F496282

General Info

Members Datasets Scaffolds Average Seq Length
2026 676 1941 169

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10199574|Ga0105242_101995742
Length 195
Sequence LFDAFSLREPVSTSLENALEKIREKKMDAAELRAMQAPIKERYKSDPSAAVITLKAKGSIDNEGLTCKVETGRALAVAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAVDVPLRSGKVIAEGDLDFRGTLGVDKEAPVGFAEIRLRFDVETDAPQDKLDLLLKLTERYCVVYQTIRNGPKVSVSMKRV

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
13 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
16 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
17 2643221692 Nocardia sp. Root136 Isolate Unclassified
18 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
23 2791355199
24 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
33 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
34 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
35 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
36 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
37 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
38 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
39 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
40 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
41 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
42 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
43 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
44 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
45 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
46 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
47 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
48 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
49 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
50 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
51 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
52 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
53 2904699407
54 2906610324
55 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
56 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
57 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
58 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
59 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
60 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
61 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
62 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
63 2922425934
64 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
65 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
66 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
67 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
68 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
69 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
70 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
71 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
72 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
73 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
74 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
75 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
76 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
77 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
78 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
79 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
80 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
81 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
82 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
83 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
84 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
85 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
86 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
87 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
89 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
90 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
91 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
93 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
98 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
99 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
100 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
105 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
106 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
107 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
108 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
109 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
110 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
114 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
115 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
118 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
119 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
123 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
127 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
128 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
129 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
130 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
131 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
134 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
135 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
136 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
137 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
138 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
139 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
140 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
141 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
142 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
143 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
144 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
145 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
146 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
147 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
148 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
153 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
156 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
157 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
158 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
159 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
160 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
161 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
162 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
163 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
164 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
165 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
166 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
167 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
168 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
169 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
170 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
171 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
172 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
173 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
174 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
175 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
176 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
177 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
178 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
179 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
180 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
181 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
187 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
188 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
189 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
190 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
191 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
192 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
193 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
194 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
195 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
196 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
197 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
199 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
200 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
201 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
202 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
203 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
204 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
205 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
206 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
207 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
208 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
209 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
210 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
211 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
212 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
213 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
217 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
218 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
219 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
220 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
221 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
222 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
223 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
224 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
225 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
226 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
227 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
228 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
229 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
230 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
231 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
232 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
233 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
234 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
235 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
236 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
237 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
238 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
242 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
243 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
244 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
247 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
251 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
322 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
323 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
324 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
325 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
332 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
337 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
338 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
339 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
340 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
341 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
342 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
343 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
344 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
345 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
346 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
347 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
348 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
349 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
350 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
351 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
352 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
353 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
354 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
355 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
356 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
357 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
358 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
359 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
362 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
363 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
364 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
365 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
366 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
367 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
368 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
369 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
370 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
371 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
372 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
373 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
374 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
375 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
376 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
377 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
378 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
379 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
380 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
381 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
382 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
383 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
384 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
385 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
386 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
387 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
388 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
389 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
390 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
391 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
392 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
393 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
394 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
395 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
396 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
397 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
398 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
399 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
400 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
401 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
402 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
403 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
404 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
405 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
406 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
407 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
408 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
409 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
410 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
411 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
412 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
413 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
414 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
415 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
416 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
417 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
418 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
419 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
420 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
421 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
422 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
423 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
424 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
425 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
426 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
427 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
428 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
429 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
430 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
431 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
432 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
433 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
434 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
435 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
436 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
437 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
438 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
439 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
440 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
441 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
442 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
443 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
444 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
445 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
446 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
447 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
448 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
449 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
450 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
451 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
452 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
453 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
454 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
455 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
456 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
457 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
458 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
459 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
460 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
461 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
462 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
463 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
464 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
465 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
466 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
467 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
468 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
469 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
470 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
471 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
472 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
473 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
474 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
475 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
476 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
477 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
478 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
479 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
480 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
481 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
482 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
483 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
484 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
485 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
486 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
487 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
488 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
489 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
490 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
491 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
492 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
493 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
494 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
495 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
496 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
497 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
498 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
499 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
500 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
501 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
502 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
503 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
504 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
505 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
506 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
507 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
508 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
509 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
510 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
511 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
512 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
513 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
514 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
515 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
516 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
517 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
518 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
519 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
520 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
521 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
522 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
523 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
524 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
525 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
526 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
527 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
528 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
529 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
530 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
531 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
532 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
533 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
534 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
535 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
536 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
537 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
538 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
539 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
540 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
541 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
542 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
543 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
544 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
545 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
546 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
547 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
548 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
549 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
550 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
551 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
552 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
553 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
554 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
555 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
556 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
557 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
558 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
559 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
560 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
561 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
562 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
563 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
564 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
565 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
566 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
567 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
568 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
569 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
580 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
582 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
583 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
584 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
585 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
586 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
587 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
588 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
589 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
590 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
591 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
592 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
593 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
594 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
595 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
598 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
599 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
600 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
601 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
602 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
603 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
604 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
605 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
606 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
607 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
608 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
609 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
610 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
611 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
612 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
613 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
614 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
615 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
616 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
617 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
618 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
619 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
620 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
621 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
622 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
623 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
624 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
625 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
626 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
627 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
628 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
629 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
630 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
631 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
632 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
633 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
634 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
635 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
636 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
637 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
638 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
639 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
640 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
641 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
642 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
643 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
644 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
645 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
646 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
647 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
648 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
649 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
650 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
651 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
652 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
653 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
654 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
655 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
656 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
657 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
658 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
659 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
660 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
661 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
662 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
663 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
664 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
665 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
666 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
667 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
668 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
669 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
670 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
671 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
672 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
673 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
674 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
675 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
676 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0.3
Isolates 4.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 2.76
Rhizoplane 6.52
Rhizosphere 74.98
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1027587 3300000549 Bacteria 663
2 JGI24743J22301_10009719 3300001991 Bacteria 1708
3 JGI24743J22301_10037910 3300001991 Bacteria 962
4 JGI24750J21931_1007628 3300002070 Bacteria 1364
5 JGI24745J21846_1018346 3300002073 Bacteria 816
6 JGI24748J21848_1004537 3300002074 Bacteria 1597
7 JGI24738J21930_10009063 3300002075 Bacteria 2250
8 JGI24738J21930_10073819 3300002075 Bacteria 709
9 JGI24749J21850_1011994 3300002076 Bacteria 1216
10 JGI24744J21845_10004515 3300002077 Bacteria 2875
11 JGI24744J21845_10030771 3300002077 Bacteria 1028
12 JGI24033J26618_1004751 3300002155 Bacteria 1475
13 JGI24034J26672_10040564 3300002239 Bacteria 780
14 JGI24742J22300_10015879 3300002244 Bacteria 1268
15 JGI24751J29686_10039394 3300002459 Bacteria 978
16 JGI25406J46586_10017548 3300003203 Bacteria 2957
17 JGI25165J46597_1008649 3300003214 Bacteria 1582
18 JGI25153J46596_10000445 3300003215 Bacteria 26572
19 JGI25153J46596_10000538 3300003215 Bacteria 23717
20 JGI25153J46596_10020462 3300003215 Bacteria 2501
21 JGI25153J46596_10026195 3300003215 Bacteria 2069
22 JGI25153J46596_10033134 3300003215 Bacteria 1711
23 JGI25153J46596_10036294 3300003215 Bacteria 1583
24 JGI25160J50197_1001101 3300003354 Bacteria 13803
25 JGI25404J52841_10003732 3300003659 Bacteria 3033
26 JGI25404J52841_10011646 3300003659 Bacteria 1899
27 JGI25404J52841_10015139 3300003659 Bacteria 1675
28 Ga0055539_1004788 3300003752 Bacteria 1788
29 Ga0055539_1005854 3300003752 Bacteria 1585
30 Ga0055542_1009354 3300003762 Bacteria 1853
31 Ga0055526_1037784 3300003771 Bacteria 1256
32 Ga0055524_1068071 3300003775 Bacteria 699
33 Ga0055531_10008929 3300003794 Bacteria 5195
34 Ga0055543_1002130 3300004625 Bacteria 6850
35 Ga0065165_1002055 3300005262 Bacteria 18607
36 Ga0065712_10075403 3300005290 Bacteria 3870
37 Ga0065715_10112493 3300005293 Bacteria 2527
38 Ga0070658_10010443 3300005327 Bacteria 7446
39 Ga0070658_10023055 3300005327 Bacteria 4998
40 Ga0070658_10058666 3300005327 Bacteria 3133
41 Ga0070658_10281558 3300005327 Bacteria 1415
42 Ga0070658_10297149 3300005327 Bacteria 1377
43 Ga0070658_10375666 3300005327 Bacteria 1219
44 Ga0070658_10411161 3300005327 Bacteria 1163
45 Ga0070676_10071522 3300005328 Bacteria 2083
46 Ga0070676_10096512 3300005328 Bacteria 1819
47 Ga0070676_10131929 3300005328 Bacteria 1581
48 Ga0070683_100002920 3300005329 Bacteria 13693
49 Ga0070683_100033897 3300005329 Bacteria 4660
50 Ga0070683_100071352 3300005329 Bacteria 3241
51 Ga0070683_100106239 3300005329 Bacteria 2647
52 Ga0070683_100449926 3300005329 Bacteria 1229
53 Ga0070683_100529002 3300005329 Bacteria 1127
54 Ga0070690_100012778 3300005330 Bacteria 4945
55 Ga0070690_100080433 3300005330 Bacteria 2131
56 Ga0070690_100108566 3300005330 Bacteria 1849
57 Ga0070690_100229123 3300005330 Bacteria 1305
58 Ga0070670_100311224 3300005331 Bacteria 1379
59 Ga0070670_100685343 3300005331 Bacteria 921
60 Ga0070670_100709646 3300005331 Bacteria 905
61 Ga0070677_10013125 3300005333 Bacteria 2891
62 Ga0070677_10321326 3300005333 Bacteria 793
63 Ga0068869_100018129 3300005334 Bacteria 4786
64 Ga0068869_100062201 3300005334 Bacteria 2739
65 Ga0068869_100102090 3300005334 Bacteria 2170
66 Ga0068869_100445491 3300005334 Bacteria 1072
67 Ga0070666_10365764 3300005335 Bacteria 1034
68 Ga0070666_10824663 3300005335 Bacteria 684
69 Ga0070680_100004517 3300005336 Bacteria 10476
70 Ga0070680_100011990 3300005336 Bacteria 6725
71 Ga0070680_100025468 3300005336 Bacteria 4729
72 Ga0070680_100093369 3300005336 Bacteria 2493
73 Ga0070680_100140626 3300005336 Bacteria 2024
74 Ga0070680_100527927 3300005336 Bacteria 1011
75 Ga0070682_100008321 3300005337 Bacteria 5848
76 Ga0070682_100053757 3300005337 Bacteria 2525
77 Ga0070682_100091873 3300005337 Bacteria 1987
78 Ga0070682_100258728 3300005337 Bacteria 1259
79 Ga0070682_100392964 3300005337 Bacteria 1047
80 Ga0068868_100014820 3300005338 Bacteria 5754
81 Ga0068868_100071263 3300005338 Bacteria 2772
82 Ga0068868_100096508 3300005338 Bacteria 2388
83 Ga0068868_100250434 3300005338 Bacteria 1491
84 Ga0070660_100032157 3300005339 Bacteria 3946
85 Ga0070660_100044465 3300005339 Bacteria 3397
86 Ga0070660_100090963 3300005339 Bacteria 2406
87 Ga0070660_100550158 3300005339 Bacteria 963
88 Ga0070660_100929522 3300005339 Bacteria 734
89 Ga0070689_100011439 3300005340 Bacteria 6357
90 Ga0070689_100062043 3300005340 Bacteria 2908
91 Ga0070689_100123365 3300005340 Bacteria 2071
92 Ga0070689_100206612 3300005340 Bacteria 1606
93 Ga0070691_10056135 3300005341 Bacteria 1887
94 Ga0070691_10184414 3300005341 Bacteria 1088
95 Ga0070687_100006752 3300005343 Bacteria 4728
96 Ga0070687_100437414 3300005343 Bacteria 867
97 Ga0070661_100065312 3300005344 Bacteria 2674
98 Ga0070661_100097435 3300005344 Bacteria 2183
99 Ga0070661_100484994 3300005344 Bacteria 988
100 Ga0070668_100095925 3300005347 Bacteria 2343
101 Ga0070668_100172544 3300005347 Bacteria 1761
102 Ga0070668_100283056 3300005347 Bacteria 1385
103 Ga0070668_101006843 3300005347 Bacteria 749
104 Ga0070669_100082696 3300005353 Bacteria 2394
105 Ga0070669_100209541 3300005353 Bacteria 1537
106 Ga0070669_100322882 3300005353 Bacteria 1247
107 Ga0070675_100014378 3300005354 Bacteria 6241
108 Ga0070675_100060400 3300005354 Bacteria 3130
109 Ga0070675_100215032 3300005354 Bacteria 1672
110 Ga0070671_100074013 3300005355 Bacteria 2845
111 Ga0070671_100079042 3300005355 Bacteria 2749
112 Ga0070671_100564920 3300005355 Bacteria 982
113 Ga0070671_100632514 3300005355 Bacteria 926
114 Ga0070671_100716355 3300005355 Bacteria 869
115 Ga0070671_101178829 3300005355 Bacteria 674
116 Ga0070674_100080455 3300005356 Bacteria 2326
117 Ga0070674_100138145 3300005356 Bacteria 1826
118 Ga0070674_100443754 3300005356 Bacteria 1069
119 Ga0070673_100060776 3300005364 Bacteria 2995
120 Ga0070673_100200613 3300005364 Bacteria 1718
121 Ga0070673_100426445 3300005364 Bacteria 1190
122 Ga0070688_100650507 3300005365 Bacteria 812
123 Ga0070659_100058613 3300005366 Bacteria 3039
124 Ga0070659_100121177 3300005366 Bacteria 2119
125 Ga0070659_100211934 3300005366 Bacteria 1597
126 Ga0070667_100087531 3300005367 Bacteria 2673
127 Ga0070667_100174737 3300005367 Bacteria 1898
128 Ga0070667_100275006 3300005367 Bacteria 1511
129 Ga0070667_100363867 3300005367 Bacteria 1311
130 Ga0070667_101135114 3300005367 Bacteria 731
131 Ga0070703_10013163 3300005406 Bacteria 2346
132 Ga0070709_10013289 3300005434 Bacteria 4624
133 Ga0070709_10025008 3300005434 Bacteria 3523
134 Ga0070709_10239640 3300005434 Bacteria 1302
135 Ga0070709_10414769 3300005434 Bacteria 1008
136 Ga0070709_10773526 3300005434 Bacteria 752
137 Ga0070714_100040957 3300005435 Bacteria 3907
138 Ga0070714_100133734 3300005435 Bacteria 2218
139 Ga0070714_100141641 3300005435 Bacteria 2159
140 Ga0070714_100169470 3300005435 Bacteria 1981
141 Ga0070714_100332131 3300005435 Bacteria 1424
142 Ga0070714_100483835 3300005435 Bacteria 1179
143 Ga0070713_100044362 3300005436 Bacteria 3640
144 Ga0070713_100136921 3300005436 Bacteria 2165
145 Ga0070713_100219612 3300005436 Bacteria 1724
146 Ga0070713_100250993 3300005436 Bacteria 1614
147 Ga0070713_100304341 3300005436 Bacteria 1468
148 Ga0070713_100372287 3300005436 Bacteria 1329
149 Ga0070710_10038133 3300005437 Bacteria 2637
150 Ga0070710_10197989 3300005437 Bacteria 1267
151 Ga0070701_10048720 3300005438 Bacteria 2187
152 Ga0070701_10354308 3300005438 Bacteria 918
153 Ga0070711_100006218 3300005439 Bacteria 7186
154 Ga0070711_100055479 3300005439 Bacteria 2737
155 Ga0070711_100110072 3300005439 Bacteria 2020
156 Ga0070711_100377433 3300005439 Bacteria 1145
157 Ga0070711_100788969 3300005439 Bacteria 805
158 Ga0070711_101136292 3300005439 Bacteria 674
159 Ga0070705_100233320 3300005440 Bacteria 1281
160 Ga0070700_100010066 3300005441 Bacteria 5206
161 Ga0070700_100077355 3300005441 Bacteria 2139
162 Ga0070700_100080179 3300005441 Bacteria 2105
163 Ga0070700_100154579 3300005441 Bacteria 1572
164 Ga0070708_100274295 3300005445 Bacteria 1586
165 Ga0070663_100022934 3300005455 Bacteria 4179
166 Ga0070663_100111428 3300005455 Bacteria 2056
167 Ga0070663_100212104 3300005455 Bacteria 1517
168 Ga0070663_101249031 3300005455 Bacteria 654
169 Ga0070678_100025622 3300005456 Bacteria 3972
170 Ga0070678_100058936 3300005456 Bacteria 2820
171 Ga0070678_100129350 3300005456 Bacteria 2004
172 Ga0070678_100140336 3300005456 Bacteria 1933
173 Ga0070678_100386158 3300005456 Bacteria 1213
174 Ga0070678_100494111 3300005456 Bacteria 1079
175 Ga0070678_101137492 3300005456 Bacteria 722
176 Ga0070662_100084032 3300005457 Bacteria 2377
177 Ga0070662_100155187 3300005457 Bacteria 1786
178 Ga0070662_100338166 3300005457 Bacteria 1231
179 Ga0070681_10036718 3300005458 Bacteria 4920
180 Ga0070681_10066430 3300005458 Bacteria 3575
181 Ga0070681_10105930 3300005458 Bacteria 2753
182 Ga0070681_10107433 3300005458 Bacteria 2731
183 Ga0070681_10122113 3300005458 Bacteria 2538
184 Ga0070681_10134000 3300005458 Bacteria 2408
185 Ga0070681_10175529 3300005458 Bacteria 2065
186 Ga0070681_10197721 3300005458 Bacteria 1929
187 Ga0070681_10265425 3300005458 Bacteria 1628
188 Ga0068867_100046802 3300005459 Bacteria 3178
189 Ga0068867_100189445 3300005459 Bacteria 1640
190 Ga0068867_100326605 3300005459 Bacteria 1273
191 Ga0070685_10038385 3300005466 Bacteria 2716
192 Ga0070706_100013032 3300005467 Bacteria 7693
193 Ga0070707_100041318 3300005468 Bacteria 4414
194 Ga0070707_100162465 3300005468 Bacteria 2176
195 Ga0070707_100217632 3300005468 Bacteria 1861
196 Ga0070698_100069010 3300005471 Bacteria 3551
197 Ga0070698_100220944 3300005471 Bacteria 1828
198 Ga0070698_100609948 3300005471 Bacteria 1032
199 Ga0070698_101478572 3300005471 Bacteria 631
200 Ga0070699_100135858 3300005518 Bacteria 2169
201 Ga0070699_100547926 3300005518 Bacteria 1053
202 Ga0070699_101104152 3300005518 Bacteria 728
203 Ga0070679_100030103 3300005530 Bacteria 5358
204 Ga0070679_100069355 3300005530 Bacteria 3516
205 Ga0070679_100175282 3300005530 Bacteria 2117
206 Ga0070679_100316065 3300005530 Bacteria 1511
207 Ga0070679_100548773 3300005530 Bacteria 1099
208 Ga0070679_100685099 3300005530 Bacteria 968
209 Ga0070679_100689173 3300005530 Bacteria 964
210 Ga0070684_100001856 3300005535 Bacteria 15468
211 Ga0070684_100022904 3300005535 Bacteria 5216
212 Ga0070684_100040770 3300005535 Bacteria 4000
213 Ga0070684_100295619 3300005535 Bacteria 1485
214 Ga0070684_100518357 3300005535 Bacteria 1105
215 Ga0070697_100040235 3300005536 Bacteria 3781
216 Ga0070697_100053543 3300005536 Bacteria 3280
217 Ga0070697_100239246 3300005536 Bacteria 1550
218 Ga0070697_100890162 3300005536 Bacteria 790
219 Ga0068853_100017579 3300005539 Bacteria 5901
220 Ga0068853_100098454 3300005539 Bacteria 2582
221 Ga0068853_100166956 3300005539 Bacteria 1989
222 Ga0068853_100502380 3300005539 Bacteria 1145
223 Ga0068853_100856388 3300005539 Bacteria 872
224 Ga0068853_100880036 3300005539 Bacteria 860
225 Ga0068853_100918978 3300005539 Bacteria 841
226 Ga0070672_100023222 3300005543 Bacteria 4568
227 Ga0070672_100224870 3300005543 Bacteria 1575
228 Ga0070672_100560182 3300005543 Bacteria 993
229 Ga0070686_100012361 3300005544 Bacteria 4859
230 Ga0070686_100270266 3300005544 Bacteria 1250
231 Ga0070696_100099952 3300005546 Bacteria 2077
232 Ga0070696_100217391 3300005546 Bacteria 1433
233 Ga0070696_100789884 3300005546 Bacteria 781
234 Ga0070693_100112444 3300005547 Bacteria 1677
235 Ga0070693_100112711 3300005547 Bacteria 1676
236 Ga0070693_100218251 3300005547 Bacteria 1248
237 Ga0070693_100276115 3300005547 Bacteria 1124
238 Ga0070665_100023227 3300005548 Bacteria 6245
239 Ga0070665_100025414 3300005548 Bacteria 5968
240 Ga0070665_100031110 3300005548 Bacteria 5372
241 Ga0070665_100033366 3300005548 Bacteria 5180
242 Ga0070665_100056291 3300005548 Bacteria 3943
243 Ga0070665_100146480 3300005548 Bacteria 2364
244 Ga0070665_100607773 3300005548 Bacteria 1106
245 Ga0070665_101035512 3300005548 Bacteria 833
246 Ga0070665_101572687 3300005548 Bacteria 665
247 Ga0068855_100057202 3300005563 Bacteria 4571
248 Ga0068855_100069808 3300005563 Bacteria 4088
249 Ga0068855_100093904 3300005563 Bacteria 3459
250 Ga0068855_100107373 3300005563 Bacteria 3207
251 Ga0068855_100137684 3300005563 Bacteria 2785
252 Ga0068855_100289943 3300005563 Bacteria 1815
253 Ga0068855_100340605 3300005563 Bacteria 1653
254 Ga0068855_100546383 3300005563 Bacteria 1254
255 Ga0068855_100913858 3300005563 Bacteria 926
256 Ga0068855_101406242 3300005563 Bacteria 719
257 Ga0070664_100084922 3300005564 Bacteria 2733
258 Ga0070664_100267794 3300005564 Bacteria 1538
259 Ga0070664_100428700 3300005564 Bacteria 1212
260 Ga0068857_100039684 3300005577 Bacteria 4171
261 Ga0068857_100068370 3300005577 Bacteria 3162
262 Ga0068857_100152132 3300005577 Bacteria 2097
263 Ga0068857_100776624 3300005577 Bacteria 914
264 Ga0068854_100273279 3300005578 Bacteria 1358
265 Ga0068854_100666804 3300005578 Bacteria 894
266 Ga0068854_100676579 3300005578 Bacteria 888
267 Ga0068856_100000013 3300005614 Bacteria 165611
268 Ga0068856_100017144 3300005614 Bacteria 7019
269 Ga0068856_100093684 3300005614 Bacteria 2989
270 Ga0068856_100184528 3300005614 Bacteria 2099
271 Ga0068856_100197292 3300005614 Bacteria 2027
272 Ga0068856_100250305 3300005614 Bacteria 1787
273 Ga0068856_100275892 3300005614 Bacteria 1698
274 Ga0068856_100457637 3300005614 Bacteria 1297
275 Ga0068856_101119450 3300005614 Bacteria 804
276 Ga0070702_100061564 3300005615 Bacteria 2186
277 Ga0070702_100129897 3300005615 Bacteria 1589
278 Ga0070702_100566424 3300005615 Bacteria 846
279 Ga0070702_100670543 3300005615 Bacteria 787
280 Ga0068852_100031538 3300005616 Bacteria 4375
281 Ga0068852_100082317 3300005616 Bacteria 2860
282 Ga0068852_100108320 3300005616 Bacteria 2521
283 Ga0068852_100154035 3300005616 Bacteria 2139
284 Ga0068852_100159012 3300005616 Bacteria 2108
285 Ga0068852_100212762 3300005616 Bacteria 1835
286 Ga0068859_100099931 3300005617 Bacteria 2956
287 Ga0068859_100101961 3300005617 Bacteria 2927
288 Ga0068859_100194525 3300005617 Bacteria 2112
289 Ga0068859_100215161 3300005617 Bacteria 2009
290 Ga0068859_100345505 3300005617 Bacteria 1582
291 Ga0068859_100598720 3300005617 Bacteria 1195
292 Ga0068859_101349884 3300005617 Bacteria 786
293 Ga0068864_100017486 3300005618 Bacteria 5978
294 Ga0068864_100017603 3300005618 Bacteria 5957
295 Ga0068864_100070903 3300005618 Bacteria 3033
296 Ga0068866_10186621 3300005718 Bacteria 1229
297 Ga0068861_100221244 3300005719 Bacteria 1600
298 Ga0068861_100425174 3300005719 Bacteria 1184
299 Ga0068851_10174101 3300005834 Bacteria 1189
300 Ga0068851_10412664 3300005834 Bacteria 796
301 Ga0068870_10065643 3300005840 Bacteria 1964
302 Ga0068870_10279102 3300005840 Bacteria 1047
303 Ga0068863_100024772 3300005841 Bacteria 5723
304 Ga0068863_100194546 3300005841 Bacteria 1949
305 Ga0068858_100067598 3300005842 Bacteria 3310
306 Ga0068858_100403594 3300005842 Bacteria 1313
307 Ga0068858_100851250 3300005842 Bacteria 890
308 Ga0068858_100858894 3300005842 Bacteria 886
309 Ga0068860_100211894 3300005843 Bacteria 1879
310 Ga0068860_100608116 3300005843 Bacteria 1099
311 Ga0068862_100063981 3300005844 Bacteria 3165
312 Ga0068862_100261705 3300005844 Bacteria 1579
313 Ga0068862_100368546 3300005844 Bacteria 1336
314 Ga0068862_100385281 3300005844 Bacteria 1308
315 Ga0068862_100581961 3300005844 Bacteria 1072
316 Ga0068862_101285052 3300005844 Bacteria 732
317 Ga0081455_10006463 3300005937 Bacteria 12561
318 Ga0081455_10022709 3300005937 Bacteria 5855
319 Ga0081455_10043487 3300005937 Bacteria 3928
320 Ga0081455_10052431 3300005937 Bacteria 3492
321 Ga0081455_10234633 3300005937 Bacteria 1352
322 Ga0081455_10235144 3300005937 Bacteria 1350
323 Ga0081455_10264508 3300005937 Bacteria 1251
324 Ga0081540_1004122 3300005983 Bacteria 11224
325 Ga0081540_1006360 3300005983 Bacteria 8622
326 Ga0081540_1012567 3300005983 Bacteria 5562
327 Ga0081540_1013330 3300005983 Bacteria 5350
328 Ga0081540_1014875 3300005983 Bacteria 4953
329 Ga0081540_1017376 3300005983 Bacteria 4456
330 Ga0081540_1017812 3300005983 Bacteria 4384
331 Ga0081540_1030686 3300005983 Bacteria 2973
332 Ga0081540_1098173 3300005983 Bacteria 1269
333 Ga0081540_1179670 3300005983 Bacteria 794
334 Ga0081540_1269898 3300005983 Bacteria 589
335 Ga0081539_10002447 3300005985 Bacteria 26205
336 Ga0081539_10037657 3300005985 Bacteria 2878
337 Ga0081539_10079348 3300005985 Bacteria 1730
338 Ga0070717_10003434 3300006028 Bacteria 11331
339 Ga0070717_10005509 3300006028 Bacteria 9241
340 Ga0070717_10138655 3300006028 Bacteria 2096
341 Ga0070717_10641700 3300006028 Bacteria 964
342 Ga0075365_10001966 3300006038 Bacteria 9711
343 Ga0075365_10062073 3300006038 Bacteria 2498
344 Ga0075365_10203161 3300006038 Bacteria 1388
345 Ga0075365_10329923 3300006038 Bacteria 1075
346 Ga0075365_10436545 3300006038 Bacteria 925
347 Ga0075365_10674500 3300006038 Bacteria 730
348 Ga0075368_10099444 3300006042 Bacteria 1193
349 Ga0075368_10141359 3300006042 Bacteria 1003
350 Ga0075368_10237068 3300006042 Bacteria 777
351 Ga0075363_100005870 3300006048 Bacteria 5522
352 Ga0075363_100043917 3300006048 Bacteria 2366
353 Ga0075363_100322757 3300006048 Bacteria 898
354 Ga0075363_100720016 3300006048 Bacteria 603
355 Ga0075364_10039883 3300006051 Bacteria 3045
356 Ga0075364_10090748 3300006051 Bacteria 2027
357 Ga0075364_10125039 3300006051 Bacteria 1723
358 Ga0075364_10416085 3300006051 Bacteria 917
359 Ga0070716_100144326 3300006173 Bacteria 1523
360 Ga0070712_100009696 3300006175 Bacteria 6069
361 Ga0070712_100424231 3300006175 Bacteria 1103
362 Ga0070712_100520976 3300006175 Bacteria 999
363 Ga0070712_101063277 3300006175 Bacteria 701
364 Ga0075362_10155827 3300006177 Bacteria 1098
365 Ga0075362_10559685 3300006177 Bacteria 588
366 Ga0075367_10015356 3300006178 Bacteria 4160
367 Ga0075367_10034293 3300006178 Bacteria 2931
368 Ga0075367_10115519 3300006178 Bacteria 1650
369 Ga0075367_10128510 3300006178 Bacteria 1565
370 Ga0075367_10345681 3300006178 Bacteria 938
371 Ga0075367_10473052 3300006178 Bacteria 794
372 Ga0075369_10002852 3300006186 Bacteria 6230
373 Ga0075369_10236182 3300006186 Bacteria 847
374 Ga0075369_10321851 3300006186 Bacteria 723
375 Ga0075366_10090740 3300006195 Bacteria 1830
376 Ga0075366_10272532 3300006195 Bacteria 1034
377 Ga0097621_100070157 3300006237 Bacteria 2893
378 Ga0097621_100155698 3300006237 Bacteria 1961
379 Ga0097621_100671714 3300006237 Bacteria 952
380 Ga0075370_10083850 3300006353 Bacteria 1834
381 Ga0075370_10293436 3300006353 Bacteria 966
382 Ga0075370_10387463 3300006353 Bacteria 837
383 Ga0068871_100109390 3300006358 Bacteria 2323
384 Ga0068871_100207019 3300006358 Bacteria 1695
385 Ga0068871_100761209 3300006358 Bacteria 891
386 Ga0075428_100000690 3300006844 Bacteria 34808
387 Ga0075430_100007503 3300006846 Bacteria 9209
388 Ga0075430_100258063 3300006846 Bacteria 1444
389 Ga0075431_100000098 3300006847 Bacteria 54303
390 Ga0075433_10904746 3300006852 Bacteria 770
391 Ga0075434_100039351 3300006871 Bacteria 4685
392 Ga0075434_100154970 3300006871 Bacteria 2311
393 Ga0075434_100311800 3300006871 Bacteria 1594
394 Ga0075434_100509818 3300006871 Bacteria 1223
395 Ga0075434_100539142 3300006871 Bacteria 1187
396 Ga0075434_101387091 3300006871 Bacteria 713
397 Ga0075429_100031980 3300006880 Bacteria 4575
398 Ga0068865_100017935 3300006881 Bacteria 4561
399 Ga0068865_100053891 3300006881 Bacteria 2792
400 Ga0068865_100058965 3300006881 Bacteria 2683
401 Ga0068865_100169922 3300006881 Bacteria 1670
402 Ga0068865_100204534 3300006881 Bacteria 1535
403 Ga0075436_100085088 3300006914 Bacteria 2195
404 Ga0075436_100947626 3300006914 Bacteria 645
405 Ga0097620_100099929 3300006931 Bacteria 2956
406 Ga0097620_100101966 3300006931 Bacteria 2927
407 Ga0097620_100194522 3300006931 Bacteria 2112
408 Ga0097620_100215163 3300006931 Bacteria 2009
409 Ga0097620_100345513 3300006931 Bacteria 1582
410 Ga0097620_100598735 3300006931 Bacteria 1195
411 Ga0097620_101349687 3300006931 Bacteria 786
412 Ga0099824_1012152 3300006942 Bacteria 9493
413 Ga0099824_1018537 3300006942 Bacteria 5686
414 Ga0099822_1000008 3300006943 Bacteria 76583
415 Ga0075435_100130154 3300007076 Bacteria 2105
416 Ga0075435_100711061 3300007076 Bacteria 873
417 Ga0075435_100749138 3300007076 Bacteria 850
418 Ga0099794_10013587 3300007265 Bacteria 3547
419 Ga0099794_10187494 3300007265 Bacteria 1057
420 Ga0099795_10004402 3300007788 Bacteria 3629
421 Ga0105251_10069877 3300009011 Bacteria 1636
422 Ga0105251_10490319 3300009011 Bacteria 573
423 Ga0105244_10205065 3300009036 Bacteria 929
424 Ga0105250_10101097 3300009092 Bacteria 1176
425 Ga0105240_10037240 3300009093 Bacteria 6252
426 Ga0105240_10056793 3300009093 Bacteria 4896
427 Ga0105240_10152791 3300009093 Bacteria 2748
428 Ga0105240_10303575 3300009093 Bacteria 1825
429 Ga0105240_10379919 3300009093 Bacteria 1596
430 Ga0105240_10386969 3300009093 Bacteria 1578
431 Ga0105240_10729597 3300009093 Bacteria 1079
432 Ga0105240_10862204 3300009093 Bacteria 977
433 Ga0105240_10943689 3300009093 Bacteria 926
434 Ga0105240_10976025 3300009093 Bacteria 907
435 Ga0111539_10003064 3300009094 Bacteria 22144
436 Ga0111539_10160811 3300009094 Bacteria 2626
437 Ga0111539_11220177 3300009094 Bacteria 873
438 Ga0105245_10028246 3300009098 Bacteria 4945
439 Ga0105245_10034624 3300009098 Bacteria 4480
440 Ga0105245_10610542 3300009098 Bacteria 1118
441 Ga0105245_10817222 3300009098 Bacteria 971
442 Ga0105247_10030601 3300009101 Bacteria 3263
443 Ga0105247_10038445 3300009101 Bacteria 2922
444 Ga0105247_10043450 3300009101 Bacteria 2753
445 Ga0105247_10045303 3300009101 Bacteria 2698
446 Ga0105247_10105410 3300009101 Bacteria 1807
447 Ga0105247_10248229 3300009101 Bacteria 1215
448 Ga0105247_10439353 3300009101 Bacteria 938
449 Ga0105247_10957894 3300009101 Bacteria 665
450 Ga0105247_10964991 3300009101 Bacteria 663
451 Ga0114129_10002171 3300009147 Bacteria 27014
452 Ga0114129_10324567 3300009147 Bacteria 2046
453 Ga0114129_10383644 3300009147 Bacteria 1855
454 Ga0105243_10057639 3300009148 Bacteria 3093
455 Ga0105243_10070160 3300009148 Bacteria 2828
456 Ga0105243_10134932 3300009148 Bacteria 2099
457 Ga0105243_10193652 3300009148 Bacteria 1777
458 Ga0105243_10441438 3300009148 Bacteria 1219
459 Ga0105243_10970587 3300009148 Bacteria 850
460 Ga0105243_11521135 3300009148 Bacteria 693
461 Ga0105241_10072051 3300009174 Bacteria 2684
462 Ga0105241_10599531 3300009174 Bacteria 995
463 Ga0105242_10199574 3300009176 Bacteria 1776
464 Ga0105242_10224017 3300009176 Bacteria 1682
465 Ga0105242_10278545 3300009176 Bacteria 1518
466 Ga0105242_10512021 3300009176 Bacteria 1143
467 Ga0105248_10042612 3300009177 Bacteria 5091
468 Ga0105248_10347052 3300009177 Bacteria 1671
469 Ga0105248_11031638 3300009177 Bacteria 929
470 Ga0105237_10000309 3300009545 Bacteria 67900
471 Ga0105237_10111947 3300009545 Bacteria 2722
472 Ga0105237_10132180 3300009545 Bacteria 2490
473 Ga0105237_10144886 3300009545 Bacteria 2370
474 Ga0105237_10504849 3300009545 Bacteria 1216
475 Ga0105237_10593923 3300009545 Bacteria 1114
476 Ga0105237_11000838 3300009545 Bacteria 843
477 Ga0105238_10005423 3300009551 Bacteria 12601
478 Ga0105238_10147334 3300009551 Bacteria 2330
479 Ga0105238_10168207 3300009551 Bacteria 2168
480 Ga0105238_10185813 3300009551 Bacteria 2055
481 Ga0105238_10379145 3300009551 Bacteria 1405
482 Ga0105238_10402651 3300009551 Bacteria 1362
483 Ga0105238_10513358 3300009551 Bacteria 1200
484 Ga0105238_10528392 3300009551 Bacteria 1183
485 Ga0105238_10548536 3300009551 Bacteria 1160
486 Ga0105238_11096387 3300009551 Bacteria 819
487 Ga0105249_10071948 3300009553 Bacteria 3196
488 Ga0105249_10080284 3300009553 Bacteria 3030
489 Ga0105249_12200768 3300009553 Bacteria 624
490 Ga0099796_10017075 3300010159 Bacteria 2155
491 Ga0099796_10146507 3300010159 Bacteria 927
492 Ga0105239_10001582 3300010375 Bacteria 30053
493 Ga0105239_10064701 3300010375 Bacteria 4014
494 Ga0105239_10206297 3300010375 Bacteria 2202
495 Ga0105239_10644837 3300010375 Bacteria 1209
496 Ga0105239_10824315 3300010375 Bacteria 1063
497 Ga0105239_11256949 3300010375 Bacteria 854
498 Ga0105246_10010697 3300011119 Bacteria 5683
499 Ga0105246_10109879 3300011119 Bacteria 2024
500 Ga0105246_10253148 3300011119 Bacteria 1399
501 Ga0105246_10269873 3300011119 Bacteria 1359
502 Ga0157327_1011207 3300012512 Bacteria 861
503 Ga0157373_10119433 3300013100 Bacteria 1853
504 Ga0157373_10294728 3300013100 Bacteria 1151
505 Ga0157373_10751772 3300013100 Bacteria 717
506 Ga0157371_10549327 3300013102 Bacteria 856
507 Ga0157370_10097547 3300013104 Bacteria 2757
508 Ga0157370_10176358 3300013104 Bacteria 1987
509 Ga0157370_10227191 3300013104 Bacteria 1728
510 Ga0157370_10426039 3300013104 Bacteria 1220
511 Ga0157369_10025156 3300013105 Bacteria 6610
512 Ga0157369_10042001 3300013105 Bacteria 4990
513 Ga0157369_10148563 3300013105 Bacteria 2477
514 Ga0157369_10271778 3300013105 Bacteria 1766
515 Ga0157369_10298130 3300013105 Bacteria 1677
516 Ga0157369_10338579 3300013105 Bacteria 1563
517 Ga0157369_10666756 3300013105 Bacteria 1072
518 Ga0157374_10019961 3300013296 Bacteria 5941
519 Ga0157374_10493165 3300013296 Bacteria 1229
520 Ga0157374_10866735 3300013296 Bacteria 920
521 Ga0157374_10934971 3300013296 Bacteria 885
522 Ga0157378_10017967 3300013297 Bacteria 6209
523 Ga0157378_10994564 3300013297 Bacteria 873
524 Ga0163162_10024461 3300013306 Bacteria 5962
525 Ga0163162_10035503 3300013306 Bacteria 4967
526 Ga0163162_10077909 3300013306 Bacteria 3379
527 Ga0163162_10096154 3300013306 Bacteria 3050
528 Ga0163162_10320490 3300013306 Bacteria 1682
529 Ga0163162_10362395 3300013306 Bacteria 1583
530 Ga0163162_10432788 3300013306 Bacteria 1448
531 Ga0163162_10553942 3300013306 Bacteria 1278
532 Ga0163162_10906309 3300013306 Bacteria 994
533 Ga0157372_10355887 3300013307 Bacteria 1706
534 Ga0157375_10036254 3300013308 Bacteria 4716
535 Ga0157375_10071876 3300013308 Bacteria 3474
536 Ga0157375_10139987 3300013308 Bacteria 2546
537 Ga0157375_10584536 3300013308 Bacteria 1277
538 Ga0157375_11466956 3300013308 Bacteria 805
539 Ga0163163_10037397 3300014325 Bacteria 4722
540 Ga0163163_10119032 3300014325 Bacteria 2674
541 Ga0163163_10294263 3300014325 Bacteria 1676
542 Ga0163163_11408892 3300014325 Bacteria 759
543 Ga0157380_10106778 3300014326 Bacteria 2344
544 Ga0157380_10768264 3300014326 Bacteria 977
545 Ga0157380_11500177 3300014326 Bacteria 727
546 Ga0182008_10237137 3300014497 Bacteria 937
547 Ga0157377_10162758 3300014745 Bacteria 1389
548 Ga0157379_10025155 3300014968 Bacteria 5285
549 Ga0157379_10046247 3300014968 Bacteria 3883
550 Ga0157379_10059551 3300014968 Bacteria 3414
551 Ga0157379_10293265 3300014968 Bacteria 1481
552 Ga0157379_10687313 3300014968 Bacteria 960
553 Ga0157376_10030300 3300014969 Bacteria 4319
554 Ga0157376_10795808 3300014969 Bacteria 958
555 Ga0157376_11138462 3300014969 Bacteria 807
556 Ga0163161_10055689 3300017792 Bacteria 2871
557 Ga0163161_10184926 3300017792 Bacteria 1599
558 Ga0163161_10194179 3300017792 Bacteria 1562
559 Ga0163161_10248930 3300017792 Bacteria 1385
560 Ga0163161_10621181 3300017792 Bacteria 893
561 Ga0163161_10672205 3300017792 Bacteria 860
562 Ga0197907_10504455 3300020069 Bacteria 1214
563 Ga0206354_10062039 3300020081 Bacteria 2270
564 Ga0206354_10665166 3300020081 Bacteria 627
565 Ga0206354_10765695 3300020081 Bacteria 2929
566 Ga0206353_10759208 3300020082 Bacteria 652
567 Ga0206353_12022395 3300020082 Bacteria 950
568 Ga0213872_10092493 3300021361 Bacteria 1353
569 Ga0213874_10009524 3300021377 Bacteria 2405
570 Ga0213874_10107516 3300021377 Bacteria 934
571 Ga0213875_10000001 3300021388 Bacteria 2793540
572 Ga0213875_10141766 3300021388 Bacteria 1125
573 Ga0209677_101005 3300025253 Bacteria 13501
574 Ga0209677_102354 3300025253 Bacteria 7236
575 Ga0209148_1002750 3300025254 Bacteria 5556
576 Ga0209148_1010998 3300025254 Bacteria 1694
577 Ga0209233_1010987 3300025261 Bacteria 2683
578 Ga0209455_1002301 3300025272 Bacteria 7501
579 Ga0209455_1003946 3300025272 Bacteria 5039
580 Ga0209455_1007330 3300025272 Bacteria 3128
581 Ga0209455_1036979 3300025272 Bacteria 772
582 Ga0209025_1096081 3300025294 Bacteria 953
583 Ga0209564_1000602 3300025295 Bacteria 56176
584 Ga0209564_1012457 3300025295 Bacteria 3708
585 Ga0209564_1023731 3300025295 Bacteria 2119
586 Ga0209758_1000015 3300025297 Bacteria 851943
587 Ga0209758_1000335 3300025297 Bacteria 87764
588 Ga0209758_1001187 3300025297 Bacteria 32935
589 Ga0209758_1003099 3300025297 Bacteria 15727
590 Ga0209758_1004724 3300025297 Bacteria 11105
591 Ga0209758_1033744 3300025297 Bacteria 2049
592 Ga0209758_1078561 3300025297 Bacteria 1007
593 Ga0207426_1025887 3300025302 Bacteria 1971
594 Ga0209051_1059483 3300025303 Bacteria 1211
595 Ga0209257_1001779 3300025304 Bacteria 23779
596 Ga0207697_10333523 3300025315 Bacteria 673
597 Ga0207697_10343807 3300025315 Bacteria 662
598 Ga0207656_10004567 3300025321 Bacteria 4845
599 Ga0207656_10014106 3300025321 Bacteria 3071
600 Ga0207656_10049177 3300025321 Bacteria 1818
601 Ga0207653_10186273 3300025885 Bacteria 778
602 Ga0207682_10173466 3300025893 Bacteria 982
603 Ga0207692_10099233 3300025898 Bacteria 1595
604 Ga0207692_10604237 3300025898 Bacteria 705
605 Ga0207642_10384932 3300025899 Bacteria 836
606 Ga0207710_10023332 3300025900 Bacteria 2658
607 Ga0207710_10101396 3300025900 Bacteria 1358
608 Ga0207710_10101682 3300025900 Bacteria 1356
609 Ga0207710_10165150 3300025900 Bacteria 1080
610 Ga0207710_10499360 3300025900 Bacteria 631
611 Ga0207688_10001281 3300025901 Bacteria 13017
612 Ga0207688_10070515 3300025901 Bacteria 1982
613 Ga0207688_10151075 3300025901 Bacteria 1372
614 Ga0207680_10096772 3300025903 Bacteria 1889
615 Ga0207647_10094422 3300025904 Bacteria 1782
616 Ga0207647_10115607 3300025904 Bacteria 1584
617 Ga0207647_10123662 3300025904 Bacteria 1524
618 Ga0207647_10505229 3300025904 Bacteria 674
619 Ga0207699_10129447 3300025906 Bacteria 1644
620 Ga0207699_10191177 3300025906 Bacteria 1381
621 Ga0207699_10274548 3300025906 Bacteria 1169
622 Ga0207699_10450515 3300025906 Bacteria 923
623 Ga0207699_10972320 3300025906 Bacteria 627
624 Ga0207699_11058259 3300025906 Bacteria 600
625 Ga0207645_10012345 3300025907 Bacteria 5798
626 Ga0207645_10061109 3300025907 Bacteria 2406
627 Ga0207645_10234956 3300025907 Bacteria 1210
628 Ga0207645_10828962 3300025907 Bacteria 629
629 Ga0207643_10002521 3300025908 Bacteria 9905
630 Ga0207643_10351729 3300025908 Bacteria 925
631 Ga0207705_10159864 3300025909 Bacteria 1692
632 Ga0207705_10303624 3300025909 Bacteria 1224
633 Ga0207705_10322557 3300025909 Bacteria 1187
634 Ga0207705_10357980 3300025909 Bacteria 1125
635 Ga0207705_10580423 3300025909 Bacteria 872
636 Ga0207705_10610959 3300025909 Bacteria 848
637 Ga0207684_10002807 3300025910 Bacteria 17312
638 Ga0207684_10048178 3300025910 Bacteria 3614
639 Ga0207684_10093025 3300025910 Bacteria 2570
640 Ga0207684_10141931 3300025910 Bacteria 2065
641 Ga0207684_10241063 3300025910 Bacteria 1560
642 Ga0207684_10591279 3300025910 Bacteria 948
643 Ga0207654_10020658 3300025911 Bacteria 3495
644 Ga0207707_10018377 3300025912 Bacteria 6094
645 Ga0207707_10029100 3300025912 Bacteria 4827
646 Ga0207707_10107387 3300025912 Bacteria 2440
647 Ga0207707_10158405 3300025912 Bacteria 1980
648 Ga0207707_10176772 3300025912 Bacteria 1865
649 Ga0207707_10255791 3300025912 Bacteria 1520
650 Ga0207707_10657073 3300025912 Bacteria 883
651 Ga0207695_10026779 3300025913 Bacteria 6430
652 Ga0207695_10047865 3300025913 Bacteria 4520
653 Ga0207695_10725319 3300025913 Bacteria 874
654 Ga0207695_11083819 3300025913 Bacteria 681
655 Ga0207671_10003123 3300025914 Bacteria 16824
656 Ga0207671_10045550 3300025914 Bacteria 3244
657 Ga0207671_10131505 3300025914 Bacteria 1921
658 Ga0207671_10224311 3300025914 Bacteria 1473
659 Ga0207671_10260441 3300025914 Bacteria 1365
660 Ga0207671_10713142 3300025914 Bacteria 797
661 Ga0207671_11039849 3300025914 Bacteria 644
662 Ga0207693_10010868 3300025915 Bacteria 7386
663 Ga0207693_10091866 3300025915 Bacteria 2380
664 Ga0207693_10096126 3300025915 Bacteria 2322
665 Ga0207693_10102360 3300025915 Bacteria 2246
666 Ga0207693_10124522 3300025915 Bacteria 2025
667 Ga0207693_10371537 3300025915 Bacteria 1119
668 Ga0207693_10530532 3300025915 Bacteria 918
669 Ga0207693_10622027 3300025915 Bacteria 840
670 Ga0207663_10010063 3300025916 Bacteria 5015
671 Ga0207663_10064231 3300025916 Bacteria 2341
672 Ga0207663_10073261 3300025916 Bacteria 2216
673 Ga0207663_10099225 3300025916 Bacteria 1952
674 Ga0207663_10107742 3300025916 Bacteria 1885
675 Ga0207663_10118050 3300025916 Bacteria 1811
676 Ga0207660_10019619 3300025917 Bacteria 4522
677 Ga0207660_10061468 3300025917 Bacteria 2703
678 Ga0207660_10087338 3300025917 Bacteria 2304
679 Ga0207660_10113998 3300025917 Bacteria 2038
680 Ga0207660_10226680 3300025917 Bacteria 1468
681 Ga0207660_10273957 3300025917 Bacteria 1338
682 Ga0207660_10547248 3300025917 Bacteria 941
683 Ga0207660_10584613 3300025917 Bacteria 909
684 Ga0207662_10012503 3300025918 Bacteria 4727
685 Ga0207662_10110428 3300025918 Bacteria 1714
686 Ga0207662_10139220 3300025918 Bacteria 1536
687 Ga0207662_10627109 3300025918 Bacteria 750
688 Ga0207657_10011567 3300025919 Bacteria 8754
689 Ga0207657_10012512 3300025919 Bacteria 8373
690 Ga0207657_10084668 3300025919 Bacteria 2657
691 Ga0207657_10176990 3300025919 Bacteria 1726
692 Ga0207657_10513084 3300025919 Bacteria 938
693 Ga0207649_10294479 3300025920 Bacteria 1185
694 Ga0207652_10022949 3300025921 Bacteria 5168
695 Ga0207652_10059883 3300025921 Bacteria 3283
696 Ga0207652_10062291 3300025921 Bacteria 3223
697 Ga0207652_10105307 3300025921 Bacteria 2496
698 Ga0207652_10117272 3300025921 Bacteria 2365
699 Ga0207652_10223759 3300025921 Bacteria 1695
700 Ga0207652_10253247 3300025921 Bacteria 1588
701 Ga0207652_10974808 3300025921 Bacteria 746
702 Ga0207646_10004138 3300025922 Bacteria 15931
703 Ga0207646_10062636 3300025922 Bacteria 3320
704 Ga0207646_10076033 3300025922 Bacteria 3000
705 Ga0207646_10101217 3300025922 Bacteria 2583
706 Ga0207681_10147371 3300025923 Bacteria 1760
707 Ga0207681_10174222 3300025923 Bacteria 1633
708 Ga0207681_10264735 3300025923 Bacteria 1347
709 Ga0207681_10447948 3300025923 Bacteria 1050
710 Ga0207694_10061628 3300025924 Bacteria 2920
711 Ga0207694_10132061 3300025924 Bacteria 2002
712 Ga0207694_10397247 3300025924 Bacteria 1146
713 Ga0207694_10422782 3300025924 Bacteria 1110
714 Ga0207694_10560718 3300025924 Bacteria 959
715 Ga0207694_10614337 3300025924 Bacteria 915
716 Ga0207694_10678339 3300025924 Bacteria 869
717 Ga0207694_11217675 3300025924 Bacteria 637
718 Ga0207650_10160992 3300025925 Bacteria 1778
719 Ga0207650_10689282 3300025925 Bacteria 863
720 Ga0207650_10835270 3300025925 Bacteria 781
721 Ga0207659_10069599 3300025926 Bacteria 2563
722 Ga0207659_10082218 3300025926 Bacteria 2384
723 Ga0207659_10183758 3300025926 Bacteria 1659
724 Ga0207687_10021268 3300025927 Bacteria 4309
725 Ga0207687_10075058 3300025927 Bacteria 2425
726 Ga0207687_10277552 3300025927 Bacteria 1342
727 Ga0207687_11351150 3300025927 Bacteria 612
728 Ga0207687_11465218 3300025927 Bacteria 586
729 Ga0207700_10014735 3300025928 Bacteria 5132
730 Ga0207700_10026602 3300025928 Bacteria 4037
731 Ga0207700_10036814 3300025928 Bacteria 3538
732 Ga0207700_10050036 3300025928 Bacteria 3112
733 Ga0207700_10166946 3300025928 Bacteria 1833
734 Ga0207700_10487987 3300025928 Bacteria 1089
735 Ga0207664_10047450 3300025929 Bacteria 3374
736 Ga0207664_10113350 3300025929 Bacteria 2258
737 Ga0207664_10365999 3300025929 Bacteria 1278
738 Ga0207664_10489460 3300025929 Bacteria 1101
739 Ga0207664_10517223 3300025929 Bacteria 1070
740 Ga0207664_11256351 3300025929 Bacteria 659
741 Ga0207644_10075234 3300025931 Bacteria 2481
742 Ga0207644_10168058 3300025931 Bacteria 1710
743 Ga0207644_10205147 3300025931 Bacteria 1556
744 Ga0207644_10247260 3300025931 Bacteria 1422
745 Ga0207644_10262142 3300025931 Bacteria 1382
746 Ga0207690_10028519 3300025932 Bacteria 3539
747 Ga0207690_10099646 3300025932 Bacteria 2072
748 Ga0207690_10168530 3300025932 Bacteria 1638
749 Ga0207690_10295806 3300025932 Bacteria 1265
750 Ga0207690_11005409 3300025932 Bacteria 694
751 Ga0207706_10042174 3300025933 Bacteria 4044
752 Ga0207706_10110812 3300025933 Bacteria 2414
753 Ga0207706_10216469 3300025933 Bacteria 1678
754 Ga0207706_10382914 3300025933 Bacteria 1220
755 Ga0207706_10689442 3300025933 Bacteria 873
756 Ga0207686_10250745 3300025934 Bacteria 1293
757 Ga0207686_10336619 3300025934 Bacteria 1132
758 Ga0207686_10498909 3300025934 Bacteria 944
759 Ga0207686_10807700 3300025934 Bacteria 752
760 Ga0207709_10026629 3300025935 Bacteria 3324
761 Ga0207709_10274164 3300025935 Bacteria 1243
762 Ga0207709_10316487 3300025935 Bacteria 1166
763 Ga0207670_10002298 3300025936 Bacteria 10022
764 Ga0207670_10131451 3300025936 Bacteria 1835
765 Ga0207670_10143793 3300025936 Bacteria 1761
766 Ga0207669_10088626 3300025937 Bacteria 2007
767 Ga0207669_10142605 3300025937 Bacteria 1665
768 Ga0207704_10136518 3300025938 Bacteria 1708
769 Ga0207704_10384764 3300025938 Bacteria 1102
770 Ga0207704_10711924 3300025938 Bacteria 832
771 Ga0207665_10050010 3300025939 Bacteria 2810
772 Ga0207665_10115770 3300025939 Bacteria 1889
773 Ga0207665_10297418 3300025939 Bacteria 1206
774 Ga0207665_10634596 3300025939 Bacteria 836
775 Ga0207691_10000910 3300025940 Bacteria 29340
776 Ga0207691_10104060 3300025940 Bacteria 2530
777 Ga0207691_10216989 3300025940 Bacteria 1660
778 Ga0207691_10275176 3300025940 Bacteria 1449
779 Ga0207691_10471723 3300025940 Bacteria 1067
780 Ga0207691_10704271 3300025940 Bacteria 852
781 Ga0207711_10040871 3300025941 Bacteria 3947
782 Ga0207711_10043351 3300025941 Bacteria 3837
783 Ga0207711_10248969 3300025941 Bacteria 1631
784 Ga0207711_10718502 3300025941 Bacteria 932
785 Ga0207689_10010184 3300025942 Bacteria 8101
786 Ga0207689_10548863 3300025942 Bacteria 970
787 Ga0207661_10000331 3300025944 Bacteria 30097
788 Ga0207661_10010939 3300025944 Bacteria 6552
789 Ga0207661_10020659 3300025944 Bacteria 4926
790 Ga0207661_10235871 3300025944 Bacteria 1621
791 Ga0207661_10343741 3300025944 Bacteria 1345
792 Ga0207661_10786354 3300025944 Bacteria 876
793 Ga0207661_10897528 3300025944 Bacteria 816
794 Ga0207679_10065923 3300025945 Bacteria 2711
795 Ga0207679_10077143 3300025945 Bacteria 2534
796 Ga0207679_10221902 3300025945 Bacteria 1591
797 Ga0207679_10565367 3300025945 Bacteria 1022
798 Ga0207667_10007691 3300025949 Bacteria 12900
799 Ga0207667_10060838 3300025949 Bacteria 3953
800 Ga0207667_10113693 3300025949 Bacteria 2791
801 Ga0207667_10174750 3300025949 Bacteria 2207
802 Ga0207667_10184852 3300025949 Bacteria 2140
803 Ga0207667_10363912 3300025949 Bacteria 1475
804 Ga0207667_10453250 3300025949 Bacteria 1303
805 Ga0207667_10641396 3300025949 Bacteria 1068
806 Ga0207667_10663163 3300025949 Bacteria 1048
807 Ga0207667_10815050 3300025949 Bacteria 929
808 Ga0207651_10176919 3300025960 Bacteria 1688
809 Ga0207651_11231338 3300025960 Bacteria 672
810 Ga0207712_10091096 3300025961 Bacteria 2245
811 Ga0207712_10126979 3300025961 Bacteria 1938
812 Ga0207712_10601298 3300025961 Bacteria 951
813 Ga0207668_10031967 3300025972 Bacteria 3472
814 Ga0207668_10062839 3300025972 Bacteria 2616
815 Ga0207668_10099716 3300025972 Bacteria 2155
816 Ga0207668_10176358 3300025972 Bacteria 1681
817 Ga0207640_10678318 3300025981 Bacteria 881
818 Ga0207640_10716954 3300025981 Bacteria 859
819 Ga0207658_10299305 3300025986 Bacteria 1385
820 Ga0207658_10457081 3300025986 Bacteria 1131
821 Ga0207658_10458212 3300025986 Bacteria 1130
822 Ga0207658_11656391 3300025986 Bacteria 585
823 Ga0207677_10056475 3300026023 Bacteria 2690
824 Ga0207677_10158658 3300026023 Bacteria 1755
825 Ga0207677_10173916 3300026023 Bacteria 1687
826 Ga0207677_10360777 3300026023 Bacteria 1221
827 Ga0207677_10613413 3300026023 Bacteria 956
828 Ga0207677_11549484 3300026023 Bacteria 613
829 Ga0207703_10307091 3300026035 Bacteria 1449
830 Ga0207639_10154560 3300026041 Bacteria 1926
831 Ga0207639_10161003 3300026041 Bacteria 1891
832 Ga0207639_10243173 3300026041 Bacteria 1566
833 Ga0207639_10246443 3300026041 Bacteria 1556
834 Ga0207639_10385513 3300026041 Bacteria 1259
835 Ga0207639_10456714 3300026041 Bacteria 1161
836 Ga0207639_10481413 3300026041 Bacteria 1131
837 Ga0207639_10506044 3300026041 Bacteria 1104
838 Ga0207639_10769317 3300026041 Bacteria 896
839 Ga0207678_10048755 3300026067 Bacteria 3660
840 Ga0207678_10100046 3300026067 Bacteria 2477
841 Ga0207678_10122850 3300026067 Bacteria 2215
842 Ga0207678_10123834 3300026067 Bacteria 2206
843 Ga0207678_10134382 3300026067 Bacteria 2111
844 Ga0207678_10157318 3300026067 Bacteria 1940
845 Ga0207678_10254674 3300026067 Bacteria 1504
846 Ga0207678_10532250 3300026067 Bacteria 1026
847 Ga0207678_10608124 3300026067 Bacteria 958
848 Ga0207678_10781108 3300026067 Bacteria 843
849 Ga0207678_11214441 3300026067 Bacteria 668
850 Ga0207708_10033132 3300026075 Bacteria 3924
851 Ga0207708_10386680 3300026075 Bacteria 1155
852 Ga0207708_10393198 3300026075 Bacteria 1145
853 Ga0207708_10416336 3300026075 Bacteria 1114
854 Ga0207702_10000090 3300026078 Bacteria 104566
855 Ga0207702_10185089 3300026078 Bacteria 1920
856 Ga0207702_10210726 3300026078 Bacteria 1807
857 Ga0207702_10244279 3300026078 Bacteria 1683
858 Ga0207702_10300358 3300026078 Bacteria 1523
859 Ga0207702_10325086 3300026078 Bacteria 1466
860 Ga0207702_10360972 3300026078 Bacteria 1392
861 Ga0207702_10594458 3300026078 Bacteria 1085
862 Ga0207641_10007802 3300026088 Bacteria 8891
863 Ga0207641_10498345 3300026088 Bacteria 1182
864 Ga0207641_12160732 3300026088 Bacteria 557
865 Ga0207648_10130081 3300026089 Bacteria 2216
866 Ga0207648_10587660 3300026089 Bacteria 1025
867 Ga0207676_10019515 3300026095 Bacteria 4948
868 Ga0207676_10022610 3300026095 Bacteria 4625
869 Ga0207676_10083876 3300026095 Bacteria 2596
870 Ga0207674_10041607 3300026116 Bacteria 4750
871 Ga0207674_10068053 3300026116 Bacteria 3584
872 Ga0207674_10094319 3300026116 Bacteria 2979
873 Ga0207674_10515831 3300026116 Bacteria 1154
874 Ga0207674_10526311 3300026116 Bacteria 1142
875 Ga0207675_100189454 3300026118 Bacteria 1972
876 Ga0207675_101456053 3300026118 Bacteria 706
877 Ga0207683_10016743 3300026121 Bacteria 6239
878 Ga0207683_10054711 3300026121 Bacteria 3499
879 Ga0207698_10040951 3300026142 Bacteria 3448
880 Ga0207698_10057029 3300026142 Bacteria 3019
881 Ga0207698_10092817 3300026142 Bacteria 2476
882 Ga0207698_10314056 3300026142 Bacteria 1465
883 Ga0207698_10339619 3300026142 Bacteria 1414
884 Ga0207698_10756952 3300026142 Bacteria 971
885 Ga0207698_11345038 3300026142 Bacteria 729
886 Ga0209389_1000051 3300027296 Bacteria 110364
887 Ga0209589_1000012 3300027357 Bacteria 229451
888 Ga0209589_1000013 3300027357 Bacteria 229273
889 Ga0209589_1000026 3300027357 Bacteria 158154
890 Ga0209489_100013 3300027361 Bacteria 229831
891 Ga0209489_100046 3300027361 Bacteria 158154
892 Ga0209700_100047 3300027363 Bacteria 158154
893 Ga0209996_1024158 3300027395 Bacteria 865
894 Ga0209179_1008764 3300027512 Bacteria 1715
895 Ga0209588_1143359 3300027671 Bacteria 759
896 Ga0209588_1161027 3300027671 Bacteria 708
897 Ga0209971_1040391 3300027682 Bacteria 1122
898 Ga0209966_1004684 3300027695 Bacteria 2326
899 Ga0209998_10007358 3300027717 Bacteria 2285
900 Ga0209813_10126149 3300027866 Bacteria 896
901 Ga0209813_10162353 3300027866 Bacteria 807
902 Ga0207428_10004275 3300027907 Bacteria 13666
903 Ga0207428_10031000 3300027907 Bacteria 4417
904 Ga0207428_10888316 3300027907 Bacteria 630
905 Ga0268266_10000265 3300028379 Bacteria 87871
906 Ga0268266_10017376 3300028379 Bacteria 6137
907 Ga0268266_10019020 3300028379 Bacteria 5850
908 Ga0268266_10193146 3300028379 Bacteria 1859
909 Ga0268266_10293576 3300028379 Bacteria 1514
910 Ga0268266_10446163 3300028379 Bacteria 1229
911 Ga0268266_10736166 3300028379 Bacteria 951
912 Ga0268265_10147460 3300028380 Bacteria 1979
913 Ga0268265_10512504 3300028380 Bacteria 1132
914 Ga0268265_10604367 3300028380 Bacteria 1048
915 Ga0268265_10659718 3300028380 Bacteria 1006
916 Ga0268265_11511087 3300028380 Bacteria 675
917 Ga0268264_10123943 3300028381 Bacteria 2281
918 Ga0268264_10184708 3300028381 Bacteria 1896
919 Ga0268264_10903019 3300028381 Bacteria 887
920 Ga0268264_12046006 3300028381 Bacteria 582
921 Ga0265337_1048980 3300028556 Bacteria 1194
922 Ga0265326_10035032 3300028558 Bacteria 1428
923 Ga0265334_10003557 3300028573 Bacteria 7063
924 Ga0265334_10026998 3300028573 Bacteria 2315
925 Ga0265323_10000915 3300028653 Bacteria 15566
926 Ga0265336_10000355 3300028666 Bacteria 29857
927 Ga0307517_10000436 3300028786 Bacteria 71537
928 Ga0307517_10260688 3300028786 Bacteria 1007
929 Ga0307515_10091382 3300028794 Bacteria 3804
930 Ga0307515_10157342 3300028794 Bacteria 2337
931 Ga0307515_10466576 3300028794 Bacteria 876
932 Ga0265338_10000256 3300028800 Bacteria 97079
933 Ga0265330_10031372 3300031235 Bacteria 2382
934 Ga0265330_10118787 3300031235 Bacteria 1127
935 Ga0265332_10036830 3300031238 Bacteria 2123
936 Ga0265332_10106860 3300031238 Bacteria 1180
937 Ga0265328_10200839 3300031239 Bacteria 757
938 Ga0265325_10000954 3300031241 Bacteria 20913
939 Ga0265325_10054489 3300031241 Bacteria 2047
940 Ga0265325_10225883 3300031241 Bacteria 855
941 Ga0265340_10003706 3300031247 Bacteria 8606
942 Ga0265340_10016165 3300031247 Bacteria 3867
943 Ga0265340_10052271 3300031247 Bacteria 1977
944 Ga0265339_10006965 3300031249 Bacteria 7349
945 Ga0265339_10065271 3300031249 Bacteria 1952
946 Ga0265331_10024366 3300031250 Bacteria 3062
947 Ga0265331_10209783 3300031250 Bacteria 876
948 Ga0265316_10398855 3300031344 Bacteria 991
949 Ga0307509_10650387 3300031507 Bacteria 723
950 Ga0307408_100087243 3300031548 Bacteria 2347
951 Ga0307408_100782759 3300031548 Bacteria 864
952 Ga0307408_101025038 3300031548 Bacteria 762
953 Ga0265313_10007353 3300031595 Bacteria 7547
954 Ga0265313_10058214 3300031595 Bacteria 1822
955 Ga0265313_10162961 3300031595 Bacteria 946
956 Ga0265313_10192548 3300031595 Bacteria 852
957 Ga0307508_10104109 3300031616 Bacteria 2435
958 Ga0307508_10223120 3300031616 Bacteria 1484
959 Ga0307508_10699716 3300031616 Bacteria 623
960 Ga0307514_10318040 3300031649 Bacteria 857
961 Ga0265314_10004337 3300031711 Bacteria 13221
962 Ga0265314_10027273 3300031711 Bacteria 4279
963 Ga0265314_10406221 3300031711 Bacteria 735
964 Ga0265342_10000082 3300031712 Bacteria 102532
965 Ga0265342_10014798 3300031712 Bacteria 5165
966 Ga0265342_10016507 3300031712 Bacteria 4823
967 Ga0265342_10107466 3300031712 Bacteria 1583
968 Ga0265342_10318021 3300031712 Bacteria 816
969 Ga0307516_10055684 3300031730 Bacteria 3859
970 Ga0307516_10572644 3300031730 Bacteria 783
971 Ga0307405_11064611 3300031731 Bacteria 693
972 Ga0307413_10139000 3300031824 Bacteria 1675
973 Ga0307413_10489505 3300031824 Bacteria 985
974 Ga0307406_10310243 3300031901 Bacteria 1216
975 Ga0307406_10664242 3300031901 Bacteria 866
976 Ga0307407_10078826 3300031903 Bacteria 1986
977 Ga0307407_10144836 3300031903 Bacteria 1537
978 Ga0307412_10152622 3300031911 Bacteria 1706
979 Ga0307412_10274861 3300031911 Bacteria 1320
980 Ga0307412_11727332 3300031911 Bacteria 574
981 Ga0307409_100263371 3300031995 Bacteria 1583
982 Ga0307416_100307768 3300032002 Bacteria 1579
983 Ga0307416_100440341 3300032002 Bacteria 1353
984 Ga0307416_100532209 3300032002 Bacteria 1245
985 Ga0307416_101746369 3300032002 Bacteria 727
986 Ga0307416_101759243 3300032002 Bacteria 724
987 Ga0307411_10220092 3300032005 Bacteria 1472
988 Ga0307411_10327801 3300032005 Bacteria 1239
989 Ga0307411_10391885 3300032005 Bacteria 1146
990 Ga0307415_100638302 3300032126 Bacteria 953
991 Ga0307510_10039374 3300033180 Bacteria 5208
992 Ga0307510_10148385 3300033180 Bacteria 1970
993 Ga0307510_10229712 3300033180 Bacteria 1359
994 Ga0315911_1000019 3300033442 Bacteria 146597
995 Ga0316213_1001962 3300033546 Bacteria 1405
996 Ga0373930_0045689 3300034816 Bacteria 944
997 Ga0373950_0115141 3300034818 Bacteria 590
998 Ga0373959_0016360 3300034820 Bacteria 1374
999 Ga0373938_0016598 3300034957 Bacteria 1441
1000 Ga0373926_0008328 3300035083 Bacteria 3450
1001 Ga0373926_0110085 3300035083 Bacteria 1034
1002 Ga0373926_0119707 3300035083 Bacteria 992
1003 Ga0373926_0304076 3300035083 Bacteria 623
1004 Ga0373928_0100198 3300035084 Bacteria 755
1005 Ga0373929_0031950 3300035085 Bacteria 1130
1006 Ga0373934_0054615 3300035086 Bacteria 1586
1007 Ga0373934_0170997 3300035086 Bacteria 892
1008 Ga0373934_0186149 3300035086 Bacteria 854
1009 Ga0373934_0213529 3300035086 Bacteria 795
1010 Ga0373952_0022816 3300035092 Bacteria 1332
1011 Ga0373923_0033166 3300035111 Bacteria 2090
1012 Ga0373923_0045536 3300035111 Bacteria 1822
1013 Ga0373923_0204379 3300035111 Bacteria 914
1014 Ga0373932_0064982 3300035112 Bacteria 1118
1015 Ga0373932_0080809 3300035112 Bacteria 1026
1016 Ga0373936_0010944 3300035113 Bacteria 3428
1017 Ga0373936_0019833 3300035113 Bacteria 2608
1018 Ga0373936_0367294 3300035113 Bacteria 657
1019 Ga0373941_0166238 3300035115 Bacteria 819
1020 Ga0373945_0016886 3300035116 Bacteria 2467
1021 Ga0373953_0005186 3300035117 Bacteria 4212
1022 Ga0373953_0017256 3300035117 Bacteria 2651
1023 Ga0373953_0097846 3300035117 Bacteria 1232
1024 Ga0373954_0008529 3300035118 Bacteria 4501
1025 Ga0373954_0055059 3300035118 Bacteria 1871
1026 Ga0373954_0123193 3300035118 Bacteria 1259
1027 Ga0373956_0001240 3300035119 Bacteria 10554
1028 Ga0373956_0038630 3300035119 Bacteria 2112
1029 Ga0373956_0070343 3300035119 Bacteria 1596
1030 Ga0373956_0250966 3300035119 Bacteria 841
1031 Ga0373957_0019473 3300035120 Bacteria 2388
1032 Ga0373957_0195691 3300035120 Bacteria 841
1033 Ga0373960_0057616 3300035121 Bacteria 1170
1034 Ga0373960_0138487 3300035121 Bacteria 822
1035 Ga0373960_0186070 3300035121 Bacteria 727
1036 Ga0373943_0161825 3300035170 Bacteria 1219
1037 Ga0373943_0174013 3300035170 Bacteria 1179
1038 Ga0373943_0507769 3300035170 Bacteria 705
1039 Ga0373943_0726800 3300035170 Bacteria 589
1040 Ga0373946_0003413 3300035171 Bacteria 5637
1041 Ga0373946_0028128 3300035171 Bacteria 2228
1042 Ga0373946_0218525 3300035171 Bacteria 919
1043 Ga0373955_0019592 3300035172 Bacteria 3385
1044 Ga0373955_0027121 3300035172 Bacteria 2957
1045 Ga0373955_0074877 3300035172 Bacteria 1901
1046 Ga0373955_0141000 3300035172 Bacteria 1413
1047 Ga0373955_0762695 3300035172 Bacteria 594
1048 Ga0373961_0175473 3300035241 Bacteria 744
1049 Ga0373961_0213821 3300035241 Bacteria 685
1050 Ga0373961_0328289 3300035241 Bacteria 572
1051 Ga0373962_0191623 3300035242 Bacteria 688
1052 Ga0373924_0011894 3300035410 Bacteria 3241
1053 Ga0373924_0078144 3300035410 Bacteria 1404
1054 Ga0373924_0086002 3300035410 Bacteria 1341
1055 Ga0373924_0197371 3300035410 Bacteria 887
1056 Ga0373931_0006486 3300035691 Bacteria 5468
1057 Ga0373931_0014615 3300035691 Bacteria 3840
1058 Ga0373931_0099107 3300035691 Bacteria 1636
1059 Ga0373931_0490953 3300035691 Bacteria 791
1060 Ga0373935_0000467 3300035692 Bacteria 21063
1061 Ga0373935_0135033 3300035692 Bacteria 1661
1062 Ga0373935_0203850 3300035692 Bacteria 1368
1063 Ga0373927_0000844 3300035695 Bacteria 23389
1064 Ga0373927_0012690 3300035695 Bacteria 5604
1065 Ga0373927_0091391 3300035695 Bacteria 1977
1066 Ga0373927_0095419 3300035695 Bacteria 1933
1067 Ga0373927_0181371 3300035695 Bacteria 1381
1068 Ga0373927_0316516 3300035695 Bacteria 1027
1069 Ga0373933_0000057 3300035724 Bacteria 66100
1070 Ga0373933_0102427 3300035724 Bacteria 1777
1071 Ga0373933_0178313 3300035724 Bacteria 1354
1072 Ga0373947_0000761 3300035725 Bacteria 19322
1073 Ga0373947_0003343 3300035725 Bacteria 9498
1074 Ga0373947_0009428 3300035725 Bacteria 5607
1075 Ga0373947_0085506 3300035725 Bacteria 1959
1076 Ga0373947_0163504 3300035725 Bacteria 1440
1077 Ga0373947_0315097 3300035725 Bacteria 1045
1078 Ga0373937_0036680 3300036401 Bacteria 4468
1079 Ga0373937_0064104 3300036401 Bacteria 3380
1080 Ga0373937_0263271 3300036401 Bacteria 1626
1081 Ga0373937_0277244 3300036401 Bacteria 1583
1082 Ga0373937_0487013 3300036401 Bacteria 1171
1083 Ga0373937_0664520 3300036401 Bacteria 988
1084 Ga0373937_1693157 3300036401 Bacteria 579
1085 Ga0373925_0009308 3300037068 Bacteria 7148
1086 Ga0373925_0010741 3300037068 Bacteria 6640
1087 Ga0373925_0046971 3300037068 Bacteria 3212
1088 Ga0373925_0106679 3300037068 Bacteria 2160
1089 Ga0373925_0114990 3300037068 Bacteria 2083
1090 Ga0373925_0120533 3300037068 Bacteria 2036
1091 Ga0373925_0169447 3300037068 Bacteria 1723
1092 Ga0373925_0410567 3300037068 Bacteria 1105
1093 Ga0373925_1394211 3300037068 Bacteria 574
1094 Ga0395899_0181235 3300037312 Bacteria 1479
1095 Ga0395899_0228306 3300037312 Bacteria 1286
1096 Ga0395900_0045319 3300037418 Bacteria 4530
1097 Ga0395900_0181083 3300037418 Bacteria 2141
1098 Ga0395900_0299646 3300037418 Bacteria 1594
1099 Ga0395900_1270852 3300037418 Bacteria 650
1100 Ga0395898_0036376 3300037466 Bacteria 4888
1101 Ga0395898_0151741 3300037466 Bacteria 2217
1102 Ga0395898_0261331 3300037466 Bacteria 1651
1103 Ga0395898_0459737 3300037466 Bacteria 1212
1104 Ga0395905_0003590 3300037471 Bacteria 16507
1105 Ga0395905_0161365 3300037471 Bacteria 2106
1106 Ga0436364_0017072 3300037853 Bacteria 1467
1107 Ga0436364_0191290 3300037853 Bacteria 7857
1108 Ga0436364_0273345 3300037853 Bacteria 2794207
1109 Ga0436364_0476672 3300037853 Bacteria 579
1110 Ga0436364_1439469 3300037853 Bacteria 1599
1111 Ga0395901_0148727 3300038443 Bacteria 2461
1112 Ga0395901_0233242 3300038443 Bacteria 1921
1113 Ga0395901_0243895 3300038443 Bacteria 1873
1114 Ga0395901_0543393 3300038443 Bacteria 1178
1115 Ga0436365_0158617 3300039437 Bacteria 4242
1116 Ga0436365_0647493 3300039437 Bacteria 4934
1117 Ga0436365_1023053 3300039437 Bacteria 1279
1118 Ga0436365_1097492 3300039437 Bacteria 1810
1119 Ga0436365_1647635 3300039437 Bacteria 700
1120 Ga0436365_1784550 3300039437 Bacteria 1221
1121 Ga0436365_1818588 3300039437 Bacteria 876
1122 Ga0436360_0991307 3300039438 Bacteria 877
1123 Ga0436360_1308546 3300039438 Bacteria 883
1124 Ga0436361_0000793 3300039447 Bacteria 788
1125 Ga0436361_0407076 3300039447 Bacteria 593
1126 Ga0436361_0461323 3300039447 Bacteria 713
1127 Ga0436361_0547128 3300039447 Bacteria 2184
1128 Ga0436361_1101008 3300039447 Bacteria 1394
1129 Ga0436361_1156177 3300039447 Bacteria 1625
1130 Ga0436363_0018622 3300039450 Bacteria 4303
1131 Ga0436363_0206742 3300039450 Bacteria 736
1132 Ga0436363_0652096 3300039450 Bacteria 1352
1133 Ga0436363_0787831 3300039450 Bacteria 668
1134 Ga0436363_0810938 3300039450 Bacteria 1474
1135 Ga0436363_1179570 3300039450 Bacteria 1457
1136 Ga0436363_1666906 3300039450 Bacteria 2981
1137 Ga0436362_0141741 3300039453 Bacteria 579
1138 Ga0436362_0751881 3300039453 Bacteria 1001
1139 Ga0439465_0067987 3300041413 Bacteria 1190
1140 Ga0439465_0161497 3300041413 Bacteria 804
1141 Ga0451791_0749274 3300041451 Bacteria 656
1142 Ga0451793_0054577 3300041452 Bacteria 7263
1143 Ga0451797_1331092 3300041453 Bacteria 794
1144 Ga0451800_1591566 3300041459 Bacteria 942
1145 Ga0451802_1069953 3300041460 Bacteria 725
1146 Ga0451833_0732736 3300041491 Bacteria 6524
1147 Ga0451833_1387290 3300041491 Bacteria 4061
1148 Ga0451837_0665351 3300041494 Bacteria 2112
1149 Ga0451839_0022668 3300041496 Bacteria 626
1150 Ga0451839_1449860 3300041496 Bacteria 4328
1151 Ga0451845_0121349 3300041501 Bacteria 1322
1152 Ga0451845_0946972 3300041501 Bacteria 611
1153 Ga0451849_0798151 3300041505 Bacteria 907
1154 Ga0451843_0143358 3300041509 Bacteria 745
1155 Ga0439450_007144 3300042008 Bacteria 2036
1156 Ga0439455_0038258 3300042012 Bacteria 1220
1157 Ga0439464_0019297 3300042439 Bacteria 1861
1158 Ga0439464_0024306 3300042439 Bacteria 1675
1159 Ga0451577_0419685 3300042876 Bacteria 1215
1160 Ga0466969_0328977 3300044656 Bacteria 691
1161 Ga0466972_0146815 3300044658 Bacteria 1110
1162 Ga0466966_0036194 3300044684 Bacteria 3188
1163 Ga0466966_0041642 3300044684 Bacteria 2951
1164 Ga0466966_0099621 3300044684 Bacteria 1798
1165 Ga0466966_0143683 3300044684 Bacteria 1457
1166 Ga0466966_0145658 3300044684 Bacteria 1446
1167 Ga0466961_0000019 3300044693 Bacteria 107624
1168 Ga0466961_0335584 3300044693 Bacteria 921
1169 Ga0466961_0671921 3300044693 Bacteria 621
1170 Ga0466963_0102338 3300044694 Bacteria 1962
1171 Ga0466963_0143179 3300044694 Bacteria 1657
1172 Ga0466964_0132835 3300044706 Bacteria 1136
1173 Ga0453684_0360090 3300044712 Bacteria 1638
1174 Ga0466957_0378196 3300044842 Bacteria 965
1175 Ga0466960_0089343 3300044901 Bacteria 1568
1176 Ga0466959_0003898 3300045049 Bacteria 9905
1177 Ga0466959_0043940 3300045049 Bacteria 3292
1178 Ga0466958_0022400 3300045836 Bacteria 3701
1179 Ga0466958_0225113 3300045836 Bacteria 1197
1180 Ga0466967_0067830 3300045976 Bacteria 3183
1181 Ga0466967_0340286 3300045976 Bacteria 1451
1182 Ga0466967_0406329 3300045976 Bacteria 1326
1183 Ga0466967_0506268 3300045976 Bacteria 1185
1184 Ga0466967_0513182 3300045976 Bacteria 1177
1185 Ga0495617_089567 3300046452 Bacteria 1005
1186 Ga0495617_119323 3300046452 Bacteria 850
1187 Ga0495617_121721 3300046452 Bacteria 840
1188 Ga0495627_127638 3300046453 Bacteria 716
1189 Ga0495592_0019614 3300046454 Bacteria 5143
1190 Ga0495592_0031884 3300046454 Bacteria 3980
1191 Ga0495592_0148000 3300046454 Bacteria 1626
1192 Ga0495603_0000068 3300046455 Bacteria 45309
1193 Ga0495603_0002089 3300046455 Bacteria 11746
1194 Ga0495603_0007944 3300046455 Bacteria 6402
1195 Ga0495603_0083835 3300046455 Bacteria 1867
1196 Ga0495603_0088097 3300046455 Bacteria 1816
1197 Ga0495603_0236953 3300046455 Bacteria 1051
1198 Ga0495590_0083767 3300046457 Bacteria 1124
1199 Ga0495590_0129260 3300046457 Bacteria 908
1200 Ga0495591_097871 3300046458 Bacteria 730
1201 Ga0495629_0000434 3300046459 Bacteria 34882
1202 Ga0495629_0009402 3300046459 Bacteria 7151
1203 Ga0495629_0084952 3300046459 Bacteria 2208
1204 Ga0495629_0162376 3300046459 Bacteria 1552
1205 Ga0495629_0173167 3300046459 Bacteria 1497
1206 Ga0495629_0217074 3300046459 Bacteria 1320
1207 Ga0495629_0349847 3300046459 Bacteria 1008
1208 Ga0495638_0027370 3300046460 Bacteria 3690
1209 Ga0495638_0056275 3300046460 Bacteria 2440
1210 Ga0495638_0130626 3300046460 Bacteria 1475
1211 Ga0495638_0247848 3300046460 Bacteria 983
1212 Ga0495638_0256042 3300046460 Bacteria 963
1213 Ga0495638_0374448 3300046460 Bacteria 745
1214 Ga0495641_0001990 3300046461 Bacteria 16585
1215 Ga0495641_0019818 3300046461 Bacteria 3429
1216 Ga0495641_0110905 3300046461 Bacteria 1224
1217 Ga0495641_0128542 3300046461 Bacteria 1131
1218 Ga0495641_0178863 3300046461 Bacteria 950
1219 Ga0495651_0016442 3300046462 Bacteria 5730
1220 Ga0495651_0045798 3300046462 Bacteria 3387
1221 Ga0495651_0064969 3300046462 Bacteria 2787
1222 Ga0495651_0099993 3300046462 Bacteria 2161
1223 Ga0495651_0164349 3300046462 Bacteria 1587
1224 Ga0495651_0260511 3300046462 Bacteria 1180
1225 Ga0495653_0004509 3300046463 Bacteria 11247
1226 Ga0495653_0034477 3300046463 Bacteria 4004
1227 Ga0495653_0142244 3300046463 Bacteria 1686
1228 Ga0495653_0505881 3300046463 Bacteria 752
1229 Ga0495650_0058840 3300046471 Bacteria 1550
1230 Ga0495650_0085551 3300046471 Bacteria 1208
1231 Ga0495580_0001835 3300046472 Bacteria 18673
1232 Ga0495580_0034351 3300046472 Bacteria 3651
1233 Ga0495580_0123771 3300046472 Bacteria 1795
1234 Ga0495580_0243806 3300046472 Bacteria 1232
1235 Ga0495580_0377123 3300046472 Bacteria 958
1236 Ga0495582_0000057 3300046473 Bacteria 57066
1237 Ga0495582_0016816 3300046473 Bacteria 4005
1238 Ga0495582_0052978 3300046473 Bacteria 2237
1239 Ga0495582_0083452 3300046473 Bacteria 1776
1240 Ga0495582_0183772 3300046473 Bacteria 1192
1241 Ga0495605_0186203 3300046474 Bacteria 911
1242 Ga0495605_0263477 3300046474 Bacteria 735
1243 Ga0495639_0000161 3300046475 Bacteria 34648
1244 Ga0495639_0009503 3300046475 Bacteria 4172
1245 Ga0495639_0053095 3300046475 Bacteria 1846
1246 Ga0495639_0118946 3300046475 Bacteria 1259
1247 Ga0495639_0257806 3300046475 Bacteria 863
1248 Ga0495639_0349902 3300046475 Bacteria 742
1249 Ga0495639_0380173 3300046475 Bacteria 712
1250 Ga0495639_0644573 3300046475 Bacteria 546
1251 Ga0495662_0000173 3300046476 Bacteria 25579
1252 Ga0495662_0039339 3300046476 Bacteria 2285
1253 Ga0495662_0174911 3300046476 Bacteria 1058
1254 Ga0495662_0261958 3300046476 Bacteria 851
1255 Ga0495662_0474628 3300046476 Bacteria 613
1256 Ga0495664_0007250 3300046477 Bacteria 6151
1257 Ga0495664_0008650 3300046477 Bacteria 5680
1258 Ga0495664_0021985 3300046477 Bacteria 3689
1259 Ga0495664_0136568 3300046477 Bacteria 1486
1260 Ga0495664_0142095 3300046477 Bacteria 1455
1261 Ga0495664_0156677 3300046477 Bacteria 1382
1262 Ga0495584_0009339 3300046491 Bacteria 5052
1263 Ga0495584_0083743 3300046491 Bacteria 1606
1264 Ga0495584_0167987 3300046491 Bacteria 1115
1265 Ga0495585_0017468 3300046492 Bacteria 4144
1266 Ga0495585_0143465 3300046492 Bacteria 1249
1267 Ga0495585_0419622 3300046492 Bacteria 643
1268 Ga0495594_0001614 3300046499 Bacteria 11735
1269 Ga0495594_0046067 3300046499 Bacteria 2394
1270 Ga0495594_0071770 3300046499 Bacteria 1926
1271 Ga0495594_0080957 3300046499 Bacteria 1813
1272 Ga0495594_0142373 3300046499 Bacteria 1360
1273 Ga0495594_0696323 3300046499 Bacteria 574
1274 Ga0495596_0092393 3300046500 Bacteria 1175
1275 Ga0495596_0159891 3300046500 Bacteria 875
1276 Ga0495607_0046481 3300046501 Bacteria 2549
1277 Ga0495607_0260370 3300046501 Bacteria 831
1278 Ga0495607_0271639 3300046501 Bacteria 808
1279 Ga0495607_0340169 3300046501 Bacteria 695
1280 Ga0495583_0086646 3300046506 Bacteria 1354
1281 Ga0495608_0005868 3300046511 Bacteria 8741
1282 Ga0495608_0046683 3300046511 Bacteria 2881
1283 Ga0495608_0164559 3300046511 Bacteria 1409
1284 Ga0495616_0083449 3300046513 Bacteria 1524
1285 Ga0495616_0142477 3300046513 Bacteria 1090
1286 Ga0495616_0325292 3300046513 Bacteria 645
1287 Ga0495618_0021420 3300046514 Bacteria 3985
1288 Ga0495618_0062276 3300046514 Bacteria 2367
1289 Ga0495618_0099986 3300046514 Bacteria 1856
1290 Ga0495618_0116885 3300046514 Bacteria 1708
1291 Ga0495620_0095477 3300046515 Bacteria 1189
1292 Ga0495620_0105228 3300046515 Bacteria 1122
1293 Ga0495620_0192646 3300046515 Bacteria 786
1294 Ga0495620_0263334 3300046515 Bacteria 657
1295 Ga0495628_0011544 3300046516 Bacteria 7468
1296 Ga0495628_0131766 3300046516 Bacteria 1911
1297 Ga0495628_0144233 3300046516 Bacteria 1816
1298 Ga0495630_0003207 3300046517 Bacteria 11373
1299 Ga0495630_0009891 3300046517 Bacteria 6869
1300 Ga0495630_0035392 3300046517 Bacteria 3732
1301 Ga0495630_0081625 3300046517 Bacteria 2440
1302 Ga0495630_0229601 3300046517 Bacteria 1418
1303 Ga0495630_0551971 3300046517 Bacteria 883
1304 Ga0495631_0166754 3300046518 Bacteria 945
1305 Ga0495632_0104286 3300046519 Bacteria 1335
1306 Ga0495637_0293726 3300046520 Bacteria 578
1307 Ga0495643_0169301 3300046522 Bacteria 1069
1308 Ga0495644_0006954 3300046523 Bacteria 4379
1309 Ga0495644_0048849 3300046523 Bacteria 1589
1310 Ga0495644_0069626 3300046523 Bacteria 1322
1311 Ga0495648_0008096 3300046524 Bacteria 8311
1312 Ga0495648_0015341 3300046524 Bacteria 5566
1313 Ga0495648_0330526 3300046524 Bacteria 703
1314 Ga0495648_0462314 3300046524 Bacteria 552
1315 Ga0495663_0030223 3300046525 Bacteria 1604
1316 Ga0495666_0018026 3300046526 Bacteria 3517
1317 Ga0495666_0030817 3300046526 Bacteria 2630
1318 Ga0495666_0365310 3300046526 Bacteria 650
1319 Ga0495642_0136080 3300046528 Bacteria 1059
1320 Ga0495642_0414647 3300046528 Bacteria 594
1321 Ga0495652_0038445 3300046529 Bacteria 4146
1322 Ga0495652_0046212 3300046529 Bacteria 3739
1323 Ga0495652_0052210 3300046529 Bacteria 3488
1324 Ga0495652_0111751 3300046529 Bacteria 2196
1325 Ga0495652_0143031 3300046529 Bacteria 1879
1326 Ga0495652_0546798 3300046529 Bacteria 797
1327 Ga0495652_0803153 3300046529 Bacteria 626
1328 Ga0495652_0839974 3300046529 Bacteria 609
1329 Ga0495654_0039047 3300046530 Bacteria 2371
1330 Ga0495654_0062684 3300046530 Bacteria 1782
1331 Ga0495654_0182272 3300046530 Bacteria 909
1332 Ga0495665_0000075 3300046531 Bacteria 42692
1333 Ga0495665_0032786 3300046531 Bacteria 2779
1334 Ga0495665_0043974 3300046531 Bacteria 2374
1335 Ga0495640_0011872 3300046533 Bacteria 6681
1336 Ga0495640_0037135 3300046533 Bacteria 3438
1337 Ga0495640_0091632 3300046533 Bacteria 2005
1338 Ga0495640_0480950 3300046533 Bacteria 757
1339 Ga0495586_0321407 3300046535 Bacteria 888
1340 Ga0495586_0749540 3300046535 Bacteria 564
1341 Ga0495587_0005824 3300046536 Bacteria 8026
1342 Ga0495587_0026053 3300046536 Bacteria 3568
1343 Ga0495587_0033715 3300046536 Bacteria 3089
1344 Ga0495587_0199682 3300046536 Bacteria 1131
1345 Ga0495587_0239205 3300046536 Bacteria 1022
1346 Ga0495598_0004512 3300046537 Bacteria 3021
1347 Ga0495598_0030372 3300046537 Bacteria 1513
1348 Ga0495598_0074738 3300046537 Bacteria 1075
1349 Ga0495609_0081636 3300046538 Bacteria 1413
1350 Ga0495609_0451476 3300046538 Bacteria 511
1351 Ga0495621_0121212 3300046539 Bacteria 1011
1352 Ga0495597_0229584 3300046542 Bacteria 735
1353 Ga0495597_0290359 3300046542 Bacteria 636
1354 Ga0495645_0024888 3300046543 Bacteria 4343
1355 Ga0495645_0082584 3300046543 Bacteria 2304
1356 Ga0495645_0203057 3300046543 Bacteria 1343
1357 Ga0495645_0336413 3300046543 Bacteria 976
1358 Ga0495622_0012051 3300046557 Bacteria 3997
1359 Ga0495622_0041413 3300046557 Bacteria 2142
1360 Ga0495622_0171462 3300046557 Bacteria 975
1361 Ga0495633_0024562 3300046558 Bacteria 2977
1362 Ga0495633_0039918 3300046558 Bacteria 2238
1363 Ga0495633_0118661 3300046558 Bacteria 1225
1364 Ga0495667_0006368 3300046559 Bacteria 8004
1365 Ga0495667_0017539 3300046559 Bacteria 4835
1366 Ga0495667_0019902 3300046559 Bacteria 4528
1367 Ga0495667_0073028 3300046559 Bacteria 2235
1368 Ga0495667_0155249 3300046559 Bacteria 1473
1369 Ga0495667_0161939 3300046559 Bacteria 1439
1370 Ga0495667_0265274 3300046559 Bacteria 1092
1371 Ga0495667_0316475 3300046559 Bacteria 988
1372 Ga0495656_0002229 3300046615 Bacteria 6408
1373 Ga0495656_0020753 3300046615 Bacteria 2551
1374 Ga0495656_0061396 3300046615 Bacteria 1641
1375 Ga0495656_0085065 3300046615 Bacteria 1435
1376 Ga0495656_0355160 3300046615 Bacteria 760
1377 Ga0495656_0393459 3300046615 Bacteria 724
1378 Ga0495668_0017150 3300046616 Bacteria 4206
1379 Ga0495668_0069063 3300046616 Bacteria 1943
1380 Ga0495668_0111567 3300046616 Bacteria 1496
1381 Ga0495668_0638805 3300046616 Bacteria 588
1382 Ga0495634_0002559 3300046642 Bacteria 15022
1383 Ga0495634_0035954 3300046642 Bacteria 3389
1384 Ga0495634_0054936 3300046642 Bacteria 2664
1385 Ga0495634_0106922 3300046642 Bacteria 1802
1386 Ga0495634_0152619 3300046642 Bacteria 1460
1387 Ga0495611_0364613 3300046648 Bacteria 662
1388 Ga0495625_0070230 3300046660 Bacteria 2459
1389 Ga0495625_0183713 3300046660 Bacteria 1389
1390 Ga0495625_0196527 3300046660 Bacteria 1333
1391 Ga0495635_0000691 3300046663 Bacteria 21736
1392 Ga0495635_0275222 3300046663 Bacteria 1131
1393 Ga0495659_0121854 3300046664 Bacteria 1027
1394 Ga0495659_0321605 3300046664 Bacteria 657
1395 Ga0495661_0148465 3300046665 Bacteria 1268
1396 Ga0495661_0423657 3300046665 Bacteria 644
1397 Ga0495588_0002885 3300046674 Bacteria 7407
1398 Ga0495588_0086051 3300046674 Bacteria 1644
1399 Ga0495588_0106471 3300046674 Bacteria 1476
1400 Ga0495657_0026358 3300046675 Bacteria 4116
1401 Ga0495657_0047454 3300046675 Bacteria 2903
1402 Ga0495599_0016518 3300046678 Bacteria 4583
1403 Ga0495599_0052799 3300046678 Bacteria 2546
1404 Ga0495599_0063753 3300046678 Bacteria 2303
1405 Ga0495599_0099639 3300046678 Bacteria 1811
1406 Ga0495599_0120695 3300046678 Bacteria 1629
1407 Ga0495623_0006694 3300046679 Bacteria 7497
1408 Ga0495646_0034970 3300046680 Bacteria 3117
1409 Ga0495646_0071612 3300046680 Bacteria 2039
1410 Ga0495646_0093838 3300046680 Bacteria 1729
1411 Ga0495646_0146647 3300046680 Bacteria 1315
1412 Ga0495647_0015336 3300046681 Bacteria 2684
1413 Ga0495647_0106924 3300046681 Bacteria 1164
1414 Ga0495658_0000388 3300046683 Bacteria 24753
1415 Ga0495658_0009245 3300046683 Bacteria 4902
1416 Ga0495658_0043627 3300046683 Bacteria 2509
1417 Ga0495658_0441587 3300046683 Bacteria 831
1418 Ga0495658_0712275 3300046683 Bacteria 643
1419 Ga0495669_0024921 3300046684 Bacteria 2606
1420 Ga0495669_0089373 3300046684 Bacteria 1421
1421 Ga0495613_0014049 3300046689 Bacteria 5942
1422 Ga0495613_0022116 3300046689 Bacteria 4738
1423 Ga0495613_0040271 3300046689 Bacteria 3463
1424 Ga0495613_0041571 3300046689 Bacteria 3404
1425 Ga0495613_0059017 3300046689 Bacteria 2814
1426 Ga0495613_0604164 3300046689 Bacteria 730
1427 Ga0495613_0685800 3300046689 Bacteria 675
1428 Ga0495624_0010418 3300046690 Bacteria 6408
1429 Ga0495624_0074116 3300046690 Bacteria 2115
1430 Ga0495624_0186292 3300046690 Bacteria 1263
1431 Ga0495624_0296246 3300046690 Bacteria 976
1432 Ga0495670_0015796 3300046691 Bacteria 3710
1433 Ga0495670_0023527 3300046691 Bacteria 3040
1434 Ga0495670_0169803 3300046691 Bacteria 1148
1435 Ga0495670_0251719 3300046691 Bacteria 942
1436 Ga0495670_0404827 3300046691 Bacteria 737
1437 Ga0495671_0025636 3300046692 Bacteria 3062
1438 Ga0495671_0385078 3300046692 Bacteria 672
1439 Ga0495649_0259217 3300046694 Bacteria 892
1440 Ga0495649_0428087 3300046694 Bacteria 662
1441 Ga0495589_0180833 3300046794 Bacteria 1000
1442 Ga0495589_0469799 3300046794 Bacteria 575
1443 Ga0495600_0000551 3300046809 Bacteria 19431
1444 Ga0495600_0011511 3300046809 Bacteria 5513
1445 Ga0495600_0130169 3300046809 Bacteria 1636
1446 Ga0495600_0327911 3300046809 Bacteria 962
1447 Ga0495660_0247724 3300046810 Bacteria 828
1448 Ga0495581_0000388 3300047315 Bacteria 22050
1449 Ga0495581_0087418 3300047315 Bacteria 1807
1450 Ga0495581_0149659 3300047315 Bacteria 1363
1451 Ga0495581_0152841 3300047315 Bacteria 1348
1452 Ga0495581_0217532 3300047315 Bacteria 1117
1453 Ga0495581_0502344 3300047315 Bacteria 705
1454 Ga0495604_0016072 3300047317 Bacteria 5978
1455 Ga0495604_0077829 3300047317 Bacteria 2491
1456 Ga0495604_0102789 3300047317 Bacteria 2097
1457 Ga0495604_0231764 3300047317 Bacteria 1266
1458 Ga0495604_0349299 3300047317 Bacteria 983
1459 Ga0495604_0644511 3300047317 Bacteria 676
1460 Ga0495636_0150238 3300047318 Bacteria 1045
1461 Ga0495674_0000671 3300047319 Bacteria 32203
1462 Ga0495674_0034294 3300047319 Bacteria 4590
1463 Ga0495674_0060282 3300047319 Bacteria 3311
1464 Ga0495674_0063261 3300047319 Bacteria 3219
1465 Ga0495674_0351987 3300047319 Bacteria 1195
1466 Ga0495674_0429222 3300047319 Bacteria 1064
1467 Ga0495674_0433036 3300047319 Bacteria 1058
1468 Ga0495674_1026426 3300047319 Bacteria 631
1469 Ga0495672_0016746 3300047320 Bacteria 4922
1470 Ga0495672_0094329 3300047320 Bacteria 1636
1471 Ga0495676_0040452 3300047321 Bacteria 3848
1472 Ga0495676_0313568 3300047321 Bacteria 1055
1473 Ga0495680_0005795 3300047322 Bacteria 11562
1474 Ga0495680_0026097 3300047322 Bacteria 4823
1475 Ga0495680_0027772 3300047322 Bacteria 4644
1476 Ga0495680_0055922 3300047322 Bacteria 3058
1477 Ga0495683_0175223 3300047323 Bacteria 983
1478 Ga0495683_0280464 3300047323 Bacteria 721
1479 Ga0495675_0001030 3300047444 Bacteria 16933
1480 Ga0495675_0010217 3300047444 Bacteria 5857
1481 Ga0495675_0240009 3300047444 Bacteria 1091
1482 Ga0495677_0023647 3300047445 Bacteria 2230
1483 Ga0495677_0053818 3300047445 Bacteria 1484
1484 Ga0495679_036164 3300047446 Bacteria 1561
1485 Ga0495679_147944 3300047446 Bacteria 632
1486 Ga0495673_0073462 3300047469 Bacteria 1433
1487 Ga0495673_0195553 3300047469 Bacteria 759
1488 Ga0495681_0032520 3300047470 Bacteria 2625
1489 Ga0495684_0009133 3300047471 Bacteria 7657
1490 Ga0495684_0112862 3300047471 Bacteria 2049
1491 Ga0495684_0209874 3300047471 Bacteria 1433
1492 Ga0495686_0148881 3300047472 Bacteria 1376
1493 Ga0495686_0184037 3300047472 Bacteria 1209
1494 Ga0495686_0209984 3300047472 Bacteria 1113
1495 Ga0495686_0241286 3300047472 Bacteria 1019
1496 Ga0495686_0248542 3300047472 Bacteria 1000
1497 Ga0495686_0588263 3300047472 Bacteria 577
1498 Ga0495593_0000139 3300047673 Bacteria 35239
1499 Ga0495593_0007168 3300047673 Bacteria 6536
1500 Ga0495593_0032731 3300047673 Bacteria 2833
1501 Ga0495593_0072308 3300047673 Bacteria 1791
1502 Ga0495602_0051710 3300048088 Bacteria 3657
1503 Ga0495602_0071774 3300048088 Bacteria 2955
1504 Ga0495602_0177537 3300048088 Bacteria 1646
1505 Ga0495602_0188619 3300048088 Bacteria 1583
1506 Ga0495602_0429345 3300048088 Bacteria 937
1507 Ga0495614_0118609 3300048089 Bacteria 1165
1508 Ga0495626_0073999 3300048091 Bacteria 1525
1509 Ga0495626_0102571 3300048091 Bacteria 1246
1510 Ga0496100_0023379 3300048903 Bacteria 3754
1511 Ga0496100_0130639 3300048903 Bacteria 1768
1512 Ga0496100_0336982 3300048903 Bacteria 1136
1513 Ga0496100_1454746 3300048903 Bacteria 541
1514 Ga0496101_0002029 3300048904 Bacteria 12307
1515 Ga0496101_0039687 3300048904 Bacteria 3350
1516 Ga0496101_0121862 3300048904 Bacteria 1972
1517 Ga0496101_0417639 3300048904 Bacteria 1057
1518 Ga0496101_0512965 3300048904 Bacteria 947
1519 Ga0496102_0016370 3300048905 Bacteria 6477
1520 Ga0496102_0025088 3300048905 Bacteria 5303
1521 Ga0496102_0026413 3300048905 Bacteria 5178
1522 Ga0496102_0075327 3300048905 Bacteria 3102
1523 Ga0496102_0100670 3300048905 Bacteria 2684
1524 Ga0496102_0156264 3300048905 Bacteria 2144
1525 Ga0496102_1512771 3300048905 Bacteria 590
1526 Ga0496103_0002891 3300048906 Bacteria 10659
1527 Ga0496103_0071854 3300048906 Bacteria 2166
1528 Ga0496103_0114074 3300048906 Bacteria 1718
1529 Ga0496103_0553392 3300048906 Bacteria 734
1530 Ga0496104_0012006 3300048907 Bacteria 7772
1531 Ga0496104_0012848 3300048907 Bacteria 7541
1532 Ga0496104_0016042 3300048907 Bacteria 6801
1533 Ga0496104_0044855 3300048907 Bacteria 4155
1534 Ga0496104_0086467 3300048907 Bacteria 2993
1535 Ga0496104_0585108 3300048907 Bacteria 1026
1536 Ga0496105_0002574 3300048908 Bacteria 13182
1537 Ga0496105_0013684 3300048908 Bacteria 6441
1538 Ga0496105_0044947 3300048908 Bacteria 3643
1539 Ga0496105_0214836 3300048908 Bacteria 1567
1540 Ga0496105_0538801 3300048908 Bacteria 912
1541 Ga0496106_0007853 3300048909 Bacteria 7894
1542 Ga0496106_0043383 3300048909 Bacteria 3374
1543 Ga0496106_0048307 3300048909 Bacteria 3205
1544 Ga0496106_0249371 3300048909 Bacteria 1419
1545 Ga0496106_0265361 3300048909 Bacteria 1374
1546 Ga0496106_0625616 3300048909 Bacteria 861
1547 Ga0496106_0627022 3300048909 Bacteria 860
1548 Ga0496106_0861810 3300048909 Bacteria 716
1549 Ga0496107_0002849 3300048910 Bacteria 11432
1550 Ga0496107_0016796 3300048910 Bacteria 5146
1551 Ga0496107_0020694 3300048910 Bacteria 4649
1552 Ga0496107_0093459 3300048910 Bacteria 2199
1553 Ga0496107_0093933 3300048910 Bacteria 2194
1554 Ga0496107_0152516 3300048910 Bacteria 1710
1555 Ga0496107_0678959 3300048910 Bacteria 758
1556 Ga0496108_0002506 3300048911 Bacteria 14695
1557 Ga0496108_0031405 3300048911 Bacteria 4407
1558 Ga0496108_0064547 3300048911 Bacteria 3085
1559 Ga0496108_0119255 3300048911 Bacteria 2262
1560 Ga0496108_0124604 3300048911 Bacteria 2211
1561 Ga0496108_0129918 3300048911 Bacteria 2165
1562 Ga0496108_0212977 3300048911 Bacteria 1677
1563 Ga0496108_0309512 3300048911 Bacteria 1376
1564 Ga0496108_0384174 3300048911 Bacteria 1226
1565 Ga0496108_0624700 3300048911 Bacteria 938
1566 Ga0496108_1252468 3300048911 Bacteria 625
1567 Ga0496109_0001930 3300048912 Bacteria 17226
1568 Ga0496109_0008606 3300048912 Bacteria 8687
1569 Ga0496109_0020678 3300048912 Bacteria 5814
1570 Ga0496109_0037201 3300048912 Bacteria 4397
1571 Ga0496109_0074406 3300048912 Bacteria 3122
1572 Ga0496109_0307034 3300048912 Bacteria 1496
1573 Ga0496109_0333559 3300048912 Bacteria 1432
1574 Ga0496109_0360515 3300048912 Bacteria 1373
1575 Ga0496109_0596255 3300048912 Bacteria 1041
1576 Ga0496109_1043130 3300048912 Bacteria 755
1577 Ga0496109_1555631 3300048912 Bacteria 596
1578 Ga0496110_0004950 3300048913 Bacteria 10400
1579 Ga0496110_0026064 3300048913 Bacteria 4999
1580 Ga0496110_0039460 3300048913 Bacteria 4111
1581 Ga0496110_0061582 3300048913 Bacteria 3312
1582 Ga0496110_0096035 3300048913 Bacteria 2655
1583 Ga0496110_0115956 3300048913 Bacteria 2411
1584 Ga0496110_0185379 3300048913 Bacteria 1890
1585 Ga0496110_0354669 3300048913 Bacteria 1336
1586 Ga0496110_0431857 3300048913 Bacteria 1200
1587 Ga0496111_0002335 3300048914 Bacteria 11431
1588 Ga0496111_0005165 3300048914 Bacteria 8323
1589 Ga0496111_0048193 3300048914 Bacteria 3069
1590 Ga0496111_0061767 3300048914 Bacteria 2716
1591 Ga0496111_0090103 3300048914 Bacteria 2247
1592 Ga0496111_0183999 3300048914 Bacteria 1553
1593 Ga0496111_0260453 3300048914 Bacteria 1287
1594 Ga0496111_0406278 3300048914 Bacteria 1006
1595 Ga0496111_0505764 3300048914 Bacteria 889
1596 Ga0496112_0003333 3300048915 Bacteria 13256
1597 Ga0496112_0009853 3300048915 Bacteria 8633
1598 Ga0496112_0020136 3300048915 Bacteria 6316
1599 Ga0496112_0041239 3300048915 Bacteria 4516
1600 Ga0496112_0096486 3300048915 Bacteria 2927
1601 Ga0496112_0158986 3300048915 Bacteria 2226
1602 Ga0496112_0236673 3300048915 Bacteria 1779
1603 Ga0496112_0238351 3300048915 Bacteria 1772
1604 Ga0496112_0308564 3300048915 Bacteria 1527
1605 Ga0496112_0531710 3300048915 Bacteria 1110
1606 Ga0496112_0655132 3300048915 Bacteria 979
1607 Ga0496112_0948962 3300048915 Bacteria 781
1608 Ga0496112_1276619 3300048915 Bacteria 650
1609 Ga0496112_1301697 3300048915 Bacteria 642
1610 Ga0496113_0002381 3300048916 Bacteria 10910
1611 Ga0496113_0004641 3300048916 Bacteria 8469
1612 Ga0496113_0017232 3300048916 Bacteria 5009
1613 Ga0496113_0035302 3300048916 Bacteria 3655
1614 Ga0496113_0037933 3300048916 Bacteria 3540
1615 Ga0496113_0046770 3300048916 Bacteria 3213
1616 Ga0496113_1330883 3300048916 Bacteria 558
1617 Ga0496114_0016637 3300048917 Bacteria 5930
1618 Ga0496114_0025242 3300048917 Bacteria 4856
1619 Ga0496114_0030400 3300048917 Bacteria 4443
1620 Ga0496114_0069020 3300048917 Bacteria 2968
1621 Ga0496114_0312227 3300048917 Bacteria 1389
1622 Ga0496114_0550245 3300048917 Bacteria 1019
1623 Ga0496114_0829879 3300048917 Bacteria 804
1624 Ga0496114_0951281 3300048917 Bacteria 741
1625 Ga0496114_1096659 3300048917 Bacteria 681
1626 Ga0496115_0000678 3300048918 Bacteria 25173
1627 Ga0496115_0011449 3300048918 Bacteria 6649
1628 Ga0496115_0071870 3300048918 Bacteria 2806
1629 Ga0496115_0108808 3300048918 Bacteria 2275
1630 Ga0496115_0204634 3300048918 Bacteria 1630
1631 Ga0496115_0283083 3300048918 Bacteria 1361
1632 Ga0496115_0293935 3300048918 Bacteria 1332
1633 Ga0496115_0489454 3300048918 Bacteria 990
1634 Ga0496115_0505963 3300048918 Bacteria 970
1635 Ga0496116_0019342 3300048919 Bacteria 5215
1636 Ga0496117_0022442 3300048920 Bacteria 5061
1637 Ga0496117_0189973 3300048920 Bacteria 1171
1638 Ga0496118_0042240 3300048921 Bacteria 3599
1639 Ga0496118_0053940 3300048921 Bacteria 3050
1640 Ga0496118_0054212 3300048921 Bacteria 3039
1641 Ga0496118_0085018 3300048921 Bacteria 2205
1642 Ga0496118_0273721 3300048921 Bacteria 944
1643 Ga0496118_0355882 3300048921 Bacteria 778
1644 Ga0496119_0194163 3300048922 Bacteria 1056
1645 Ga0496119_0209548 3300048922 Bacteria 1003
1646 Ga0496120_0044083 3300048923 Bacteria 2594
1647 Ga0496120_0059002 3300048923 Bacteria 2152
1648 Ga0496121_0001737 3300048924 Bacteria 35592
1649 Ga0496121_0004082 3300048924 Bacteria 20058
1650 Ga0496121_0020275 3300048924 Bacteria 6592
1651 Ga0496121_0021375 3300048924 Bacteria 6340
1652 Ga0496121_0080102 3300048924 Bacteria 2590
1653 Ga0496121_0101848 3300048924 Bacteria 2213
1654 Ga0496121_0143243 3300048924 Bacteria 1770
1655 Ga0496121_0145730 3300048924 Bacteria 1750
1656 Ga0496121_0192362 3300048924 Bacteria 1462
1657 Ga0496121_0221473 3300048924 Bacteria 1332
1658 Ga0496121_0314357 3300048924 Bacteria 1057
1659 Ga0496122_0103441 3300048925 Bacteria 1895
1660 Ga0496122_0129577 3300048925 Bacteria 1606
1661 Ga0496123_0058054 3300048926 Bacteria 2514
1662 Ga0496123_0082904 3300048926 Bacteria 1941
1663 Ga0496123_0195655 3300048926 Bacteria 1041
1664 Ga0496124_0043136 3300048927 Bacteria 3879
1665 Ga0496124_0073787 3300048927 Bacteria 2822
1666 Ga0496124_0132977 3300048927 Bacteria 1974
1667 Ga0496124_0473799 3300048927 Bacteria 847
1668 Ga0496124_0751224 3300048927 Bacteria 611
1669 Ga0496125_0000048 3300048928 Bacteria 290651
1670 Ga0496125_0000664 3300048928 Bacteria 57244
1671 Ga0496125_0004229 3300048928 Bacteria 16724
1672 Ga0496125_0010930 3300048928 Bacteria 9126
1673 Ga0496125_0095036 3300048928 Bacteria 2218
1674 Ga0496125_0244647 3300048928 Bacteria 1136
1675 Ga0496125_0263575 3300048928 Bacteria 1078
1676 Ga0496125_0316782 3300048928 Bacteria 948
1677 Ga0496126_0008798 3300048929 Bacteria 10831
1678 Ga0496126_0016848 3300048929 Bacteria 7294
1679 Ga0496126_0028615 3300048929 Bacteria 5307
1680 Ga0496126_0052900 3300048929 Bacteria 3687
1681 Ga0496126_0066347 3300048929 Bacteria 3227
1682 Ga0496126_0076270 3300048929 Bacteria 2974
1683 Ga0496126_0096059 3300048929 Bacteria 2599
1684 Ga0496126_0137511 3300048929 Bacteria 2106
1685 Ga0496126_0170955 3300048929 Bacteria 1851
1686 Ga0496126_0256629 3300048929 Bacteria 1455
1687 Ga0496126_0285729 3300048929 Bacteria 1365
1688 Ga0496126_0391049 3300048929 Bacteria 1130
1689 Ga0496126_0591168 3300048929 Bacteria 875
1690 Ga0496126_0622728 3300048929 Bacteria 848
1691 Ga0496126_0695803 3300048929 Bacteria 790
1692 Ga0496126_0782821 3300048929 Bacteria 733
1693 Ga0495682_0061301 3300049460 Bacteria 1358
1694 Ga0495682_0207599 3300049460 Bacteria 694
1695 Ga0501031_0034074 3300049568 Bacteria 3322
1696 Ga0501031_0035611 3300049568 Bacteria 3247
1697 Ga0501031_0096396 3300049568 Bacteria 1930
1698 Ga0501032_0091257 3300049569 Bacteria 2021
1699 Ga0501032_0142072 3300049569 Bacteria 1581
1700 Ga0501032_0593493 3300049569 Bacteria 705
1701 Ga0501033_0033855 3300049570 Bacteria 3835
1702 Ga0501033_0037107 3300049570 Bacteria 3649
1703 Ga0501033_0173892 3300049570 Bacteria 1546
1704 Ga0501033_0214615 3300049570 Bacteria 1371
1705 Ga0501033_0432333 3300049570 Bacteria 916
1706 Ga0501034_0091435 3300049571 Bacteria 3040
1707 Ga0501034_0266782 3300049571 Bacteria 1654
1708 Ga0501034_0291987 3300049571 Bacteria 1568
1709 Ga0501036_0033224 3300049572 Bacteria 4362
1710 Ga0501036_0067529 3300049572 Bacteria 3025
1711 Ga0501036_0086049 3300049572 Bacteria 2657
1712 Ga0501037_0050675 3300049573 Bacteria 3037
1713 Ga0501037_0104279 3300049573 Bacteria 2045
1714 Ga0501037_0106139 3300049573 Bacteria 2024
1715 Ga0501037_0434510 3300049573 Bacteria 897
1716 Ga0501038_0014226 3300049574 Bacteria 7249
1717 Ga0501038_0023623 3300049574 Bacteria 5492
1718 Ga0501038_0048160 3300049574 Bacteria 3689
1719 Ga0501038_0193917 3300049574 Bacteria 1633
1720 Ga0501038_0343307 3300049574 Bacteria 1164
1721 Ga0501038_0515017 3300049574 Bacteria 913
1722 Ga0501038_0901036 3300049574 Bacteria 653
1723 Ga0501039_0034171 3300049575 Bacteria 3923
1724 Ga0501039_0160181 3300049575 Bacteria 1768
1725 Ga0501039_0196455 3300049575 Bacteria 1586
1726 Ga0501039_0259544 3300049575 Bacteria 1366
1727 Ga0501039_1213587 3300049575 Bacteria 583
1728 Ga0501040_0014186 3300049576 Bacteria 5246
1729 Ga0501040_0270245 3300049576 Bacteria 1214
1730 Ga0501041_0307220 3300049577 Bacteria 1000
1731 Ga0501042_0300512 3300049578 Bacteria 1160
1732 Ga0501043_0045141 3300049579 Bacteria 3465
1733 Ga0501043_0215125 3300049579 Bacteria 1488
1734 Ga0501046_0176043 3300049580 Bacteria 1602
1735 Ga0501046_0365556 3300049580 Bacteria 1046
1736 Ga0501047_0071967 3300049581 Bacteria 3327
1737 Ga0501047_0228029 3300049581 Bacteria 1717
1738 Ga0501047_0235152 3300049581 Bacteria 1684
1739 Ga0501047_0264664 3300049581 Bacteria 1566
1740 Ga0501047_0313322 3300049581 Bacteria 1409
1741 Ga0501047_0441179 3300049581 Bacteria 1132
1742 Ga0501047_0657749 3300049581 Bacteria 867
1743 Ga0501048_0987750 3300049582 Bacteria 606
1744 Ga0501067_0046310 3300049583 Bacteria 2414
1745 Ga0501067_0046367 3300049583 Bacteria 2412
1746 Ga0501067_0081091 3300049583 Bacteria 1799
1747 Ga0501067_0165724 3300049583 Bacteria 1230
1748 Ga0501069_0150548 3300049585 Bacteria 1337
1749 Ga0501069_0499267 3300049585 Bacteria 726
1750 Ga0501070_0170934 3300049586 Bacteria 1790
1751 Ga0501070_0217086 3300049586 Bacteria 1569
1752 Ga0501070_0649752 3300049586 Bacteria 837
1753 Ga0501070_1135687 3300049586 Bacteria 601
1754 Ga0501071_0151813 3300049587 Bacteria 1728
1755 Ga0501071_0185148 3300049587 Bacteria 1561
1756 Ga0501072_0038043 3300049588 Bacteria 3776
1757 Ga0501072_0153039 3300049588 Bacteria 1839
1758 Ga0501073_0292652 3300049589 Bacteria 1123
1759 Ga0501073_0918759 3300049589 Bacteria 602
1760 Ga0501074_0090925 3300049590 Bacteria 2186
1761 Ga0501074_0745900 3300049590 Bacteria 690
1762 Ga0501075_0099622 3300049591 Bacteria 2207
1763 Ga0501075_0528928 3300049591 Bacteria 900
1764 Ga0501075_0702167 3300049591 Bacteria 771
1765 Ga0501076_0034170 3300049592 Bacteria 3973
1766 Ga0501076_0591218 3300049592 Bacteria 915
1767 Ga0501076_0790205 3300049592 Bacteria 783
1768 Ga0501079_0019561 3300049741 Bacteria 5172
1769 Ga0501079_0071225 3300049741 Bacteria 2685
1770 Ga0501079_0187441 3300049741 Bacteria 1615
1771 Ga0501080_0140111 3300049742 Bacteria 2236
1772 Ga0501080_0168264 3300049742 Bacteria 2022
1773 Ga0501080_0190909 3300049742 Bacteria 1882
1774 Ga0501080_0296293 3300049742 Bacteria 1468
1775 Ga0501081_0469661 3300049743 Bacteria 936
1776 Ga0501083_0031618 3300049744 Bacteria 3632
1777 Ga0501083_0357937 3300049744 Bacteria 949
1778 Ga0501035_0166288 3300049822 Bacteria 1907
1779 Ga0501035_0736981 3300049822 Bacteria 792
1780 Ga0501044_0012346 3300049823 Bacteria 9246
1781 Ga0501044_0076306 3300049823 Bacteria 3402
1782 Ga0501044_0087376 3300049823 Bacteria 3149
1783 Ga0501044_0136502 3300049823 Bacteria 2444
1784 Ga0501044_0305261 3300049823 Bacteria 1519
1785 Ga0501044_0701526 3300049823 Bacteria 897
1786 Ga0501044_0881492 3300049823 Bacteria 770
1787 Ga0501045_0385969 3300049824 Bacteria 1042
1788 Ga0501045_0700586 3300049824 Bacteria 747
1789 nmdc:mga03683_105564_c1 3300050489 Bacteria 1241
1790 nmdc:mga03683_506098_c1 3300050489 Bacteria 585
1791 nmdc:mga03n38_3011_c1 3300050490 Bacteria 5335
1792 nmdc:mga03n38_408527_c1 3300050490 Bacteria 749
1793 nmdc:mga03n38_414576_c1 3300050490 Bacteria 744
1794 nmdc:mga03n38_425522_c1 3300050490 Bacteria 735
1795 nmdc:mga03n38_684328_c1 3300050490 Bacteria 590
1796 nmdc:mga00v17_203844_c1 3300050491 Bacteria 1279
1797 nmdc:mga00v17_723519_c1 3300050491 Bacteria 637
1798 nmdc:mga00v17_77901_c1 3300050491 Bacteria 2065
1799 nmdc:mga0yw44_134093_c1 3300050492 Bacteria 1605
1800 nmdc:mga0yw44_1376_c1 3300050492 Bacteria 9645
1801 nmdc:mga0yw44_175558_c1 3300050492 Bacteria 1408
1802 nmdc:mga0yw44_479465_c1 3300050492 Bacteria 844
1803 nmdc:mga0yw44_599966_c1 3300050492 Bacteria 748
1804 nmdc:mga0yw44_645621_c1 3300050492 Bacteria 719
1805 nmdc:mga0k408_288905_c1 3300050493 Bacteria 979
1806 nmdc:mga06z11_311935_c1 3300050494 Bacteria 937
1807 nmdc:mga06z11_368544_c1 3300050494 Bacteria 862
1808 nmdc:mga06z11_711524_c1 3300050494 Bacteria 612
1809 nmdc:mga06z11_77102_c1 3300050494 Bacteria 1779
1810 nmdc:mga04h51_154029_c1 3300050495 Bacteria 880
1811 nmdc:mga04h51_162212_c1 3300050495 Bacteria 861
1812 nmdc:mga04h51_64144_c1 3300050495 Bacteria 1266
1813 nmdc:mga07m45_122065_c1 3300050496 Bacteria 1505
1814 nmdc:mga07m45_256424_c1 3300050496 Bacteria 1017
1815 nmdc:mga07m45_319044_c1 3300050496 Bacteria 903
1816 nmdc:mga07m45_373061_c1 3300050496 Bacteria 829
1817 nmdc:mga07m45_49166_c1 3300050496 Bacteria 2373
1818 nmdc:mga05p37_182526_c1 3300050507 Bacteria 2552
1819 nmdc:mga05p37_3470_c1 3300050507 Bacteria 18419
1820 nmdc:mga09592_2434_c1 3300050508 Bacteria 15016
1821 nmdc:mga0qj67_253580_c1 3300050509 Bacteria 1427
1822 nmdc:mga0qj67_7467_c1 3300050509 Bacteria 8074
1823 nmdc:mga06r32_1530_c1 3300050510 Bacteria 20800
1824 nmdc:mga08y16_1107_c1 3300050511 Bacteria 26547
1825 nmdc:mga08y16_1244482_c1 3300050511 Bacteria 713
1826 nmdc:mga08y16_1553864_c1 3300050511 Bacteria 621
1827 nmdc:mga08y16_342236_c1 3300050511 Bacteria 1537
1828 nmdc:mga08y16_401420_c1 3300050511 Bacteria 1403
1829 nmdc:mga0n895_467916_c1 3300050512 Bacteria 1272
1830 nmdc:mga0n895_49365_c1 3300050512 Bacteria 4122
1831 nmdc:mga0n895_575773_c1 3300050512 Bacteria 1130
1832 nmdc:mga0n895_610499_c1 3300050512 Bacteria 1092
1833 nmdc:mga0n895_655478_c1 3300050512 Bacteria 1048
1834 nmdc:mga0rr50_433125_c1 3300050513 Bacteria 1113
1835 nmdc:mga08x19_94088_c1 3300050514 Bacteria 1981
1836 nmdc:mga0a205_1080261_c1 3300050515 Bacteria 650
1837 nmdc:mga0a205_450863_c1 3300050515 Bacteria 1146
1838 nmdc:mga0sz30_265680_c1 3300050516 Bacteria 764
1839 nmdc:mga0sz30_291977_c1 3300050516 Bacteria 727
1840 nmdc:mga0sz30_67954_c1 3300050516 Bacteria 1531
1841 Ga0495601_0001796 3300053077 Bacteria 11911
1842 Ga0495601_0026292 3300053077 Bacteria 3593
1843 Ga0495601_0042688 3300053077 Bacteria 2846
1844 Ga0495601_0215099 3300053077 Bacteria 1255
1845 Ga0495601_0379431 3300053077 Bacteria 917
1846 Ga0495612_0026334 3300053078 Bacteria 2337
1847 Ga0495612_0033689 3300053078 Bacteria 2073
1848 Ga0495612_0152096 3300053078 Bacteria 1007
1849 Ga0495612_0304689 3300053078 Bacteria 715
1850 Ga0500610_0098484 3300053079 Bacteria 1515
1851 Ga0500635_0001224 3300053080 Bacteria 6145
1852 Ga0500635_0048836 3300053080 Bacteria 1442
1853 Ga0495655_0064142 3300053083 Bacteria 1010
1854 Ga0495655_0217183 3300053083 Bacteria 631
1855 Ga0495595_0009387 3300053084 Bacteria 4046
1856 Ga0495595_0011803 3300053084 Bacteria 3661
1857 Ga0495595_0073773 3300053084 Bacteria 1616
1858 Ga0495595_0103224 3300053084 Bacteria 1377
1859 Ga0495595_0104997 3300053084 Bacteria 1366
1860 Ga0495595_0244293 3300053084 Bacteria 898
1861 Ga0495595_0443772 3300053084 Bacteria 659
1862 Ga0495619_0000063 3300053085 Bacteria 84834
1863 Ga0495619_0001425 3300053085 Bacteria 15712
1864 Ga0495619_0010141 3300053085 Bacteria 5935
1865 Ga0495619_0025400 3300053085 Bacteria 3804
1866 Ga0495619_0274898 3300053085 Bacteria 1167
1867 Ga0495619_0509467 3300053085 Bacteria 827
1868 Ga0495619_0711338 3300053085 Bacteria 683
1869 Ga0500643_047491 3300053087 Bacteria 1237
1870 Ga0500581_049019 3300053089 Bacteria 2156
1871 Ga0500583_0138299 3300053092 Bacteria 1209
1872 Ga0500566_0003557 3300053094 Bacteria 9288
1873 Ga0500566_0006997 3300053094 Bacteria 6679
1874 Ga0500566_0056551 3300053094 Bacteria 2230
1875 Ga0500641_0007969 3300053096 Bacteria 3776
1876 Ga0500641_0012173 3300053096 Bacteria 3136
1877 Ga0500641_0012528 3300053096 Bacteria 3098
1878 Ga0500641_0394577 3300053096 Bacteria 545
1879 Ga0500650_0020682 3300053098 Bacteria 2891
1880 Ga0500650_0326948 3300053098 Bacteria 674
1881 Ga0500554_001467 3300053102 Bacteria 4561
1882 Ga0500555_171559 3300053103 Bacteria 527
1883 Ga0500562_019172 3300053108 Bacteria 1768
1884 Ga0500569_063269 3300053109 Bacteria 1147
1885 Ga0500591_078003 3300053115 Bacteria 1481
1886 Ga0500593_040849 3300053117 Bacteria 2074
1887 Ga0500595_000484 3300053119 Bacteria 24498
1888 Ga0500595_011036 3300053119 Bacteria 3558
1889 Ga0500595_012586 3300053119 Bacteria 3266
1890 Ga0500595_017127 3300053119 Bacteria 2683
1891 Ga0500595_019976 3300053119 Bacteria 2419
1892 Ga0500595_048589 3300053119 Bacteria 1325
1893 Ga0500608_004187 3300053122 Bacteria 5548
1894 Ga0500608_126502 3300053122 Bacteria 1151
1895 Ga0500614_011114 3300053123 Bacteria 1943
1896 Ga0500642_0000055 3300053130 Bacteria 68809
1897 Ga0500642_0054088 3300053130 Bacteria 1781
1898 Ga0500652_021843 3300053131 Bacteria 2415
1899 Ga0500655_016830 3300053133 Bacteria 1348
1900 Ga0500658_0093341 3300053134 Bacteria 1304
1901 Ga0500559_0000250 3300053136 Bacteria 42675
1902 Ga0500559_0000268 3300053136 Bacteria 40472
1903 Ga0500559_0282531 3300053136 Bacteria 780
1904 Ga0500577_0023346 3300053142 Bacteria 2065
1905 Ga0500586_005181 3300053145 Bacteria 3278
1906 Ga0500590_021617 3300053148 Bacteria 3340
1907 Ga0500590_043672 3300053148 Bacteria 2298
1908 Ga0500603_000552 3300053150 Bacteria 9438
1909 Ga0500603_005247 3300053150 Bacteria 2781
1910 Ga0500616_0000035 3300053153 Bacteria 394242
1911 Ga0500622_0003126 3300053156 Bacteria 11374
1912 Ga0500622_0096822 3300053156 Bacteria 1458
1913 Ga0500627_0051431 3300053158 Bacteria 1797
1914 Ga0500627_0083350 3300053158 Bacteria 1426
1915 Ga0500630_102307 3300053159 Bacteria 1303
1916 Ga0500633_0017896 3300053160 Bacteria 2089
1917 Ga0500634_0100273 3300053161 Bacteria 1451
1918 Ga0500638_067288 3300053162 Bacteria 1716
1919 Ga0500639_004632 3300053163 Bacteria 6991
1920 Ga0500636_0010367 3300053177 Bacteria 5435
1921 Ga0500636_0011244 3300053177 Bacteria 5236
1922 Ga0500636_0015519 3300053177 Bacteria 4489
1923 Ga0500636_0079981 3300053177 Bacteria 1884
1924 Ga0500636_0154177 3300053177 Bacteria 1259
1925 Ga0500637_0000027 3300053178 Bacteria 58759
1926 Ga0500637_0000645 3300053178 Bacteria 13832
1927 Ga0500637_0022697 3300053178 Bacteria 3423
1928 Ga0500637_0507412 3300053178 Bacteria 596
1929 Ga0500570_077411 3300053724 Bacteria 1518
1930 Ga0500645_024026 3300053730 Bacteria 1865
1931 Ga0500609_044172 3300053731 Bacteria 617
1932 Ga0500596_006754 3300053735 Bacteria 1920
1933 Ga0500596_024696 3300053735 Bacteria 915
1934 Ga0501084_0109959 3300054114 Bacteria 2316
1935 Ga0501084_0170115 3300054114 Bacteria 1839
1936 Ga0501084_0643463 3300054114 Bacteria 895
1937 Ga0500661_000569 3300055283 Bacteria 6864
1938 Ga0501082_0192587 3300060353 Bacteria 1773
1939 Ga0501082_1009349 3300060353 Bacteria 728
1940 Ga0466962_0227454 3300061719 Bacteria 914
1941 Ga0530510_0451091 3300061734 Bacteria 972

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10003557 Ga0265334_100035578 140
2 3300037853 Ga0436364_1439469 Ga0436364_1439469_732_1286 151
3 3300005530 Ga0070679_100548773 Ga0070679_1005487732 156
4 3300048924 Ga0496121_0192362 Ga0496121_0192362_332_841 156
5 3300005343 Ga0070687_100437414 Ga0070687_1004374142 159
6 3300025918 Ga0207662_10110428 Ga0207662_101104282 159
7 3300035241 Ga0373961_0175473 Ga0373961_0175473_20_505 161
8 3300046475 Ga0495639_0644573 Ga0495639_0644573_48_533 161
9 3300046518 Ga0495631_0166754 Ga0495631_0166754_441_926 161
10 3300046520 Ga0495637_0293726 Ga0495637_0293726_80_565 161
11 3300046522 Ga0495643_0169301 Ga0495643_0169301_574_1059 161
12 3300046537 Ga0495598_0074738 Ga0495598_0074738_11_496 161
13 3300046538 Ga0495609_0081636 Ga0495609_0081636_20_505 161
14 3300046538 Ga0495609_0451476 Ga0495609_0451476_11_496 161
15 3300046615 Ga0495656_0393459 Ga0495656_0393459_225_710 161
16 3300046691 Ga0495670_0404827 Ga0495670_0404827_234_719 161
17 3300046794 Ga0495589_0469799 Ga0495589_0469799_73_558 161
18 3300047320 Ga0495672_0016746 Ga0495672_0016746_2281_2769 161
19 3300048924 Ga0496121_0145730 Ga0496121_0145730_307_795 161
20 3300050512 nmdc:mga0n895_575773_c1 nmdc:mga0n895_575773_c1_629_1114 161
21 3300053096 Ga0500641_0394577 Ga0500641_0394577_43_528 161
22 3300053103 Ga0500555_171559 Ga0500555_171559_18_503 161
23 iso_pu_bacteria 2643221692 2644517398 163
24 3300039437 Ga0436365_1818588 Ga0436365_1818588_69_566 165
25 iso_pu_bacteria 2508501009 2508546286 165
26 iso_pu_bacteria 2508501042 2508695217 165
27 iso_pu_bacteria 2508501128 2509150088 165
28 iso_pu_bacteria 2513237094 2513639640 165
29 iso_pu_bacteria 2513237096 2513661588 165
30 iso_pu_bacteria 2513237098 2513676354 165
31 iso_pu_bacteria 2513237101 2513694105 165
32 iso_pu_bacteria 2513237102 2513699685 165
33 iso_pu_bacteria 2513237104 2513718756 165
34 iso_pu_bacteria 2513237137 2513860188 165
35 iso_pu_bacteria 2513237145 2513922888 165
36 iso_pu_bacteria 2517572143 2517888515 165
37 iso_pu_bacteria 2524023210 2524467192 165
38 iso_pu_bacteria 2524023228 2524535180 165
39 iso_pu_bacteria 2602042107 2603857838 165
40 iso_pu_bacteria 2643221547 2643759027 165
41 iso_pu_bacteria 2667528175 2671119694 165
42 iso_pu_bacteria 2721755755 2723849394 165
43 iso_pu_bacteria 2728368998 2728750375 165
44 iso_pu_bacteria 2791355197 2793067336 165
45 iso_pu_bacteria 2791355199 2793077042 165
46 iso_pu_bacteria 2802429268 2804752178 165
47 iso_pu_bacteria 2824600985 2824605926 165
48 iso_pu_bacteria 2824609381 2824615858 165
49 iso_pu_bacteria 2824617872 2824622223 165
50 iso_pu_bacteria 2824626560 2824632105 165
51 iso_pu_bacteria 2824635225 2824639365 165
52 iso_pu_bacteria 2824644064 2824650535 165
53 iso_pu_bacteria 2824653114 2824661203 165
54 iso_pu_bacteria 2824714736 2824716886 165
55 iso_pu_bacteria 2824723954 2824726946 165
56 iso_pu_bacteria 2849076700 2849082767 165
57 iso_pu_bacteria 2857509624 2857511660 165
58 iso_pu_bacteria 2857524615 2857527209 165
59 iso_pu_bacteria 2874604998 2874608365 165
60 iso_pu_bacteria 2876761206 2876769184 165
61 iso_pu_bacteria 2876808645 2876815884 165
62 iso_pu_bacteria 2879110137 2879112867 165
63 iso_pu_bacteria 2881364244 2881370913 165
64 iso_pu_bacteria 2881665667 2881665786 165
65 iso_pu_bacteria 2885366525 2885371310 165
66 iso_pu_bacteria 2885374607 2885375505 165
67 iso_pu_bacteria 2885383462 2885392041 165
68 iso_pu_bacteria 2888388044 2888390946 165
69 iso_pu_bacteria 2888419890 2888420679 165
70 iso_pu_bacteria 2889033259 2889035807 165
71 iso_pu_bacteria 2893066018 2893068012 165
72 iso_pu_bacteria 2903748898 2903758913 165
73 iso_pu_bacteria 2903768456 2903770580 165
74 iso_pu_bacteria 2904690495 2904699333 165
75 iso_pu_bacteria 2904699407 2904708039 165
76 iso_pu_bacteria 2906610324 2906614116 165
77 iso_pu_bacteria 2906635258 2906638209 165
78 iso_pu_bacteria 2906643746 2906644430 165
79 iso_pu_bacteria 2906660503 2906668368 165
80 iso_pu_bacteria 2908739725 2908747055 165
81 iso_pu_bacteria 2908756301 2908764755 165
82 iso_pu_bacteria 2919073203 2919078328 165
83 iso_pu_bacteria 2922361189 2922364291 165
84 iso_pu_bacteria 2922386360 2922388989 165
85 iso_pu_bacteria 2922425934 2922425947 165
86 iso_pu_bacteria 2932794094 2932794598 165
87 iso_pu_bacteria 2932801729 2932806879 165
88 iso_pu_bacteria 2935630451 2935636693 165
89 iso_pu_bacteria 2935883170 2935890224 165
90 iso_pu_bacteria 2941507105 2941513329 165
91 iso_pu_bacteria 2941515067 2941521292 165
92 iso_pu_bacteria 2941523033 2941528996 165
93 iso_pu_bacteria 2941531003 2941532431 165
94 iso_pu_bacteria 3005474847 3005483606 165
95 iso_pu_bacteria 3005506211 3005509449 165
96 iso_pu_bacteria 3005710791 3005718017 165
97 iso_pu_bacteria 8006933436 8006936646 165
98 iso_pu_bacteria 8006964411 8006970265 165
99 iso_pu_bacteria 8006973647 8006976615 165
100 iso_pu_bacteria 8006984368 8006992385 165
101 iso_pu_bacteria 8006994254 8007000024 165
102 iso_pu_bacteria 8019555841 8019562071 165
103 iso_pu_bacteria 8019565922 8019572136 165
104 iso_pu_bacteria 8056673599 8056678632 165
105 iso_pu_bacteria 8056681323 8056682977 165
106 iso_pu_bacteria 8056689827 8056691599 165
107 iso_pu_bacteria 8056967851 8056971006 165
108 3300021388 Ga0213875_10000001 Ga0213875_100000012175 166
109 3300026023 Ga0207677_11549484 Ga0207677_115494842 166
110 3300037853 Ga0436364_0273345 Ga0436364_0273345_2287919_2288419 166
111 3300041452 Ga0451793_0054577 Ga0451793_0054577_1606_2124 166
112 3300041491 Ga0451833_0732736 Ga0451833_0732736_4387_4896 166
113 3300041491 Ga0451833_1387290 Ga0451833_1387290_1769_2287 166
114 3300041494 Ga0451837_0665351 Ga0451837_0665351_1311_1829 166
115 3300041496 Ga0451839_1449860 Ga0451839_1449860_1236_1754 166
116 3300041501 Ga0451845_0121349 Ga0451845_0121349_64_573 166
117 3300042876 Ga0451577_0419685 Ga0451577_0419685_561_1082 166
118 3300044693 Ga0466961_0335584 Ga0466961_0335584_365_868 166
119 3300027907 Ga0207428_10031000 Ga0207428_100310002 167
120 3300042439 Ga0439464_0019297 Ga0439464_0019297_797_1300 167
121 3300046458 Ga0495591_097871 Ga0495591_097871_185_688 167
122 3300049582 Ga0501048_0987750 Ga0501048_0987750_71_577 167
123 3300049583 Ga0501067_0081091 Ga0501067_0081091_1025_1528 167
124 3300049585 Ga0501069_0150548 Ga0501069_0150548_14_517 167
125 3300049586 Ga0501070_0170934 Ga0501070_0170934_475_978 167
126 3300049744 Ga0501083_0031618 Ga0501083_0031618_1790_2293 167
127 iso_pu_bacteria 2657244999 2657683916 167
128 3300005331 Ga0070670_100709646 Ga0070670_1007096461 168
129 3300005334 Ga0068869_100062201 Ga0068869_1000622012 168
130 3300005435 Ga0070714_100040957 Ga0070714_1000409577 168
131 3300005441 Ga0070700_100010066 Ga0070700_1000100666 168
132 3300005445 Ga0070708_100274295 Ga0070708_1002742952 168
133 3300005467 Ga0070706_100013032 Ga0070706_1000130322 168
134 3300005471 Ga0070698_100220944 Ga0070698_1002209442 168
135 3300005536 Ga0070697_100040235 Ga0070697_1000402355 168
136 3300005536 Ga0070697_100053543 Ga0070697_1000535434 168
137 3300005834 Ga0068851_10412664 Ga0068851_104126642 168
138 3300009545 Ga0105237_10593923 Ga0105237_105939232 168
139 3300025910 Ga0207684_10002807 Ga0207684_1000280710 168
140 3300025910 Ga0207684_10093025 Ga0207684_100930252 168
141 3300025914 Ga0207671_10713142 Ga0207671_107131422 168
142 3300025922 Ga0207646_10004138 Ga0207646_1000413814 168
143 3300025925 Ga0207650_10689282 Ga0207650_106892821 168
144 3300025939 Ga0207665_10050010 Ga0207665_100500104 168
145 3300026075 Ga0207708_10393198 Ga0207708_103931982 168
146 3300035119 Ga0373956_0250966 Ga0373956_0250966_164_676 168
147 3300035170 Ga0373943_0161825 Ga0373943_0161825_467_991 168
148 3300035692 Ga0373935_0203850 Ga0373935_0203850_137_661 168
149 3300035725 Ga0373947_0009428 Ga0373947_0009428_4943_5467 168
150 3300037068 Ga0373925_0410567 Ga0373925_0410567_520_1044 168
151 3300037853 Ga0436364_0017072 Ga0436364_0017072_563_1075 168
152 3300045836 Ga0466958_0225113 Ga0466958_0225113_267_779 168
153 3300046472 Ga0495580_0034351 Ga0495580_0034351_3000_3512 168
154 3300046535 Ga0495586_0321407 Ga0495586_0321407_290_802 168
155 3300053084 Ga0495595_0443772 Ga0495595_0443772_69_581 168
156 3300000549 LJQas_1027587 LJQas_10275871 169
157 3300001991 JGI24743J22301_10009719 JGI24743J22301_100097194 169
158 3300001991 JGI24743J22301_10037910 JGI24743J22301_100379101 169
159 3300002070 JGI24750J21931_1007628 JGI24750J21931_10076282 169
160 3300002073 JGI24745J21846_1018346 JGI24745J21846_10183462 169
161 3300002074 JGI24748J21848_1004537 JGI24748J21848_10045372 169
162 3300002075 JGI24738J21930_10009063 JGI24738J21930_100090631 169
163 3300002075 JGI24738J21930_10073819 JGI24738J21930_100738192 169
164 3300002076 JGI24749J21850_1011994 JGI24749J21850_10119942 169
165 3300002077 JGI24744J21845_10004515 JGI24744J21845_100045152 169
166 3300002077 JGI24744J21845_10030771 JGI24744J21845_100307712 169
167 3300002155 JGI24033J26618_1004751 JGI24033J26618_10047512 169
168 3300002239 JGI24034J26672_10040564 JGI24034J26672_100405641 169
169 3300002244 JGI24742J22300_10015879 JGI24742J22300_100158792 169
170 3300002459 JGI24751J29686_10039394 JGI24751J29686_100393942 169
171 3300003203 JGI25406J46586_10017548 JGI25406J46586_100175482 169
172 3300003214 JGI25165J46597_1008649 JGI25165J46597_10086492 169
173 3300003215 JGI25153J46596_10000445 JGI25153J46596_1000044516 169
174 3300003215 JGI25153J46596_10000538 JGI25153J46596_1000053815 169
175 3300003215 JGI25153J46596_10020462 JGI25153J46596_100204622 169
176 3300003215 JGI25153J46596_10026195 JGI25153J46596_100261953 169
177 3300003215 JGI25153J46596_10033134 JGI25153J46596_100331342 169
178 3300003215 JGI25153J46596_10036294 JGI25153J46596_100362941 169
179 3300003354 JGI25160J50197_1001101 JGI25160J50197_10011012 169
180 3300003659 JGI25404J52841_10003732 JGI25404J52841_100037324 169
181 3300003659 JGI25404J52841_10011646 JGI25404J52841_100116463 169
182 3300003659 JGI25404J52841_10015139 JGI25404J52841_100151392 169
183 3300003752 Ga0055539_1004788 Ga0055539_10047881 169
184 3300003752 Ga0055539_1005854 Ga0055539_10058541 169
185 3300003762 Ga0055542_1009354 Ga0055542_10093542 169
186 3300003771 Ga0055526_1037784 Ga0055526_10377842 169
187 3300003775 Ga0055524_1068071 Ga0055524_10680711 169
188 3300003794 Ga0055531_10008929 Ga0055531_100089293 169
189 3300004625 Ga0055543_1002130 Ga0055543_10021303 169
190 3300005262 Ga0065165_1002055 Ga0065165_100205516 169
191 3300005290 Ga0065712_10075403 Ga0065712_100754032 169
192 3300005293 Ga0065715_10112493 Ga0065715_101124932 169
193 3300005327 Ga0070658_10010443 Ga0070658_100104435 169
194 3300005327 Ga0070658_10023055 Ga0070658_100230553 169
195 3300005327 Ga0070658_10058666 Ga0070658_100586662 169
196 3300005327 Ga0070658_10281558 Ga0070658_102815581 169
197 3300005327 Ga0070658_10297149 Ga0070658_102971492 169
198 3300005327 Ga0070658_10375666 Ga0070658_103756662 169
199 3300005327 Ga0070658_10411161 Ga0070658_104111611 169
200 3300005328 Ga0070676_10071522 Ga0070676_100715222 169
201 3300005328 Ga0070676_10096512 Ga0070676_100965122 169
202 3300005328 Ga0070676_10131929 Ga0070676_101319292 169
203 3300005329 Ga0070683_100002920 Ga0070683_1000029202 169
204 3300005329 Ga0070683_100033897 Ga0070683_1000338975 169
205 3300005329 Ga0070683_100071352 Ga0070683_1000713522 169
206 3300005329 Ga0070683_100106239 Ga0070683_1001062394 169
207 3300005329 Ga0070683_100449926 Ga0070683_1004499262 169
208 3300005329 Ga0070683_100529002 Ga0070683_1005290022 169
209 3300005330 Ga0070690_100012778 Ga0070690_1000127783 169
210 3300005330 Ga0070690_100080433 Ga0070690_1000804332 169
211 3300005330 Ga0070690_100108566 Ga0070690_1001085661 169
212 3300005330 Ga0070690_100229123 Ga0070690_1002291232 169
213 3300005331 Ga0070670_100311224 Ga0070670_1003112242 169
214 3300005331 Ga0070670_100685343 Ga0070670_1006853432 169
215 3300005333 Ga0070677_10013125 Ga0070677_100131253 169
216 3300005333 Ga0070677_10321326 Ga0070677_103213261 169
217 3300005334 Ga0068869_100018129 Ga0068869_1000181296 169
218 3300005334 Ga0068869_100102090 Ga0068869_1001020903 169
219 3300005334 Ga0068869_100445491 Ga0068869_1004454911 169
220 3300005335 Ga0070666_10365764 Ga0070666_103657642 169
221 3300005335 Ga0070666_10824663 Ga0070666_108246631 169
222 3300005336 Ga0070680_100004517 Ga0070680_1000045174 169
223 3300005336 Ga0070680_100011990 Ga0070680_1000119903 169
224 3300005336 Ga0070680_100025468 Ga0070680_1000254682 169
225 3300005336 Ga0070680_100093369 Ga0070680_1000933692 169
226 3300005336 Ga0070680_100140626 Ga0070680_1001406263 169
227 3300005336 Ga0070680_100527927 Ga0070680_1005279272 169
228 3300005337 Ga0070682_100008321 Ga0070682_1000083215 169
229 3300005337 Ga0070682_100053757 Ga0070682_1000537572 169
230 3300005337 Ga0070682_100091873 Ga0070682_1000918732 169
231 3300005337 Ga0070682_100258728 Ga0070682_1002587282 169
232 3300005337 Ga0070682_100392964 Ga0070682_1003929642 169
233 3300005338 Ga0068868_100014820 Ga0068868_1000148202 169
234 3300005338 Ga0068868_100071263 Ga0068868_1000712633 169
235 3300005338 Ga0068868_100096508 Ga0068868_1000965082 169
236 3300005338 Ga0068868_100250434 Ga0068868_1002504342 169
237 3300005339 Ga0070660_100032157 Ga0070660_1000321572 169
238 3300005339 Ga0070660_100044465 Ga0070660_1000444654 169
239 3300005339 Ga0070660_100090963 Ga0070660_1000909633 169
240 3300005339 Ga0070660_100550158 Ga0070660_1005501581 169
241 3300005339 Ga0070660_100929522 Ga0070660_1009295221 169
242 3300005340 Ga0070689_100011439 Ga0070689_1000114395 169
243 3300005340 Ga0070689_100062043 Ga0070689_1000620432 169
244 3300005340 Ga0070689_100123365 Ga0070689_1001233652 169
245 3300005340 Ga0070689_100206612 Ga0070689_1002066122 169
246 3300005341 Ga0070691_10056135 Ga0070691_100561353 169
247 3300005341 Ga0070691_10184414 Ga0070691_101844141 169
248 3300005343 Ga0070687_100006752 Ga0070687_1000067522 169
249 3300005344 Ga0070661_100065312 Ga0070661_1000653122 169
250 3300005344 Ga0070661_100097435 Ga0070661_1000974353 169
251 3300005344 Ga0070661_100484994 Ga0070661_1004849941 169
252 3300005347 Ga0070668_100095925 Ga0070668_1000959252 169
253 3300005347 Ga0070668_100172544 Ga0070668_1001725442 169
254 3300005347 Ga0070668_100283056 Ga0070668_1002830562 169
255 3300005347 Ga0070668_101006843 Ga0070668_1010068431 169
256 3300005353 Ga0070669_100082696 Ga0070669_1000826963 169
257 3300005353 Ga0070669_100209541 Ga0070669_1002095412 169
258 3300005353 Ga0070669_100322882 Ga0070669_1003228822 169
259 3300005354 Ga0070675_100014378 Ga0070675_1000143785 169
260 3300005354 Ga0070675_100060400 Ga0070675_1000604004 169
261 3300005354 Ga0070675_100215032 Ga0070675_1002150322 169
262 3300005355 Ga0070671_100074013 Ga0070671_1000740134 169
263 3300005355 Ga0070671_100079042 Ga0070671_1000790422 169
264 3300005355 Ga0070671_100564920 Ga0070671_1005649202 169
265 3300005355 Ga0070671_100632514 Ga0070671_1006325142 169
266 3300005355 Ga0070671_100716355 Ga0070671_1007163552 169
267 3300005355 Ga0070671_101178829 Ga0070671_1011788291 169
268 3300005356 Ga0070674_100080455 Ga0070674_1000804552 169
269 3300005356 Ga0070674_100138145 Ga0070674_1001381452 169
270 3300005356 Ga0070674_100443754 Ga0070674_1004437542 169
271 3300005364 Ga0070673_100060776 Ga0070673_1000607763 169
272 3300005364 Ga0070673_100200613 Ga0070673_1002006131 169
273 3300005364 Ga0070673_100426445 Ga0070673_1004264452 169
274 3300005365 Ga0070688_100650507 Ga0070688_1006505072 169
275 3300005366 Ga0070659_100058613 Ga0070659_1000586131 169
276 3300005366 Ga0070659_100121177 Ga0070659_1001211772 169
277 3300005366 Ga0070659_100211934 Ga0070659_1002119343 169
278 3300005367 Ga0070667_100087531 Ga0070667_1000875313 169
279 3300005367 Ga0070667_100174737 Ga0070667_1001747372 169
280 3300005367 Ga0070667_100275006 Ga0070667_1002750062 169
281 3300005367 Ga0070667_100363867 Ga0070667_1003638672 169
282 3300005367 Ga0070667_101135114 Ga0070667_1011351141 169
283 3300005406 Ga0070703_10013163 Ga0070703_100131632 169
284 3300005434 Ga0070709_10013289 Ga0070709_100132893 169
285 3300005434 Ga0070709_10025008 Ga0070709_100250084 169
286 3300005434 Ga0070709_10239640 Ga0070709_102396402 169
287 3300005434 Ga0070709_10414769 Ga0070709_104147692 169
288 3300005434 Ga0070709_10773526 Ga0070709_107735261 169
289 3300005435 Ga0070714_100133734 Ga0070714_1001337342 169
290 3300005435 Ga0070714_100141641 Ga0070714_1001416412 169
291 3300005435 Ga0070714_100169470 Ga0070714_1001694702 169
292 3300005435 Ga0070714_100332131 Ga0070714_1003321312 169
293 3300005435 Ga0070714_100483835 Ga0070714_1004838352 169
294 3300005436 Ga0070713_100044362 Ga0070713_1000443623 169
295 3300005436 Ga0070713_100136921 Ga0070713_1001369212 169
296 3300005436 Ga0070713_100219612 Ga0070713_1002196122 169
297 3300005436 Ga0070713_100250993 Ga0070713_1002509932 169
298 3300005436 Ga0070713_100304341 Ga0070713_1003043412 169
299 3300005436 Ga0070713_100372287 Ga0070713_1003722871 169
300 3300005437 Ga0070710_10038133 Ga0070710_100381332 169
301 3300005437 Ga0070710_10197989 Ga0070710_101979892 169
302 3300005438 Ga0070701_10048720 Ga0070701_100487203 169
303 3300005438 Ga0070701_10354308 Ga0070701_103543082 169
304 3300005439 Ga0070711_100006218 Ga0070711_1000062185 169
305 3300005439 Ga0070711_100055479 Ga0070711_1000554792 169
306 3300005439 Ga0070711_100110072 Ga0070711_1001100722 169
307 3300005439 Ga0070711_100377433 Ga0070711_1003774332 169
308 3300005439 Ga0070711_100788969 Ga0070711_1007889691 169
309 3300005439 Ga0070711_101136292 Ga0070711_1011362921 169
310 3300005440 Ga0070705_100233320 Ga0070705_1002333202 169
311 3300005441 Ga0070700_100077355 Ga0070700_1000773553 169
312 3300005441 Ga0070700_100080179 Ga0070700_1000801793 169
313 3300005441 Ga0070700_100154579 Ga0070700_1001545792 169
314 3300005455 Ga0070663_100022934 Ga0070663_1000229343 169
315 3300005455 Ga0070663_100111428 Ga0070663_1001114283 169
316 3300005455 Ga0070663_100212104 Ga0070663_1002121041 169
317 3300005455 Ga0070663_101249031 Ga0070663_1012490311 169
318 3300005456 Ga0070678_100025622 Ga0070678_1000256222 169
319 3300005456 Ga0070678_100058936 Ga0070678_1000589363 169
320 3300005456 Ga0070678_100129350 Ga0070678_1001293502 169
321 3300005456 Ga0070678_100140336 Ga0070678_1001403362 169
322 3300005456 Ga0070678_100386158 Ga0070678_1003861581 169
323 3300005456 Ga0070678_100494111 Ga0070678_1004941111 169
324 3300005456 Ga0070678_101137492 Ga0070678_1011374921 169
325 3300005457 Ga0070662_100084032 Ga0070662_1000840321 169
326 3300005457 Ga0070662_100155187 Ga0070662_1001551872 169
327 3300005457 Ga0070662_100338166 Ga0070662_1003381662 169
328 3300005458 Ga0070681_10036718 Ga0070681_100367184 169
329 3300005458 Ga0070681_10066430 Ga0070681_100664302 169
330 3300005458 Ga0070681_10105930 Ga0070681_101059303 169
331 3300005458 Ga0070681_10107433 Ga0070681_101074332 169
332 3300005458 Ga0070681_10122113 Ga0070681_101221132 169
333 3300005458 Ga0070681_10134000 Ga0070681_101340002 169
334 3300005458 Ga0070681_10175529 Ga0070681_101755293 169
335 3300005458 Ga0070681_10197721 Ga0070681_101977212 169
336 3300005458 Ga0070681_10265425 Ga0070681_102654252 169
337 3300005459 Ga0068867_100046802 Ga0068867_1000468023 169
338 3300005459 Ga0068867_100189445 Ga0068867_1001894452 169
339 3300005459 Ga0068867_100326605 Ga0068867_1003266052 169
340 3300005466 Ga0070685_10038385 Ga0070685_100383853 169
341 3300005468 Ga0070707_100041318 Ga0070707_1000413182 169
342 3300005468 Ga0070707_100162465 Ga0070707_1001624653 169
343 3300005468 Ga0070707_100217632 Ga0070707_1002176323 169
344 3300005471 Ga0070698_100069010 Ga0070698_1000690104 169
345 3300005471 Ga0070698_100609948 Ga0070698_1006099481 169
346 3300005471 Ga0070698_101478572 Ga0070698_1014785721 169
347 3300005518 Ga0070699_100135858 Ga0070699_1001358582 169
348 3300005518 Ga0070699_100547926 Ga0070699_1005479262 169
349 3300005518 Ga0070699_101104152 Ga0070699_1011041521 169
350 3300005530 Ga0070679_100030103 Ga0070679_1000301033 169
351 3300005530 Ga0070679_100069355 Ga0070679_1000693553 169
352 3300005530 Ga0070679_100175282 Ga0070679_1001752823 169
353 3300005530 Ga0070679_100316065 Ga0070679_1003160652 169
354 3300005530 Ga0070679_100685099 Ga0070679_1006850992 169
355 3300005530 Ga0070679_100689173 Ga0070679_1006891731 169
356 3300005535 Ga0070684_100001856 Ga0070684_1000018563 169
357 3300005535 Ga0070684_100022904 Ga0070684_1000229044 169
358 3300005535 Ga0070684_100040770 Ga0070684_1000407702 169
359 3300005535 Ga0070684_100295619 Ga0070684_1002956192 169
360 3300005535 Ga0070684_100518357 Ga0070684_1005183572 169
361 3300005536 Ga0070697_100239246 Ga0070697_1002392461 169
362 3300005536 Ga0070697_100890162 Ga0070697_1008901621 169
363 3300005539 Ga0068853_100017579 Ga0068853_1000175793 169
364 3300005539 Ga0068853_100098454 Ga0068853_1000984543 169
365 3300005539 Ga0068853_100166956 Ga0068853_1001669562 169
366 3300005539 Ga0068853_100502380 Ga0068853_1005023801 169
367 3300005539 Ga0068853_100856388 Ga0068853_1008563882 169
368 3300005539 Ga0068853_100880036 Ga0068853_1008800361 169
369 3300005539 Ga0068853_100918978 Ga0068853_1009189782 169
370 3300005543 Ga0070672_100023222 Ga0070672_1000232225 169
371 3300005543 Ga0070672_100224870 Ga0070672_1002248701 169
372 3300005543 Ga0070672_100560182 Ga0070672_1005601822 169
373 3300005544 Ga0070686_100012361 Ga0070686_1000123616 169
374 3300005544 Ga0070686_100270266 Ga0070686_1002702661 169
375 3300005546 Ga0070696_100099952 Ga0070696_1000999522 169
376 3300005546 Ga0070696_100217391 Ga0070696_1002173912 169
377 3300005546 Ga0070696_100789884 Ga0070696_1007898841 169
378 3300005547 Ga0070693_100112444 Ga0070693_1001124442 169
379 3300005547 Ga0070693_100112711 Ga0070693_1001127112 169
380 3300005547 Ga0070693_100218251 Ga0070693_1002182511 169
381 3300005547 Ga0070693_100276115 Ga0070693_1002761151 169
382 3300005548 Ga0070665_100023227 Ga0070665_1000232272 169
383 3300005548 Ga0070665_100025414 Ga0070665_1000254147 169
384 3300005548 Ga0070665_100031110 Ga0070665_1000311102 169
385 3300005548 Ga0070665_100033366 Ga0070665_1000333663 169
386 3300005548 Ga0070665_100056291 Ga0070665_1000562913 169
387 3300005548 Ga0070665_100146480 Ga0070665_1001464802 169
388 3300005548 Ga0070665_100607773 Ga0070665_1006077731 169
389 3300005548 Ga0070665_101035512 Ga0070665_1010355122 169
390 3300005548 Ga0070665_101572687 Ga0070665_1015726871 169
391 3300005563 Ga0068855_100057202 Ga0068855_1000572021 169
392 3300005563 Ga0068855_100069808 Ga0068855_1000698082 169
393 3300005563 Ga0068855_100093904 Ga0068855_1000939043 169
394 3300005563 Ga0068855_100107373 Ga0068855_1001073734 169
395 3300005563 Ga0068855_100137684 Ga0068855_1001376844 169
396 3300005563 Ga0068855_100289943 Ga0068855_1002899432 169
397 3300005563 Ga0068855_100340605 Ga0068855_1003406052 169
398 3300005563 Ga0068855_100546383 Ga0068855_1005463832 169
399 3300005563 Ga0068855_100913858 Ga0068855_1009138582 169
400 3300005563 Ga0068855_101406242 Ga0068855_1014062421 169
401 3300005564 Ga0070664_100084922 Ga0070664_1000849222 169
402 3300005564 Ga0070664_100267794 Ga0070664_1002677942 169
403 3300005564 Ga0070664_100428700 Ga0070664_1004287001 169
404 3300005577 Ga0068857_100039684 Ga0068857_1000396842 169
405 3300005577 Ga0068857_100068370 Ga0068857_1000683704 169
406 3300005577 Ga0068857_100152132 Ga0068857_1001521322 169
407 3300005577 Ga0068857_100776624 Ga0068857_1007766242 169
408 3300005578 Ga0068854_100273279 Ga0068854_1002732791 169
409 3300005578 Ga0068854_100666804 Ga0068854_1006668042 169
410 3300005578 Ga0068854_100676579 Ga0068854_1006765791 169
411 3300005614 Ga0068856_100000013 Ga0068856_10000001396 169
412 3300005614 Ga0068856_100017144 Ga0068856_1000171443 169
413 3300005614 Ga0068856_100093684 Ga0068856_1000936842 169
414 3300005614 Ga0068856_100184528 Ga0068856_1001845283 169
415 3300005614 Ga0068856_100197292 Ga0068856_1001972923 169
416 3300005614 Ga0068856_100250305 Ga0068856_1002503053 169
417 3300005614 Ga0068856_100275892 Ga0068856_1002758922 169
418 3300005614 Ga0068856_100457637 Ga0068856_1004576372 169
419 3300005614 Ga0068856_101119450 Ga0068856_1011194501 169
420 3300005615 Ga0070702_100061564 Ga0070702_1000615642 169
421 3300005615 Ga0070702_100129897 Ga0070702_1001298971 169
422 3300005615 Ga0070702_100566424 Ga0070702_1005664241 169
423 3300005615 Ga0070702_100670543 Ga0070702_1006705431 169
424 3300005616 Ga0068852_100031538 Ga0068852_1000315384 169
425 3300005616 Ga0068852_100082317 Ga0068852_1000823173 169
426 3300005616 Ga0068852_100108320 Ga0068852_1001083203 169
427 3300005616 Ga0068852_100154035 Ga0068852_1001540353 169
428 3300005616 Ga0068852_100159012 Ga0068852_1001590122 169
429 3300005616 Ga0068852_100212762 Ga0068852_1002127622 169
430 3300005617 Ga0068859_100099931 Ga0068859_1000999313 169
431 3300005617 Ga0068859_100101961 Ga0068859_1001019613 169
432 3300005617 Ga0068859_100194525 Ga0068859_1001945253 169
433 3300005617 Ga0068859_100215161 Ga0068859_1002151612 169
434 3300005617 Ga0068859_100345505 Ga0068859_1003455052 169
435 3300005617 Ga0068859_100598720 Ga0068859_1005987201 169
436 3300005617 Ga0068859_101349884 Ga0068859_1013498841 169
437 3300005618 Ga0068864_100017486 Ga0068864_1000174863 169
438 3300005618 Ga0068864_100017603 Ga0068864_1000176035 169
439 3300005618 Ga0068864_100070903 Ga0068864_1000709031 169
440 3300005718 Ga0068866_10186621 Ga0068866_101866212 169
441 3300005719 Ga0068861_100221244 Ga0068861_1002212442 169
442 3300005719 Ga0068861_100425174 Ga0068861_1004251742 169
443 3300005834 Ga0068851_10174101 Ga0068851_101741011 169
444 3300005840 Ga0068870_10065643 Ga0068870_100656432 169
445 3300005840 Ga0068870_10279102 Ga0068870_102791022 169
446 3300005841 Ga0068863_100024772 Ga0068863_1000247722 169
447 3300005841 Ga0068863_100194546 Ga0068863_1001945463 169
448 3300005842 Ga0068858_100067598 Ga0068858_1000675982 169
449 3300005842 Ga0068858_100403594 Ga0068858_1004035942 169
450 3300005842 Ga0068858_100851250 Ga0068858_1008512501 169
451 3300005842 Ga0068858_100858894 Ga0068858_1008588941 169
452 3300005843 Ga0068860_100211894 Ga0068860_1002118942 169
453 3300005843 Ga0068860_100608116 Ga0068860_1006081162 169
454 3300005844 Ga0068862_100063981 Ga0068862_1000639812 169
455 3300005844 Ga0068862_100261705 Ga0068862_1002617053 169
456 3300005844 Ga0068862_100368546 Ga0068862_1003685462 169
457 3300005844 Ga0068862_100385281 Ga0068862_1003852812 169
458 3300005844 Ga0068862_100581961 Ga0068862_1005819611 169
459 3300005844 Ga0068862_101285052 Ga0068862_1012850521 169
460 3300005937 Ga0081455_10006463 Ga0081455_100064637 169
461 3300005937 Ga0081455_10022709 Ga0081455_100227094 169
462 3300005937 Ga0081455_10043487 Ga0081455_100434872 169
463 3300005937 Ga0081455_10052431 Ga0081455_100524313 169
464 3300005937 Ga0081455_10234633 Ga0081455_102346332 169
465 3300005937 Ga0081455_10235144 Ga0081455_102351442 169
466 3300005937 Ga0081455_10264508 Ga0081455_102645082 169
467 3300005983 Ga0081540_1004122 Ga0081540_10041223 169
468 3300005983 Ga0081540_1006360 Ga0081540_10063603 169
469 3300005983 Ga0081540_1012567 Ga0081540_10125675 169
470 3300005983 Ga0081540_1013330 Ga0081540_10133304 169
471 3300005983 Ga0081540_1014875 Ga0081540_10148753 169
472 3300005983 Ga0081540_1017376 Ga0081540_10173764 169
473 3300005983 Ga0081540_1017812 Ga0081540_10178122 169
474 3300005983 Ga0081540_1030686 Ga0081540_10306863 169
475 3300005983 Ga0081540_1098173 Ga0081540_10981731 169
476 3300005983 Ga0081540_1179670 Ga0081540_11796702 169
477 3300005983 Ga0081540_1269898 Ga0081540_12698981 169
478 3300005985 Ga0081539_10002447 Ga0081539_1000244720 169
479 3300005985 Ga0081539_10037657 Ga0081539_100376573 169
480 3300005985 Ga0081539_10079348 Ga0081539_100793482 169
481 3300006028 Ga0070717_10003434 Ga0070717_1000343411 169
482 3300006028 Ga0070717_10005509 Ga0070717_100055095 169
483 3300006028 Ga0070717_10138655 Ga0070717_101386552 169
484 3300006028 Ga0070717_10641700 Ga0070717_106417002 169
485 3300006038 Ga0075365_10001966 Ga0075365_100019664 169
486 3300006038 Ga0075365_10062073 Ga0075365_100620733 169
487 3300006038 Ga0075365_10203161 Ga0075365_102031611 169
488 3300006038 Ga0075365_10329923 Ga0075365_103299232 169
489 3300006038 Ga0075365_10436545 Ga0075365_104365452 169
490 3300006038 Ga0075365_10674500 Ga0075365_106745001 169
491 3300006042 Ga0075368_10099444 Ga0075368_100994441 169
492 3300006042 Ga0075368_10141359 Ga0075368_101413592 169
493 3300006042 Ga0075368_10237068 Ga0075368_102370682 169
494 3300006048 Ga0075363_100005870 Ga0075363_1000058703 169
495 3300006048 Ga0075363_100043917 Ga0075363_1000439173 169
496 3300006048 Ga0075363_100322757 Ga0075363_1003227571 169
497 3300006048 Ga0075363_100720016 Ga0075363_1007200161 169
498 3300006051 Ga0075364_10039883 Ga0075364_100398831 169
499 3300006051 Ga0075364_10090748 Ga0075364_100907482 169
500 3300006051 Ga0075364_10125039 Ga0075364_101250392 169
501 3300006051 Ga0075364_10416085 Ga0075364_104160852 169
502 3300006173 Ga0070716_100144326 Ga0070716_1001443262 169
503 3300006175 Ga0070712_100009696 Ga0070712_1000096963 169
504 3300006175 Ga0070712_100424231 Ga0070712_1004242312 169
505 3300006175 Ga0070712_100520976 Ga0070712_1005209762 169
506 3300006175 Ga0070712_101063277 Ga0070712_1010632771 169
507 3300006177 Ga0075362_10155827 Ga0075362_101558271 169
508 3300006177 Ga0075362_10559685 Ga0075362_105596851 169
509 3300006178 Ga0075367_10015356 Ga0075367_100153562 169
510 3300006178 Ga0075367_10034293 Ga0075367_100342934 169
511 3300006178 Ga0075367_10115519 Ga0075367_101155193 169
512 3300006178 Ga0075367_10128510 Ga0075367_101285102 169
513 3300006178 Ga0075367_10345681 Ga0075367_103456812 169
514 3300006178 Ga0075367_10473052 Ga0075367_104730521 169
515 3300006186 Ga0075369_10002852 Ga0075369_100028523 169
516 3300006186 Ga0075369_10236182 Ga0075369_102361822 169
517 3300006186 Ga0075369_10321851 Ga0075369_103218511 169
518 3300006195 Ga0075366_10090740 Ga0075366_100907402 169
519 3300006195 Ga0075366_10272532 Ga0075366_102725322 169
520 3300006237 Ga0097621_100070157 Ga0097621_1000701573 169
521 3300006237 Ga0097621_100155698 Ga0097621_1001556982 169
522 3300006237 Ga0097621_100671714 Ga0097621_1006717142 169
523 3300006353 Ga0075370_10083850 Ga0075370_100838503 169
524 3300006353 Ga0075370_10293436 Ga0075370_102934361 169
525 3300006353 Ga0075370_10387463 Ga0075370_103874631 169
526 3300006358 Ga0068871_100109390 Ga0068871_1001093903 169
527 3300006358 Ga0068871_100207019 Ga0068871_1002070192 169
528 3300006358 Ga0068871_100761209 Ga0068871_1007612091 169
529 3300006844 Ga0075428_100000690 Ga0075428_10000069021 169
530 3300006846 Ga0075430_100007503 Ga0075430_1000075034 169
531 3300006846 Ga0075430_100258063 Ga0075430_1002580633 169
532 3300006847 Ga0075431_100000098 Ga0075431_10000009841 169
533 3300006852 Ga0075433_10904746 Ga0075433_109047461 169
534 3300006871 Ga0075434_100039351 Ga0075434_1000393514 169
535 3300006871 Ga0075434_100154970 Ga0075434_1001549702 169
536 3300006871 Ga0075434_100311800 Ga0075434_1003118002 169
537 3300006871 Ga0075434_100509818 Ga0075434_1005098182 169
538 3300006871 Ga0075434_100539142 Ga0075434_1005391421 169
539 3300006871 Ga0075434_101387091 Ga0075434_1013870911 169
540 3300006880 Ga0075429_100031980 Ga0075429_1000319803 169
541 3300006881 Ga0068865_100017935 Ga0068865_1000179353 169
542 3300006881 Ga0068865_100053891 Ga0068865_1000538911 169
543 3300006881 Ga0068865_100058965 Ga0068865_1000589653 169
544 3300006881 Ga0068865_100169922 Ga0068865_1001699222 169
545 3300006881 Ga0068865_100204534 Ga0068865_1002045342 169
546 3300006914 Ga0075436_100085088 Ga0075436_1000850882 169
547 3300006914 Ga0075436_100947626 Ga0075436_1009476261 169
548 3300006931 Ga0097620_100099929 Ga0097620_1000999293 169
549 3300006931 Ga0097620_100101966 Ga0097620_1001019662 169
550 3300006931 Ga0097620_100194522 Ga0097620_1001945222 169
551 3300006931 Ga0097620_100215163 Ga0097620_1002151632 169
552 3300006931 Ga0097620_100345513 Ga0097620_1003455132 169
553 3300006931 Ga0097620_100598735 Ga0097620_1005987352 169
554 3300006931 Ga0097620_101349687 Ga0097620_1013496871 169
555 3300006942 Ga0099824_1012152 Ga0099824_101215210 169
556 3300006942 Ga0099824_1018537 Ga0099824_10185374 169
557 3300006943 Ga0099822_1000008 Ga0099822_100000825 169
558 3300007076 Ga0075435_100130154 Ga0075435_1001301542 169
559 3300007076 Ga0075435_100711061 Ga0075435_1007110611 169
560 3300007076 Ga0075435_100749138 Ga0075435_1007491382 169
561 3300007265 Ga0099794_10013587 Ga0099794_100135872 169
562 3300007265 Ga0099794_10187494 Ga0099794_101874942 169
563 3300007788 Ga0099795_10004402 Ga0099795_100044023 169
564 3300009011 Ga0105251_10069877 Ga0105251_100698772 169
565 3300009011 Ga0105251_10490319 Ga0105251_104903191 169
566 3300009036 Ga0105244_10205065 Ga0105244_102050652 169
567 3300009092 Ga0105250_10101097 Ga0105250_101010971 169
568 3300009093 Ga0105240_10037240 Ga0105240_100372404 169
569 3300009093 Ga0105240_10056793 Ga0105240_100567934 169
570 3300009093 Ga0105240_10152791 Ga0105240_101527912 169
571 3300009093 Ga0105240_10303575 Ga0105240_103035752 169
572 3300009093 Ga0105240_10379919 Ga0105240_103799192 169
573 3300009093 Ga0105240_10386969 Ga0105240_103869692 169
574 3300009093 Ga0105240_10729597 Ga0105240_107295971 169
575 3300009093 Ga0105240_10862204 Ga0105240_108622042 169
576 3300009093 Ga0105240_10943689 Ga0105240_109436891 169
577 3300009093 Ga0105240_10976025 Ga0105240_109760252 169
578 3300009094 Ga0111539_10003064 Ga0111539_1000306419 169
579 3300009094 Ga0111539_10160811 Ga0111539_101608112 169
580 3300009094 Ga0111539_11220177 Ga0111539_112201772 169
581 3300009098 Ga0105245_10028246 Ga0105245_100282461 169
582 3300009098 Ga0105245_10034624 Ga0105245_100346245 169
583 3300009098 Ga0105245_10610542 Ga0105245_106105422 169
584 3300009098 Ga0105245_10817222 Ga0105245_108172222 169
585 3300009101 Ga0105247_10030601 Ga0105247_100306014 169
586 3300009101 Ga0105247_10038445 Ga0105247_100384451 169
587 3300009101 Ga0105247_10043450 Ga0105247_100434502 169
588 3300009101 Ga0105247_10045303 Ga0105247_100453034 169
589 3300009101 Ga0105247_10105410 Ga0105247_101054103 169
590 3300009101 Ga0105247_10248229 Ga0105247_102482292 169
591 3300009101 Ga0105247_10439353 Ga0105247_104393532 169
592 3300009101 Ga0105247_10957894 Ga0105247_109578941 169
593 3300009101 Ga0105247_10964991 Ga0105247_109649911 169
594 3300009147 Ga0114129_10002171 Ga0114129_1000217120 169
595 3300009147 Ga0114129_10324567 Ga0114129_103245672 169
596 3300009147 Ga0114129_10383644 Ga0114129_103836443 169
597 3300009148 Ga0105243_10057639 Ga0105243_100576394 169
598 3300009148 Ga0105243_10070160 Ga0105243_100701602 169
599 3300009148 Ga0105243_10134932 Ga0105243_101349322 169
600 3300009148 Ga0105243_10193652 Ga0105243_101936522 169
601 3300009148 Ga0105243_10441438 Ga0105243_104414382 169
602 3300009148 Ga0105243_10970587 Ga0105243_109705872 169
603 3300009148 Ga0105243_11521135 Ga0105243_115211351 169
604 3300009174 Ga0105241_10072051 Ga0105241_100720513 169
605 3300009174 Ga0105241_10599531 Ga0105241_105995312 169
606 3300009176 Ga0105242_10199574 Ga0105242_101995742 169
607 3300009176 Ga0105242_10224017 Ga0105242_102240171 169
608 3300009176 Ga0105242_10278545 Ga0105242_102785452 169
609 3300009176 Ga0105242_10512021 Ga0105242_105120212 169
610 3300009177 Ga0105248_10042612 Ga0105248_100426124 169
611 3300009177 Ga0105248_10347052 Ga0105248_103470522 169
612 3300009177 Ga0105248_11031638 Ga0105248_110316381 169
613 3300009545 Ga0105237_10000309 Ga0105237_100003092 169
614 3300009545 Ga0105237_10111947 Ga0105237_101119472 169
615 3300009545 Ga0105237_10132180 Ga0105237_101321802 169
616 3300009545 Ga0105237_10144886 Ga0105237_101448863 169
617 3300009545 Ga0105237_10504849 Ga0105237_105048491 169
618 3300009545 Ga0105237_11000838 Ga0105237_110008382 169
619 3300009551 Ga0105238_10005423 Ga0105238_100054237 169
620 3300009551 Ga0105238_10147334 Ga0105238_101473343 169
621 3300009551 Ga0105238_10168207 Ga0105238_101682072 169
622 3300009551 Ga0105238_10185813 Ga0105238_101858133 169
623 3300009551 Ga0105238_10379145 Ga0105238_103791452 169
624 3300009551 Ga0105238_10402651 Ga0105238_104026512 169
625 3300009551 Ga0105238_10513358 Ga0105238_105133582 169
626 3300009551 Ga0105238_10528392 Ga0105238_105283922 169
627 3300009551 Ga0105238_10548536 Ga0105238_105485361 169
628 3300009551 Ga0105238_11096387 Ga0105238_110963872 169
629 3300009553 Ga0105249_10071948 Ga0105249_100719482 169
630 3300009553 Ga0105249_10080284 Ga0105249_100802842 169
631 3300009553 Ga0105249_12200768 Ga0105249_122007681 169
632 3300010159 Ga0099796_10017075 Ga0099796_100170752 169
633 3300010159 Ga0099796_10146507 Ga0099796_101465071 169
634 3300010375 Ga0105239_10001582 Ga0105239_1000158225 169
635 3300010375 Ga0105239_10064701 Ga0105239_100647013 169
636 3300010375 Ga0105239_10206297 Ga0105239_102062972 169
637 3300010375 Ga0105239_10644837 Ga0105239_106448372 169
638 3300010375 Ga0105239_10824315 Ga0105239_108243152 169
639 3300010375 Ga0105239_11256949 Ga0105239_112569491 169
640 3300011119 Ga0105246_10010697 Ga0105246_100106974 169
641 3300011119 Ga0105246_10109879 Ga0105246_101098793 169
642 3300011119 Ga0105246_10253148 Ga0105246_102531482 169
643 3300011119 Ga0105246_10269873 Ga0105246_102698732 169
644 3300012512 Ga0157327_1011207 Ga0157327_10112071 169
645 3300013100 Ga0157373_10119433 Ga0157373_101194331 169
646 3300013100 Ga0157373_10294728 Ga0157373_102947282 169
647 3300013100 Ga0157373_10751772 Ga0157373_107517721 169
648 3300013102 Ga0157371_10549327 Ga0157371_105493272 169
649 3300013104 Ga0157370_10097547 Ga0157370_100975472 169
650 3300013104 Ga0157370_10176358 Ga0157370_101763581 169
651 3300013104 Ga0157370_10227191 Ga0157370_102271912 169
652 3300013104 Ga0157370_10426039 Ga0157370_104260392 169
653 3300013105 Ga0157369_10025156 Ga0157369_100251565 169
654 3300013105 Ga0157369_10042001 Ga0157369_100420011 169
655 3300013105 Ga0157369_10148563 Ga0157369_101485631 169
656 3300013105 Ga0157369_10271778 Ga0157369_102717782 169
657 3300013105 Ga0157369_10298130 Ga0157369_102981302 169
658 3300013105 Ga0157369_10338579 Ga0157369_103385791 169
659 3300013105 Ga0157369_10666756 Ga0157369_106667562 169
660 3300013296 Ga0157374_10019961 Ga0157374_100199612 169
661 3300013296 Ga0157374_10493165 Ga0157374_104931652 169
662 3300013296 Ga0157374_10866735 Ga0157374_108667351 169
663 3300013296 Ga0157374_10934971 Ga0157374_109349711 169
664 3300013297 Ga0157378_10017967 Ga0157378_100179673 169
665 3300013297 Ga0157378_10994564 Ga0157378_109945642 169
666 3300013306 Ga0163162_10024461 Ga0163162_100244613 169
667 3300013306 Ga0163162_10035503 Ga0163162_100355033 169
668 3300013306 Ga0163162_10077909 Ga0163162_100779092 169
669 3300013306 Ga0163162_10096154 Ga0163162_100961544 169
670 3300013306 Ga0163162_10320490 Ga0163162_103204902 169
671 3300013306 Ga0163162_10362395 Ga0163162_103623952 169
672 3300013306 Ga0163162_10432788 Ga0163162_104327882 169
673 3300013306 Ga0163162_10553942 Ga0163162_105539422 169
674 3300013306 Ga0163162_10906309 Ga0163162_109063092 169
675 3300013307 Ga0157372_10355887 Ga0157372_103558872 169
676 3300013308 Ga0157375_10036254 Ga0157375_100362542 169
677 3300013308 Ga0157375_10071876 Ga0157375_100718764 169
678 3300013308 Ga0157375_10139987 Ga0157375_101399872 169
679 3300013308 Ga0157375_10584536 Ga0157375_105845362 169
680 3300013308 Ga0157375_11466956 Ga0157375_114669562 169
681 3300014325 Ga0163163_10037397 Ga0163163_100373974 169
682 3300014325 Ga0163163_10119032 Ga0163163_101190322 169
683 3300014325 Ga0163163_10294263 Ga0163163_102942632 169
684 3300014325 Ga0163163_11408892 Ga0163163_114088921 169
685 3300014326 Ga0157380_10106778 Ga0157380_101067781 169
686 3300014326 Ga0157380_10768264 Ga0157380_107682641 169
687 3300014326 Ga0157380_11500177 Ga0157380_115001772 169
688 3300014497 Ga0182008_10237137 Ga0182008_102371372 169
689 3300014745 Ga0157377_10162758 Ga0157377_101627582 169
690 3300014968 Ga0157379_10025155 Ga0157379_100251555 169
691 3300014968 Ga0157379_10046247 Ga0157379_100462473 169
692 3300014968 Ga0157379_10059551 Ga0157379_100595513 169
693 3300014968 Ga0157379_10293265 Ga0157379_102932652 169
694 3300014968 Ga0157379_10687313 Ga0157379_106873132 169
695 3300014969 Ga0157376_10030300 Ga0157376_100303002 169
696 3300014969 Ga0157376_10795808 Ga0157376_107958081 169
697 3300014969 Ga0157376_11138462 Ga0157376_111384622 169
698 3300017792 Ga0163161_10055689 Ga0163161_100556891 169
699 3300017792 Ga0163161_10184926 Ga0163161_101849261 169
700 3300017792 Ga0163161_10194179 Ga0163161_101941791 169
701 3300017792 Ga0163161_10248930 Ga0163161_102489301 169
702 3300017792 Ga0163161_10621181 Ga0163161_106211812 169
703 3300017792 Ga0163161_10672205 Ga0163161_106722052 169
704 3300020069 Ga0197907_10504455 Ga0197907_105044551 169
705 3300020081 Ga0206354_10062039 Ga0206354_100620393 169
706 3300020081 Ga0206354_10665166 Ga0206354_106651661 169
707 3300020081 Ga0206354_10765695 Ga0206354_107656951 169
708 3300020082 Ga0206353_10759208 Ga0206353_107592082 169
709 3300020082 Ga0206353_12022395 Ga0206353_120223952 169
710 3300021361 Ga0213872_10092493 Ga0213872_100924932 169
711 3300021377 Ga0213874_10009524 Ga0213874_100095243 169
712 3300021377 Ga0213874_10107516 Ga0213874_101075161 169
713 3300021388 Ga0213875_10141766 Ga0213875_101417662 169
714 3300025253 Ga0209677_101005 Ga0209677_1010057 169
715 3300025253 Ga0209677_102354 Ga0209677_1023543 169
716 3300025254 Ga0209148_1002750 Ga0209148_10027504 169
717 3300025254 Ga0209148_1010998 Ga0209148_10109981 169
718 3300025261 Ga0209233_1010987 Ga0209233_10109872 169
719 3300025272 Ga0209455_1002301 Ga0209455_10023013 169
720 3300025272 Ga0209455_1003946 Ga0209455_10039464 169
721 3300025272 Ga0209455_1007330 Ga0209455_10073303 169
722 3300025272 Ga0209455_1036979 Ga0209455_10369791 169
723 3300025294 Ga0209025_1096081 Ga0209025_10960811 169
724 3300025295 Ga0209564_1000602 Ga0209564_100060248 169
725 3300025295 Ga0209564_1012457 Ga0209564_10124573 169
726 3300025295 Ga0209564_1023731 Ga0209564_10237313 169
727 3300025297 Ga0209758_1000015 Ga0209758_100001579 169
728 3300025297 Ga0209758_1000335 Ga0209758_100033515 169
729 3300025297 Ga0209758_1001187 Ga0209758_10011876 169
730 3300025297 Ga0209758_1003099 Ga0209758_10030992 169
731 3300025297 Ga0209758_1004724 Ga0209758_10047242 169
732 3300025297 Ga0209758_1033744 Ga0209758_10337441 169
733 3300025297 Ga0209758_1078561 Ga0209758_10785612 169
734 3300025302 Ga0207426_1025887 Ga0207426_10258872 169
735 3300025303 Ga0209051_1059483 Ga0209051_10594832 169
736 3300025304 Ga0209257_1001779 Ga0209257_10017799 169
737 3300025315 Ga0207697_10333523 Ga0207697_103335231 169
738 3300025315 Ga0207697_10343807 Ga0207697_103438071 169
739 3300025321 Ga0207656_10004567 Ga0207656_100045673 169
740 3300025321 Ga0207656_10014106 Ga0207656_100141062 169
741 3300025321 Ga0207656_10049177 Ga0207656_100491771 169
742 3300025885 Ga0207653_10186273 Ga0207653_101862731 169
743 3300025893 Ga0207682_10173466 Ga0207682_101734662 169
744 3300025898 Ga0207692_10099233 Ga0207692_100992332 169
745 3300025898 Ga0207692_10604237 Ga0207692_106042371 169
746 3300025899 Ga0207642_10384932 Ga0207642_103849321 169
747 3300025900 Ga0207710_10023332 Ga0207710_100233322 169
748 3300025900 Ga0207710_10101396 Ga0207710_101013961 169
749 3300025900 Ga0207710_10101682 Ga0207710_101016822 169
750 3300025900 Ga0207710_10165150 Ga0207710_101651502 169
751 3300025900 Ga0207710_10499360 Ga0207710_104993602 169
752 3300025901 Ga0207688_10001281 Ga0207688_1000128111 169
753 3300025901 Ga0207688_10070515 Ga0207688_100705153 169
754 3300025901 Ga0207688_10151075 Ga0207688_101510752 169
755 3300025903 Ga0207680_10096772 Ga0207680_100967722 169
756 3300025904 Ga0207647_10094422 Ga0207647_100944222 169
757 3300025904 Ga0207647_10115607 Ga0207647_101156072 169
758 3300025904 Ga0207647_10123662 Ga0207647_101236622 169
759 3300025904 Ga0207647_10505229 Ga0207647_105052291 169
760 3300025906 Ga0207699_10129447 Ga0207699_101294472 169
761 3300025906 Ga0207699_10191177 Ga0207699_101911772 169
762 3300025906 Ga0207699_10274548 Ga0207699_102745482 169
763 3300025906 Ga0207699_10450515 Ga0207699_104505152 169
764 3300025906 Ga0207699_10972320 Ga0207699_109723201 169
765 3300025906 Ga0207699_11058259 Ga0207699_110582591 169
766 3300025907 Ga0207645_10012345 Ga0207645_100123452 169
767 3300025907 Ga0207645_10061109 Ga0207645_100611093 169
768 3300025907 Ga0207645_10234956 Ga0207645_102349562 169
769 3300025907 Ga0207645_10828962 Ga0207645_108289621 169
770 3300025908 Ga0207643_10002521 Ga0207643_100025213 169
771 3300025908 Ga0207643_10351729 Ga0207643_103517291 169
772 3300025909 Ga0207705_10159864 Ga0207705_101598642 169
773 3300025909 Ga0207705_10303624 Ga0207705_103036242 169
774 3300025909 Ga0207705_10322557 Ga0207705_103225572 169
775 3300025909 Ga0207705_10357980 Ga0207705_103579802 169
776 3300025909 Ga0207705_10580423 Ga0207705_105804231 169
777 3300025909 Ga0207705_10610959 Ga0207705_106109592 169
778 3300025910 Ga0207684_10048178 Ga0207684_100481782 169
779 3300025910 Ga0207684_10141931 Ga0207684_101419312 169
780 3300025910 Ga0207684_10241063 Ga0207684_102410632 169
781 3300025910 Ga0207684_10591279 Ga0207684_105912792 169
782 3300025911 Ga0207654_10020658 Ga0207654_100206582 169
783 3300025912 Ga0207707_10018377 Ga0207707_100183772 169
784 3300025912 Ga0207707_10029100 Ga0207707_100291005 169
785 3300025912 Ga0207707_10107387 Ga0207707_101073872 169
786 3300025912 Ga0207707_10158405 Ga0207707_101584052 169
787 3300025912 Ga0207707_10176772 Ga0207707_101767721 169
788 3300025912 Ga0207707_10255791 Ga0207707_102557912 169
789 3300025912 Ga0207707_10657073 Ga0207707_106570732 169
790 3300025913 Ga0207695_10026779 Ga0207695_100267796 169
791 3300025913 Ga0207695_10047865 Ga0207695_100478652 169
792 3300025913 Ga0207695_10725319 Ga0207695_107253191 169
793 3300025913 Ga0207695_11083819 Ga0207695_110838191 169
794 3300025914 Ga0207671_10003123 Ga0207671_100031237 169
795 3300025914 Ga0207671_10045550 Ga0207671_100455502 169
796 3300025914 Ga0207671_10131505 Ga0207671_101315052 169
797 3300025914 Ga0207671_10224311 Ga0207671_102243112 169
798 3300025914 Ga0207671_10260441 Ga0207671_102604412 169
799 3300025914 Ga0207671_11039849 Ga0207671_110398491 169
800 3300025915 Ga0207693_10010868 Ga0207693_100108684 169
801 3300025915 Ga0207693_10091866 Ga0207693_100918663 169
802 3300025915 Ga0207693_10096126 Ga0207693_100961262 169
803 3300025915 Ga0207693_10102360 Ga0207693_101023603 169
804 3300025915 Ga0207693_10124522 Ga0207693_101245222 169
805 3300025915 Ga0207693_10371537 Ga0207693_103715372 169
806 3300025915 Ga0207693_10530532 Ga0207693_105305321 169
807 3300025915 Ga0207693_10622027 Ga0207693_106220272 169
808 3300025916 Ga0207663_10010063 Ga0207663_100100632 169
809 3300025916 Ga0207663_10064231 Ga0207663_100642312 169
810 3300025916 Ga0207663_10073261 Ga0207663_100732613 169
811 3300025916 Ga0207663_10099225 Ga0207663_100992252 169
812 3300025916 Ga0207663_10107742 Ga0207663_101077422 169
813 3300025916 Ga0207663_10118050 Ga0207663_101180502 169
814 3300025917 Ga0207660_10019619 Ga0207660_100196194 169
815 3300025917 Ga0207660_10061468 Ga0207660_100614682 169
816 3300025917 Ga0207660_10087338 Ga0207660_100873382 169
817 3300025917 Ga0207660_10113998 Ga0207660_101139982 169
818 3300025917 Ga0207660_10226680 Ga0207660_102266802 169
819 3300025917 Ga0207660_10273957 Ga0207660_102739572 169
820 3300025917 Ga0207660_10547248 Ga0207660_105472482 169
821 3300025917 Ga0207660_10584613 Ga0207660_105846132 169
822 3300025918 Ga0207662_10012503 Ga0207662_100125032 169
823 3300025918 Ga0207662_10139220 Ga0207662_101392201 169
824 3300025918 Ga0207662_10627109 Ga0207662_106271091 169
825 3300025919 Ga0207657_10011567 Ga0207657_100115674 169
826 3300025919 Ga0207657_10012512 Ga0207657_100125123 169
827 3300025919 Ga0207657_10084668 Ga0207657_100846683 169
828 3300025919 Ga0207657_10176990 Ga0207657_101769902 169
829 3300025919 Ga0207657_10513084 Ga0207657_105130841 169
830 3300025920 Ga0207649_10294479 Ga0207649_102944792 169
831 3300025921 Ga0207652_10022949 Ga0207652_100229492 169
832 3300025921 Ga0207652_10059883 Ga0207652_100598832 169
833 3300025921 Ga0207652_10062291 Ga0207652_100622912 169
834 3300025921 Ga0207652_10105307 Ga0207652_101053072 169
835 3300025921 Ga0207652_10117272 Ga0207652_101172723 169
836 3300025921 Ga0207652_10223759 Ga0207652_102237593 169
837 3300025921 Ga0207652_10253247 Ga0207652_102532472 169
838 3300025921 Ga0207652_10974808 Ga0207652_109748082 169
839 3300025922 Ga0207646_10062636 Ga0207646_100626362 169
840 3300025922 Ga0207646_10076033 Ga0207646_100760333 169
841 3300025922 Ga0207646_10101217 Ga0207646_101012172 169
842 3300025923 Ga0207681_10147371 Ga0207681_101473712 169
843 3300025923 Ga0207681_10174222 Ga0207681_101742222 169
844 3300025923 Ga0207681_10264735 Ga0207681_102647352 169
845 3300025923 Ga0207681_10447948 Ga0207681_104479481 169
846 3300025924 Ga0207694_10061628 Ga0207694_100616282 169
847 3300025924 Ga0207694_10132061 Ga0207694_101320613 169
848 3300025924 Ga0207694_10397247 Ga0207694_103972472 169
849 3300025924 Ga0207694_10422782 Ga0207694_104227821 169
850 3300025924 Ga0207694_10560718 Ga0207694_105607182 169
851 3300025924 Ga0207694_10614337 Ga0207694_106143372 169
852 3300025924 Ga0207694_10678339 Ga0207694_106783392 169
853 3300025924 Ga0207694_11217675 Ga0207694_112176751 169
854 3300025925 Ga0207650_10160992 Ga0207650_101609922 169
855 3300025925 Ga0207650_10835270 Ga0207650_108352701 169
856 3300025926 Ga0207659_10069599 Ga0207659_100695992 169
857 3300025926 Ga0207659_10082218 Ga0207659_100822182 169
858 3300025926 Ga0207659_10183758 Ga0207659_101837582 169
859 3300025927 Ga0207687_10021268 Ga0207687_100212684 169
860 3300025927 Ga0207687_10075058 Ga0207687_100750583 169
861 3300025927 Ga0207687_10277552 Ga0207687_102775521 169
862 3300025927 Ga0207687_11351150 Ga0207687_113511501 169
863 3300025927 Ga0207687_11465218 Ga0207687_114652181 169
864 3300025928 Ga0207700_10014735 Ga0207700_100147355 169
865 3300025928 Ga0207700_10026602 Ga0207700_100266022 169
866 3300025928 Ga0207700_10036814 Ga0207700_100368142 169
867 3300025928 Ga0207700_10050036 Ga0207700_100500363 169
868 3300025928 Ga0207700_10166946 Ga0207700_101669461 169
869 3300025928 Ga0207700_10487987 Ga0207700_104879872 169
870 3300025929 Ga0207664_10047450 Ga0207664_100474502 169
871 3300025929 Ga0207664_10113350 Ga0207664_101133502 169
872 3300025929 Ga0207664_10365999 Ga0207664_103659992 169
873 3300025929 Ga0207664_10489460 Ga0207664_104894601 169
874 3300025929 Ga0207664_10517223 Ga0207664_105172232 169
875 3300025929 Ga0207664_11256351 Ga0207664_112563511 169
876 3300025931 Ga0207644_10075234 Ga0207644_100752343 169
877 3300025931 Ga0207644_10168058 Ga0207644_101680583 169
878 3300025931 Ga0207644_10205147 Ga0207644_102051472 169
879 3300025931 Ga0207644_10247260 Ga0207644_102472602 169
880 3300025931 Ga0207644_10262142 Ga0207644_102621421 169
881 3300025932 Ga0207690_10028519 Ga0207690_100285193 169
882 3300025932 Ga0207690_10099646 Ga0207690_100996462 169
883 3300025932 Ga0207690_10168530 Ga0207690_101685302 169
884 3300025932 Ga0207690_10295806 Ga0207690_102958061 169
885 3300025932 Ga0207690_11005409 Ga0207690_110054091 169
886 3300025933 Ga0207706_10042174 Ga0207706_100421742 169
887 3300025933 Ga0207706_10110812 Ga0207706_101108122 169
888 3300025933 Ga0207706_10216469 Ga0207706_102164693 169
889 3300025933 Ga0207706_10382914 Ga0207706_103829141 169
890 3300025933 Ga0207706_10689442 Ga0207706_106894421 169
891 3300025934 Ga0207686_10250745 Ga0207686_102507451 169
892 3300025934 Ga0207686_10336619 Ga0207686_103366192 169
893 3300025934 Ga0207686_10498909 Ga0207686_104989092 169
894 3300025934 Ga0207686_10807700 Ga0207686_108077001 169
895 3300025935 Ga0207709_10026629 Ga0207709_100266292 169
896 3300025935 Ga0207709_10274164 Ga0207709_102741641 169
897 3300025935 Ga0207709_10316487 Ga0207709_103164872 169
898 3300025936 Ga0207670_10002298 Ga0207670_100022986 169
899 3300025936 Ga0207670_10131451 Ga0207670_101314513 169
900 3300025936 Ga0207670_10143793 Ga0207670_101437932 169
901 3300025937 Ga0207669_10088626 Ga0207669_100886263 169
902 3300025937 Ga0207669_10142605 Ga0207669_101426052 169
903 3300025938 Ga0207704_10136518 Ga0207704_101365182 169
904 3300025938 Ga0207704_10384764 Ga0207704_103847642 169
905 3300025938 Ga0207704_10711924 Ga0207704_107119242 169
906 3300025939 Ga0207665_10115770 Ga0207665_101157702 169
907 3300025939 Ga0207665_10297418 Ga0207665_102974182 169
908 3300025939 Ga0207665_10634596 Ga0207665_106345961 169
909 3300025940 Ga0207691_10000910 Ga0207691_1000091013 169
910 3300025940 Ga0207691_10104060 Ga0207691_101040603 169
911 3300025940 Ga0207691_10216989 Ga0207691_102169892 169
912 3300025940 Ga0207691_10275176 Ga0207691_102751761 169
913 3300025940 Ga0207691_10471723 Ga0207691_104717231 169
914 3300025940 Ga0207691_10704271 Ga0207691_107042712 169
915 3300025941 Ga0207711_10040871 Ga0207711_100408714 169
916 3300025941 Ga0207711_10043351 Ga0207711_100433513 169
917 3300025941 Ga0207711_10248969 Ga0207711_102489692 169
918 3300025941 Ga0207711_10718502 Ga0207711_107185021 169
919 3300025942 Ga0207689_10010184 Ga0207689_100101846 169
920 3300025942 Ga0207689_10548863 Ga0207689_105488632 169
921 3300025944 Ga0207661_10000331 Ga0207661_100003319 169
922 3300025944 Ga0207661_10010939 Ga0207661_100109394 169
923 3300025944 Ga0207661_10020659 Ga0207661_100206593 169
924 3300025944 Ga0207661_10235871 Ga0207661_102358712 169
925 3300025944 Ga0207661_10343741 Ga0207661_103437412 169
926 3300025944 Ga0207661_10786354 Ga0207661_107863542 169
927 3300025944 Ga0207661_10897528 Ga0207661_108975281 169
928 3300025945 Ga0207679_10065923 Ga0207679_100659231 169
929 3300025945 Ga0207679_10077143 Ga0207679_100771432 169
930 3300025945 Ga0207679_10221902 Ga0207679_102219021 169
931 3300025945 Ga0207679_10565367 Ga0207679_105653671 169
932 3300025949 Ga0207667_10007691 Ga0207667_100076913 169
933 3300025949 Ga0207667_10060838 Ga0207667_100608384 169
934 3300025949 Ga0207667_10113693 Ga0207667_101136933 169
935 3300025949 Ga0207667_10174750 Ga0207667_101747502 169
936 3300025949 Ga0207667_10184852 Ga0207667_101848522 169
937 3300025949 Ga0207667_10363912 Ga0207667_103639122 169
938 3300025949 Ga0207667_10453250 Ga0207667_104532502 169
939 3300025949 Ga0207667_10641396 Ga0207667_106413962 169
940 3300025949 Ga0207667_10663163 Ga0207667_106631632 169
941 3300025949 Ga0207667_10815050 Ga0207667_108150501 169
942 3300025960 Ga0207651_10176919 Ga0207651_101769192 169
943 3300025960 Ga0207651_11231338 Ga0207651_112313381 169
944 3300025961 Ga0207712_10091096 Ga0207712_100910963 169
945 3300025961 Ga0207712_10126979 Ga0207712_101269793 169
946 3300025961 Ga0207712_10601298 Ga0207712_106012982 169
947 3300025972 Ga0207668_10031967 Ga0207668_100319674 169
948 3300025972 Ga0207668_10062839 Ga0207668_100628392 169
949 3300025972 Ga0207668_10099716 Ga0207668_100997161 169
950 3300025972 Ga0207668_10176358 Ga0207668_101763582 169
951 3300025981 Ga0207640_10678318 Ga0207640_106783181 169
952 3300025981 Ga0207640_10716954 Ga0207640_107169542 169
953 3300025986 Ga0207658_10299305 Ga0207658_102993052 169
954 3300025986 Ga0207658_10457081 Ga0207658_104570812 169
955 3300025986 Ga0207658_10458212 Ga0207658_104582121 169
956 3300025986 Ga0207658_11656391 Ga0207658_116563911 169
957 3300026023 Ga0207677_10056475 Ga0207677_100564753 169
958 3300026023 Ga0207677_10158658 Ga0207677_101586582 169
959 3300026023 Ga0207677_10173916 Ga0207677_101739162 169
960 3300026023 Ga0207677_10360777 Ga0207677_103607772 169
961 3300026023 Ga0207677_10613413 Ga0207677_106134131 169
962 3300026035 Ga0207703_10307091 Ga0207703_103070911 169
963 3300026041 Ga0207639_10154560 Ga0207639_101545602 169
964 3300026041 Ga0207639_10161003 Ga0207639_101610032 169
965 3300026041 Ga0207639_10243173 Ga0207639_102431733 169
966 3300026041 Ga0207639_10246443 Ga0207639_102464432 169
967 3300026041 Ga0207639_10385513 Ga0207639_103855132 169
968 3300026041 Ga0207639_10456714 Ga0207639_104567142 169
969 3300026041 Ga0207639_10481413 Ga0207639_104814132 169
970 3300026041 Ga0207639_10506044 Ga0207639_105060441 169
971 3300026041 Ga0207639_10769317 Ga0207639_107693171 169
972 3300026067 Ga0207678_10048755 Ga0207678_100487553 169
973 3300026067 Ga0207678_10100046 Ga0207678_101000463 169
974 3300026067 Ga0207678_10122850 Ga0207678_101228502 169
975 3300026067 Ga0207678_10123834 Ga0207678_101238342 169
976 3300026067 Ga0207678_10134382 Ga0207678_101343822 169
977 3300026067 Ga0207678_10157318 Ga0207678_101573181 169
978 3300026067 Ga0207678_10254674 Ga0207678_102546742 169
979 3300026067 Ga0207678_10532250 Ga0207678_105322501 169
980 3300026067 Ga0207678_10608124 Ga0207678_106081241 169
981 3300026067 Ga0207678_10781108 Ga0207678_107811081 169
982 3300026067 Ga0207678_11214441 Ga0207678_112144411 169
983 3300026075 Ga0207708_10033132 Ga0207708_100331322 169
984 3300026075 Ga0207708_10386680 Ga0207708_103866801 169
985 3300026075 Ga0207708_10416336 Ga0207708_104163362 169
986 3300026078 Ga0207702_10000090 Ga0207702_1000009014 169
987 3300026078 Ga0207702_10185089 Ga0207702_101850893 169
988 3300026078 Ga0207702_10210726 Ga0207702_102107262 169
989 3300026078 Ga0207702_10244279 Ga0207702_102442792 169
990 3300026078 Ga0207702_10300358 Ga0207702_103003582 169
991 3300026078 Ga0207702_10325086 Ga0207702_103250862 169
992 3300026078 Ga0207702_10360972 Ga0207702_103609722 169
993 3300026078 Ga0207702_10594458 Ga0207702_105944582 169
994 3300026088 Ga0207641_10007802 Ga0207641_100078022 169
995 3300026088 Ga0207641_10498345 Ga0207641_104983452 169
996 3300026088 Ga0207641_12160732 Ga0207641_121607321 169
997 3300026089 Ga0207648_10130081 Ga0207648_101300813 169
998 3300026089 Ga0207648_10587660 Ga0207648_105876602 169
999 3300026095 Ga0207676_10019515 Ga0207676_100195153 169
1000 3300026095 Ga0207676_10022610 Ga0207676_100226104 169
1001 3300026095 Ga0207676_10083876 Ga0207676_100838763 169
1002 3300026116 Ga0207674_10041607 Ga0207674_100416073 169
1003 3300026116 Ga0207674_10068053 Ga0207674_100680534 169
1004 3300026116 Ga0207674_10094319 Ga0207674_100943192 169
1005 3300026116 Ga0207674_10515831 Ga0207674_105158312 169
1006 3300026116 Ga0207674_10526311 Ga0207674_105263112 169
1007 3300026118 Ga0207675_100189454 Ga0207675_1001894542 169
1008 3300026118 Ga0207675_101456053 Ga0207675_1014560531 169
1009 3300026121 Ga0207683_10016743 Ga0207683_100167432 169
1010 3300026121 Ga0207683_10054711 Ga0207683_100547114 169
1011 3300026142 Ga0207698_10040951 Ga0207698_100409513 169
1012 3300026142 Ga0207698_10057029 Ga0207698_100570293 169
1013 3300026142 Ga0207698_10092817 Ga0207698_100928172 169
1014 3300026142 Ga0207698_10314056 Ga0207698_103140562 169
1015 3300026142 Ga0207698_10339619 Ga0207698_103396192 169
1016 3300026142 Ga0207698_10756952 Ga0207698_107569522 169
1017 3300026142 Ga0207698_11345038 Ga0207698_113450381 169
1018 3300027296 Ga0209389_1000051 Ga0209389_100005162 169
1019 3300027357 Ga0209589_1000012 Ga0209589_1000012145 169
1020 3300027357 Ga0209589_1000013 Ga0209589_100001361 169
1021 3300027357 Ga0209589_1000026 Ga0209589_100002646 169
1022 3300027361 Ga0209489_100013 Ga0209489_100013146 169
1023 3300027361 Ga0209489_100046 Ga0209489_10004646 169
1024 3300027363 Ga0209700_100047 Ga0209700_10004746 169
1025 3300027395 Ga0209996_1024158 Ga0209996_10241581 169
1026 3300027512 Ga0209179_1008764 Ga0209179_10087642 169
1027 3300027671 Ga0209588_1143359 Ga0209588_11433591 169
1028 3300027671 Ga0209588_1161027 Ga0209588_11610271 169
1029 3300027682 Ga0209971_1040391 Ga0209971_10403912 169
1030 3300027695 Ga0209966_1004684 Ga0209966_10046843 169
1031 3300027717 Ga0209998_10007358 Ga0209998_100073581 169
1032 3300027866 Ga0209813_10126149 Ga0209813_101261492 169
1033 3300027866 Ga0209813_10162353 Ga0209813_101623531 169
1034 3300027907 Ga0207428_10004275 Ga0207428_100042754 169
1035 3300027907 Ga0207428_10888316 Ga0207428_108883161 169
1036 3300028379 Ga0268266_10000265 Ga0268266_1000026532 169
1037 3300028379 Ga0268266_10017376 Ga0268266_100173762 169
1038 3300028379 Ga0268266_10019020 Ga0268266_100190203 169
1039 3300028379 Ga0268266_10193146 Ga0268266_101931462 169
1040 3300028379 Ga0268266_10293576 Ga0268266_102935762 169
1041 3300028379 Ga0268266_10446163 Ga0268266_104461632 169
1042 3300028379 Ga0268266_10736166 Ga0268266_107361662 169
1043 3300028380 Ga0268265_10147460 Ga0268265_101474602 169
1044 3300028380 Ga0268265_10512504 Ga0268265_105125042 169
1045 3300028380 Ga0268265_10604367 Ga0268265_106043671 169
1046 3300028380 Ga0268265_10659718 Ga0268265_106597181 169
1047 3300028380 Ga0268265_11511087 Ga0268265_115110871 169
1048 3300028381 Ga0268264_10123943 Ga0268264_101239432 169
1049 3300028381 Ga0268264_10184708 Ga0268264_101847082 169
1050 3300028381 Ga0268264_10903019 Ga0268264_109030192 169
1051 3300028381 Ga0268264_12046006 Ga0268264_120460061 169
1052 3300028556 Ga0265337_1048980 Ga0265337_10489802 169
1053 3300028558 Ga0265326_10035032 Ga0265326_100350321 169
1054 3300028573 Ga0265334_10026998 Ga0265334_100269982 169
1055 3300028653 Ga0265323_10000915 Ga0265323_100009157 169
1056 3300028666 Ga0265336_10000355 Ga0265336_1000035514 169
1057 3300028786 Ga0307517_10000436 Ga0307517_1000043655 169
1058 3300028786 Ga0307517_10260688 Ga0307517_102606882 169
1059 3300028794 Ga0307515_10091382 Ga0307515_100913822 169
1060 3300028794 Ga0307515_10157342 Ga0307515_101573422 169
1061 3300028794 Ga0307515_10466576 Ga0307515_104665761 169
1062 3300028800 Ga0265338_10000256 Ga0265338_1000025672 169
1063 3300031235 Ga0265330_10031372 Ga0265330_100313721 169
1064 3300031235 Ga0265330_10118787 Ga0265330_101187872 169
1065 3300031238 Ga0265332_10036830 Ga0265332_100368302 169
1066 3300031238 Ga0265332_10106860 Ga0265332_101068602 169
1067 3300031239 Ga0265328_10200839 Ga0265328_102008392 169
1068 3300031241 Ga0265325_10000954 Ga0265325_100009547 169
1069 3300031241 Ga0265325_10054489 Ga0265325_100544893 169
1070 3300031241 Ga0265325_10225883 Ga0265325_102258832 169
1071 3300031247 Ga0265340_10003706 Ga0265340_100037065 169
1072 3300031247 Ga0265340_10016165 Ga0265340_100161654 169
1073 3300031247 Ga0265340_10052271 Ga0265340_100522712 169
1074 3300031249 Ga0265339_10006965 Ga0265339_100069653 169
1075 3300031249 Ga0265339_10065271 Ga0265339_100652712 169
1076 3300031250 Ga0265331_10024366 Ga0265331_100243663 169
1077 3300031250 Ga0265331_10209783 Ga0265331_102097831 169
1078 3300031344 Ga0265316_10398855 Ga0265316_103988552 169
1079 3300031507 Ga0307509_10650387 Ga0307509_106503871 169
1080 3300031548 Ga0307408_100087243 Ga0307408_1000872432 169
1081 3300031548 Ga0307408_100782759 Ga0307408_1007827591 169
1082 3300031548 Ga0307408_101025038 Ga0307408_1010250382 169
1083 3300031595 Ga0265313_10007353 Ga0265313_100073534 169
1084 3300031595 Ga0265313_10058214 Ga0265313_100582142 169
1085 3300031595 Ga0265313_10162961 Ga0265313_101629611 169
1086 3300031595 Ga0265313_10192548 Ga0265313_101925482 169
1087 3300031616 Ga0307508_10104109 Ga0307508_101041093 169
1088 3300031616 Ga0307508_10223120 Ga0307508_102231202 169
1089 3300031616 Ga0307508_10699716 Ga0307508_106997161 169
1090 3300031649 Ga0307514_10318040 Ga0307514_103180401 169
1091 3300031711 Ga0265314_10004337 Ga0265314_100043375 169
1092 3300031711 Ga0265314_10027273 Ga0265314_100272733 169
1093 3300031711 Ga0265314_10406221 Ga0265314_104062211 169
1094 3300031712 Ga0265342_10000082 Ga0265342_1000008251 169
1095 3300031712 Ga0265342_10014798 Ga0265342_100147984 169
1096 3300031712 Ga0265342_10016507 Ga0265342_100165074 169
1097 3300031712 Ga0265342_10107466 Ga0265342_101074663 169
1098 3300031712 Ga0265342_10318021 Ga0265342_103180211 169
1099 3300031730 Ga0307516_10055684 Ga0307516_100556843 169
1100 3300031730 Ga0307516_10572644 Ga0307516_105726442 169
1101 3300031731 Ga0307405_11064611 Ga0307405_110646111 169
1102 3300031824 Ga0307413_10139000 Ga0307413_101390002 169
1103 3300031824 Ga0307413_10489505 Ga0307413_104895051 169
1104 3300031901 Ga0307406_10310243 Ga0307406_103102432 169
1105 3300031901 Ga0307406_10664242 Ga0307406_106642422 169
1106 3300031903 Ga0307407_10078826 Ga0307407_100788262 169
1107 3300031903 Ga0307407_10144836 Ga0307407_101448362 169
1108 3300031911 Ga0307412_10152622 Ga0307412_101526222 169
1109 3300031911 Ga0307412_10274861 Ga0307412_102748612 169
1110 3300031911 Ga0307412_11727332 Ga0307412_117273321 169
1111 3300031995 Ga0307409_100263371 Ga0307409_1002633712 169
1112 3300032002 Ga0307416_100307768 Ga0307416_1003077682 169
1113 3300032002 Ga0307416_100440341 Ga0307416_1004403412 169
1114 3300032002 Ga0307416_100532209 Ga0307416_1005322092 169
1115 3300032002 Ga0307416_101746369 Ga0307416_1017463691 169
1116 3300032002 Ga0307416_101759243 Ga0307416_1017592431 169
1117 3300032005 Ga0307411_10220092 Ga0307411_102200921 169
1118 3300032005 Ga0307411_10327801 Ga0307411_103278011 169
1119 3300032005 Ga0307411_10391885 Ga0307411_103918851 169
1120 3300032126 Ga0307415_100638302 Ga0307415_1006383022 169
1121 3300033180 Ga0307510_10039374 Ga0307510_100393743 169
1122 3300033180 Ga0307510_10148385 Ga0307510_101483852 169
1123 3300033180 Ga0307510_10229712 Ga0307510_102297122 169
1124 3300033442 Ga0315911_1000019 Ga0315911_100001968 169
1125 3300033546 Ga0316213_1001962 Ga0316213_10019621 169
1126 3300034816 Ga0373930_0045689 Ga0373930_0045689_299_808 169
1127 3300034818 Ga0373950_0115141 Ga0373950_0115141_66_575 169
1128 3300034820 Ga0373959_0016360 Ga0373959_0016360_57_566 169
1129 3300034957 Ga0373938_0016598 Ga0373938_0016598_355_864 169
1130 3300035083 Ga0373926_0008328 Ga0373926_0008328_2585_3094 169
1131 3300035083 Ga0373926_0110085 Ga0373926_0110085_32_541 169
1132 3300035083 Ga0373926_0119707 Ga0373926_0119707_390_899 169
1133 3300035083 Ga0373926_0304076 Ga0373926_0304076_17_526 169
1134 3300035084 Ga0373928_0100198 Ga0373928_0100198_100_609 169
1135 3300035085 Ga0373929_0031950 Ga0373929_0031950_259_768 169
1136 3300035086 Ga0373934_0054615 Ga0373934_0054615_936_1445 169
1137 3300035086 Ga0373934_0170997 Ga0373934_0170997_104_613 169
1138 3300035086 Ga0373934_0186149 Ga0373934_0186149_113_622 169
1139 3300035086 Ga0373934_0213529 Ga0373934_0213529_77_586 169
1140 3300035092 Ga0373952_0022816 Ga0373952_0022816_383_892 169
1141 3300035111 Ga0373923_0033166 Ga0373923_0033166_593_1102 169
1142 3300035111 Ga0373923_0045536 Ga0373923_0045536_816_1325 169
1143 3300035111 Ga0373923_0204379 Ga0373923_0204379_338_847 169
1144 3300035112 Ga0373932_0064982 Ga0373932_0064982_541_1050 169
1145 3300035112 Ga0373932_0080809 Ga0373932_0080809_129_638 169
1146 3300035113 Ga0373936_0010944 Ga0373936_0010944_2694_3203 169
1147 3300035113 Ga0373936_0019833 Ga0373936_0019833_1835_2344 169
1148 3300035113 Ga0373936_0367294 Ga0373936_0367294_34_543 169
1149 3300035115 Ga0373941_0166238 Ga0373941_0166238_86_595 169
1150 3300035116 Ga0373945_0016886 Ga0373945_0016886_567_1076 169
1151 3300035117 Ga0373953_0005186 Ga0373953_0005186_2489_2998 169
1152 3300035117 Ga0373953_0017256 Ga0373953_0017256_133_642 169
1153 3300035117 Ga0373953_0097846 Ga0373953_0097846_572_1081 169
1154 3300035118 Ga0373954_0008529 Ga0373954_0008529_1417_1926 169
1155 3300035118 Ga0373954_0055059 Ga0373954_0055059_78_587 169
1156 3300035118 Ga0373954_0123193 Ga0373954_0123193_355_864 169
1157 3300035119 Ga0373956_0001240 Ga0373956_0001240_9658_10167 169
1158 3300035119 Ga0373956_0038630 Ga0373956_0038630_270_779 169
1159 3300035119 Ga0373956_0070343 Ga0373956_0070343_196_705 169
1160 3300035120 Ga0373957_0019473 Ga0373957_0019473_1047_1556 169
1161 3300035120 Ga0373957_0195691 Ga0373957_0195691_304_813 169
1162 3300035121 Ga0373960_0057616 Ga0373960_0057616_247_756 169
1163 3300035121 Ga0373960_0138487 Ga0373960_0138487_257_766 169
1164 3300035121 Ga0373960_0186070 Ga0373960_0186070_160_669 169
1165 3300035170 Ga0373943_0174013 Ga0373943_0174013_359_868 169
1166 3300035170 Ga0373943_0507769 Ga0373943_0507769_138_647 169
1167 3300035170 Ga0373943_0726800 Ga0373943_0726800_16_525 169
1168 3300035171 Ga0373946_0003413 Ga0373946_0003413_1078_1587 169
1169 3300035171 Ga0373946_0028128 Ga0373946_0028128_1657_2166 169
1170 3300035171 Ga0373946_0218525 Ga0373946_0218525_365_874 169
1171 3300035172 Ga0373955_0019592 Ga0373955_0019592_1190_1699 169
1172 3300035172 Ga0373955_0027121 Ga0373955_0027121_1043_1552 169
1173 3300035172 Ga0373955_0074877 Ga0373955_0074877_1350_1859 169
1174 3300035172 Ga0373955_0141000 Ga0373955_0141000_834_1343 169
1175 3300035172 Ga0373955_0762695 Ga0373955_0762695_75_584 169
1176 3300035241 Ga0373961_0213821 Ga0373961_0213821_112_621 169
1177 3300035241 Ga0373961_0328289 Ga0373961_0328289_27_536 169
1178 3300035242 Ga0373962_0191623 Ga0373962_0191623_83_592 169
1179 3300035410 Ga0373924_0011894 Ga0373924_0011894_2130_2639 169
1180 3300035410 Ga0373924_0078144 Ga0373924_0078144_729_1238 169
1181 3300035410 Ga0373924_0086002 Ga0373924_0086002_304_813 169
1182 3300035410 Ga0373924_0197371 Ga0373924_0197371_77_586 169
1183 3300035691 Ga0373931_0006486 Ga0373931_0006486_1753_2262 169
1184 3300035691 Ga0373931_0014615 Ga0373931_0014615_2744_3253 169
1185 3300035691 Ga0373931_0099107 Ga0373931_0099107_717_1226 169
1186 3300035691 Ga0373931_0490953 Ga0373931_0490953_190_699 169
1187 3300035692 Ga0373935_0000467 Ga0373935_0000467_14118_14627 169
1188 3300035692 Ga0373935_0135033 Ga0373935_0135033_714_1223 169
1189 3300035695 Ga0373927_0000844 Ga0373927_0000844_18373_18882 169
1190 3300035695 Ga0373927_0012690 Ga0373927_0012690_2013_2522 169
1191 3300035695 Ga0373927_0091391 Ga0373927_0091391_427_936 169
1192 3300035695 Ga0373927_0095419 Ga0373927_0095419_430_939 169
1193 3300035695 Ga0373927_0181371 Ga0373927_0181371_754_1263 169
1194 3300035695 Ga0373927_0316516 Ga0373927_0316516_411_920 169
1195 3300035724 Ga0373933_0000057 Ga0373933_0000057_47148_47657 169
1196 3300035724 Ga0373933_0102427 Ga0373933_0102427_308_817 169
1197 3300035724 Ga0373933_0178313 Ga0373933_0178313_726_1235 169
1198 3300035725 Ga0373947_0000761 Ga0373947_0000761_1144_1653 169
1199 3300035725 Ga0373947_0003343 Ga0373947_0003343_5356_5865 169
1200 3300035725 Ga0373947_0085506 Ga0373947_0085506_31_540 169
1201 3300035725 Ga0373947_0163504 Ga0373947_0163504_908_1417 169
1202 3300035725 Ga0373947_0315097 Ga0373947_0315097_62_571 169
1203 3300036401 Ga0373937_0036680 Ga0373937_0036680_944_1453 169
1204 3300036401 Ga0373937_0064104 Ga0373937_0064104_1246_1755 169
1205 3300036401 Ga0373937_0263271 Ga0373937_0263271_34_543 169
1206 3300036401 Ga0373937_0277244 Ga0373937_0277244_513_1022 169
1207 3300036401 Ga0373937_0487013 Ga0373937_0487013_235_744 169
1208 3300036401 Ga0373937_0664520 Ga0373937_0664520_109_618 169
1209 3300036401 Ga0373937_1693157 Ga0373937_1693157_24_533 169
1210 3300037068 Ga0373925_0009308 Ga0373925_0009308_3058_3567 169
1211 3300037068 Ga0373925_0010741 Ga0373925_0010741_246_755 169
1212 3300037068 Ga0373925_0046971 Ga0373925_0046971_1938_2447 169
1213 3300037068 Ga0373925_0106679 Ga0373925_0106679_972_1481 169
1214 3300037068 Ga0373925_0114990 Ga0373925_0114990_1514_2023 169
1215 3300037068 Ga0373925_0120533 Ga0373925_0120533_530_1039 169
1216 3300037068 Ga0373925_0169447 Ga0373925_0169447_395_904 169
1217 3300037068 Ga0373925_1394211 Ga0373925_1394211_33_542 169
1218 3300037312 Ga0395899_0181235 Ga0395899_0181235_75_584 169
1219 3300037312 Ga0395899_0228306 Ga0395899_0228306_202_711 169
1220 3300037418 Ga0395900_0045319 Ga0395900_0045319_3542_4051 169
1221 3300037418 Ga0395900_0181083 Ga0395900_0181083_418_927 169
1222 3300037418 Ga0395900_0299646 Ga0395900_0299646_256_765 169
1223 3300037418 Ga0395900_1270852 Ga0395900_1270852_106_615 169
1224 3300037466 Ga0395898_0036376 Ga0395898_0036376_1837_2346 169
1225 3300037466 Ga0395898_0151741 Ga0395898_0151741_1534_2043 169
1226 3300037466 Ga0395898_0261331 Ga0395898_0261331_633_1142 169
1227 3300037466 Ga0395898_0459737 Ga0395898_0459737_15_524 169
1228 3300037471 Ga0395905_0003590 Ga0395905_0003590_10238_10747 169
1229 3300037471 Ga0395905_0161365 Ga0395905_0161365_1092_1601 169
1230 3300037853 Ga0436364_0191290 Ga0436364_0191290_1676_2185 169
1231 3300037853 Ga0436364_0476672 Ga0436364_0476672_57_566 169
1232 3300038443 Ga0395901_0148727 Ga0395901_0148727_536_1045 169
1233 3300038443 Ga0395901_0233242 Ga0395901_0233242_182_691 169
1234 3300038443 Ga0395901_0243895 Ga0395901_0243895_1267_1776 169
1235 3300038443 Ga0395901_0543393 Ga0395901_0543393_426_935 169
1236 3300039437 Ga0436365_0158617 Ga0436365_0158617_2632_3141 169
1237 3300039437 Ga0436365_0647493 Ga0436365_0647493_4292_4801 169
1238 3300039437 Ga0436365_1023053 Ga0436365_1023053_431_940 169
1239 3300039437 Ga0436365_1097492 Ga0436365_1097492_971_1480 169
1240 3300039437 Ga0436365_1647635 Ga0436365_1647635_109_618 169
1241 3300039437 Ga0436365_1784550 Ga0436365_1784550_665_1174 169
1242 3300039438 Ga0436360_0991307 Ga0436360_0991307_144_653 169
1243 3300039438 Ga0436360_1308546 Ga0436360_1308546_41_550 169
1244 3300039447 Ga0436361_0000793 Ga0436361_0000793_190_699 169
1245 3300039447 Ga0436361_0407076 Ga0436361_0407076_18_527 169
1246 3300039447 Ga0436361_0461323 Ga0436361_0461323_113_622 169
1247 3300039447 Ga0436361_0547128 Ga0436361_0547128_1568_2077 169
1248 3300039447 Ga0436361_1101008 Ga0436361_1101008_127_636 169
1249 3300039447 Ga0436361_1156177 Ga0436361_1156177_116_625 169
1250 3300039450 Ga0436363_0018622 Ga0436363_0018622_177_686 169
1251 3300039450 Ga0436363_0206742 Ga0436363_0206742_80_589 169
1252 3300039450 Ga0436363_0652096 Ga0436363_0652096_542_1051 169
1253 3300039450 Ga0436363_0787831 Ga0436363_0787831_66_575 169
1254 3300039450 Ga0436363_0810938 Ga0436363_0810938_719_1228 169
1255 3300039450 Ga0436363_1179570 Ga0436363_1179570_108_617 169
1256 3300039450 Ga0436363_1666906 Ga0436363_1666906_14_523 169
1257 3300039453 Ga0436362_0141741 Ga0436362_0141741_55_564 169
1258 3300039453 Ga0436362_0751881 Ga0436362_0751881_383_892 169
1259 3300041413 Ga0439465_0067987 Ga0439465_0067987_564_1073 169
1260 3300041413 Ga0439465_0161497 Ga0439465_0161497_55_564 169
1261 3300041451 Ga0451791_0749274 Ga0451791_0749274_55_567 169
1262 3300041453 Ga0451797_1331092 Ga0451797_1331092_190_699 169
1263 3300041459 Ga0451800_1591566 Ga0451800_1591566_407_916 169
1264 3300041460 Ga0451802_1069953 Ga0451802_1069953_93_602 169
1265 3300041496 Ga0451839_0022668 Ga0451839_0022668_94_603 169
1266 3300041501 Ga0451845_0946972 Ga0451845_0946972_82_591 169
1267 3300041505 Ga0451849_0798151 Ga0451849_0798151_362_871 169
1268 3300041509 Ga0451843_0143358 Ga0451843_0143358_73_582 169
1269 3300042008 Ga0439450_007144 Ga0439450_007144_715_1224 169
1270 3300042012 Ga0439455_0038258 Ga0439455_0038258_253_762 169
1271 3300042439 Ga0439464_0024306 Ga0439464_0024306_734_1243 169
1272 3300044656 Ga0466969_0328977 Ga0466969_0328977_94_603 169
1273 3300044658 Ga0466972_0146815 Ga0466972_0146815_576_1085 169
1274 3300044684 Ga0466966_0036194 Ga0466966_0036194_2321_2830 169
1275 3300044684 Ga0466966_0041642 Ga0466966_0041642_1870_2379 169
1276 3300044684 Ga0466966_0099621 Ga0466966_0099621_137_646 169
1277 3300044684 Ga0466966_0143683 Ga0466966_0143683_771_1280 169
1278 3300044684 Ga0466966_0145658 Ga0466966_0145658_59_568 169
1279 3300044693 Ga0466961_0000019 Ga0466961_0000019_47256_47765 169
1280 3300044693 Ga0466961_0671921 Ga0466961_0671921_65_574 169
1281 3300044694 Ga0466963_0102338 Ga0466963_0102338_1246_1755 169
1282 3300044694 Ga0466963_0143179 Ga0466963_0143179_676_1185 169
1283 3300044706 Ga0466964_0132835 Ga0466964_0132835_215_724 169
1284 3300044712 Ga0453684_0360090 Ga0453684_0360090_394_915 169
1285 3300044842 Ga0466957_0378196 Ga0466957_0378196_190_699 169
1286 3300044901 Ga0466960_0089343 Ga0466960_0089343_561_1070 169
1287 3300045049 Ga0466959_0003898 Ga0466959_0003898_9309_9818 169
1288 3300045049 Ga0466959_0043940 Ga0466959_0043940_1987_2496 169
1289 3300045836 Ga0466958_0022400 Ga0466958_0022400_2394_2903 169
1290 3300045976 Ga0466967_0067830 Ga0466967_0067830_2562_3071 169
1291 3300045976 Ga0466967_0340286 Ga0466967_0340286_402_911 169
1292 3300045976 Ga0466967_0406329 Ga0466967_0406329_595_1104 169
1293 3300045976 Ga0466967_0506268 Ga0466967_0506268_466_975 169
1294 3300045976 Ga0466967_0513182 Ga0466967_0513182_273_782 169
1295 3300046452 Ga0495617_089567 Ga0495617_089567_477_986 169
1296 3300046452 Ga0495617_119323 Ga0495617_119323_129_638 169
1297 3300046452 Ga0495617_121721 Ga0495617_121721_230_766 169
1298 3300046453 Ga0495627_127638 Ga0495627_127638_65_574 169
1299 3300046454 Ga0495592_0019614 Ga0495592_0019614_3623_4132 169
1300 3300046454 Ga0495592_0031884 Ga0495592_0031884_2343_2852 169
1301 3300046454 Ga0495592_0148000 Ga0495592_0148000_1036_1545 169
1302 3300046455 Ga0495603_0000068 Ga0495603_0000068_26950_27459 169
1303 3300046455 Ga0495603_0002089 Ga0495603_0002089_9944_10453 169
1304 3300046455 Ga0495603_0007944 Ga0495603_0007944_5578_6087 169
1305 3300046455 Ga0495603_0083835 Ga0495603_0083835_1283_1792 169
1306 3300046455 Ga0495603_0088097 Ga0495603_0088097_1105_1614 169
1307 3300046455 Ga0495603_0236953 Ga0495603_0236953_137_646 169
1308 3300046457 Ga0495590_0083767 Ga0495590_0083767_534_1043 169
1309 3300046457 Ga0495590_0129260 Ga0495590_0129260_284_793 169
1310 3300046459 Ga0495629_0000434 Ga0495629_0000434_11755_12264 169
1311 3300046459 Ga0495629_0009402 Ga0495629_0009402_1157_1666 169
1312 3300046459 Ga0495629_0084952 Ga0495629_0084952_1243_1752 169
1313 3300046459 Ga0495629_0162376 Ga0495629_0162376_524_1033 169
1314 3300046459 Ga0495629_0173167 Ga0495629_0173167_678_1187 169
1315 3300046459 Ga0495629_0217074 Ga0495629_0217074_572_1081 169
1316 3300046459 Ga0495629_0349847 Ga0495629_0349847_201_710 169
1317 3300046460 Ga0495638_0027370 Ga0495638_0027370_225_734 169
1318 3300046460 Ga0495638_0056275 Ga0495638_0056275_169_678 169
1319 3300046460 Ga0495638_0130626 Ga0495638_0130626_225_734 169
1320 3300046460 Ga0495638_0247848 Ga0495638_0247848_338_847 169
1321 3300046460 Ga0495638_0256042 Ga0495638_0256042_406_915 169
1322 3300046460 Ga0495638_0374448 Ga0495638_0374448_54_563 169
1323 3300046461 Ga0495641_0001990 Ga0495641_0001990_3024_3533 169
1324 3300046461 Ga0495641_0019818 Ga0495641_0019818_94_603 169
1325 3300046461 Ga0495641_0110905 Ga0495641_0110905_131_640 169
1326 3300046461 Ga0495641_0128542 Ga0495641_0128542_249_758 169
1327 3300046461 Ga0495641_0178863 Ga0495641_0178863_31_540 169
1328 3300046462 Ga0495651_0016442 Ga0495651_0016442_4738_5247 169
1329 3300046462 Ga0495651_0045798 Ga0495651_0045798_2643_3152 169
1330 3300046462 Ga0495651_0064969 Ga0495651_0064969_52_561 169
1331 3300046462 Ga0495651_0099993 Ga0495651_0099993_1100_1609 169
1332 3300046462 Ga0495651_0164349 Ga0495651_0164349_628_1137 169
1333 3300046462 Ga0495651_0260511 Ga0495651_0260511_649_1158 169
1334 3300046463 Ga0495653_0004509 Ga0495653_0004509_406_915 169
1335 3300046463 Ga0495653_0034477 Ga0495653_0034477_1352_1861 169
1336 3300046463 Ga0495653_0142244 Ga0495653_0142244_12_521 169
1337 3300046463 Ga0495653_0505881 Ga0495653_0505881_191_700 169
1338 3300046471 Ga0495650_0058840 Ga0495650_0058840_50_559 169
1339 3300046471 Ga0495650_0085551 Ga0495650_0085551_175_684 169
1340 3300046472 Ga0495580_0001835 Ga0495580_0001835_15151_15660 169
1341 3300046472 Ga0495580_0123771 Ga0495580_0123771_178_687 169
1342 3300046472 Ga0495580_0243806 Ga0495580_0243806_517_1026 169
1343 3300046472 Ga0495580_0377123 Ga0495580_0377123_395_904 169
1344 3300046473 Ga0495582_0000057 Ga0495582_0000057_56443_56952 169
1345 3300046473 Ga0495582_0016816 Ga0495582_0016816_154_663 169
1346 3300046473 Ga0495582_0052978 Ga0495582_0052978_64_573 169
1347 3300046473 Ga0495582_0083452 Ga0495582_0083452_822_1331 169
1348 3300046473 Ga0495582_0183772 Ga0495582_0183772_672_1181 169
1349 3300046474 Ga0495605_0186203 Ga0495605_0186203_32_541 169
1350 3300046474 Ga0495605_0263477 Ga0495605_0263477_48_557 169
1351 3300046475 Ga0495639_0000161 Ga0495639_0000161_18629_19138 169
1352 3300046475 Ga0495639_0009503 Ga0495639_0009503_3406_3915 169
1353 3300046475 Ga0495639_0053095 Ga0495639_0053095_148_657 169
1354 3300046475 Ga0495639_0118946 Ga0495639_0118946_484_993 169
1355 3300046475 Ga0495639_0257806 Ga0495639_0257806_69_578 169
1356 3300046475 Ga0495639_0349902 Ga0495639_0349902_16_525 169
1357 3300046475 Ga0495639_0380173 Ga0495639_0380173_173_682 169
1358 3300046476 Ga0495662_0000173 Ga0495662_0000173_7870_8379 169
1359 3300046476 Ga0495662_0039339 Ga0495662_0039339_1454_1963 169
1360 3300046476 Ga0495662_0174911 Ga0495662_0174911_487_996 169
1361 3300046476 Ga0495662_0261958 Ga0495662_0261958_283_792 169
1362 3300046476 Ga0495662_0474628 Ga0495662_0474628_40_549 169
1363 3300046477 Ga0495664_0007250 Ga0495664_0007250_5178_5687 169
1364 3300046477 Ga0495664_0008650 Ga0495664_0008650_3779_4288 169
1365 3300046477 Ga0495664_0021985 Ga0495664_0021985_861_1370 169
1366 3300046477 Ga0495664_0136568 Ga0495664_0136568_495_1004 169
1367 3300046477 Ga0495664_0142095 Ga0495664_0142095_632_1141 169
1368 3300046477 Ga0495664_0156677 Ga0495664_0156677_66_575 169
1369 3300046491 Ga0495584_0009339 Ga0495584_0009339_3862_4374 169
1370 3300046491 Ga0495584_0083743 Ga0495584_0083743_444_953 169
1371 3300046491 Ga0495584_0167987 Ga0495584_0167987_574_1083 169
1372 3300046492 Ga0495585_0017468 Ga0495585_0017468_2902_3411 169
1373 3300046492 Ga0495585_0143465 Ga0495585_0143465_504_1013 169
1374 3300046492 Ga0495585_0419622 Ga0495585_0419622_77_586 169
1375 3300046499 Ga0495594_0001614 Ga0495594_0001614_9424_9933 169
1376 3300046499 Ga0495594_0046067 Ga0495594_0046067_207_716 169
1377 3300046499 Ga0495594_0071770 Ga0495594_0071770_837_1346 169
1378 3300046499 Ga0495594_0080957 Ga0495594_0080957_1177_1686 169
1379 3300046499 Ga0495594_0142373 Ga0495594_0142373_183_692 169
1380 3300046499 Ga0495594_0696323 Ga0495594_0696323_27_536 169
1381 3300046500 Ga0495596_0092393 Ga0495596_0092393_30_539 169
1382 3300046500 Ga0495596_0159891 Ga0495596_0159891_305_814 169
1383 3300046501 Ga0495607_0046481 Ga0495607_0046481_140_649 169
1384 3300046501 Ga0495607_0260370 Ga0495607_0260370_249_758 169
1385 3300046501 Ga0495607_0271639 Ga0495607_0271639_97_606 169
1386 3300046501 Ga0495607_0340169 Ga0495607_0340169_135_644 169
1387 3300046506 Ga0495583_0086646 Ga0495583_0086646_338_847 169
1388 3300046511 Ga0495608_0005868 Ga0495608_0005868_4988_5497 169
1389 3300046511 Ga0495608_0046683 Ga0495608_0046683_641_1150 169
1390 3300046511 Ga0495608_0164559 Ga0495608_0164559_521_1030 169
1391 3300046513 Ga0495616_0083449 Ga0495616_0083449_421_930 169
1392 3300046513 Ga0495616_0142477 Ga0495616_0142477_152_661 169
1393 3300046513 Ga0495616_0325292 Ga0495616_0325292_102_611 169
1394 3300046514 Ga0495618_0021420 Ga0495618_0021420_2350_2859 169
1395 3300046514 Ga0495618_0062276 Ga0495618_0062276_599_1108 169
1396 3300046514 Ga0495618_0099986 Ga0495618_0099986_1118_1627 169
1397 3300046514 Ga0495618_0116885 Ga0495618_0116885_977_1486 169
1398 3300046515 Ga0495620_0095477 Ga0495620_0095477_612_1121 169
1399 3300046515 Ga0495620_0105228 Ga0495620_0105228_435_944 169
1400 3300046515 Ga0495620_0192646 Ga0495620_0192646_267_776 169
1401 3300046515 Ga0495620_0263334 Ga0495620_0263334_135_644 169
1402 3300046516 Ga0495628_0011544 Ga0495628_0011544_4894_5403 169
1403 3300046516 Ga0495628_0131766 Ga0495628_0131766_641_1150 169
1404 3300046516 Ga0495628_0144233 Ga0495628_0144233_469_978 169
1405 3300046517 Ga0495630_0003207 Ga0495630_0003207_5796_6305 169
1406 3300046517 Ga0495630_0009891 Ga0495630_0009891_5181_5690 169
1407 3300046517 Ga0495630_0035392 Ga0495630_0035392_3157_3666 169
1408 3300046517 Ga0495630_0081625 Ga0495630_0081625_430_939 169
1409 3300046517 Ga0495630_0229601 Ga0495630_0229601_657_1166 169
1410 3300046517 Ga0495630_0551971 Ga0495630_0551971_303_812 169
1411 3300046519 Ga0495632_0104286 Ga0495632_0104286_237_746 169
1412 3300046523 Ga0495644_0006954 Ga0495644_0006954_3037_3546 169
1413 3300046523 Ga0495644_0048849 Ga0495644_0048849_171_680 169
1414 3300046523 Ga0495644_0069626 Ga0495644_0069626_463_972 169
1415 3300046524 Ga0495648_0008096 Ga0495648_0008096_6578_7087 169
1416 3300046524 Ga0495648_0015341 Ga0495648_0015341_3171_3680 169
1417 3300046524 Ga0495648_0330526 Ga0495648_0330526_48_557 169
1418 3300046524 Ga0495648_0462314 Ga0495648_0462314_11_520 169
1419 3300046525 Ga0495663_0030223 Ga0495663_0030223_278_787 169
1420 3300046526 Ga0495666_0018026 Ga0495666_0018026_243_752 169
1421 3300046526 Ga0495666_0030817 Ga0495666_0030817_1784_2293 169
1422 3300046526 Ga0495666_0365310 Ga0495666_0365310_64_573 169
1423 3300046528 Ga0495642_0136080 Ga0495642_0136080_524_1033 169
1424 3300046528 Ga0495642_0414647 Ga0495642_0414647_39_548 169
1425 3300046529 Ga0495652_0038445 Ga0495652_0038445_85_594 169
1426 3300046529 Ga0495652_0046212 Ga0495652_0046212_2591_3100 169
1427 3300046529 Ga0495652_0052210 Ga0495652_0052210_455_964 169
1428 3300046529 Ga0495652_0111751 Ga0495652_0111751_1334_1843 169
1429 3300046529 Ga0495652_0143031 Ga0495652_0143031_394_903 169
1430 3300046529 Ga0495652_0546798 Ga0495652_0546798_142_651 169
1431 3300046529 Ga0495652_0803153 Ga0495652_0803153_33_542 169
1432 3300046529 Ga0495652_0839974 Ga0495652_0839974_12_521 169
1433 3300046530 Ga0495654_0039047 Ga0495654_0039047_343_852 169
1434 3300046530 Ga0495654_0062684 Ga0495654_0062684_1104_1613 169
1435 3300046530 Ga0495654_0182272 Ga0495654_0182272_388_897 169
1436 3300046531 Ga0495665_0000075 Ga0495665_0000075_36153_36662 169
1437 3300046531 Ga0495665_0032786 Ga0495665_0032786_895_1404 169
1438 3300046531 Ga0495665_0043974 Ga0495665_0043974_1240_1749 169
1439 3300046533 Ga0495640_0011872 Ga0495640_0011872_4186_4695 169
1440 3300046533 Ga0495640_0037135 Ga0495640_0037135_1322_1831 169
1441 3300046533 Ga0495640_0091632 Ga0495640_0091632_1486_1995 169
1442 3300046533 Ga0495640_0480950 Ga0495640_0480950_237_746 169
1443 3300046535 Ga0495586_0749540 Ga0495586_0749540_28_537 169
1444 3300046536 Ga0495587_0005824 Ga0495587_0005824_2221_2730 169
1445 3300046536 Ga0495587_0026053 Ga0495587_0026053_809_1318 169
1446 3300046536 Ga0495587_0033715 Ga0495587_0033715_65_574 169
1447 3300046536 Ga0495587_0199682 Ga0495587_0199682_586_1095 169
1448 3300046536 Ga0495587_0239205 Ga0495587_0239205_42_551 169
1449 3300046537 Ga0495598_0004512 Ga0495598_0004512_767_1276 169
1450 3300046537 Ga0495598_0030372 Ga0495598_0030372_829_1338 169
1451 3300046539 Ga0495621_0121212 Ga0495621_0121212_450_959 169
1452 3300046542 Ga0495597_0229584 Ga0495597_0229584_57_566 169
1453 3300046542 Ga0495597_0290359 Ga0495597_0290359_50_559 169
1454 3300046543 Ga0495645_0024888 Ga0495645_0024888_1942_2451 169
1455 3300046543 Ga0495645_0082584 Ga0495645_0082584_1427_1936 169
1456 3300046543 Ga0495645_0203057 Ga0495645_0203057_64_573 169
1457 3300046543 Ga0495645_0336413 Ga0495645_0336413_279_788 169
1458 3300046557 Ga0495622_0012051 Ga0495622_0012051_115_624 169
1459 3300046557 Ga0495622_0041413 Ga0495622_0041413_12_521 169
1460 3300046557 Ga0495622_0171462 Ga0495622_0171462_185_694 169
1461 3300046558 Ga0495633_0024562 Ga0495633_0024562_2333_2842 169
1462 3300046558 Ga0495633_0039918 Ga0495633_0039918_1565_2074 169
1463 3300046558 Ga0495633_0118661 Ga0495633_0118661_210_719 169
1464 3300046559 Ga0495667_0006368 Ga0495667_0006368_5488_5997 169
1465 3300046559 Ga0495667_0017539 Ga0495667_0017539_2235_2744 169
1466 3300046559 Ga0495667_0019902 Ga0495667_0019902_1564_2073 169
1467 3300046559 Ga0495667_0073028 Ga0495667_0073028_603_1112 169
1468 3300046559 Ga0495667_0155249 Ga0495667_0155249_214_723 169
1469 3300046559 Ga0495667_0161939 Ga0495667_0161939_566_1075 169
1470 3300046559 Ga0495667_0265274 Ga0495667_0265274_59_568 169
1471 3300046559 Ga0495667_0316475 Ga0495667_0316475_234_743 169
1472 3300046615 Ga0495656_0002229 Ga0495656_0002229_4233_4742 169
1473 3300046615 Ga0495656_0020753 Ga0495656_0020753_980_1489 169
1474 3300046615 Ga0495656_0061396 Ga0495656_0061396_683_1192 169
1475 3300046615 Ga0495656_0085065 Ga0495656_0085065_115_624 169
1476 3300046615 Ga0495656_0355160 Ga0495656_0355160_189_698 169
1477 3300046616 Ga0495668_0017150 Ga0495668_0017150_3540_4049 169
1478 3300046616 Ga0495668_0069063 Ga0495668_0069063_452_961 169
1479 3300046616 Ga0495668_0111567 Ga0495668_0111567_540_1049 169
1480 3300046616 Ga0495668_0638805 Ga0495668_0638805_15_524 169
1481 3300046642 Ga0495634_0002559 Ga0495634_0002559_10476_10985 169
1482 3300046642 Ga0495634_0035954 Ga0495634_0035954_1081_1590 169
1483 3300046642 Ga0495634_0054936 Ga0495634_0054936_334_843 169
1484 3300046642 Ga0495634_0106922 Ga0495634_0106922_243_752 169
1485 3300046642 Ga0495634_0152619 Ga0495634_0152619_413_922 169
1486 3300046648 Ga0495611_0364613 Ga0495611_0364613_133_642 169
1487 3300046660 Ga0495625_0070230 Ga0495625_0070230_275_784 169
1488 3300046660 Ga0495625_0183713 Ga0495625_0183713_381_890 169
1489 3300046660 Ga0495625_0196527 Ga0495625_0196527_773_1282 169
1490 3300046663 Ga0495635_0000691 Ga0495635_0000691_19706_20215 169
1491 3300046663 Ga0495635_0275222 Ga0495635_0275222_110_619 169
1492 3300046664 Ga0495659_0121854 Ga0495659_0121854_93_602 169
1493 3300046664 Ga0495659_0321605 Ga0495659_0321605_88_597 169
1494 3300046665 Ga0495661_0148465 Ga0495661_0148465_625_1134 169
1495 3300046665 Ga0495661_0423657 Ga0495661_0423657_33_542 169
1496 3300046674 Ga0495588_0002885 Ga0495588_0002885_3142_3651 169
1497 3300046674 Ga0495588_0086051 Ga0495588_0086051_684_1193 169
1498 3300046674 Ga0495588_0106471 Ga0495588_0106471_194_703 169
1499 3300046675 Ga0495657_0026358 Ga0495657_0026358_2346_2855 169
1500 3300046675 Ga0495657_0047454 Ga0495657_0047454_1341_1850 169
1501 3300046678 Ga0495599_0016518 Ga0495599_0016518_2701_3210 169
1502 3300046678 Ga0495599_0052799 Ga0495599_0052799_1485_1994 169
1503 3300046678 Ga0495599_0063753 Ga0495599_0063753_630_1139 169
1504 3300046678 Ga0495599_0099639 Ga0495599_0099639_964_1473 169
1505 3300046678 Ga0495599_0120695 Ga0495599_0120695_414_923 169
1506 3300046679 Ga0495623_0006694 Ga0495623_0006694_5420_5929 169
1507 3300046680 Ga0495646_0034970 Ga0495646_0034970_174_683 169
1508 3300046680 Ga0495646_0071612 Ga0495646_0071612_1131_1640 169
1509 3300046680 Ga0495646_0093838 Ga0495646_0093838_1075_1584 169
1510 3300046680 Ga0495646_0146647 Ga0495646_0146647_419_928 169
1511 3300046681 Ga0495647_0015336 Ga0495647_0015336_141_650 169
1512 3300046681 Ga0495647_0106924 Ga0495647_0106924_615_1124 169
1513 3300046683 Ga0495658_0000388 Ga0495658_0000388_4525_5034 169
1514 3300046683 Ga0495658_0009245 Ga0495658_0009245_107_616 169
1515 3300046683 Ga0495658_0043627 Ga0495658_0043627_463_972 169
1516 3300046683 Ga0495658_0441587 Ga0495658_0441587_244_753 169
1517 3300046683 Ga0495658_0712275 Ga0495658_0712275_34_543 169
1518 3300046684 Ga0495669_0024921 Ga0495669_0024921_452_961 169
1519 3300046684 Ga0495669_0089373 Ga0495669_0089373_657_1166 169
1520 3300046689 Ga0495613_0014049 Ga0495613_0014049_1103_1612 169
1521 3300046689 Ga0495613_0022116 Ga0495613_0022116_726_1235 169
1522 3300046689 Ga0495613_0040271 Ga0495613_0040271_1333_1842 169
1523 3300046689 Ga0495613_0041571 Ga0495613_0041571_1883_2392 169
1524 3300046689 Ga0495613_0059017 Ga0495613_0059017_547_1056 169
1525 3300046689 Ga0495613_0604164 Ga0495613_0604164_153_662 169
1526 3300046689 Ga0495613_0685800 Ga0495613_0685800_102_641 169
1527 3300046690 Ga0495624_0010418 Ga0495624_0010418_3117_3626 169
1528 3300046690 Ga0495624_0074116 Ga0495624_0074116_289_798 169
1529 3300046690 Ga0495624_0186292 Ga0495624_0186292_455_964 169
1530 3300046690 Ga0495624_0296246 Ga0495624_0296246_339_848 169
1531 3300046691 Ga0495670_0015796 Ga0495670_0015796_684_1193 169
1532 3300046691 Ga0495670_0023527 Ga0495670_0023527_2456_2965 169
1533 3300046691 Ga0495670_0169803 Ga0495670_0169803_575_1084 169
1534 3300046691 Ga0495670_0251719 Ga0495670_0251719_30_542 169
1535 3300046692 Ga0495671_0025636 Ga0495671_0025636_465_974 169
1536 3300046692 Ga0495671_0385078 Ga0495671_0385078_69_578 169
1537 3300046694 Ga0495649_0259217 Ga0495649_0259217_290_799 169
1538 3300046694 Ga0495649_0428087 Ga0495649_0428087_123_632 169
1539 3300046794 Ga0495589_0180833 Ga0495589_0180833_338_847 169
1540 3300046809 Ga0495600_0000551 Ga0495600_0000551_11452_11961 169
1541 3300046809 Ga0495600_0011511 Ga0495600_0011511_2551_3060 169
1542 3300046809 Ga0495600_0130169 Ga0495600_0130169_152_661 169
1543 3300046809 Ga0495600_0327911 Ga0495600_0327911_167_676 169
1544 3300046810 Ga0495660_0247724 Ga0495660_0247724_162_671 169
1545 3300047315 Ga0495581_0000388 Ga0495581_0000388_6031_6540 169
1546 3300047315 Ga0495581_0087418 Ga0495581_0087418_1256_1765 169
1547 3300047315 Ga0495581_0149659 Ga0495581_0149659_81_590 169
1548 3300047315 Ga0495581_0152841 Ga0495581_0152841_454_963 169
1549 3300047315 Ga0495581_0217532 Ga0495581_0217532_583_1092 169
1550 3300047315 Ga0495581_0502344 Ga0495581_0502344_99_608 169
1551 3300047317 Ga0495604_0016072 Ga0495604_0016072_2677_3186 169
1552 3300047317 Ga0495604_0077829 Ga0495604_0077829_1308_1817 169
1553 3300047317 Ga0495604_0102789 Ga0495604_0102789_802_1311 169
1554 3300047317 Ga0495604_0231764 Ga0495604_0231764_445_954 169
1555 3300047317 Ga0495604_0349299 Ga0495604_0349299_146_655 169
1556 3300047317 Ga0495604_0644511 Ga0495604_0644511_88_597 169
1557 3300047318 Ga0495636_0150238 Ga0495636_0150238_33_542 169
1558 3300047319 Ga0495674_0000671 Ga0495674_0000671_8293_8802 169
1559 3300047319 Ga0495674_0034294 Ga0495674_0034294_511_1020 169
1560 3300047319 Ga0495674_0060282 Ga0495674_0060282_2789_3298 169
1561 3300047319 Ga0495674_0063261 Ga0495674_0063261_1095_1604 169
1562 3300047319 Ga0495674_0351987 Ga0495674_0351987_290_799 169
1563 3300047319 Ga0495674_0429222 Ga0495674_0429222_102_611 169
1564 3300047319 Ga0495674_0433036 Ga0495674_0433036_429_938 169
1565 3300047319 Ga0495674_1026426 Ga0495674_1026426_33_542 169
1566 3300047320 Ga0495672_0094329 Ga0495672_0094329_797_1306 169
1567 3300047321 Ga0495676_0040452 Ga0495676_0040452_3072_3581 169
1568 3300047321 Ga0495676_0313568 Ga0495676_0313568_309_818 169
1569 3300047322 Ga0495680_0005795 Ga0495680_0005795_10231_10740 169
1570 3300047322 Ga0495680_0026097 Ga0495680_0026097_2647_3156 169
1571 3300047322 Ga0495680_0027772 Ga0495680_0027772_895_1404 169
1572 3300047322 Ga0495680_0055922 Ga0495680_0055922_430_939 169
1573 3300047323 Ga0495683_0175223 Ga0495683_0175223_164_673 169
1574 3300047323 Ga0495683_0280464 Ga0495683_0280464_190_699 169
1575 3300047444 Ga0495675_0001030 Ga0495675_0001030_4483_4992 169
1576 3300047444 Ga0495675_0010217 Ga0495675_0010217_469_978 169
1577 3300047444 Ga0495675_0240009 Ga0495675_0240009_49_558 169
1578 3300047445 Ga0495677_0023647 Ga0495677_0023647_984_1493 169
1579 3300047445 Ga0495677_0053818 Ga0495677_0053818_305_814 169
1580 3300047446 Ga0495679_036164 Ga0495679_036164_714_1223 169
1581 3300047446 Ga0495679_147944 Ga0495679_147944_37_546 169
1582 3300047469 Ga0495673_0073462 Ga0495673_0073462_825_1334 169
1583 3300047469 Ga0495673_0195553 Ga0495673_0195553_207_716 169
1584 3300047470 Ga0495681_0032520 Ga0495681_0032520_1402_1911 169
1585 3300047471 Ga0495684_0009133 Ga0495684_0009133_5748_6257 169
1586 3300047471 Ga0495684_0112862 Ga0495684_0112862_297_806 169
1587 3300047471 Ga0495684_0209874 Ga0495684_0209874_530_1039 169
1588 3300047472 Ga0495686_0148881 Ga0495686_0148881_200_709 169
1589 3300047472 Ga0495686_0184037 Ga0495686_0184037_520_1029 169
1590 3300047472 Ga0495686_0209984 Ga0495686_0209984_403_912 169
1591 3300047472 Ga0495686_0241286 Ga0495686_0241286_245_754 169
1592 3300047472 Ga0495686_0248542 Ga0495686_0248542_228_737 169
1593 3300047472 Ga0495686_0588263 Ga0495686_0588263_40_549 169
1594 3300047673 Ga0495593_0000139 Ga0495593_0000139_249_758 169
1595 3300047673 Ga0495593_0007168 Ga0495593_0007168_5670_6179 169
1596 3300047673 Ga0495593_0032731 Ga0495593_0032731_1068_1577 169
1597 3300047673 Ga0495593_0072308 Ga0495593_0072308_46_555 169
1598 3300048088 Ga0495602_0051710 Ga0495602_0051710_1417_1926 169
1599 3300048088 Ga0495602_0071774 Ga0495602_0071774_1688_2197 169
1600 3300048088 Ga0495602_0177537 Ga0495602_0177537_846_1355 169
1601 3300048088 Ga0495602_0188619 Ga0495602_0188619_460_969 169
1602 3300048088 Ga0495602_0429345 Ga0495602_0429345_248_757 169
1603 3300048089 Ga0495614_0118609 Ga0495614_0118609_388_897 169
1604 3300048091 Ga0495626_0073999 Ga0495626_0073999_762_1271 169
1605 3300048091 Ga0495626_0102571 Ga0495626_0102571_73_582 169
1606 3300048903 Ga0496100_0023379 Ga0496100_0023379_2776_3285 169
1607 3300048903 Ga0496100_0130639 Ga0496100_0130639_500_1009 169
1608 3300048903 Ga0496100_0336982 Ga0496100_0336982_573_1082 169
1609 3300048903 Ga0496100_1454746 Ga0496100_1454746_11_523 169
1610 3300048904 Ga0496101_0002029 Ga0496101_0002029_9936_10445 169
1611 3300048904 Ga0496101_0039687 Ga0496101_0039687_332_919 169
1612 3300048904 Ga0496101_0121862 Ga0496101_0121862_641_1150 169
1613 3300048904 Ga0496101_0417639 Ga0496101_0417639_296_805 169
1614 3300048904 Ga0496101_0512965 Ga0496101_0512965_385_894 169
1615 3300048905 Ga0496102_0016370 Ga0496102_0016370_5849_6436 169
1616 3300048905 Ga0496102_0025088 Ga0496102_0025088_172_681 169
1617 3300048905 Ga0496102_0026413 Ga0496102_0026413_2284_2793 169
1618 3300048905 Ga0496102_0075327 Ga0496102_0075327_674_1183 169
1619 3300048905 Ga0496102_0100670 Ga0496102_0100670_1435_1944 169
1620 3300048905 Ga0496102_0156264 Ga0496102_0156264_565_1074 169
1621 3300048905 Ga0496102_1512771 Ga0496102_1512771_11_520 169
1622 3300048906 Ga0496103_0002891 Ga0496103_0002891_9749_10258 169
1623 3300048906 Ga0496103_0071854 Ga0496103_0071854_627_1136 169
1624 3300048906 Ga0496103_0114074 Ga0496103_0114074_1004_1513 169
1625 3300048906 Ga0496103_0553392 Ga0496103_0553392_12_521 169
1626 3300048907 Ga0496104_0012006 Ga0496104_0012006_5766_6275 169
1627 3300048907 Ga0496104_0012848 Ga0496104_0012848_6296_6883 169
1628 3300048907 Ga0496104_0016042 Ga0496104_0016042_77_586 169
1629 3300048907 Ga0496104_0044855 Ga0496104_0044855_1955_2464 169
1630 3300048907 Ga0496104_0086467 Ga0496104_0086467_2382_2891 169
1631 3300048907 Ga0496104_0585108 Ga0496104_0585108_407_916 169
1632 3300048908 Ga0496105_0002574 Ga0496105_0002574_7687_8196 169
1633 3300048908 Ga0496105_0013684 Ga0496105_0013684_1996_2505 169
1634 3300048908 Ga0496105_0044947 Ga0496105_0044947_1934_2521 169
1635 3300048908 Ga0496105_0214836 Ga0496105_0214836_551_1060 169
1636 3300048908 Ga0496105_0538801 Ga0496105_0538801_380_889 169
1637 3300048909 Ga0496106_0007853 Ga0496106_0007853_3936_4523 169
1638 3300048909 Ga0496106_0043383 Ga0496106_0043383_2640_3149 169
1639 3300048909 Ga0496106_0048307 Ga0496106_0048307_2282_2791 169
1640 3300048909 Ga0496106_0249371 Ga0496106_0249371_367_876 169
1641 3300048909 Ga0496106_0265361 Ga0496106_0265361_96_605 169
1642 3300048909 Ga0496106_0625616 Ga0496106_0625616_284_793 169
1643 3300048909 Ga0496106_0627022 Ga0496106_0627022_26_541 169
1644 3300048909 Ga0496106_0861810 Ga0496106_0861810_102_611 169
1645 3300048910 Ga0496107_0002849 Ga0496107_0002849_3124_3633 169
1646 3300048910 Ga0496107_0016796 Ga0496107_0016796_884_1471 169
1647 3300048910 Ga0496107_0020694 Ga0496107_0020694_1808_2323 169
1648 3300048910 Ga0496107_0093459 Ga0496107_0093459_1007_1516 169
1649 3300048910 Ga0496107_0093933 Ga0496107_0093933_643_1152 169
1650 3300048910 Ga0496107_0152516 Ga0496107_0152516_710_1219 169
1651 3300048910 Ga0496107_0678959 Ga0496107_0678959_91_600 169
1652 3300048911 Ga0496108_0002506 Ga0496108_0002506_6892_7401 169
1653 3300048911 Ga0496108_0031405 Ga0496108_0031405_3801_4310 169
1654 3300048911 Ga0496108_0064547 Ga0496108_0064547_2349_2858 169
1655 3300048911 Ga0496108_0119255 Ga0496108_0119255_722_1231 169
1656 3300048911 Ga0496108_0124604 Ga0496108_0124604_181_690 169
1657 3300048911 Ga0496108_0129918 Ga0496108_0129918_44_631 169
1658 3300048911 Ga0496108_0212977 Ga0496108_0212977_412_921 169
1659 3300048911 Ga0496108_0309512 Ga0496108_0309512_659_1168 169
1660 3300048911 Ga0496108_0384174 Ga0496108_0384174_653_1162 169
1661 3300048911 Ga0496108_0624700 Ga0496108_0624700_57_566 169
1662 3300048911 Ga0496108_1252468 Ga0496108_1252468_58_567 169
1663 3300048912 Ga0496109_0001930 Ga0496109_0001930_7016_7525 169
1664 3300048912 Ga0496109_0008606 Ga0496109_0008606_1621_2208 169
1665 3300048912 Ga0496109_0020678 Ga0496109_0020678_2337_2846 169
1666 3300048912 Ga0496109_0037201 Ga0496109_0037201_3599_4108 169
1667 3300048912 Ga0496109_0074406 Ga0496109_0074406_1669_2178 169
1668 3300048912 Ga0496109_0307034 Ga0496109_0307034_742_1251 169
1669 3300048912 Ga0496109_0333559 Ga0496109_0333559_290_799 169
1670 3300048912 Ga0496109_0360515 Ga0496109_0360515_168_677 169
1671 3300048912 Ga0496109_0596255 Ga0496109_0596255_143_652 169
1672 3300048912 Ga0496109_1043130 Ga0496109_1043130_139_648 169
1673 3300048912 Ga0496109_1555631 Ga0496109_1555631_16_525 169
1674 3300048913 Ga0496110_0004950 Ga0496110_0004950_6263_6850 169
1675 3300048913 Ga0496110_0026064 Ga0496110_0026064_2703_3212 169
1676 3300048913 Ga0496110_0039460 Ga0496110_0039460_2582_3091 169
1677 3300048913 Ga0496110_0061582 Ga0496110_0061582_296_805 169
1678 3300048913 Ga0496110_0096035 Ga0496110_0096035_46_555 169
1679 3300048913 Ga0496110_0115956 Ga0496110_0115956_1746_2255 169
1680 3300048913 Ga0496110_0185379 Ga0496110_0185379_521_1030 169
1681 3300048913 Ga0496110_0354669 Ga0496110_0354669_375_884 169
1682 3300048913 Ga0496110_0431857 Ga0496110_0431857_383_892 169
1683 3300048914 Ga0496111_0002335 Ga0496111_0002335_846_1355 169
1684 3300048914 Ga0496111_0005165 Ga0496111_0005165_4200_4787 169
1685 3300048914 Ga0496111_0048193 Ga0496111_0048193_238_747 169
1686 3300048914 Ga0496111_0061767 Ga0496111_0061767_74_583 169
1687 3300048914 Ga0496111_0090103 Ga0496111_0090103_1151_1660 169
1688 3300048914 Ga0496111_0183999 Ga0496111_0183999_487_996 169
1689 3300048914 Ga0496111_0260453 Ga0496111_0260453_174_683 169
1690 3300048914 Ga0496111_0406278 Ga0496111_0406278_459_968 169
1691 3300048914 Ga0496111_0505764 Ga0496111_0505764_358_867 169
1692 3300048915 Ga0496112_0003333 Ga0496112_0003333_1693_2202 169
1693 3300048915 Ga0496112_0009853 Ga0496112_0009853_1197_1706 169
1694 3300048915 Ga0496112_0020136 Ga0496112_0020136_3070_3579 169
1695 3300048915 Ga0496112_0041239 Ga0496112_0041239_1531_2040 169
1696 3300048915 Ga0496112_0096486 Ga0496112_0096486_1002_1511 169
1697 3300048915 Ga0496112_0158986 Ga0496112_0158986_942_1451 169
1698 3300048915 Ga0496112_0236673 Ga0496112_0236673_687_1274 169
1699 3300048915 Ga0496112_0238351 Ga0496112_0238351_169_678 169
1700 3300048915 Ga0496112_0308564 Ga0496112_0308564_700_1209 169
1701 3300048915 Ga0496112_0531710 Ga0496112_0531710_138_647 169
1702 3300048915 Ga0496112_0655132 Ga0496112_0655132_214_723 169
1703 3300048915 Ga0496112_0948962 Ga0496112_0948962_252_761 169
1704 3300048915 Ga0496112_1276619 Ga0496112_1276619_119_628 169
1705 3300048915 Ga0496112_1301697 Ga0496112_1301697_117_626 169
1706 3300048916 Ga0496113_0002381 Ga0496113_0002381_4793_5302 169
1707 3300048916 Ga0496113_0004641 Ga0496113_0004641_1153_1662 169
1708 3300048916 Ga0496113_0017232 Ga0496113_0017232_512_1021 169
1709 3300048916 Ga0496113_0035302 Ga0496113_0035302_1271_1780 169
1710 3300048916 Ga0496113_0037933 Ga0496113_0037933_872_1381 169
1711 3300048916 Ga0496113_0046770 Ga0496113_0046770_75_662 169
1712 3300048916 Ga0496113_1330883 Ga0496113_1330883_12_521 169
1713 3300048917 Ga0496114_0016637 Ga0496114_0016637_2624_3211 169
1714 3300048917 Ga0496114_0025242 Ga0496114_0025242_3103_3612 169
1715 3300048917 Ga0496114_0030400 Ga0496114_0030400_1388_1897 169
1716 3300048917 Ga0496114_0069020 Ga0496114_0069020_1728_2237 169
1717 3300048917 Ga0496114_0312227 Ga0496114_0312227_97_606 169
1718 3300048917 Ga0496114_0550245 Ga0496114_0550245_353_862 169
1719 3300048917 Ga0496114_0829879 Ga0496114_0829879_58_567 169
1720 3300048917 Ga0496114_0951281 Ga0496114_0951281_147_656 169
1721 3300048917 Ga0496114_1096659 Ga0496114_1096659_40_549 169
1722 3300048918 Ga0496115_0000678 Ga0496115_0000678_5249_5836 169
1723 3300048918 Ga0496115_0011449 Ga0496115_0011449_1654_2163 169
1724 3300048918 Ga0496115_0071870 Ga0496115_0071870_2112_2621 169
1725 3300048918 Ga0496115_0108808 Ga0496115_0108808_522_1031 169
1726 3300048918 Ga0496115_0204634 Ga0496115_0204634_974_1483 169
1727 3300048918 Ga0496115_0283083 Ga0496115_0283083_73_582 169
1728 3300048918 Ga0496115_0293935 Ga0496115_0293935_72_581 169
1729 3300048918 Ga0496115_0489454 Ga0496115_0489454_460_969 169
1730 3300048918 Ga0496115_0505963 Ga0496115_0505963_49_558 169
1731 3300048919 Ga0496116_0019342 Ga0496116_0019342_2982_3491 169
1732 3300048920 Ga0496117_0022442 Ga0496117_0022442_622_1131 169
1733 3300048920 Ga0496117_0189973 Ga0496117_0189973_378_890 169
1734 3300048921 Ga0496118_0042240 Ga0496118_0042240_2921_3430 169
1735 3300048921 Ga0496118_0053940 Ga0496118_0053940_652_1161 169
1736 3300048921 Ga0496118_0054212 Ga0496118_0054212_2286_2798 169
1737 3300048921 Ga0496118_0085018 Ga0496118_0085018_113_622 169
1738 3300048921 Ga0496118_0273721 Ga0496118_0273721_261_770 169
1739 3300048921 Ga0496118_0355882 Ga0496118_0355882_100_612 169
1740 3300048922 Ga0496119_0194163 Ga0496119_0194163_341_853 169
1741 3300048922 Ga0496119_0209548 Ga0496119_0209548_448_957 169
1742 3300048923 Ga0496120_0044083 Ga0496120_0044083_1031_1540 169
1743 3300048923 Ga0496120_0059002 Ga0496120_0059002_150_659 169
1744 3300048924 Ga0496121_0001737 Ga0496121_0001737_27375_27884 169
1745 3300048924 Ga0496121_0004082 Ga0496121_0004082_14654_15163 169
1746 3300048924 Ga0496121_0020275 Ga0496121_0020275_3684_4193 169
1747 3300048924 Ga0496121_0021375 Ga0496121_0021375_364_873 169
1748 3300048924 Ga0496121_0080102 Ga0496121_0080102_1726_2238 169
1749 3300048924 Ga0496121_0101848 Ga0496121_0101848_189_698 169
1750 3300048924 Ga0496121_0143243 Ga0496121_0143243_250_789 169
1751 3300048924 Ga0496121_0221473 Ga0496121_0221473_497_1006 169
1752 3300048924 Ga0496121_0314357 Ga0496121_0314357_147_656 169
1753 3300048925 Ga0496122_0103441 Ga0496122_0103441_1323_1832 169
1754 3300048925 Ga0496122_0129577 Ga0496122_0129577_19_528 169
1755 3300048926 Ga0496123_0058054 Ga0496123_0058054_1487_1996 169
1756 3300048926 Ga0496123_0082904 Ga0496123_0082904_1285_1794 169
1757 3300048926 Ga0496123_0195655 Ga0496123_0195655_34_543 169
1758 3300048927 Ga0496124_0043136 Ga0496124_0043136_2290_2799 169
1759 3300048927 Ga0496124_0073787 Ga0496124_0073787_1434_1943 169
1760 3300048927 Ga0496124_0132977 Ga0496124_0132977_409_918 169
1761 3300048927 Ga0496124_0473799 Ga0496124_0473799_82_591 169
1762 3300048927 Ga0496124_0751224 Ga0496124_0751224_84_593 169
1763 3300048928 Ga0496125_0000048 Ga0496125_0000048_85990_86523 169
1764 3300048928 Ga0496125_0000664 Ga0496125_0000664_34134_34643 169
1765 3300048928 Ga0496125_0004229 Ga0496125_0004229_5636_6145 169
1766 3300048928 Ga0496125_0010930 Ga0496125_0010930_5636_6145 169
1767 3300048928 Ga0496125_0095036 Ga0496125_0095036_142_651 169
1768 3300048928 Ga0496125_0244647 Ga0496125_0244647_561_1073 169
1769 3300048928 Ga0496125_0263575 Ga0496125_0263575_38_547 169
1770 3300048928 Ga0496125_0316782 Ga0496125_0316782_385_894 169
1771 3300048929 Ga0496126_0008798 Ga0496126_0008798_5168_5677 169
1772 3300048929 Ga0496126_0016848 Ga0496126_0016848_6308_6817 169
1773 3300048929 Ga0496126_0028615 Ga0496126_0028615_2003_2512 169
1774 3300048929 Ga0496126_0052900 Ga0496126_0052900_1707_2216 169
1775 3300048929 Ga0496126_0066347 Ga0496126_0066347_14_523 169
1776 3300048929 Ga0496126_0076270 Ga0496126_0076270_202_711 169
1777 3300048929 Ga0496126_0096059 Ga0496126_0096059_282_791 169
1778 3300048929 Ga0496126_0137511 Ga0496126_0137511_457_966 169
1779 3300048929 Ga0496126_0170955 Ga0496126_0170955_258_767 169
1780 3300048929 Ga0496126_0256629 Ga0496126_0256629_559_1068 169
1781 3300048929 Ga0496126_0285729 Ga0496126_0285729_808_1317 169
1782 3300048929 Ga0496126_0391049 Ga0496126_0391049_399_908 169
1783 3300048929 Ga0496126_0591168 Ga0496126_0591168_353_862 169
1784 3300048929 Ga0496126_0622728 Ga0496126_0622728_115_624 169
1785 3300048929 Ga0496126_0695803 Ga0496126_0695803_251_760 169
1786 3300048929 Ga0496126_0782821 Ga0496126_0782821_159_668 169
1787 3300049460 Ga0495682_0061301 Ga0495682_0061301_12_521 169
1788 3300049460 Ga0495682_0207599 Ga0495682_0207599_125_634 169
1789 3300049568 Ga0501031_0034074 Ga0501031_0034074_2438_2947 169
1790 3300049568 Ga0501031_0035611 Ga0501031_0035611_1924_2433 169
1791 3300049568 Ga0501031_0096396 Ga0501031_0096396_1132_1641 169
1792 3300049569 Ga0501032_0091257 Ga0501032_0091257_118_627 169
1793 3300049569 Ga0501032_0142072 Ga0501032_0142072_384_893 169
1794 3300049569 Ga0501032_0593493 Ga0501032_0593493_51_560 169
1795 3300049570 Ga0501033_0033855 Ga0501033_0033855_840_1349 169
1796 3300049570 Ga0501033_0037107 Ga0501033_0037107_1424_1933 169
1797 3300049570 Ga0501033_0173892 Ga0501033_0173892_926_1435 169
1798 3300049570 Ga0501033_0214615 Ga0501033_0214615_83_592 169
1799 3300049570 Ga0501033_0432333 Ga0501033_0432333_68_577 169
1800 3300049571 Ga0501034_0091435 Ga0501034_0091435_2487_2996 169
1801 3300049571 Ga0501034_0266782 Ga0501034_0266782_682_1191 169
1802 3300049571 Ga0501034_0291987 Ga0501034_0291987_911_1429 169
1803 3300049572 Ga0501036_0033224 Ga0501036_0033224_1367_1876 169
1804 3300049572 Ga0501036_0067529 Ga0501036_0067529_2021_2530 169
1805 3300049572 Ga0501036_0086049 Ga0501036_0086049_1415_1924 169
1806 3300049573 Ga0501037_0050675 Ga0501037_0050675_2484_2993 169
1807 3300049573 Ga0501037_0104279 Ga0501037_0104279_583_1092 169
1808 3300049573 Ga0501037_0106139 Ga0501037_0106139_484_993 169
1809 3300049573 Ga0501037_0434510 Ga0501037_0434510_63_572 169
1810 3300049574 Ga0501038_0014226 Ga0501038_0014226_5320_5829 169
1811 3300049574 Ga0501038_0023623 Ga0501038_0023623_2607_3116 169
1812 3300049574 Ga0501038_0048160 Ga0501038_0048160_2487_2996 169
1813 3300049574 Ga0501038_0193917 Ga0501038_0193917_858_1367 169
1814 3300049574 Ga0501038_0343307 Ga0501038_0343307_183_692 169
1815 3300049574 Ga0501038_0515017 Ga0501038_0515017_256_765 169
1816 3300049574 Ga0501038_0901036 Ga0501038_0901036_22_531 169
1817 3300049575 Ga0501039_0034171 Ga0501039_0034171_2573_3082 169
1818 3300049575 Ga0501039_0160181 Ga0501039_0160181_10_519 169
1819 3300049575 Ga0501039_0196455 Ga0501039_0196455_1062_1571 169
1820 3300049575 Ga0501039_0259544 Ga0501039_0259544_586_1095 169
1821 3300049575 Ga0501039_1213587 Ga0501039_1213587_30_539 169
1822 3300049576 Ga0501040_0014186 Ga0501040_0014186_2438_2947 169
1823 3300049576 Ga0501040_0270245 Ga0501040_0270245_592_1101 169
1824 3300049577 Ga0501041_0307220 Ga0501041_0307220_407_916 169
1825 3300049578 Ga0501042_0300512 Ga0501042_0300512_390_899 169
1826 3300049579 Ga0501043_0045141 Ga0501043_0045141_2484_2993 169
1827 3300049579 Ga0501043_0215125 Ga0501043_0215125_815_1324 169
1828 3300049580 Ga0501046_0176043 Ga0501046_0176043_255_764 169
1829 3300049580 Ga0501046_0365556 Ga0501046_0365556_153_668 169
1830 3300049581 Ga0501047_0071967 Ga0501047_0071967_1183_1692 169
1831 3300049581 Ga0501047_0228029 Ga0501047_0228029_1009_1518 169
1832 3300049581 Ga0501047_0235152 Ga0501047_0235152_636_1145 169
1833 3300049581 Ga0501047_0264664 Ga0501047_0264664_635_1144 169
1834 3300049581 Ga0501047_0313322 Ga0501047_0313322_678_1208 169
1835 3300049581 Ga0501047_0441179 Ga0501047_0441179_559_1068 169
1836 3300049581 Ga0501047_0657749 Ga0501047_0657749_329_838 169
1837 3300049583 Ga0501067_0046310 Ga0501067_0046310_630_1139 169
1838 3300049583 Ga0501067_0046367 Ga0501067_0046367_386_895 169
1839 3300049583 Ga0501067_0165724 Ga0501067_0165724_319_828 169
1840 3300049585 Ga0501069_0499267 Ga0501069_0499267_134_643 169
1841 3300049586 Ga0501070_0217086 Ga0501070_0217086_202_711 169
1842 3300049586 Ga0501070_0649752 Ga0501070_0649752_263_772 169
1843 3300049586 Ga0501070_1135687 Ga0501070_1135687_48_557 169
1844 3300049587 Ga0501071_0151813 Ga0501071_0151813_121_630 169
1845 3300049587 Ga0501071_0185148 Ga0501071_0185148_838_1347 169
1846 3300049588 Ga0501072_0038043 Ga0501072_0038043_2514_3023 169
1847 3300049588 Ga0501072_0153039 Ga0501072_0153039_798_1307 169
1848 3300049589 Ga0501073_0292652 Ga0501073_0292652_308_817 169
1849 3300049589 Ga0501073_0918759 Ga0501073_0918759_26_535 169
1850 3300049590 Ga0501074_0090925 Ga0501074_0090925_328_837 169
1851 3300049590 Ga0501074_0745900 Ga0501074_0745900_90_599 169
1852 3300049591 Ga0501075_0099622 Ga0501075_0099622_409_918 169
1853 3300049591 Ga0501075_0528928 Ga0501075_0528928_58_567 169
1854 3300049591 Ga0501075_0702167 Ga0501075_0702167_137_646 169
1855 3300049592 Ga0501076_0034170 Ga0501076_0034170_1415_1924 169
1856 3300049592 Ga0501076_0591218 Ga0501076_0591218_235_744 169
1857 3300049592 Ga0501076_0790205 Ga0501076_0790205_236_745 169
1858 3300049741 Ga0501079_0019561 Ga0501079_0019561_3067_3576 169
1859 3300049741 Ga0501079_0071225 Ga0501079_0071225_693_1202 169
1860 3300049741 Ga0501079_0187441 Ga0501079_0187441_701_1210 169
1861 3300049742 Ga0501080_0140111 Ga0501080_0140111_653_1162 169
1862 3300049742 Ga0501080_0168264 Ga0501080_0168264_29_538 169
1863 3300049742 Ga0501080_0190909 Ga0501080_0190909_927_1436 169
1864 3300049742 Ga0501080_0296293 Ga0501080_0296293_24_533 169
1865 3300049743 Ga0501081_0469661 Ga0501081_0469661_42_551 169
1866 3300049744 Ga0501083_0357937 Ga0501083_0357937_236_745 169
1867 3300049822 Ga0501035_0166288 Ga0501035_0166288_1220_1729 169
1868 3300049822 Ga0501035_0736981 Ga0501035_0736981_273_782 169
1869 3300049823 Ga0501044_0012346 Ga0501044_0012346_3135_3644 169
1870 3300049823 Ga0501044_0076306 Ga0501044_0076306_1626_2135 169
1871 3300049823 Ga0501044_0087376 Ga0501044_0087376_1909_2418 169
1872 3300049823 Ga0501044_0136502 Ga0501044_0136502_1396_1926 169
1873 3300049823 Ga0501044_0305261 Ga0501044_0305261_51_560 169
1874 3300049823 Ga0501044_0701526 Ga0501044_0701526_335_844 169
1875 3300049823 Ga0501044_0881492 Ga0501044_0881492_179_688 169
1876 3300049824 Ga0501045_0385969 Ga0501045_0385969_153_662 169
1877 3300049824 Ga0501045_0700586 Ga0501045_0700586_137_646 169
1878 3300050489 nmdc:mga03683_105564_c1 nmdc:mga03683_105564_c1_336_845 169
1879 3300050489 nmdc:mga03683_506098_c1 nmdc:mga03683_506098_c1_62_571 169
1880 3300050490 nmdc:mga03n38_3011_c1 nmdc:mga03n38_3011_c1_4525_5034 169
1881 3300050490 nmdc:mga03n38_408527_c1 nmdc:mga03n38_408527_c1_171_680 169
1882 3300050490 nmdc:mga03n38_414576_c1 nmdc:mga03n38_414576_c1_34_543 169
1883 3300050490 nmdc:mga03n38_425522_c1 nmdc:mga03n38_425522_c1_34_549 169
1884 3300050490 nmdc:mga03n38_684328_c1 nmdc:mga03n38_684328_c1_13_522 169
1885 3300050491 nmdc:mga00v17_203844_c1 nmdc:mga00v17_203844_c1_725_1234 169
1886 3300050491 nmdc:mga00v17_723519_c1 nmdc:mga00v17_723519_c1_34_543 169
1887 3300050491 nmdc:mga00v17_77901_c1 nmdc:mga00v17_77901_c1_1494_2003 169
1888 3300050492 nmdc:mga0yw44_134093_c1 nmdc:mga0yw44_134093_c1_269_778 169
1889 3300050492 nmdc:mga0yw44_1376_c1 nmdc:mga0yw44_1376_c1_8115_8624 169
1890 3300050492 nmdc:mga0yw44_175558_c1 nmdc:mga0yw44_175558_c1_794_1303 169
1891 3300050492 nmdc:mga0yw44_479465_c1 nmdc:mga0yw44_479465_c1_53_562 169
1892 3300050492 nmdc:mga0yw44_599966_c1 nmdc:mga0yw44_599966_c1_50_559 169
1893 3300050492 nmdc:mga0yw44_645621_c1 nmdc:mga0yw44_645621_c1_47_556 169
1894 3300050493 nmdc:mga0k408_288905_c1 nmdc:mga0k408_288905_c1_393_902 169
1895 3300050494 nmdc:mga06z11_311935_c1 nmdc:mga06z11_311935_c1_283_792 169
1896 3300050494 nmdc:mga06z11_368544_c1 nmdc:mga06z11_368544_c1_108_617 169
1897 3300050494 nmdc:mga06z11_711524_c1 nmdc:mga06z11_711524_c1_84_593 169
1898 3300050494 nmdc:mga06z11_77102_c1 nmdc:mga06z11_77102_c1_383_892 169
1899 3300050495 nmdc:mga04h51_154029_c1 nmdc:mga04h51_154029_c1_128_637 169
1900 3300050495 nmdc:mga04h51_162212_c1 nmdc:mga04h51_162212_c1_297_806 169
1901 3300050495 nmdc:mga04h51_64144_c1 nmdc:mga04h51_64144_c1_404_913 169
1902 3300050496 nmdc:mga07m45_122065_c1 nmdc:mga07m45_122065_c1_906_1415 169
1903 3300050496 nmdc:mga07m45_256424_c1 nmdc:mga07m45_256424_c1_333_842 169
1904 3300050496 nmdc:mga07m45_319044_c1 nmdc:mga07m45_319044_c1_110_619 169
1905 3300050496 nmdc:mga07m45_373061_c1 nmdc:mga07m45_373061_c1_252_761 169
1906 3300050496 nmdc:mga07m45_49166_c1 nmdc:mga07m45_49166_c1_564_1073 169
1907 3300050507 nmdc:mga05p37_182526_c1 nmdc:mga05p37_182526_c1_298_807 169
1908 3300050507 nmdc:mga05p37_3470_c1 nmdc:mga05p37_3470_c1_3015_3524 169
1909 3300050508 nmdc:mga09592_2434_c1 nmdc:mga09592_2434_c1_8920_9429 169
1910 3300050509 nmdc:mga0qj67_253580_c1 nmdc:mga0qj67_253580_c1_91_606 169
1911 3300050509 nmdc:mga0qj67_7467_c1 nmdc:mga0qj67_7467_c1_5278_5787 169
1912 3300050510 nmdc:mga06r32_1530_c1 nmdc:mga06r32_1530_c1_7887_8396 169
1913 3300050511 nmdc:mga08y16_1107_c1 nmdc:mga08y16_1107_c1_11014_11523 169
1914 3300050511 nmdc:mga08y16_1244482_c1 nmdc:mga08y16_1244482_c1_172_681 169
1915 3300050511 nmdc:mga08y16_1553864_c1 nmdc:mga08y16_1553864_c1_11_520 169
1916 3300050511 nmdc:mga08y16_342236_c1 nmdc:mga08y16_342236_c1_759_1268 169
1917 3300050511 nmdc:mga08y16_401420_c1 nmdc:mga08y16_401420_c1_831_1340 169
1918 3300050512 nmdc:mga0n895_467916_c1 nmdc:mga0n895_467916_c1_540_1049 169
1919 3300050512 nmdc:mga0n895_49365_c1 nmdc:mga0n895_49365_c1_1387_1896 169
1920 3300050512 nmdc:mga0n895_610499_c1 nmdc:mga0n895_610499_c1_295_804 169
1921 3300050512 nmdc:mga0n895_655478_c1 nmdc:mga0n895_655478_c1_161_670 169
1922 3300050513 nmdc:mga0rr50_433125_c1 nmdc:mga0rr50_433125_c1_589_1098 169
1923 3300050514 nmdc:mga08x19_94088_c1 nmdc:mga08x19_94088_c1_1440_1949 169
1924 3300050515 nmdc:mga0a205_1080261_c1 nmdc:mga0a205_1080261_c1_68_577 169
1925 3300050515 nmdc:mga0a205_450863_c1 nmdc:mga0a205_450863_c1_206_715 169
1926 3300050516 nmdc:mga0sz30_265680_c1 nmdc:mga0sz30_265680_c1_40_576 169
1927 3300050516 nmdc:mga0sz30_291977_c1 nmdc:mga0sz30_291977_c1_122_631 169
1928 3300050516 nmdc:mga0sz30_67954_c1 nmdc:mga0sz30_67954_c1_22_531 169
1929 3300053077 Ga0495601_0001796 Ga0495601_0001796_6569_7078 169
1930 3300053077 Ga0495601_0026292 Ga0495601_0026292_2048_2557 169
1931 3300053077 Ga0495601_0042688 Ga0495601_0042688_12_521 169
1932 3300053077 Ga0495601_0215099 Ga0495601_0215099_627_1136 169
1933 3300053077 Ga0495601_0379431 Ga0495601_0379431_302_811 169
1934 3300053078 Ga0495612_0026334 Ga0495612_0026334_169_678 169
1935 3300053078 Ga0495612_0033689 Ga0495612_0033689_64_573 169
1936 3300053078 Ga0495612_0152096 Ga0495612_0152096_301_810 169
1937 3300053078 Ga0495612_0304689 Ga0495612_0304689_111_620 169
1938 3300053079 Ga0500610_0098484 Ga0500610_0098484_970_1479 169
1939 3300053080 Ga0500635_0001224 Ga0500635_0001224_1910_2419 169
1940 3300053080 Ga0500635_0048836 Ga0500635_0048836_855_1364 169
1941 3300053083 Ga0495655_0064142 Ga0495655_0064142_398_907 169
1942 3300053083 Ga0495655_0217183 Ga0495655_0217183_43_552 169
1943 3300053084 Ga0495595_0009387 Ga0495595_0009387_3238_3747 169
1944 3300053084 Ga0495595_0011803 Ga0495595_0011803_2123_2632 169
1945 3300053084 Ga0495595_0073773 Ga0495595_0073773_926_1435 169
1946 3300053084 Ga0495595_0103224 Ga0495595_0103224_783_1292 169
1947 3300053084 Ga0495595_0104997 Ga0495595_0104997_510_1019 169
1948 3300053084 Ga0495595_0244293 Ga0495595_0244293_20_529 169
1949 3300053085 Ga0495619_0000063 Ga0495619_0000063_78113_78622 169
1950 3300053085 Ga0495619_0001425 Ga0495619_0001425_8408_8917 169
1951 3300053085 Ga0495619_0010141 Ga0495619_0010141_513_1022 169
1952 3300053085 Ga0495619_0025400 Ga0495619_0025400_641_1150 169
1953 3300053085 Ga0495619_0274898 Ga0495619_0274898_319_828 169
1954 3300053085 Ga0495619_0509467 Ga0495619_0509467_258_767 169
1955 3300053085 Ga0495619_0711338 Ga0495619_0711338_96_605 169
1956 3300053087 Ga0500643_047491 Ga0500643_047491_246_782 169
1957 3300053089 Ga0500581_049019 Ga0500581_049019_182_691 169
1958 3300053092 Ga0500583_0138299 Ga0500583_0138299_477_1013 169
1959 3300053094 Ga0500566_0003557 Ga0500566_0003557_706_1215 169
1960 3300053094 Ga0500566_0006997 Ga0500566_0006997_3347_3856 169
1961 3300053094 Ga0500566_0056551 Ga0500566_0056551_536_1045 169
1962 3300053096 Ga0500641_0007969 Ga0500641_0007969_1137_1646 169
1963 3300053096 Ga0500641_0012173 Ga0500641_0012173_701_1210 169
1964 3300053096 Ga0500641_0012528 Ga0500641_0012528_2556_3065 169
1965 3300053098 Ga0500650_0020682 Ga0500650_0020682_601_1110 169
1966 3300053098 Ga0500650_0326948 Ga0500650_0326948_141_650 169
1967 3300053102 Ga0500554_001467 Ga0500554_001467_176_685 169
1968 3300053108 Ga0500562_019172 Ga0500562_019172_927_1436 169
1969 3300053109 Ga0500569_063269 Ga0500569_063269_135_644 169
1970 3300053115 Ga0500591_078003 Ga0500591_078003_141_650 169
1971 3300053117 Ga0500593_040849 Ga0500593_040849_753_1262 169
1972 3300053119 Ga0500595_000484 Ga0500595_000484_7110_7619 169
1973 3300053119 Ga0500595_011036 Ga0500595_011036_1754_2263 169
1974 3300053119 Ga0500595_012586 Ga0500595_012586_2657_3166 169
1975 3300053119 Ga0500595_017127 Ga0500595_017127_1728_2237 169
1976 3300053119 Ga0500595_019976 Ga0500595_019976_10_519 169
1977 3300053119 Ga0500595_048589 Ga0500595_048589_582_1091 169
1978 3300053122 Ga0500608_004187 Ga0500608_004187_2437_2946 169
1979 3300053122 Ga0500608_126502 Ga0500608_126502_483_992 169
1980 3300053123 Ga0500614_011114 Ga0500614_011114_1386_1895 169
1981 3300053130 Ga0500642_0000055 Ga0500642_0000055_22643_23152 169
1982 3300053130 Ga0500642_0054088 Ga0500642_0054088_486_995 169
1983 3300053131 Ga0500652_021843 Ga0500652_021843_148_657 169
1984 3300053133 Ga0500655_016830 Ga0500655_016830_122_631 169
1985 3300053134 Ga0500658_0093341 Ga0500658_0093341_11_520 169
1986 3300053136 Ga0500559_0000250 Ga0500559_0000250_38917_39426 169
1987 3300053136 Ga0500559_0000268 Ga0500559_0000268_34514_35023 169
1988 3300053136 Ga0500559_0282531 Ga0500559_0282531_225_734 169
1989 3300053142 Ga0500577_0023346 Ga0500577_0023346_239_775 169
1990 3300053145 Ga0500586_005181 Ga0500586_005181_397_906 169
1991 3300053148 Ga0500590_021617 Ga0500590_021617_2326_2835 169
1992 3300053148 Ga0500590_043672 Ga0500590_043672_1255_1764 169
1993 3300053150 Ga0500603_000552 Ga0500603_000552_6180_6689 169
1994 3300053150 Ga0500603_005247 Ga0500603_005247_1468_1977 169
1995 3300053153 Ga0500616_0000035 Ga0500616_0000035_208327_208836 169
1996 3300053156 Ga0500622_0003126 Ga0500622_0003126_4498_5007 169
1997 3300053156 Ga0500622_0096822 Ga0500622_0096822_421_930 169
1998 3300053158 Ga0500627_0051431 Ga0500627_0051431_375_884 169
1999 3300053158 Ga0500627_0083350 Ga0500627_0083350_529_1038 169
2000 3300053159 Ga0500630_102307 Ga0500630_102307_442_951 169
2001 3300053160 Ga0500633_0017896 Ga0500633_0017896_317_826 169
2002 3300053161 Ga0500634_0100273 Ga0500634_0100273_882_1391 169
2003 3300053162 Ga0500638_067288 Ga0500638_067288_319_828 169
2004 3300053163 Ga0500639_004632 Ga0500639_004632_12_521 169
2005 3300053177 Ga0500636_0010367 Ga0500636_0010367_147_656 169
2006 3300053177 Ga0500636_0011244 Ga0500636_0011244_3342_3851 169
2007 3300053177 Ga0500636_0015519 Ga0500636_0015519_1123_1632 169
2008 3300053177 Ga0500636_0079981 Ga0500636_0079981_207_716 169
2009 3300053177 Ga0500636_0154177 Ga0500636_0154177_292_801 169
2010 3300053178 Ga0500637_0000027 Ga0500637_0000027_36475_36984 169
2011 3300053178 Ga0500637_0000645 Ga0500637_0000645_5068_5577 169
2012 3300053178 Ga0500637_0022697 Ga0500637_0022697_1914_2423 169
2013 3300053178 Ga0500637_0507412 Ga0500637_0507412_37_546 169
2014 3300053724 Ga0500570_077411 Ga0500570_077411_850_1359 169
2015 3300053730 Ga0500645_024026 Ga0500645_024026_777_1286 169
2016 3300053731 Ga0500609_044172 Ga0500609_044172_15_524 169
2017 3300053735 Ga0500596_006754 Ga0500596_006754_877_1386 169
2018 3300053735 Ga0500596_024696 Ga0500596_024696_300_809 169
2019 3300054114 Ga0501084_0109959 Ga0501084_0109959_1015_1524 169
2020 3300054114 Ga0501084_0170115 Ga0501084_0170115_681_1190 169
2021 3300054114 Ga0501084_0643463 Ga0501084_0643463_34_543 169
2022 3300055283 Ga0500661_000569 Ga0500661_000569_4843_5352 169
2023 3300060353 Ga0501082_0192587 Ga0501082_0192587_1032_1541 169
2024 3300060353 Ga0501082_1009349 Ga0501082_1009349_206_715 169
2025 3300061719 Ga0466962_0227454 Ga0466962_0227454_370_885 169
2026 3300061734 Ga0530510_0451091 Ga0530510_0451091_429_938 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

86

191

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8246 54 166
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.8142 64 168
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.8083 64 168
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8073 64 167
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.7782 61 168
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9001 69 168 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8626 68 168 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8517 68 168 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8433 69 168 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8387 70 168 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A4Q7V1L0-F1-model_v4 Putative OsmC-like protein 0.9666 1 161
AF-A0A440JM30-F1-model_v4 deleted 0.9649 50 161
AF-A0A7W0NGL8-F1-model_v4 deleted 0.9617 3 161
AF-A0A0D1XLZ8-F1-model_v4 OsmC-like protein 0.9607 1 160
AF-A0A7W0U1P8-F1-model_v4 OsmC family protein 0.9599 1 161

Feature Viewer

pLDDT pTM Quality
94.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map