152	3300005471	Ga0070698_100016601	Ga0070698_1000166017	174
1153	3300005471	Ga0070698_100034875	Ga0070698_1000348753	174
1154	3300005471	Ga0070698_100035264	Ga0070698_1000352646	174
1155	3300005471	Ga0070698_100035463	Ga0070698_1000354633	174
1156	3300005471	Ga0070698_100066401	Ga0070698_1000664012	174
1157	3300005471	Ga0070698_100074362	Ga0070698_1000743621	174
1158	3300005518	Ga0070699_100019115	Ga0070699_1000191157	174
1159	3300005518	Ga0070699_100024460	Ga0070699_1000244603	174
1160	3300005518	Ga0070699_100026662	Ga0070699_1000266628	174
1161	3300005518	Ga0070699_100038208	Ga0070699_1000382087	174
1162	3300005518	Ga0070699_100059963	Ga0070699_1000599631	174
1163	3300005518	Ga0070699_100062651	Ga0070699_1000626513	174
1164	3300005518	Ga0070699_100195455	Ga0070699_1001954553	174
1165	3300005518	Ga0070699_100269386	Ga0070699_1002693862	174
1166	3300005518	Ga0070699_100826691	Ga0070699_1008266911	174
1167	3300005518	Ga0070699_100872000	Ga0070699_1008720002	174
1168	3300005518	Ga0070699_100922045	Ga0070699_1009220452	174
1169	3300005530	Ga0070679_100000661	Ga0070679_10000066120	174
1170	3300005530	Ga0070679_100303607	Ga0070679_1003036073	174
1171	3300005536	Ga0070697_100000761	Ga0070697_10000076117	174
1172	3300005536	Ga0070697_100002791	Ga0070697_1000027914	174
1173	3300005536	Ga0070697_100012955	Ga0070697_1000129553	174
1174	3300005536	Ga0070697_100419287	Ga0070697_1004192872	174
1175	3300005536	Ga0070697_101497093	Ga0070697_1014970931	174
1176	3300005539	Ga0068853_100101661	Ga0068853_1001016613	174
1177	3300005539	Ga0068853_100181150	Ga0068853_1001811502	174
1178	3300005539	Ga0068853_100231044	Ga0068853_1002310442	174
1179	3300005539	Ga0068853_101556095	Ga0068853_1015560951	174
1180	3300005543	Ga0070672_100026540	Ga0070672_1000265405	174
1181	3300005543	Ga0070672_100466908	Ga0070672_1004669082	174
1182	3300005544	Ga0070686_100005785	Ga0070686_1000057852	174
1183	3300005544	Ga0070686_100013995	Ga0070686_1000139958	174
1184	3300005544	Ga0070686_100046653	Ga0070686_1000466533	174
1185	3300005544	Ga0070686_100467594	Ga0070686_1004675942	174
1186	3300005544	Ga0070686_100614166	Ga0070686_1006141661	174
1187	3300005544	Ga0070686_100631658	Ga0070686_1006316582	174
1188	3300005545	Ga0070695_100033900	Ga0070695_1000339006	174
1189	3300005545	Ga0070695_100076334	Ga0070695_1000763343	174
1190	3300005545	Ga0070695_100083578	Ga0070695_1000835783	174
1191	3300005545	Ga0070695_100170312	Ga0070695_1001703122	174
1192	3300005545	Ga0070695_100239110	Ga0070695_1002391101	174
1193	3300005545	Ga0070695_100241506	Ga0070695_1002415062	174
1194	3300005545	Ga0070695_100247538	Ga0070695_1002475382	174
1195	3300005545	Ga0070695_100573436	Ga0070695_1005734361	174
1196	3300005545	Ga0070695_100927126	Ga0070695_1009271261	174
1197	3300005546	Ga0070696_100047947	Ga0070696_1000479473	174
1198	3300005546	Ga0070696_100053664	Ga0070696_1000536644	174
1199	3300005546	Ga0070696_100133532	Ga0070696_1001335321	174
1200	3300005546	Ga0070696_100182939	Ga0070696_1001829392	174
1201	3300005546	Ga0070696_100332780	Ga0070696_1003327802	174
1202	3300005546	Ga0070696_100594350	Ga0070696_1005943502	174
1203	3300005546	Ga0070696_100955153	Ga0070696_1009551531	174
1204	3300005547	Ga0070693_100003410	Ga0070693_1000034106	174
1205	3300005547	Ga0070693_100021759	Ga0070693_1000217594	174
1206	3300005547	Ga0070693_100077904	Ga0070693_1000779042	174
1207	3300005547	Ga0070693_100093271	Ga0070693_1000932712	174
1208	3300005547	Ga0070693_100117588	Ga0070693_1001175881	174
1209	3300005547	Ga0070693_100164869	Ga0070693_1001648692	174
1210	3300005547	Ga0070693_100228684	Ga0070693_1002286842	174
1211	3300005547	Ga0070693_100286351	Ga0070693_1002863512	174
1212	3300005548	Ga0070665_101107420	Ga0070665_1011074201	174
1213	3300005548	Ga0070665_101552980	Ga0070665_1015529801	174
1214	3300005549	Ga0070704_100013963	Ga0070704_1000139638	174
1215	3300005549	Ga0070704_100018581	Ga0070704_1000185813	174
1216	3300005549	Ga0070704_100034482	Ga0070704_1000344823	174
1217	3300005549	Ga0070704_100078833	Ga0070704_1000788333	174
1218	3300005549	Ga0070704_100347699	Ga0070704_1003476992	174
1219	3300005549	Ga0070704_100379334	Ga0070704_1003793342	174
1220	3300005549	Ga0070704_100541756	Ga0070704_1005417562	174
1221	3300005549	Ga0070704_100573230	Ga0070704_1005732301	174
1222	3300005549	Ga0070704_100799388	Ga0070704_1007993882	174
1223	3300005549	Ga0070704_100879586	Ga0070704_1008795862	174
1224	3300005549	Ga0070704_101134990	Ga0070704_1011349901	174
1225	3300005563	Ga0068855_100261345	Ga0068855_1002613453	174
1226	3300005563	Ga0068855_100323508	Ga0068855_1003235083	174
1227	3300005563	Ga0068855_100552004	Ga0068855_1005520042	174
1228	3300005563	Ga0068855_100912091	Ga0068855_1009120912	174
1229	3300005564	Ga0070664_100003167	Ga0070664_1000031676	174
1230	3300005564	Ga0070664_100525104	Ga0070664_1005251042	174
1231	3300005564	Ga0070664_100557912	Ga0070664_1005579122	174
1232	3300005564	Ga0070664_101131234	Ga0070664_1011312341	174
1233	3300005564	Ga0070664_101150120	Ga0070664_1011501201	174
1234	3300005577	Ga0068857_100256564	Ga0068857_1002565643	174
1235	3300005577	Ga0068857_100363121	Ga0068857_1003631212	174
1236	3300005577	Ga0068857_100475405	Ga0068857_1004754052	174
1237	3300005577	Ga0068857_100499467	Ga0068857_1004994672	174
1238	3300005577	Ga0068857_101223917	Ga0068857_1012239172	174
1239	3300005577	Ga0068857_101307355	Ga0068857_1013073552	174
1240	3300005578	Ga0068854_100020758	Ga0068854_1000207583	174
1241	3300005578	Ga0068854_100169796	Ga0068854_1001697962	174
1242	3300005578	Ga0068854_100467496	Ga0068854_1004674961	174
1243	3300005578	Ga0068854_100876391	Ga0068854_1008763912	174
1244	3300005614	Ga0068856_100121599	Ga0068856_1001215993	174
1245	3300005615	Ga0070702_100015413	Ga0070702_1000154133	174
1246	3300005615	Ga0070702_100036883	Ga0070702_1000368831	174
1247	3300005615	Ga0070702_100039137	Ga0070702_1000391372	174
1248	3300005615	Ga0070702_100446062	Ga0070702_1004460621	174
1249	3300005615	Ga0070702_100483483	Ga0070702_1004834832	174
1250	3300005616	Ga0068852_100087406	Ga0068852_1000874063	174
1251	3300005616	Ga0068852_100451609	Ga0068852_1004516092	174
1252	3300005617	Ga0068859_100056053	Ga0068859_1000560534	174
1253	3300005617	Ga0068859_100067591	Ga0068859_1000675914	174
1254	3300005617	Ga0068859_100122037	Ga0068859_1001220373	174
1255	3300005617	Ga0068859_100129114	Ga0068859_1001291143	174
1256	3300005617	Ga0068859_100156767	Ga0068859_1001567674	174
1257	3300005617	Ga0068859_100237255	Ga0068859_1002372551	174
1258	3300005617	Ga0068859_100240688	Ga0068859_1002406883	174
1259	3300005617	Ga0068859_100296389	Ga0068859_1002963891	174
1260	3300005617	Ga0068859_100505664	Ga0068859_1005056642	174
1261	3300005617	Ga0068859_100574158	Ga0068859_1005741581	174
1262	3300005617	Ga0068859_100607627	Ga0068859_1006076272	174
1263	3300005617	Ga0068859_100628635	Ga0068859_1006286352	174
1264	3300005617	Ga0068859_100648908	Ga0068859_1006489082	174
1265	3300005617	Ga0068859_100701481	Ga0068859_1007014812	174
1266	3300005617	Ga0068859_100802930	Ga0068859_1008029301	174
1267	3300005617	Ga0068859_100823490	Ga0068859_1008234901	174
1268	3300005618	Ga0068864_100021548	Ga0068864_1000215486	174
1269	3300005618	Ga0068864_100037009	Ga0068864_1000370091	174
1270	3300005618	Ga0068864_100049121	Ga0068864_1000491213	174
1271	3300005618	Ga0068864_100051844	Ga0068864_1000518443	174
1272	3300005618	Ga0068864_100051845	Ga0068864_1000518452	174
1273	3300005618	Ga0068864_100056009	Ga0068864_1000560098	174
1274	3300005618	Ga0068864_100063202	Ga0068864_1000632028	174
1275	3300005618	Ga0068864_100155094	Ga0068864_1001550941	174
1276	3300005618	Ga0068864_100167996	Ga0068864_1001679963	174
1277	3300005618	Ga0068864_100450029	Ga0068864_1004500291	174
1278	3300005618	Ga0068864_100636501	Ga0068864_1006365011	174
1279	3300005618	Ga0068864_100663371	Ga0068864_1006633711	174
1280	3300005618	Ga0068864_100864761	Ga0068864_1008647612	174
1281	3300005718	Ga0068866_10012501	Ga0068866_100125012	174
1282	3300005718	Ga0068866_10071399	Ga0068866_100713992	174
1283	3300005718	Ga0068866_10261452	Ga0068866_102614522	174
1284	3300005719	Ga0068861_100048259	Ga0068861_1000482593	174
1285	3300005719	Ga0068861_100048837	Ga0068861_1000488373	174
1286	3300005719	Ga0068861_100096363	Ga0068861_1000963633	174
1287	3300005719	Ga0068861_100175821	Ga0068861_1001758212	174
1288	3300005719	Ga0068861_100212775	Ga0068861_1002127753	174
1289	3300005834	Ga0068851_10036164	Ga0068851_100361642	174
1290	3300005834	Ga0068851_10217424	Ga0068851_102174241	174
1291	3300005834	Ga0068851_10224954	Ga0068851_102249542	174
1292	3300005840	Ga0068870_10009612	Ga0068870_100096128	174
1293	3300005840	Ga0068870_10024974	Ga0068870_100249743	174
1294	3300005840	Ga0068870_10063049	Ga0068870_100630493	174
1295	3300005840	Ga0068870_10122892	Ga0068870_101228922	174
1296	3300005840	Ga0068870_10359188	Ga0068870_103591882	174
1297	3300005841	Ga0068863_100019878	Ga0068863_1000198784	174
1298	3300005841	Ga0068863_100042226	Ga0068863_1000422263	174
1299	3300005841	Ga0068863_100082290	Ga0068863_1000822903	174
1300	3300005841	Ga0068863_100272885	Ga0068863_1002728852	174
1301	3300005841	Ga0068863_100283162	Ga0068863_1002831622	174
1302	3300005841	Ga0068863_100313690	Ga0068863_1003136903	174
1303	3300005841	Ga0068863_100447147	Ga0068863_1004471472	174
1304	3300005841	Ga0068863_100488454	Ga0068863_1004884541	174
1305	3300005841	Ga0068863_100644338	Ga0068863_1006443382	174
1306	3300005841	Ga0068863_101956510	Ga0068863_1019565101	174
1307	3300005842	Ga0068858_100008879	Ga0068858_1000088796	174
1308	3300005842	Ga0068858_100039391	Ga0068858_1000393912	174
1309	3300005842	Ga0068858_100083972	Ga0068858_1000839722	174
1310	3300005842	Ga0068858_100110403	Ga0068858_1001104033	174
1311	3300005842	Ga0068858_100147989	Ga0068858_1001479892	174
1312	3300005842	Ga0068858_100292735	Ga0068858_1002927351	174
1313	3300005842	Ga0068858_100405918	Ga0068858_1004059182	174
1314	3300005842	Ga0068858_100668083	Ga0068858_1006680832	174
1315	3300005842	Ga0068858_101096284	Ga0068858_1010962841	174
1316	3300005843	Ga0068860_100057451	Ga0068860_1000574514	174
1317	3300005843	Ga0068860_100102558	Ga0068860_1001025583	174
1318	3300005843	Ga0068860_100195919	Ga0068860_1001959192	174
1319	3300005843	Ga0068860_100213149	Ga0068860_1002131493	174
1320	3300005843	Ga0068860_100254033	Ga0068860_1002540332	174
1321	3300005843	Ga0068860_100383690	Ga0068860_1003836902	174
1322	3300005843	Ga0068860_100824708	Ga0068860_1008247082	174
1323	3300005843	Ga0068860_100896885	Ga0068860_1008968852	174
1324	3300005843	Ga0068860_101447307	Ga0068860_1014473071	174
1325	3300005843	Ga0068860_102147369	Ga0068860_1021473691	174
1326	3300005844	Ga0068862_100022289	Ga0068862_1000222897	174
1327	3300005844	Ga0068862_100040779	Ga0068862_1000407794	174
1328	3300005844	Ga0068862_100131758	Ga0068862_1001317582	174
1329	3300005844	Ga0068862_100176622	Ga0068862_1001766222	174
1330	3300005844	Ga0068862_100247456	Ga0068862_1002474562	174
1331	3300005844	Ga0068862_101364053	Ga0068862_1013640532	174
1332	3300005937	Ga0081455_10148747	Ga0081455_101487472	174
1333	3300005985	Ga0081539_10000976	Ga0081539_100009768	174
1334	3300005985	Ga0081539_10002683	Ga0081539_100026832	174
1335	3300005985	Ga0081539_10003361	Ga0081539_100033618	174
1336	3300005985	Ga0081539_10005422	Ga0081539_100054228	174
1337	3300005985	Ga0081539_10064018	Ga0081539_100640183	174
1338	3300005985	Ga0081539_10081902	Ga0081539_100819023	174
1339	3300005985	Ga0081539_10184922	Ga0081539_101849222	174
1340	3300006058	Ga0075432_10109492	Ga0075432_101094922	174
1341	3300006163	Ga0070715_10000039	Ga0070715_1000003958	174
1342	3300006173	Ga0070716_100000014	Ga0070716_1000000148	174
1343	3300006173	Ga0070716_100084084	Ga0070716_1000840843	174
1344	3300006173	Ga0070716_100215686	Ga0070716_1002156862	174
1345	3300006237	Ga0097621_100061660	Ga0097621_1000616603	174
1346	3300006237	Ga0097621_100087801	Ga0097621_1000878013	174
1347	3300006237	Ga0097621_100112658	Ga0097621_1001126583	174
1348	3300006358	Ga0068871_100005005	Ga0068871_10000500514	174
1349	3300006358	Ga0068871_100088882	Ga0068871_1000888823	174
1350	3300006358	Ga0068871_100233684	Ga0068871_1002336843	174
1351	3300006358	Ga0068871_101723853	Ga0068871_1017238531	174
1352	3300006844	Ga0075428_100081117	Ga0075428_1000811172	174
1353	3300006844	Ga0075428_100281008	Ga0075428_1002810082	174
1354	3300006844	Ga0075428_100347989	Ga0075428_1003479891	174
1355	3300006847	Ga0075431_100126819	Ga0075431_1001268194	174
1356	3300006847	Ga0075431_100172905	Ga0075431_1001729052	174
1357	3300006847	Ga0075431_100347777	Ga0075431_1003477772	174
1358	3300006852	Ga0075433_10032041	Ga0075433_100320413	174
1359	3300006852	Ga0075433_10036894	Ga0075433_100368942	174
1360	3300006852	Ga0075433_10092313	Ga0075433_100923132	174
1361	3300006852	Ga0075433_10113009	Ga0075433_101130094	174
1362	3300006852	Ga0075433_10131178	Ga0075433_101311783	174
1363	3300006852	Ga0075433_10168639	Ga0075433_101686392	174
1364	3300006852	Ga0075433_10231432	Ga0075433_102314322	174
1365	3300006852	Ga0075433_10233774	Ga0075433_102337743	174
1366	3300006852	Ga0075433_10338685	Ga0075433_103386852	174
1367	3300006852	Ga0075433_10385303	Ga0075433_103853032	174
1368	3300006852	Ga0075433_10763596	Ga0075433_107635962	174
1369	3300006852	Ga0075433_11070422	Ga0075433_110704221	174
1370	3300006871	Ga0075434_100017958	Ga0075434_1000179584	174
1371	3300006871	Ga0075434_100034935	Ga0075434_1000349354	174
1372	3300006871	Ga0075434_100191749	Ga0075434_1001917491	174
1373	3300006871	Ga0075434_100238187	Ga0075434_1002381873	174
1374	3300006871	Ga0075434_100484928	Ga0075434_1004849283	174
1375	3300006871	Ga0075434_100531129	Ga0075434_1005311292	174
1376	3300006880	Ga0075429_100029946	Ga0075429_1000299463	174
1377	3300006880	Ga0075429_100049604	Ga0075429_1000496048	174
1378	3300006881	Ga0068865_100012683	Ga0068865_1000126835	174
1379	3300006881	Ga0068865_100047442	Ga0068865_1000474424	174
1380	3300006881	Ga0068865_100374594	Ga0068865_1003745942	174
1381	3300006881	Ga0068865_100460913	Ga0068865_1004609132	174
1382	3300006881	Ga0068865_100540083	Ga0068865_1005400831	174
1383	3300006881	Ga0068865_100624907	Ga0068865_1006249072	174
1384	3300006881	Ga0068865_101123268	Ga0068865_1011232682	174
1385	3300006914	Ga0075436_100015347	Ga0075436_1000153473	174
1386	3300006914	Ga0075436_100166191	Ga0075436_1001661912	174
1387	3300006931	Ga0097620_100056054	Ga0097620_1000560545	174
1388	3300006931	Ga0097620_100067591	Ga0097620_1000675914	174
1389	3300006931	Ga0097620_100122030	Ga0097620_1001220303	174
1390	3300006931	Ga0097620_100129107	Ga0097620_1001291073	174
1391	3300006931	Ga0097620_100156772	Ga0097620_1001567724	174
1392	3300006931	Ga0097620_100237249	Ga0097620_1002372491	174
1393	3300006931	Ga0097620_100240675	Ga0097620_1002406753	174
1394	3300006931	Ga0097620_100296397	Ga0097620_1002963973	174
1395	3300006931	Ga0097620_100505645	Ga0097620_1005056452	174
1396	3300006931	Ga0097620_100574152	Ga0097620_1005741521	174
1397	3300006931	Ga0097620_100607639	Ga0097620_1006076392	174
1398	3300006931	Ga0097620_100628693	Ga0097620_1006286932	174
1399	3300006931	Ga0097620_100648968	Ga0097620_1006489682	174
1400	3300006931	Ga0097620_100701410	Ga0097620_1007014102	174
1401	3300006931	Ga0097620_100802961	Ga0097620_1008029612	174
1402	3300006931	Ga0097620_100823713	Ga0097620_1008237132	174
1403	3300007076	Ga0075435_100020792	Ga0075435_1000207924	174
1404	3300007076	Ga0075435_100036375	Ga0075435_1000363753	174
1405	3300007076	Ga0075435_100108872	Ga0075435_1001088722	174
1406	3300007076	Ga0075435_100579486	Ga0075435_1005794861	174
1407	3300007265	Ga0099794_10002610	Ga0099794_100026102	174
1408	3300007265	Ga0099794_10188392	Ga0099794_101883922	174
1409	3300009011	Ga0105251_10039112	Ga0105251_100391123	174
1410	3300009011	Ga0105251_10079822	Ga0105251_100798223	174
1411	3300009092	Ga0105250_10223871	Ga0105250_102238712	174
1412	3300009093	Ga0105240_10171414	Ga0105240_101714143	174
1413	3300009093	Ga0105240_10223897	Ga0105240_102238973	174
1414	3300009093	Ga0105240_10267492	Ga0105240_102674922	174
1415	3300009093	Ga0105240_10848642	Ga0105240_108486422	174
1416	3300009093	Ga0105240_11159552	Ga0105240_111595521	174
1417	3300009093	Ga0105240_11646154	Ga0105240_116461541	174
1418	3300009094	Ga0111539_10022660	Ga0111539_100226608	174
1419	3300009094	Ga0111539_10111096	Ga0111539_101110962	174
1420	3300009094	Ga0111539_10155362	Ga0111539_101553624	174
1421	3300009094	Ga0111539_10556309	Ga0111539_105563092	174
1422	3300009094	Ga0111539_10735728	Ga0111539_107357281	174
1423	3300009094	Ga0111539_10793350	Ga0111539_107933502	174
1424	3300009094	Ga0111539_11184195	Ga0111539_111841952	174
1425	3300009098	Ga0105245_10018594	Ga0105245_100185944	174
1426	3300009098	Ga0105245_10029207	Ga0105245_100292072	174
1427	3300009098	Ga0105245_10632950	Ga0105245_106329502	174
1428	3300009098	Ga0105245_11292432	Ga0105245_112924322	174
1429	3300009101	Ga0105247_10000050	Ga0105247_10000050115	174
1430	3300009101	Ga0105247_10057749	Ga0105247_100577492	174
1431	3300009101	Ga0105247_10104474	Ga0105247_101044742	174
1432	3300009101	Ga0105247_10225572	Ga0105247_102255722	174
1433	3300009101	Ga0105247_10429993	Ga0105247_104299932	174
1434	3300009101	Ga0105247_11222697	Ga0105247_112226971	174
1435	3300009147	Ga0114129_10033278	Ga0114129_100332783	174
1436	3300009147	Ga0114129_10051383	Ga0114129_100513833	174
1437	3300009147	Ga0114129_10134336	Ga0114129_101343362	174
1438	3300009147	Ga0114129_10152363	Ga0114129_101523632	174
1439	3300009147	Ga0114129_10198455	Ga0114129_101984553	174
1440	3300009147	Ga0114129_10253970	Ga0114129_102539704	174
1441	3300009147	Ga0114129_10309888	Ga0114129_103098882	174
1442	3300009147	Ga0114129_10468658	Ga0114129_104686582	174
1443	3300009147	Ga0114129_10483108	Ga0114129_104831082	174
1444	3300009147	Ga0114129_10605425	Ga0114129_106054251	174
1445	3300009147	Ga0114129_10807822	Ga0114129_108078222	174
1446	3300009147	Ga0114129_11902443	Ga0114129_119024431	174
1447	3300009148	Ga0105243_10007055	Ga0105243_100070553	174
1448	3300009148	Ga0105243_10010720	Ga0105243_100107203	174
1449	3300009148	Ga0105243_10038543	Ga0105243_100385438	174
1450	3300009148	Ga0105243_10146690	Ga0105243_101466902	174
1451	3300009148	Ga0105243_10430471	Ga0105243_104304712	174
1452	3300009148	Ga0105243_10583269	Ga0105243_105832692	174
1453	3300009148	Ga0105243_10674589	Ga0105243_106745892	174
1454	3300009148	Ga0105243_11008496	Ga0105243_110084962	174
1455	3300009148	Ga0105243_12305990	Ga0105243_123059901	174
1456	3300009174	Ga0105241_10012886	Ga0105241_100128862	174
1457	3300009174	Ga0105241_10101528	Ga0105241_101015282	174
1458	3300009174	Ga0105241_10142240	Ga0105241_101422404	174
1459	3300009174	Ga0105241_10317229	Ga0105241_103172292	174
1460	3300009174	Ga0105241_10541301	Ga0105241_105413011	174
1461	3300009174	Ga0105241_10605393	Ga0105241_106053932	174
1462	3300009174	Ga0105241_10697392	Ga0105241_106973922	174
1463	3300009174	Ga0105241_11221401	Ga0105241_112214012	174
1464	3300009176	Ga0105242_10003471	Ga0105242_1000347116	174
1465	3300009176	Ga0105242_10004367	Ga0105242_100043674	174
1466	3300009176	Ga0105242_10034629	Ga0105242_100346294	174
1467	3300009176	Ga0105242_10870585	Ga0105242_108705851	174
1468	3300009177	Ga0105248_10015006	Ga0105248_100150064	174
1469	3300009177	Ga0105248_10043401	Ga0105248_100434013	174
1470	3300009177	Ga0105248_10053458	Ga0105248_100534583	174
1471	3300009177	Ga0105248_10129394	Ga0105248_101293943	174
1472	3300009177	Ga0105248_10168767	Ga0105248_101687673	174
1473	3300009177	Ga0105248_10314274	Ga0105248_103142742	174
1474	3300009177	Ga0105248_10399639	Ga0105248_103996392	174
1475	3300009177	Ga0105248_10604351	Ga0105248_106043512	174
1476	3300009177	Ga0105248_10683183	Ga0105248_106831832	174
1477	3300009177	Ga0105248_10910753	Ga0105248_109107532	174
1478	3300009177	Ga0105248_11063481	Ga0105248_110634811	174
1479	3300009177	Ga0105248_11656695	Ga0105248_116566952	174
1480	3300009177	Ga0105248_11663858	Ga0105248_116638582	174
1481	3300009545	Ga0105237_10007174	Ga0105237_100071747	174
1482	3300009545	Ga0105237_10062079	Ga0105237_100620793	174
1483	3300009545	Ga0105237_10085791	Ga0105237_100857912	174
1484	3300009545	Ga0105237_10220127	Ga0105237_102201273	174
1485	3300009545	Ga0105237_10636126	Ga0105237_106361262	174
1486	3300009545	Ga0105237_10865959	Ga0105237_108659592	174
1487	3300009551	Ga0105238_10036920	Ga0105238_100369203	174
1488	3300009553	Ga0105249_10013119	Ga0105249_100131198	174
1489	3300009553	Ga0105249_10025118	Ga0105249_100251186	174
1490	3300009553	Ga0105249_10026857	Ga0105249_100268572	174
1491	3300009553	Ga0105249_10098274	Ga0105249_100982742	174
1492	3300009553	Ga0105249_10100720	Ga0105249_101007202	174
1493	3300009553	Ga0105249_10111457	Ga0105249_101114571	174
1494	3300009553	Ga0105249_10388407	Ga0105249_103884072	174
1495	3300009553	Ga0105249_10991684	Ga0105249_109916842	174
1496	3300010375	Ga0105239_10088575	Ga0105239_100885752	174
1497	3300010375	Ga0105239_10201039	Ga0105239_102010393	174
1498	3300010375	Ga0105239_10571672	Ga0105239_105716721	174
1499	3300010375	Ga0105239_11363792	Ga0105239_113637922	174
1500	3300010375	Ga0105239_11515390	Ga0105239_115153901	174
1501	3300011119	Ga0105246_10015588	Ga0105246_100155883	174
1502	3300011119	Ga0105246_10090082	Ga0105246_100900823	174
1503	3300011119	Ga0105246_10374897	Ga0105246_103748972	174
1504	3300011119	Ga0105246_10402874	Ga0105246_104028742	174
1505	3300013100	Ga0157373_10021532	Ga0157373_100215323	174
1506	3300013100	Ga0157373_10041447	Ga0157373_100414478	174
1507	3300013100	Ga0157373_10052446	Ga0157373_100524462	174
1508	3300013100	Ga0157373_10686916	Ga0157373_106869162	174
1509	3300013100	Ga0157373_10775384	Ga0157373_107753841	174
1510	3300013296	Ga0157374_10050453	Ga0157374_100504534	174
1511	3300013296	Ga0157374_10104758	Ga0157374_101047581	174
1512	3300013296	Ga0157374_10695585	Ga0157374_106955852	174
1513	3300013296	Ga0157374_11111452	Ga0157374_111114521	174
1514	3300013297	Ga0157378_10026642	Ga0157378_100266426	174
1515	3300013297	Ga0157378_10037612	Ga0157378_100376128	174
1516	3300013297	Ga0157378_10096692	Ga0157378_100966922	174
1517	3300013297	Ga0157378_10135288	Ga0157378_101352883	174
1518	3300013297	Ga0157378_10264479	Ga0157378_102644792	174
1519	3300013297	Ga0157378_10396034	Ga0157378_103960342	174
1520	3300013297	Ga0157378_10924579	Ga0157378_109245791	174
1521	3300013297	Ga0157378_11497435	Ga0157378_114974351	174
1522	3300013306	Ga0163162_10000784	Ga0163162_100007848	174
1523	3300013306	Ga0163162_10004596	Ga0163162_1000459610	174
1524	3300013306	Ga0163162_10006687	Ga0163162_100066874	174
1525	3300013306	Ga0163162_10041843	Ga0163162_100418438	174
1526	3300013306	Ga0163162_10051628	Ga0163162_100516282	174
1527	3300013306	Ga0163162_10112004	Ga0163162_101120044	174
1528	3300013306	Ga0163162_10211754	Ga0163162_102117544	174
1529	3300013306	Ga0163162_10229337	Ga0163162_102293372	174
1530	3300013306	Ga0163162_10337071	Ga0163162_103370711	174
1531	3300013306	Ga0163162_10366884	Ga0163162_103668843	174
1532	3300013306	Ga0163162_10602090	Ga0163162_106020901	174
1533	3300013306	Ga0163162_10659949	Ga0163162_106599492	174
1534	3300013306	Ga0163162_10742703	Ga0163162_107427032	174
1535	3300013306	Ga0163162_10849181	Ga0163162_108491812	174
1536	3300013306	Ga0163162_11809328	Ga0163162_118093281	174
1537	3300013306	Ga0163162_11912310	Ga0163162_119123101	174
1538	3300013307	Ga0157372_10095280	Ga0157372_100952803	174
1539	3300013307	Ga0157372_10194152	Ga0157372_101941523	174
1540	3300013307	Ga0157372_10204237	Ga0157372_102042372	174
1541	3300013307	Ga0157372_10737375	Ga0157372_107373752	174
1542	3300013307	Ga0157372_11788512	Ga0157372_117885121	174
1543	3300013307	Ga0157372_12099004	Ga0157372_120990041	174
1544	3300013308	Ga0157375_10045126	Ga0157375_100451263	174
1545	3300013308	Ga0157375_10079178	Ga0157375_100791782	174
1546	3300013308	Ga0157375_10094256	Ga0157375_100942562	174
1547	3300013308	Ga0157375_10094340	Ga0157375_100943406	174
1548	3300013308	Ga0157375_10148350	Ga0157375_101483503	174
1549	3300013308	Ga0157375_10302145	Ga0157375_103021452	174
1550	3300013308	Ga0157375_10427214	Ga0157375_104272143	174
1551	3300013308	Ga0157375_10712280	Ga0157375_107122802	174
1552	3300013308	Ga0157375_10820618	Ga0157375_108206181	174
1553	3300013308	Ga0157375_10934404	Ga0157375_109344042	174
1554	3300013308	Ga0157375_11159455	Ga0157375_111594552	174
1555	3300013308	Ga0157375_11786749	Ga0157375_117867491	174
1556	3300014325	Ga0163163_10006543	Ga0163163_100065433	174
1557	3300014325	Ga0163163_10011579	Ga0163163_100115792	174
1558	3300014325	Ga0163163_10037229	Ga0163163_100372293	174
1559	3300014325	Ga0163163_10058422	Ga0163163_100584228	174
1560	3300014325	Ga0163163_10061741	Ga0163163_100617412	174
1561	3300014325	Ga0163163_10085731	Ga0163163_100857312	174
1562	3300014325	Ga0163163_10590925	Ga0163163_105909251	174
1563	3300014325	Ga0163163_10707198	Ga0163163_107071982	174
1564	3300014325	Ga0163163_10858168	Ga0163163_108581682	174
1565	3300014325	Ga0163163_11109869	Ga0163163_111098691	174
1566	3300014325	Ga0163163_11700163	Ga0163163_117001631	174
1567	3300014326	Ga0157380_10005145	Ga0157380_100051456	174
1568	3300014326	Ga0157380_10019969	Ga0157380_100199693	174
1569	3300014326	Ga0157380_10027759	Ga0157380_100277592	174
1570	3300014326	Ga0157380_10073876	Ga0157380_100738763	174
1571	3300014326	Ga0157380_10102702	Ga0157380_101027022	174
1572	3300014326	Ga0157380_10166756	Ga0157380_101667562	174
1573	3300014326	Ga0157380_10335029	Ga0157380_103350292	174
1574	3300014326	Ga0157380_10402047	Ga0157380_104020472	174
1575	3300014326	Ga0157380_10583962	Ga0157380_105839621	174
1576	3300014326	Ga0157380_10677329	Ga0157380_106773292	174
1577	3300014326	Ga0157380_12235335	Ga0157380_122353351	174
1578	3300014745	Ga0157377_10018901	Ga0157377_100189012	174
1579	3300014745	Ga0157377_10051456	Ga0157377_100514564	174
1580	3300014745	Ga0157377_10142932	Ga0157377_101429322	174
1581	3300014745	Ga0157377_10170622	Ga0157377_101706222	174
1582	3300014745	Ga0157377_10267660	Ga0157377_102676602	174
1583	3300014745	Ga0157377_10475508	Ga0157377_104755081	174
1584	3300014968	Ga0157379_10037517	Ga0157379_100375178	174
1585	3300014968	Ga0157379_10327934	Ga0157379_103279342	174
1586	3300014968	Ga0157379_10624856	Ga0157379_106248562	174
1587	3300014969	Ga0157376_10009083	Ga0157376_100090833	174
1588	3300014969	Ga0157376_10538613	Ga0157376_105386132	174
1589	3300014969	Ga0157376_10580882	Ga0157376_105808822	174
1590	3300014969	Ga0157376_12022807	Ga0157376_120228071	174
1591	3300017792	Ga0163161_10023268	Ga0163161_100232682	174
1592	3300017792	Ga0163161_10153829	Ga0163161_101538292	174
1593	3300017792	Ga0163161_10183133	Ga0163161_101831332	174
1594	3300017792	Ga0163161_10400164	Ga0163161_104001642	174
1595	3300021384	Ga0213876_10000189	Ga0213876_100001894	174
1596	3300021384	Ga0213876_10012169	Ga0213876_100121693	174
1597	3300021384	Ga0213876_10043703	Ga0213876_100437032	174
1598	3300025223	Ga0207672_1000149	Ga0207672_10001497	174
1599	3300025315	Ga0207697_10133692	Ga0207697_101336922	174
1600	3300025315	Ga0207697_10268127	Ga0207697_102681272	174
1601	3300025321	Ga0207656_10130078	Ga0207656_101300782	174
1602	3300025321	Ga0207656_10130615	Ga0207656_101306152	174
1603	3300025321	Ga0207656_10478572	Ga0207656_104785721	174
1604	3300025735	Ga0207713_1069991	Ga0207713_10699912	174
1605	3300025885	Ga0207653_10000289	Ga0207653_100002899	174
1606	3300025885	Ga0207653_10013041	Ga0207653_100130413	174
1607	3300025893	Ga0207682_10122471	Ga0207682_101224712	174
1608	3300025893	Ga0207682_10170621	Ga0207682_101706211	174
1609	3300025899	Ga0207642_10077867	Ga0207642_100778672	174
1610	3300025899	Ga0207642_10111098	Ga0207642_101110982	174
1611	3300025900	Ga0207710_10000003	Ga0207710_10000003905	174
1612	3300025900	Ga0207710_10008744	Ga0207710_100087442	174
1613	3300025900	Ga0207710_10392801	Ga0207710_103928012	174
1614	3300025903	Ga0207680_10023352	Ga0207680_100233523	174
1615	3300025903	Ga0207680_10050712	Ga0207680_100507124	174
1616	3300025903	Ga0207680_10228326	Ga0207680_102283262	174
1617	3300025904	Ga0207647_10119899	Ga0207647_101198992	174
1618	3300025904	Ga0207647_10156058	Ga0207647_101560581	174
1619	3300025905	Ga0207685_10000024	Ga0207685_1000002456	174
1620	3300025906	Ga0207699_10178852	Ga0207699_101788522	174
1621	3300025906	Ga0207699_10619954	Ga0207699_106199542	174
1622	3300025907	Ga0207645_10062300	Ga0207645_100623003	174
1623	3300025907	Ga0207645_10063229	Ga0207645_100632294	174
1624	3300025907	Ga0207645_10207778	Ga0207645_102077782	174
1625	3300025907	Ga0207645_10246753	Ga0207645_102467532	174
1626	3300025907	Ga0207645_10312806	Ga0207645_103128062	174
1627	3300025908	Ga0207643_10020369	Ga0207643_100203692	174
1628	3300025908	Ga0207643_10080369	Ga0207643_100803692	174
1629	3300025908	Ga0207643_10111642	Ga0207643_101116422	174
1630	3300025908	Ga0207643_10164355	Ga0207643_101643552	174
1631	3300025908	Ga0207643_10312662	Ga0207643_103126622	174
1632	3300025910	Ga0207684_10000085	Ga0207684_1000008592	174
1633	3300025910	Ga0207684_10003150	Ga0207684_1000315016	174
1634	3300025910	Ga0207684_10004885	Ga0207684_100048858	174
1635	3300025910	Ga0207684_10133583	Ga0207684_101335832	174
1636	3300025910	Ga0207684_10152026	Ga0207684_101520262	174
1637	3300025910	Ga0207684_10152505	Ga0207684_101525053	174
1638	3300025910	Ga0207684_10339878	Ga0207684_103398782	174
1639	3300025910	Ga0207684_10485217	Ga0207684_104852172	174
1640	3300025910	Ga0207684_10584102	Ga0207684_105841022	174
1641	3300025910	Ga0207684_10649481	Ga0207684_106494811	174
1642	3300025911	Ga0207654_10013384	Ga0207654_100133843	174
1643	3300025911	Ga0207654_10068145	Ga0207654_100681452	174
1644	3300025911	Ga0207654_10090678	Ga0207654_100906782	174
1645	3300025911	Ga0207654_10110300	Ga0207654_101103002	174
1646	3300025911	Ga0207654_10139038	Ga0207654_101390382	174
1647	3300025911	Ga0207654_10465344	Ga0207654_104653442	174
1648	3300025911	Ga0207654_10530501	Ga0207654_105305012	174
1649	3300025912	Ga0207707_10000503	Ga0207707_1000050332	174
1650	3300025912	Ga0207707_10050582	Ga0207707_100505823	174
1651	3300025912	Ga0207707_10538546	Ga0207707_105385461	174
1652	3300025913	Ga0207695_10081076	Ga0207695_100810762	174
1653	3300025913	Ga0207695_10208695	Ga0207695_102086952	174
1654	3300025913	Ga0207695_10250144	Ga0207695_102501443	174
1655	3300025914	Ga0207671_10004181	Ga0207671_100041817	174
1656	3300025914	Ga0207671_10670849	Ga0207671_106708492	174
1657	3300025914	Ga0207671_11330819	Ga0207671_113308191	174
1658	3300025917	Ga0207660_10001058	Ga0207660_1000105810	174
1659	3300025917	Ga0207660_10087937	Ga0207660_100879373	174
1660	3300025917	Ga0207660_10354914	Ga0207660_103549142	174
1661	3300025917	Ga0207660_10378817	Ga0207660_103788172	174
1662	3300025917	Ga0207660_10577025	Ga0207660_105770251	174
1663	3300025918	Ga0207662_10005060	Ga0207662_100050606	174
1664	3300025918	Ga0207662_10040549	Ga0207662_100405493	174
1665	3300025918	Ga0207662_10071042	Ga0207662_100710422	174
1666	3300025918	Ga0207662_10315033	Ga0207662_103150331	174
1667	3300025919	Ga0207657_10084649	Ga0207657_100846493	174
1668	3300025919	Ga0207657_10180415	Ga0207657_101804153	174
1669	3300025920	Ga0207649_10024546	Ga0207649_100245462	174
1670	3300025920	Ga0207649_10467322	Ga0207649_104673222	174
1671	3300025921	Ga0207652_10000427	Ga0207652_1000042736	174
1672	3300025921	Ga0207652_10923511	Ga0207652_109235112	174
1673	3300025922	Ga0207646_10002175	Ga0207646_1000217511	174
1674	3300025922	Ga0207646_10005737	Ga0207646_100057375	174
1675	3300025922	Ga0207646_10005747	Ga0207646_100057475	174
1676	3300025922	Ga0207646_10032750	Ga0207646_100327506	174
1677	3300025922	Ga0207646_10094915	Ga0207646_100949152	174
1678	3300025922	Ga0207646_10114002	Ga0207646_101140023	174
1679	3300025922	Ga0207646_10159720	Ga0207646_101597202	174
1680	3300025922	Ga0207646_10751411	Ga0207646_107514111	174
1681	3300025922	Ga0207646_10984774	Ga0207646_109847742	174
1682	3300025922	Ga0207646_11148744	Ga0207646_111487441	174
1683	3300025923	Ga0207681_10004264	Ga0207681_100042647	174
1684	3300025923	Ga0207681_10005504	Ga0207681_100055048	174
1685	3300025923	Ga0207681_10150053	Ga0207681_101500532	174
1686	3300025923	Ga0207681_10349313	Ga0207681_103493132	174
1687	3300025924	Ga0207694_10004209	Ga0207694_100042099	174
1688	3300025924	Ga0207694_10070744	Ga0207694_100707443	174
1689	3300025925	Ga0207650_10000028	Ga0207650_100000288	174
1690	3300025925	Ga0207650_10002078	Ga0207650_1000207816	174
1691	3300025925	Ga0207650_10194481	Ga0207650_101944812	174
1692	3300025925	Ga0207650_10485295	Ga0207650_104852952	174
1693	3300025925	Ga0207650_10801472	Ga0207650_108014722	174
1694	3300025925	Ga0207650_11042385	Ga0207650_110423851	174
1695	3300025926	Ga0207659_10049731	Ga0207659_100497313	174
1696	3300025926	Ga0207659_10293103	Ga0207659_102931031	174
1697	3300025926	Ga0207659_11285655	Ga0207659_112856551	174
1698	3300025927	Ga0207687_10053920	Ga0207687_100539202	174
1699	3300025927	Ga0207687_10505701	Ga0207687_105057012	174
1700	3300025927	Ga0207687_10857361	Ga0207687_108573612	174
1701	3300025928	Ga0207700_10864000	Ga0207700_108640001	174
1702	3300025931	Ga0207644_10001958	Ga0207644_100019587	174
1703	3300025931	Ga0207644_10003226	Ga0207644_100032267	174
1704	3300025931	Ga0207644_10034752	Ga0207644_100347523	174
1705	3300025931	Ga0207644_10092764	Ga0207644_100927642	174
1706	3300025931	Ga0207644_10334205	Ga0207644_103342052	174
1707	3300025931	Ga0207644_10553655	Ga0207644_105536552	174
1708	3300025931	Ga0207644_10793403	Ga0207644_107934032	174
1709	3300025932	Ga0207690_10003154	Ga0207690_100031544	174
1710	3300025932	Ga0207690_10216295	Ga0207690_102162952	174
1711	3300025933	Ga0207706_10050740	Ga0207706_100507403	174
1712	3300025933	Ga0207706_10095417	Ga0207706_100954173	174
1713	3300025933	Ga0207706_10195623	Ga0207706_101956232	174
1714	3300025933	Ga0207706_10733675	Ga0207706_107336752	174
1715	3300025934	Ga0207686_10000496	Ga0207686_100004964	174
1716	3300025934	Ga0207686_10010563	Ga0207686_100105633	174
1717	3300025934	Ga0207686_10121904	Ga0207686_101219042	174
1718	3300025934	Ga0207686_10167796	Ga0207686_101677962	174
1719	3300025935	Ga0207709_10001154	Ga0207709_100011548	174
1720	3300025935	Ga0207709_10034818	Ga0207709_100348182	174
1721	3300025935	Ga0207709_10045264	Ga0207709_100452643	174
1722	3300025935	Ga0207709_10053093	Ga0207709_100530933	174
1723	3300025935	Ga0207709_10101498	Ga0207709_101014982	174
1724	3300025935	Ga0207709_10239338	Ga0207709_102393382	174
1725	3300025935	Ga0207709_10377747	Ga0207709_103777472	174
1726	3300025935	Ga0207709_10713006	Ga0207709_107130061	174
1727	3300025936	Ga0207670_10002963	Ga0207670_100029634	174
1728	3300025936	Ga0207670_10037877	Ga0207670_100378772	174
1729	3300025936	Ga0207670_10182241	Ga0207670_101822411	174
1730	3300025937	Ga0207669_10895068	Ga0207669_108950682	174
1731	3300025938	Ga0207704_10010523	Ga0207704_100105233	174
1732	3300025938	Ga0207704_10254067	Ga0207704_102540672	174
1733	3300025938	Ga0207704_10544038	Ga0207704_105440381	174
1734	3300025938	Ga0207704_10785521	Ga0207704_107855211	174
1735	3300025938	Ga0207704_10875557	Ga0207704_108755571	174
1736	3300025939	Ga0207665_10000029	Ga0207665_1000002986	174
1737	3300025939	Ga0207665_10011629	Ga0207665_100116297	174
1738	3300025939	Ga0207665_10160343	Ga0207665_101603431	174
1739	3300025939	Ga0207665_10160959	Ga0207665_101609592	174
1740	3300025939	Ga0207665_10176933	Ga0207665_101769333	174
1741	3300025940	Ga0207691_10032538	Ga0207691_100325383	174
1742	3300025940	Ga0207691_10189982	Ga0207691_101899822	174
1743	3300025940	Ga0207691_10201269	Ga0207691_102012693	174
1744	3300025940	Ga0207691_10935689	Ga0207691_109356892	174
1745	3300025940	Ga0207691_11142529	Ga0207691_111425292	174
1746	3300025941	Ga0207711_10076819	Ga0207711_100768192	174
1747	3300025941	Ga0207711_10087939	Ga0207711_100879393	174
1748	3300025941	Ga0207711_10208116	Ga0207711_102081163	174
1749	3300025941	Ga0207711_10216030	Ga0207711_102160302	174
1750	3300025941	Ga0207711_10230622	Ga0207711_102306222	174
1751	3300025941	Ga0207711_10561578	Ga0207711_105615781	174
1752	3300025941	Ga0207711_10672611	Ga0207711_106726112	174
1753	3300025941	Ga0207711_10891264	Ga0207711_108912641	174
1754	3300025941	Ga0207711_11140907	Ga0207711_111409071	174
1755	3300025941	Ga0207711_11549348	Ga0207711_115493481	174
1756	3300025942	Ga0207689_10013420	Ga0207689_100134203	174
1757	3300025942	Ga0207689_10028316	Ga0207689_100283162	174
1758	3300025942	Ga0207689_10037371	Ga0207689_100373712	174
1759	3300025942	Ga0207689_10042361	Ga0207689_100423613	174
1760	3300025942	Ga0207689_10080229	Ga0207689_100802293	174
1761	3300025942	Ga0207689_10080358	Ga0207689_100803585	174
1762	3300025942	Ga0207689_10110965	Ga0207689_101109654	174
1763	3300025942	Ga0207689_10122089	Ga0207689_101220893	174
1764	3300025942	Ga0207689_10172622	Ga0207689_101726222	174
1765	3300025942	Ga0207689_10237491	Ga0207689_102374912	174
1766	3300025942	Ga0207689_10237669	Ga0207689_102376692	174
1767	3300025942	Ga0207689_10278931	Ga0207689_102789312	174
1768	3300025942	Ga0207689_10280489	Ga0207689_102804892	174
1769	3300025942	Ga0207689_10290694	Ga0207689_102906942	174
1770	3300025942	Ga0207689_10385936	Ga0207689_103859362	174
1771	3300025942	Ga0207689_10851905	Ga0207689_108519052	174
1772	3300025944	Ga0207661_10906947	Ga0207661_109069472	174
1773	3300025944	Ga0207661_11279824	Ga0207661_112798241	174
1774	3300025945	Ga0207679_10028225	Ga0207679_100282252	174
1775	3300025945	Ga0207679_10057001	Ga0207679_100570013	174
1776	3300025949	Ga0207667_10281602	Ga0207667_102816023	174
1777	3300025949	Ga0207667_10338922	Ga0207667_103389222	174
1778	3300025960	Ga0207651_10039615	Ga0207651_100396154	174
1779	3300025960	Ga0207651_10040679	Ga0207651_100406792	174
1780	3300025960	Ga0207651_10145313	Ga0207651_101453133	174
1781	3300025960	Ga0207651_10165890	Ga0207651_101658903	174
1782	3300025960	Ga0207651_10366495	Ga0207651_103664952	174
1783	3300025960	Ga0207651_10748301	Ga0207651_107483012	174
1784	3300025961	Ga0207712_10000586	Ga0207712_1000058619	174
1785	3300025961	Ga0207712_10020659	Ga0207712_100206592	174
1786	3300025961	Ga0207712_10064063	Ga0207712_100640634	174
1787	3300025972	Ga0207668_10009419	Ga0207668_100094194	174
1788	3300025981	Ga0207640_10199540	Ga0207640_101995402	174
1789	3300025981	Ga0207640_10427000	Ga0207640_104270002	174
1790	3300025981	Ga0207640_10849164	Ga0207640_108491642	174
1791	3300025986	Ga0207658_10100263	Ga0207658_101002633	174
1792	3300025986	Ga0207658_10133133	Ga0207658_101331332	174
1793	3300026023	Ga0207677_10038376	Ga0207677_100383763	174
1794	3300026023	Ga0207677_10298154	Ga0207677_102981542	174
1795	3300026023	Ga0207677_10419304	Ga0207677_104193042	174
1796	3300026023	Ga0207677_10471948	Ga0207677_104719482	174
1797	3300026023	Ga0207677_11039491	Ga0207677_110394911	174
1798	3300026023	Ga0207677_11405609	Ga0207677_114056091	174
1799	3300026035	Ga0207703_10000355	Ga0207703_1000035511	174
1800	3300026035	Ga0207703_10077821	Ga0207703_100778213	174
1801	3300026035	Ga0207703_10086633	Ga0207703_100866333	174
1802	3300026035	Ga0207703_10132983	Ga0207703_101329832	174
1803	3300026035	Ga0207703_10141082	Ga0207703_101410823	174
1804	3300026035	Ga0207703_10268536	Ga0207703_102685362	174
1805	3300026041	Ga0207639_10013858	Ga0207639_100138583	174
1806	3300026041	Ga0207639_10132216	Ga0207639_101322162	174
1807	3300026041	Ga0207639_10163272	Ga0207639_101632723	174
1808	3300026041	Ga0207639_10258038	Ga0207639_102580383	174
1809	3300026041	Ga0207639_10375957	Ga0207639_103759572	174
1810	3300026067	Ga0207678_10458936	Ga0207678_104589362	174
1811	3300026075	Ga0207708_10008557	Ga0207708_100085573	174
1812	3300026075	Ga0207708_10011438	Ga0207708_100114383	174
1813	3300026075	Ga0207708_10020009	Ga0207708_100200093	174
1814	3300026075	Ga0207708_10054210	Ga0207708_100542106	174
1815	3300026075	Ga0207708_10151221	Ga0207708_101512213	174
1816	3300026075	Ga0207708_10310291	Ga0207708_103102912	174
1817	3300026075	Ga0207708_10609226	Ga0207708_106092262	174
1818	3300026078	Ga0207702_10003231	Ga0207702_100032317	174
1819	3300026088	Ga0207641_10060418	Ga0207641_100604183	174
1820	3300026088	Ga0207641_10063545	Ga0207641_100635452	174
1821	3300026088	Ga0207641_10118073	Ga0207641_101180732	174
1822	3300026088	Ga0207641_10239501	Ga0207641_102395012	174
1823	3300026088	Ga0207641_10280753	Ga0207641_102807532	174
1824	3300026088	Ga0207641_10294981	Ga0207641_102949812	174
1825	3300026088	Ga0207641_10302882	Ga0207641_103028822	174
1826	3300026088	Ga0207641_10376052	Ga0207641_103760522	174
1827	3300026088	Ga0207641_10820941	Ga0207641_108209412	174
1828	3300026088	Ga0207641_11118733	Ga0207641_111187331	174
1829	3300026089	Ga0207648_10050189	Ga0207648_100501893	174
1830	3300026089	Ga0207648_10052615	Ga0207648_100526156	174
1831	3300026089	Ga0207648_10079277	Ga0207648_100792773	174
1832	3300026089	Ga0207648_10149950	Ga0207648_101499503	174
1833	3300026089	Ga0207648_10177275	Ga0207648_101772752	174
1834	3300026089	Ga0207648_10471313	Ga0207648_104713132	174
1835	3300026089	Ga0207648_10605076	Ga0207648_106050762	174
1836	3300026089	Ga0207648_10674594	Ga0207648_106745941	174
1837	3300026095	Ga0207676_10029900	Ga0207676_100299007	174
1838	3300026095	Ga0207676_10031106	Ga0207676_100311062	174
1839	3300026095	Ga0207676_10040297	Ga0207676_100402972	174
1840	3300026095	Ga0207676_10044163	Ga0207676_100441637	174
1841	3300026095	Ga0207676_10101239	Ga0207676_101012393	174
1842	3300026095	Ga0207676_10113804	Ga0207676_101138043	174
1843	3300026095	Ga0207676_10128702	Ga0207676_101287023	174
1844	3300026095	Ga0207676_10130284	Ga0207676_101302843	174
1845	3300026095	Ga0207676_10226274	Ga0207676_102262742	174
1846	3300026095	Ga0207676_10509903	Ga0207676_105099032	174
1847	3300026095	Ga0207676_10644674	Ga0207676_106446742	174
1848	3300026095	Ga0207676_10759798	Ga0207676_107597982	174
1849	3300026095	Ga0207676_10959310	Ga0207676_109593102	174
1850	3300026116	Ga0207674_10006877	Ga0207674_100068778	174
1851	3300026116	Ga0207674_10143411	Ga0207674_101434112	174
1852	3300026116	Ga0207674_10215525	Ga0207674_102155251	174
1853	3300026116	Ga0207674_10221279	Ga0207674_102212792	174
1854	3300026116	Ga0207674_10395314	Ga0207674_103953141	174
1855	3300026116	Ga0207674_10443842	Ga0207674_104438422	174
1856	3300026116	Ga0207674_10700726	Ga0207674_107007262	174
1857	3300026116	Ga0207674_10723021	Ga0207674_107230212	174
1858	3300026118	Ga0207675_100014977	Ga0207675_1000149773	174
1859	3300026118	Ga0207675_100017801	Ga0207675_1000178018	174
1860	3300026118	Ga0207675_100047591	Ga0207675_1000475911	174
1861	3300026118	Ga0207675_100057101	Ga0207675_1000571013	174
1862	3300026118	Ga0207675_100126066	Ga0207675_1001260663	174
1863	3300026118	Ga0207675_100215370	Ga0207675_1002153701	174
1864	3300026118	Ga0207675_100232587	Ga0207675_1002325873	174
1865	3300026118	Ga0207675_100342914	Ga0207675_1003429142	174
1866	3300026118	Ga0207675_100355291	Ga0207675_1003552912	174
1867	3300026118	Ga0207675_100479938	Ga0207675_1004799381	174
1868	3300026118	Ga0207675_100535036	Ga0207675_1005350362	174
1869	3300026118	Ga0207675_101156931	Ga0207675_1011569312	174
1870	3300026121	Ga0207683_10289050	Ga0207683_102890503	174
1871	3300026121	Ga0207683_10466057	Ga0207683_104660572	174
1872	3300026121	Ga0207683_10837396	Ga0207683_108373961	174
1873	3300026142	Ga0207698_10425608	Ga0207698_104256081	174
1874	3300027671	Ga0209588_1005410	Ga0209588_10054103	174
1875	3300027907	Ga0207428_10008641	Ga0207428_100086414	174
1876	3300027907	Ga0207428_10057402	Ga0207428_100574026	174
1877	3300028379	Ga0268266_11004151	Ga0268266_110041511	174
1878	3300028380	Ga0268265_10016285	Ga0268265_100162853	174
1879	3300028380	Ga0268265_10108820	Ga0268265_101088202	174
1880	3300028380	Ga0268265_10655372	Ga0268265_106553722	174
1881	3300028380	Ga0268265_11372894	Ga0268265_113728942	174
1882	3300028381	Ga0268264_10067613	Ga0268264_100676132	174
1883	3300028381	Ga0268264_10073195	Ga0268264_100731953	174
1884	3300028381	Ga0268264_10184993	Ga0268264_101849932	174
1885	3300028381	Ga0268264_10189595	Ga0268264_101895952	174
1886	3300028381	Ga0268264_10249740	Ga0268264_102497402	174
1887	3300028381	Ga0268264_10298256	Ga0268264_102982563	174
1888	3300028381	Ga0268264_10350351	Ga0268264_103503512	174
1889	3300028381	Ga0268264_11253416	Ga0268264_112534161	174
1890	3300028794	Ga0307515_10396462	Ga0307515_103964621	174
1891	3300030733	Ga0314311_1142362	Ga0314311_11423622	174
1892	3300030735	Ga0316178_1013849	Ga0316178_10138491	174
1893	3300030745	Ga0316182_1305458	Ga0316182_13054582	174
1894	3300031456	Ga0307513_10006106	Ga0307513_100061067	174
1895	3300031548	Ga0307408_100045088	Ga0307408_1000450883	174
1896	3300031548	Ga0307408_100097520	Ga0307408_1000975203	174
1897	3300031548	Ga0307408_100507813	Ga0307408_1005078132	174
1898	3300031548	Ga0307408_100653105	Ga0307408_1006531051	174
1899	3300031548	Ga0307408_100749384	Ga0307408_1007493842	174
1900	3300031731	Ga0307405_10016948	Ga0307405_100169483	174
1901	3300031731	Ga0307405_10255097	Ga0307405_102550972	174
1902	3300031731	Ga0307405_10348430	Ga0307405_103484302	174
1903	3300031731	Ga0307405_10908049	Ga0307405_109080492	174
1904	3300031824	Ga0307413_10028600	Ga0307413_100286002	174
1905	3300031901	Ga0307406_10017514	Ga0307406_100175142	174
1906	3300031901	Ga0307406_10457724	Ga0307406_104577241	174
1907	3300031903	Ga0307407_10295179	Ga0307407_102951792	174
1908	3300031903	Ga0307407_11014576	Ga0307407_110145761	174
1909	3300031911	Ga0307412_10010192	Ga0307412_100101923	174
1910	3300031911	Ga0307412_10094052	Ga0307412_100940522	174
1911	3300031911	Ga0307412_10162625	Ga0307412_101626252	174
1912	3300031911	Ga0307412_10463771	Ga0307412_104637712	174
1913	3300031911	Ga0307412_10508801	Ga0307412_105088012	174
1914	3300031995	Ga0307409_100632192	Ga0307409_1006321922	174
1915	3300032002	Ga0307416_100022083	Ga0307416_1000220833	174
1916	3300032002	Ga0307416_100030319	Ga0307416_1000303198	174
1917	3300032002	Ga0307416_100169744	Ga0307416_1001697443	174
1918	3300032002	Ga0307416_100399173	Ga0307416_1003991732	174
1919	3300032004	Ga0307414_10162799	Ga0307414_101627993	174
1920	3300032004	Ga0307414_10223760	Ga0307414_102237602	174
1921	3300032004	Ga0307414_10264523	Ga0307414_102645232	174
1922	3300032005	Ga0307411_10510658	Ga0307411_105106581	174
1923	3300032005	Ga0307411_10629083	Ga0307411_106290832	174
1924	3300032005	Ga0307411_10718692	Ga0307411_107186921	174
1925	3300032126	Ga0307415_100016722	Ga0307415_1000167224	174
1926	3300032126	Ga0307415_100103517	Ga0307415_1001035173	174
1927	3300034820	Ga0373959_0055552	Ga0373959_0055552_41_565	174
1928	3300035088	Ga0373940_0081003	Ga0373940_0081003_289_813	174
1929	3300035088	Ga0373940_0108313	Ga0373940_0108313_65_589	174
1930	3300035088	Ga0373940_0218729	Ga0373940_0218729_44_568	174
1931	3300035090	Ga0373949_0018355	Ga0373949_0018355_764_1288	174
1932	3300035091	Ga0373951_0010761	Ga0373951_0010761_649_1173	174
1933	3300035091	Ga0373951_0033561	Ga0373951_0033561_383_907	174
1934	3300035092	Ga0373952_0074469	Ga0373952_0074469_54_578	174
1935	3300035092	Ga0373952_0080650	Ga0373952_0080650_201_725	174
1936	3300035112	Ga0373932_0139352	Ga0373932_0139352_66_590	174
1937	3300035115	Ga0373941_0057046	Ga0373941_0057046_337_861	174
1938	3300035241	Ga0373961_0015753	Ga0373961_0015753_414_938	174
1939	3300035241	Ga0373961_0076900	Ga0373961_0076900_291_815	174
1940	3300035241	Ga0373961_0174625	Ga0373961_0174625_141_665	174
1941	3300035242	Ga0373962_0151943	Ga0373962_0151943_92_616	174
1942	3300035725	Ga0373947_0733943	Ga0373947_0733943_72_596	174
1943	3300036401	Ga0373937_0097348	Ga0373937_0097348_2108_2632	174
1944	3300037466	Ga0395898_0243037	Ga0395898_0243037_734_1258	174
1945	3300037466	Ga0395898_0323356	Ga0395898_0323356_365_889	174
1946	3300037471	Ga0395905_0056292	Ga0395905_0056292_279_803	174
1947	3300037471	Ga0395905_0181892	Ga0395905_0181892_882_1406	174
1948	3300037853	Ga0436364_0946147	Ga0436364_0946147_1052_1579	174
1949	3300038443	Ga0395901_0352272	Ga0395901_0352272_515_1039	174
1950	3300038699	Ga0242422_00217	Ga0242422_00217_1395_1919	174
1951	3300038699	Ga0242422_03893	Ga0242422_03893_157_690	174
1952	3300038996	Ga0242420_007506	Ga0242420_007506_1121_1645	174
1953	3300038996	Ga0242420_014230	Ga0242420_014230_627_1151	174
1954	3300039437	Ga0436365_0357466	Ga0436365_0357466_458_1000	174
1955	3300039437	Ga0436365_0668830	Ga0436365_0668830_2792_3328	174
1956	3300039437	Ga0436365_1052004	Ga0436365_1052004_2174_2713	174
1957	3300039437	Ga0436365_1324789	Ga0436365_1324789_2881_3408	174
1958	3300042000	Ga0439437_004698	Ga0439437_004698_742_1266	174
1959	3300042125	Ga0450923_040278	Ga0450923_040278_64_600	174
1960	3300042127	Ga0450890_005734	Ga0450890_005734_957_1481	174
1961	3300042435	Ga0439434_0034549	Ga0439434_0034549_361_894	174
1962	3300044673	Ga0453683_0339298	Ga0453683_0339298_419_952	174
1963	3300044712	Ga0453684_0135319	Ga0453684_0135319_2001_2534	174
1964	3300045051	Ga0451576_0042679	Ga0451576_0042679_3367_3900	174
1965	3300045051	Ga0451576_0123757	Ga0451576_0123757_252_776	174
1966	3300045051	Ga0451576_0665725	Ga0451576_0665725_109_633	174
1967	3300045051	Ga0451576_1029128	Ga0451576_1029128_235_759	174
1968	3300046459	Ga0495629_0334932	Ga0495629_0334932_92_616	174
1969	3300046474	Ga0495605_0247890	Ga0495605_0247890_33_566	174
1970	3300046500	Ga0495596_0113214	Ga0495596_0113214_347_880	174
1971	3300046512	Ga0495610_0044352	Ga0495610_0044352_1509_2042	174
1972	3300046515	Ga0495620_0062541	Ga0495620_0062541_174_707	174
1973	3300046519	Ga0495632_0019657	Ga0495632_0019657_631_1173	174
1974	3300046522	Ga0495643_0159221	Ga0495643_0159221_90_614	174
1975	3300046525	Ga0495663_0000620	Ga0495663_0000620_4863_5396	174
1976	3300046539	Ga0495621_0002543	Ga0495621_0002543_2969_3502	174
1977	3300047318	Ga0495636_0210967	Ga0495636_0210967_67_600	174
1978	3300047445	Ga0495677_0088772	Ga0495677_0088772_196_729	174
1979	3300048905	Ga0496102_0219944	Ga0496102_0219944_828_1352	174
1980	3300048906	Ga0496103_0102110	Ga0496103_0102110_82_606	174
1981	3300048906	Ga0496103_0303201	Ga0496103_0303201_72_596	174
1982	3300048907	Ga0496104_0128970	Ga0496104_0128970_1625_2149	174
1983	3300048907	Ga0496104_0490009	Ga0496104_0490009_481_1005	174
1984	3300048907	Ga0496104_1330785	Ga0496104_1330785_57_581	174
1985	3300048908	Ga0496105_0262090	Ga0496105_0262090_91_615	174
1986	3300048909	Ga0496106_0008373	Ga0496106_0008373_2386_2919	174
1987	3300048909	Ga0496106_0047854	Ga0496106_0047854_2224_2748	174
1988	3300048909	Ga0496106_0123767	Ga0496106_0123767_856_1380	174
1989	3300048909	Ga0496106_0324189	Ga0496106_0324189_648_1172	174
1990	3300048909	Ga0496106_0834712	Ga0496106_0834712_137_661	174
1991	3300048911	Ga0496108_0047160	Ga0496108_0047160_2211_2735	174
1992	3300048911	Ga0496108_0108888	Ga0496108_0108888_271_795	174
1993	3300048911	Ga0496108_0220303	Ga0496108_0220303_850_1374	174
1994	3300048912	Ga0496109_0377003	Ga0496109_0377003_340_864	174
1995	3300048912	Ga0496109_0423446	Ga0496109_0423446_114_638	174
1996	3300048913	Ga0496110_0430106	Ga0496110_0430106_138_662	174
1997	3300048913	Ga0496110_0434940	Ga0496110_0434940_368_892	174
1998	3300048913	Ga0496110_1475954	Ga0496110_1475954_41_565	174
1999	3300048914	Ga0496111_0627063	Ga0496111_0627063_97_621	174
2000	3300048914	Ga0496111_0649976	Ga0496111_0649976_197_721	174
2001	3300048915	Ga0496112_0332263	Ga0496112_0332263_495_1019	174
2002	3300048916	Ga0496113_0069556	Ga0496113_0069556_1807_2331	174
2003	3300048916	Ga0496113_0390096	Ga0496113_0390096_44_568	174
2004	3300049514	Ga0501291_002976	Ga0501291_002976_576_1100	174
2005	3300049514	Ga0501291_013499	Ga0501291_013499_486_1010	174
2006	3300049515	Ga0501292_027717	Ga0501292_027717_123_662	174
2007	3300049521	Ga0501298_004881	Ga0501298_004881_1601_2125	174
2008	3300049521	Ga0501298_117482	Ga0501298_117482_24_566	174
2009	3300049523	Ga0501300_027896	Ga0501300_027896_145_669	174
2010	3300049527	Ga0501311_041297	Ga0501311_041297_154_678	174
2011	3300049574	Ga0501038_0039911	Ga0501038_0039911_775_1299	174
2012	3300049582	Ga0501048_0488420	Ga0501048_0488420_116_640	174
2013	3300049587	Ga0501071_0464584	Ga0501071_0464584_250_774	174
2014	3300049588	Ga0501072_1010858	Ga0501072_1010858_50_583	174
2015	3300049591	Ga0501075_0279457	Ga0501075_0279457_211_744	174
2016	3300049592	Ga0501076_0225035	Ga0501076_0225035_369_893	174
2017	3300049652	Ga0501202_013905	Ga0501202_013905_308_832	174
2018	3300049654	Ga0501207_005674	Ga0501207_005674_843_1367	174
2019	3300049655	Ga0501208_035642	Ga0501208_035642_91_615	174
2020	3300049655	Ga0501208_045339	Ga0501208_045339_24_548	174
2021	3300049658	Ga0501211_015889	Ga0501211_015889_115_639	174
2022	3300049660	Ga0501216_023919	Ga0501216_023919_506_1030	174
2023	3300049661	Ga0501217_001526	Ga0501217_001526_2737_3261	174
2024	3300049661	Ga0501217_005252	Ga0501217_005252_102_626	174
2025	3300049663	Ga0501223_004673	Ga0501223_004673_1000_1524	174
2026	3300049665	Ga0501227_000676	Ga0501227_000676_3584_4108	174
2027	3300049665	Ga0501227_013089	Ga0501227_013089_1279_1803	174
2028	3300049668	Ga0501233_003160	Ga0501233_003160_2123_2647	174
2029	3300049668	Ga0501233_142808	Ga0501233_142808_127_651	174
2030	3300049668	Ga0501233_225015	Ga0501233_225015_13_537	174
2031	3300049669	Ga0501235_029363	Ga0501235_029363_638_1162	174
2032	3300049672	Ga0501239_018843	Ga0501239_018843_218_742	174
2033	3300049675	Ga0501243_083472	Ga0501243_083472_21_545	174
2034	3300049679	Ga0501249_043687	Ga0501249_043687_391_915	174
2035	3300049684	Ga0501255_015872	Ga0501255_015872_71_595	174
2036	3300049686	Ga0501257_051495	Ga0501257_051495_237_761	174
2037	3300049686	Ga0501257_168683	Ga0501257_168683_20_544	174
2038	3300049688	Ga0501259_030183	Ga0501259_030183_153_677	174
2039	3300049689	Ga0501260_027685	Ga0501260_027685_25_549	174
2040	3300049704	Ga0501221_094256	Ga0501221_094256_59_583	174
2041	3300049705	Ga0501225_0006662	Ga0501225_0006662_419_943	174
2042	3300049705	Ga0501225_0008807	Ga0501225_0008807_502_1026	174
2043	3300049705	Ga0501225_0133885	Ga0501225_0133885_79_603	174
2044	3300049707	Ga0501234_005684	Ga0501234_005684_1356_1880	174
2045	3300049743	Ga0501081_0116859	Ga0501081_0116859_404_928	174
2046	3300049757	Ga0501232_026004	Ga0501232_026004_44_568	174
2047	3300049765	Ga0501268_002066	Ga0501268_002066_24_548	174
2048	3300049769	Ga0501272_008067	Ga0501272_008067_417_941	174
2049	3300049779	Ga0501283_000878	Ga0501283_000878_824_1348	174
2050	3300049779	Ga0501283_028080	Ga0501283_028080_170_694	174
2051	3300050507	nmdc:mga05p37_119270_c1	nmdc:mga05p37_119270_c1_55_591	174
2052	3300050507	nmdc:mga05p37_149322_c1	nmdc:mga05p37_149322_c1_859_1392	174
2053	3300050507	nmdc:mga05p37_16987_c1	nmdc:mga05p37_16987_c1_4839_5372	174
2054	3300050507	nmdc:mga05p37_240436_c1	nmdc:mga05p37_240436_c1_1483_2007	174
2055	3300050507	nmdc:mga05p37_24636_c1	nmdc:mga05p37_24636_c1_2824_3357	174
2056	3300050507	nmdc:mga05p37_432396_c1	nmdc:mga05p37_432396_c1_433_957	174
2057	3300050507	nmdc:mga05p37_610443_c1	nmdc:mga05p37_610443_c1_23_547	174
2058	3300050507	nmdc:mga05p37_62370_c1	nmdc:mga05p37_62370_c1_1723_2247	174
2059	3300050507	nmdc:mga05p37_9408_c1	nmdc:mga05p37_9408_c1_7899_8423	174
2060	3300050508	nmdc:mga09592_136130_c1	nmdc:mga09592_136130_c1_1174_1698	174
2061	3300050508	nmdc:mga09592_652482_c1	nmdc:mga09592_652482_c1_44_568	174
2062	3300050508	nmdc:mga09592_824948_c1	nmdc:mga09592_824948_c1_13_537	174
2063	3300050509	nmdc:mga0qj67_19355_c1	nmdc:mga0qj67_19355_c1_1147_1671	174
2064	3300050510	nmdc:mga06r32_119210_c1	nmdc:mga06r32_119210_c1_1154_1678	174
2065	3300050510	nmdc:mga06r32_34611_c1	nmdc:mga06r32_34611_c1_1474_1998	174
2066	3300050510	nmdc:mga06r32_393544_c1	nmdc:mga06r32_393544_c1_673_1197	174
2067	3300050511	nmdc:mga08y16_1031892_c1	nmdc:mga08y16_1031892_c1_249_773	174
2068	3300050511	nmdc:mga08y16_444034_c1	nmdc:mga08y16_444034_c1_312_836	174
2069	3300050511	nmdc:mga08y16_55017_c1	nmdc:mga08y16_55017_c1_1298_1822	174
2070	3300050511	nmdc:mga08y16_581064_c1	nmdc:mga08y16_581064_c1_532_1056	174
2071	3300050512	nmdc:mga0n895_15771_c1	nmdc:mga0n895_15771_c1_6176_6700	174
2072	3300050512	nmdc:mga0n895_218271_c1	nmdc:mga0n895_218271_c1_402_926	174
2073	3300050512	nmdc:mga0n895_236290_c1	nmdc:mga0n895_236290_c1_1078_1602	174
2074	3300050512	nmdc:mga0n895_237760_c1	nmdc:mga0n895_237760_c1_977_1501	174
2075	3300050512	nmdc:mga0n895_8040_c1	nmdc:mga0n895_8040_c1_57_590	174
2076	3300050512	nmdc:mga0n895_880477_c1	nmdc:mga0n895_880477_c1_138_662	174
2077	3300050512	nmdc:mga0n895_922157_c1	nmdc:mga0n895_922157_c1_256_789	174
2078	3300050512	nmdc:mga0n895_94842_c1	nmdc:mga0n895_94842_c1_2446_2970	174
2079	3300050513	nmdc:mga0rr50_1043031_c1	nmdc:mga0rr50_1043031_c1_14_547	174
2080	3300050513	nmdc:mga0rr50_432_c1	nmdc:mga0rr50_432_c1_1522_2055	174
2081	3300050513	nmdc:mga0rr50_66420_c1	nmdc:mga0rr50_66420_c1_2091_2615	174
2082	3300050513	nmdc:mga0rr50_8964_c1	nmdc:mga0rr50_8964_c1_3123_3647	174
2083	3300050514	nmdc:mga08x19_1070673_c1	nmdc:mga08x19_1070673_c1_23_556	174
2084	3300050514	nmdc:mga08x19_27_c1	nmdc:mga08x19_27_c1_222634_223167	174
2085	3300050515	nmdc:mga0a205_132567_c1	nmdc:mga0a205_132567_c1_193_717	174
2086	3300050515	nmdc:mga0a205_136547_c1	nmdc:mga0a205_136547_c1_992_1525	174
2087	3300050515	nmdc:mga0a205_205687_c1	nmdc:mga0a205_205687_c1_1119_1643	174
2088	3300050515	nmdc:mga0a205_22524_c1	nmdc:mga0a205_22524_c1_413_946	174
2089	3300050515	nmdc:mga0a205_22736_c1	nmdc:mga0a205_22736_c1_3739_4263	174
2090	3300050515	nmdc:mga0a205_228815_c1	nmdc:mga0a205_228815_c1_73_606	174
2091	3300050515	nmdc:mga0a205_234372_c1	nmdc:mga0a205_234372_c1_585_1109	174
2092	3300050515	nmdc:mga0a205_32992_c2	nmdc:mga0a205_32992_c2_559_1083	174
2093	3300050515	nmdc:mga0a205_55769_c1	nmdc:mga0a205_55769_c1_476_1000	174
2094	3300059493	Ga0587077_049887	Ga0587077_049887_137_661	174
2095	3300059504	Ga0587082_060241	Ga0587082_060241_127_654	174
2096	3300061734	Ga0530510_0109649	Ga0530510_0109649_803_1327	174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

17

115

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ug7-assembly1.cif.gz_LJ	70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b	0.9478	3	129
8phj-assembly1.cif.gz_5	ca4-bound cami1 in complex with 70s ribosome	0.9297	1	130
5gad-assembly1.cif.gz_I	rnc-srp-sr complex early state	0.9296	1	125
7unu-assembly1.cif.gz_I	pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b)	0.9269	1	118
7as8-assembly1.cif.gz_L	bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo	0.9249	5	128

ID	Description	Score	Start	End	Superfamily
af_Q9VPL3_26_196_3.30.70.1730	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain	0.8952	1	129	3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain	0.892	2	132	3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain	0.8796	2	132	3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain	0.8726	2	129	3.30.70.1730
6dzpI00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain	0.8653	2	129	3.30.70.1730

ID	Description	Score	Start	End	GO Terms
AF-A0A7V5X184-F1-model_v4	50S ribosomal protein L10	0.97	2	112	GO:0003735 GO:0006412 GO:0015934
AF-A0A7V5X184-F1-model_v4	50S ribosomal protein L10	0.9615	2	112	GO:0003735 GO:0006412 GO:0015934
AF-A0A2G9XPL3-F1-model_v4	50S ribosomal protein L10	0.957	2	112	GO:0003735 GO:0006412 GO:0015934
AF-A0A529X4S3-F1-model_v4	deleted	0.9557	2	134
AF-A0A382TRY1-F1-model_v4	50S ribosomal protein L10	0.9553	2	131	GO:0005840 GO:1990904

Feature Viewer

pLDDT	pTM	Quality
77.04	0.61	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496388

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00466

Ribosomal_L10

Ribosomal protein L10

17

115

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map