F496279

General Info

Members Datasets Scaffolds Average Seq Length
2025 552 4050 120

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1025569|JGI24746J21847_10255692
Length 123
Sequence MNFDIKTEELANGAYVIALTGEVDLYTAPEFKQQLLEVEVIGQGAKEVVVDFSDTTFIDSTTLGVLVGGVKRLRPNGGRLSLVCNDRNITKIFEITGLNKVFPIYESRAEAVESVGQEAQAQT

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
133 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
134 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
156 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
163 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
164 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
240 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
267 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
268 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
269 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
270 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
284 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
285 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
288 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
289 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
290 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
291 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
292 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
294 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
297 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
307 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
313 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
314 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
315 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
316 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
317 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
318 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
319 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
320 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
321 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
322 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
323 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
324 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
325 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
326 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
327 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
328 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
329 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
330 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
331 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
332 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
353 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
354 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
355 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
356 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
357 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
358 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
369 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
370 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
371 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
378 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
379 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
380 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
381 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
382 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
383 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
384 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
385 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
386 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
387 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
388 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
389 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
392 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
393 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
394 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
395 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
396 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
397 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
398 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
405 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
406 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
407 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
408 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
409 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
410 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
411 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
412 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
413 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
423 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
424 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
425 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
426 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
427 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
430 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
441 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
448 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
449 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
450 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
468 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
469 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
470 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
471 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
472 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
473 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
474 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
475 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
476 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
477 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
478 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
479 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
480 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
481 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
482 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
483 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
484 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
485 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
486 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
487 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
488 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
489 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
490 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
495 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
496 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
497 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
508 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
509 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
510 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
511 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
512 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
513 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
514 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
515 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
516 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
547 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
551 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
552 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.58
Metatranscriptomes 6.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 7.56
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 19.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1025569 3300001977 Bacteria 817
2 ARcpr5oldR_c027731 3300000041 Unclassified 525
3 CNBas_1006135 3300000531 Bacteria 692
4 LJQas_1020834 3300000549 Bacteria 762
5 JGI24743J22301_10071213 3300001991 Unclassified 726
6 JGI24750J21931_1051334 3300002070 Bacteria 644
7 JGI24749J21850_1020376 3300002076 Unclassified 936
8 JGI24744J21845_10000270 3300002077 Bacteria 8479
9 JGI24034J26672_10095216 3300002239 Unclassified 556
10 JGI24742J22300_10090598 3300002244 Unclassified 584
11 JGI24751J29686_10093803 3300002459 Unclassified 625
12 JGI25407J50210_10000043 3300003373 Bacteria 14036
13 JGI25407J50210_10003008 3300003373 Bacteria 4027
14 JGI25407J50210_10006055 3300003373 Bacteria 2998
15 JGI25407J50210_10021102 3300003373 Bacteria 1694
16 JGI25407J50210_10022167 3300003373 Bacteria 1651
17 JGI25407J50210_10046390 3300003373 Unclassified 1106
18 JGI25407J50210_10127885 3300003373 Bacteria 625
19 JGI25407J50210_10130891 3300003373 Bacteria 618
20 JGI25407J50210_10168277 3300003373 Bacteria 540
21 Ga0058863_10044069 3300004799 Bacteria 1059
22 Ga0058863_11737441 3300004799 Bacteria 564
23 Ga0058863_11784839 3300004799 Bacteria 1916
24 Ga0058861_10053199 3300004800 Bacteria 554
25 Ga0058861_11902183 3300004800 Bacteria 1615
26 Ga0058861_11963800 3300004800 Bacteria 912
27 Ga0058861_11993075 3300004800 Bacteria 949
28 Ga0058861_12004511 3300004800 Bacteria 542
29 Ga0058860_12242813 3300004801 Unclassified 582
30 Ga0058862_10018425 3300004803 Bacteria 909
31 Ga0058862_12721611 3300004803 Bacteria 1861
32 Ga0058862_12775560 3300004803 Bacteria 1663
33 Ga0070658_10054807 3300005327 Bacteria 3237
34 Ga0070658_10095618 3300005327 Bacteria 2452
35 Ga0070658_10202218 3300005327 Bacteria 1676
36 Ga0070658_10252336 3300005327 Unclassified 1497
37 Ga0070658_10672640 3300005327 Bacteria 898
38 Ga0070676_10191228 3300005328 Bacteria 1336
39 Ga0070676_10389742 3300005328 Bacteria 967
40 Ga0070676_10558129 3300005328 Bacteria 821
41 Ga0070683_100003875 3300005329 Bacteria 12235
42 Ga0070683_100004942 3300005329 Bacteria 11056
43 Ga0070683_100015367 3300005329 Bacteria 6722
44 Ga0070683_100015562 3300005329 Bacteria 6685
45 Ga0070683_100025417 3300005329 Bacteria 5319
46 Ga0070683_100032284 3300005329 Bacteria 4768
47 Ga0070683_100077333 3300005329 Unclassified 3112
48 Ga0070683_100124300 3300005329 Bacteria 2438
49 Ga0070683_100291562 3300005329 Unclassified 1552
50 Ga0070683_100411015 3300005329 Bacteria 1291
51 Ga0070683_100634372 3300005329 Bacteria 1023
52 Ga0070683_101046941 3300005329 Unclassified 784
53 Ga0070670_100100103 3300005331 Bacteria 2495
54 Ga0068869_100116112 3300005334 Bacteria 2042
55 Ga0068869_100348491 3300005334 Unclassified 1207
56 Ga0068869_100482914 3300005334 Bacteria 1032
57 Ga0068869_101072642 3300005334 Bacteria 704
58 Ga0068869_101131859 3300005334 Unclassified 686
59 Ga0070680_100003134 3300005336 Bacteria 12287
60 Ga0070680_100003591 3300005336 Bacteria 11582
61 Ga0070680_100016764 3300005336 Bacteria 5765
62 Ga0070680_100018725 3300005336 Bacteria 5478
63 Ga0070680_100237959 3300005336 Unclassified 1538
64 Ga0070680_100363144 3300005336 Unclassified 1232
65 Ga0070682_100007166 3300005337 Bacteria 6281
66 Ga0070682_100014648 3300005337 Bacteria 4534
67 Ga0070682_100093804 3300005337 Bacteria 1968
68 Ga0070682_100605447 3300005337 Unclassified 866
69 Ga0070682_100832095 3300005337 Bacteria 753
70 Ga0068868_100029713 3300005338 Bacteria 4187
71 Ga0068868_100472709 3300005338 Unclassified 1094
72 Ga0068868_100719330 3300005338 Unclassified 895
73 Ga0070660_100001983 3300005339 Bacteria 14122
74 Ga0070660_100014687 3300005339 Bacteria 5650
75 Ga0070660_100018912 3300005339 Bacteria 5043
76 Ga0070660_100020348 3300005339 Bacteria 4876
77 Ga0070660_100143962 3300005339 Bacteria 1914
78 Ga0070660_100152947 3300005339 Unclassified 1856
79 Ga0070660_100638019 3300005339 Bacteria 892
80 Ga0070689_100012172 3300005340 Bacteria 6188
81 Ga0070689_100084769 3300005340 Bacteria 2491
82 Ga0070691_10013505 3300005341 Bacteria 3741
83 Ga0070691_10035242 3300005341 Bacteria 2356
84 Ga0070691_10170363 3300005341 Bacteria 1128
85 Ga0070687_100629844 3300005343 Bacteria 741
86 Ga0070687_100715936 3300005343 Bacteria 701
87 Ga0070661_100004275 3300005344 Bacteria 9850
88 Ga0070661_100059829 3300005344 Bacteria 2795
89 Ga0070661_100495188 3300005344 Bacteria 978
90 Ga0070661_100577518 3300005344 Unclassified 907
91 Ga0070661_100593087 3300005344 Unclassified 895
92 Ga0070661_100896747 3300005344 Unclassified 732
93 Ga0070692_10295024 3300005345 Bacteria 988
94 Ga0070692_10314616 3300005345 Unclassified 960
95 Ga0070692_10582475 3300005345 Bacteria 738
96 Ga0070668_100009147 3300005347 Bacteria 7352
97 Ga0070668_100053183 3300005347 Unclassified 3123
98 Ga0070668_100469842 3300005347 Unclassified 1084
99 Ga0070668_100799891 3300005347 Bacteria 838
100 Ga0070675_100020633 3300005354 Bacteria 5258
101 Ga0070675_100876949 3300005354 Unclassified 822
102 Ga0070671_100029788 3300005355 Bacteria 4502
103 Ga0070671_100349998 3300005355 Unclassified 1261
104 Ga0070674_100005639 3300005356 Bacteria 7253
105 Ga0070674_100050682 3300005356 Unclassified 2858
106 Ga0070673_100044430 3300005364 Bacteria 3440
107 Ga0070673_100069317 3300005364 Bacteria 2826
108 Ga0070673_100614903 3300005364 Bacteria 992
109 Ga0070688_100016002 3300005365 Bacteria 4279
110 Ga0070688_100131972 3300005365 Bacteria 1686
111 Ga0070688_100648451 3300005365 Bacteria 813
112 Ga0070659_100059318 3300005366 Bacteria 3021
113 Ga0070659_100064034 3300005366 Bacteria 2909
114 Ga0070659_100089872 3300005366 Bacteria 2461
115 Ga0070659_100232868 3300005366 Unclassified 1522
116 Ga0070659_100341947 3300005366 Bacteria 1254
117 Ga0070659_100438748 3300005366 Bacteria 1106
118 Ga0070659_100561683 3300005366 Bacteria 978
119 Ga0070659_100631050 3300005366 Bacteria 923
120 Ga0070667_100009082 3300005367 Bacteria 8224
121 Ga0070703_10018550 3300005406 Bacteria 2013
122 Ga0070703_10020258 3300005406 Unclassified 1934
123 Ga0070703_10034127 3300005406 Unclassified 1552
124 Ga0070703_10085263 3300005406 Bacteria 1085
125 Ga0070703_10238877 3300005406 Bacteria 732
126 Ga0070709_10015555 3300005434 Bacteria 4332
127 Ga0070709_10053684 3300005434 Bacteria 2538
128 Ga0070709_10177399 3300005434 Bacteria 1494
129 Ga0070709_10577651 3300005434 Unclassified 863
130 Ga0070709_10595674 3300005434 Unclassified 850
131 Ga0070714_100002694 3300005435 Bacteria 13092
132 Ga0070714_100013536 3300005435 Bacteria 6538
133 Ga0070714_100020417 3300005435 Bacteria 5409
134 Ga0070714_100026064 3300005435 Bacteria 4829
135 Ga0070714_100065451 3300005435 Bacteria 3130
136 Ga0070714_100074062 3300005435 Bacteria 2951
137 Ga0070714_100221880 3300005435 Bacteria 1737
138 Ga0070714_100355538 3300005435 Bacteria 1376
139 Ga0070714_100390529 3300005435 Bacteria 1313
140 Ga0070714_100679528 3300005435 Bacteria 992
141 Ga0070714_100865879 3300005435 Bacteria 877
142 Ga0070714_101877387 3300005435 Unclassified 585
143 Ga0070713_100005694 3300005436 Bacteria 8554
144 Ga0070713_100193807 3300005436 Unclassified 1832
145 Ga0070713_100274991 3300005436 Unclassified 1543
146 Ga0070713_100464891 3300005436 Bacteria 1190
147 Ga0070713_100493504 3300005436 Bacteria 1155
148 Ga0070713_101132422 3300005436 Bacteria 757
149 Ga0070713_102352094 3300005436 Bacteria 515
150 Ga0070710_10003097 3300005437 Bacteria 7894
151 Ga0070710_10011088 3300005437 Bacteria 4444
152 Ga0070710_10031029 3300005437 Unclassified 2880
153 Ga0070710_10045000 3300005437 Bacteria 2451
154 Ga0070710_11012383 3300005437 Bacteria 606
155 Ga0070710_11442429 3300005437 Bacteria 516
156 Ga0070710_11442770 3300005437 Bacteria 516
157 Ga0070701_10011918 3300005438 Bacteria 3904
158 Ga0070701_10032032 3300005438 Bacteria 2614
159 Ga0070701_10039684 3300005438 Bacteria 2390
160 Ga0070711_100006000 3300005439 Bacteria 7293
161 Ga0070711_100020967 3300005439 Bacteria 4220
162 Ga0070711_100060127 3300005439 Bacteria 2640
163 Ga0070711_100109928 3300005439 Unclassified 2021
164 Ga0070711_100167465 3300005439 Unclassified 1672
165 Ga0070711_100231071 3300005439 Bacteria 1442
166 Ga0070711_100495444 3300005439 Bacteria 1006
167 Ga0070711_100741187 3300005439 Bacteria 830
168 Ga0070705_100006630 3300005440 Bacteria 5687
169 Ga0070705_100099872 3300005440 Unclassified 1830
170 Ga0070705_101384348 3300005440 Bacteria 586
171 Ga0070700_100004550 3300005441 Bacteria 7256
172 Ga0070700_100008039 3300005441 Bacteria 5733
173 Ga0070700_100143935 3300005441 Unclassified 1623
174 Ga0070700_100218527 3300005441 Unclassified 1349
175 Ga0070700_100428767 3300005441 Archaea 1001
176 Ga0070700_101720119 3300005441 Unclassified 538
177 Ga0070694_100078212 3300005444 Bacteria 2294
178 Ga0070694_100093263 3300005444 Bacteria 2116
179 Ga0070694_100097550 3300005444 Unclassified 2074
180 Ga0070694_100163564 3300005444 Bacteria 1635
181 Ga0070694_100292928 3300005444 Bacteria 1245
182 Ga0070694_100403141 3300005444 Unclassified 1071
183 Ga0070694_100506252 3300005444 Bacteria 961
184 Ga0070694_100789431 3300005444 Bacteria 778
185 Ga0070708_100015786 3300005445 Bacteria 6243
186 Ga0070708_100200605 3300005445 Unclassified 1867
187 Ga0070708_100380528 3300005445 Bacteria 1331
188 Ga0070708_100455620 3300005445 Bacteria 1207
189 Ga0070708_100498394 3300005445 Unclassified 1149
190 Ga0070708_101020057 3300005445 Unclassified 776
191 Ga0070663_100008031 3300005455 Bacteria 6469
192 Ga0070663_100501777 3300005455 Bacteria 1008
193 Ga0070678_100026628 3300005456 Bacteria 3913
194 Ga0070678_100064976 3300005456 Bacteria 2707
195 Ga0070678_100368470 3300005456 Unclassified 1240
196 Ga0070678_100517760 3300005456 Unclassified 1055
197 Ga0070678_100978404 3300005456 Unclassified 777
198 Ga0070662_100016960 3300005457 Bacteria 4898
199 Ga0070662_100065436 3300005457 Bacteria 2665
200 Ga0070662_100164627 3300005457 Bacteria 1737
201 Ga0070662_100432141 3300005457 Bacteria 1091
202 Ga0070681_10005686 3300005458 Bacteria 12051
203 Ga0070681_10007190 3300005458 Bacteria 10848
204 Ga0070681_10026484 3300005458 Bacteria 5827
205 Ga0070681_10059689 3300005458 Unclassified 3793
206 Ga0070681_10090820 3300005458 Bacteria 3004
207 Ga0070681_10102077 3300005458 Bacteria 2813
208 Ga0070681_10175042 3300005458 Bacteria 2068
209 Ga0068867_100006973 3300005459 Bacteria 7986
210 Ga0068867_100033254 3300005459 Bacteria 3733
211 Ga0068867_100073840 3300005459 Bacteria 2554
212 Ga0070685_10000816 3300005466 Bacteria 16917
213 Ga0070685_10535385 3300005466 Bacteria 834
214 Ga0070685_10768751 3300005466 Bacteria 708
215 Ga0070706_100020865 3300005467 Bacteria 6031
216 Ga0070706_100039379 3300005467 Unclassified 4364
217 Ga0070706_100044894 3300005467 Bacteria 4082
218 Ga0070706_100477554 3300005467 Bacteria 1160
219 Ga0070706_100556298 3300005467 Unclassified 1067
220 Ga0070707_100000949 3300005468 Bacteria 28781
221 Ga0070707_100008460 3300005468 Bacteria 9557
222 Ga0070707_100030747 3300005468 Bacteria 5114
223 Ga0070707_100175479 3300005468 Bacteria 2089
224 Ga0070707_100570562 3300005468 Bacteria 1094
225 Ga0070707_100732611 3300005468 Bacteria 952
226 Ga0070707_101137811 3300005468 Unclassified 746
227 Ga0070698_100104407 3300005471 Bacteria 2804
228 Ga0070698_100129651 3300005471 Bacteria 2478
229 Ga0070698_100145113 3300005471 Unclassified 2323
230 Ga0070698_100175800 3300005471 Unclassified 2080
231 Ga0070698_100229696 3300005471 Bacteria 1789
232 Ga0070698_100319812 3300005471 Bacteria 1482
233 Ga0070698_100455753 3300005471 Bacteria 1215
234 Ga0070699_100033241 3300005518 Bacteria 4455
235 Ga0070699_100104436 3300005518 Unclassified 2485
236 Ga0070699_100336076 3300005518 Bacteria 1359
237 Ga0070699_100620979 3300005518 Unclassified 986
238 Ga0070699_100688635 3300005518 Unclassified 934
239 Ga0070699_101571820 3300005518 Bacteria 603
240 Ga0070679_100003327 3300005530 Bacteria 14715
241 Ga0070679_100034667 3300005530 Bacteria 5002
242 Ga0070679_100036280 3300005530 Bacteria 4893
243 Ga0070679_100096267 3300005530 Unclassified 2948
244 Ga0070679_100119568 3300005530 Bacteria 2619
245 Ga0070679_100137031 3300005530 Bacteria 2429
246 Ga0070679_100162691 3300005530 Bacteria 2206
247 Ga0070679_100171898 3300005530 Unclassified 2139
248 Ga0070679_100296057 3300005530 Unclassified 1569
249 Ga0070679_100366707 3300005530 Bacteria 1387
250 Ga0070679_100515577 3300005530 Unclassified 1139
251 Ga0070679_100551128 3300005530 Unclassified 1097
252 Ga0070684_100007962 3300005535 Bacteria 8272
253 Ga0070684_100013215 3300005535 Bacteria 6648
254 Ga0070684_100014125 3300005535 Bacteria 6457
255 Ga0070684_100014774 3300005535 Bacteria 6336
256 Ga0070684_100023477 3300005535 Bacteria 5160
257 Ga0070684_100040341 3300005535 Bacteria 4019
258 Ga0070684_100102459 3300005535 Unclassified 2559
259 Ga0070684_100198141 3300005535 Unclassified 1829
260 Ga0070684_100300933 3300005535 Bacteria 1472
261 Ga0070684_100767353 3300005535 Bacteria 901
262 Ga0070684_101010462 3300005535 Bacteria 781
263 Ga0070697_100075441 3300005536 Bacteria 2772
264 Ga0070697_100105678 3300005536 Bacteria 2342
265 Ga0070697_100438398 3300005536 Bacteria 1137
266 Ga0070697_100958980 3300005536 Bacteria 760
267 Ga0070697_101262820 3300005536 Bacteria 659
268 Ga0068853_100261655 3300005539 Bacteria 1591
269 Ga0070672_100049761 3300005543 Bacteria 3262
270 Ga0070672_100419912 3300005543 Unclassified 1149
271 Ga0070686_100004382 3300005544 Bacteria 7782
272 Ga0070686_100053104 3300005544 Unclassified 2586
273 Ga0070686_100132245 3300005544 Bacteria 1727
274 Ga0070695_100018875 3300005545 Unclassified 4192
275 Ga0070695_100197479 3300005545 Bacteria 1435
276 Ga0070695_100883184 3300005545 Bacteria 721
277 Ga0070696_100026892 3300005546 Bacteria 3916
278 Ga0070696_100048064 3300005546 Bacteria 2961
279 Ga0070696_100062253 3300005546 Bacteria 2611
280 Ga0070696_100071072 3300005546 Bacteria 2449
281 Ga0070696_100290075 3300005546 Bacteria 1250
282 Ga0070693_100091560 3300005547 Bacteria 1834
283 Ga0070693_100182878 3300005547 Unclassified 1350
284 Ga0070693_100205863 3300005547 Bacteria 1281
285 Ga0070693_100306115 3300005547 Bacteria 1073
286 Ga0070693_100733012 3300005547 Bacteria 727
287 Ga0070693_100865643 3300005547 Bacteria 675
288 Ga0070693_101151193 3300005547 Bacteria 594
289 Ga0070693_101566402 3300005547 Bacteria 517
290 Ga0070665_100041443 3300005548 Bacteria 4628
291 Ga0070665_100802888 3300005548 Unclassified 954
292 Ga0070704_100030154 3300005549 Bacteria 3631
293 Ga0070704_100070736 3300005549 Bacteria 2533
294 Ga0070704_100273762 3300005549 Bacteria 1396
295 Ga0070704_100304591 3300005549 Unclassified 1329
296 Ga0070704_100412772 3300005549 Bacteria 1155
297 Ga0070704_100618445 3300005549 Bacteria 953
298 Ga0070704_100985148 3300005549 Bacteria 762
299 Ga0070704_101886147 3300005549 Unclassified 554
300 Ga0070704_102280652 3300005549 Bacteria 504
301 Ga0070704_102289475 3300005549 Bacteria 503
302 Ga0068855_100007343 3300005563 Bacteria 13353
303 Ga0068855_100052133 3300005563 Bacteria 4817
304 Ga0068855_100100393 3300005563 Bacteria 3332
305 Ga0068855_100119357 3300005563 Bacteria 3019
306 Ga0068855_100192027 3300005563 Bacteria 2303
307 Ga0068855_100233615 3300005563 Bacteria 2057
308 Ga0068855_100643935 3300005563 Bacteria 1139
309 Ga0068855_102063349 3300005563 Bacteria 575
310 Ga0070664_100259034 3300005564 Bacteria 1565
311 Ga0070664_100287489 3300005564 Bacteria 1484
312 Ga0070664_100464054 3300005564 Bacteria 1164
313 Ga0070664_100982632 3300005564 Bacteria 793
314 Ga0068857_100011204 3300005577 Bacteria 7799
315 Ga0068857_100024729 3300005577 Bacteria 5290
316 Ga0068857_100177906 3300005577 Bacteria 1935
317 Ga0068857_100463588 3300005577 Unclassified 1186
318 Ga0068857_101787033 3300005577 Bacteria 602
319 Ga0068854_100053511 3300005578 Bacteria 2899
320 Ga0068854_100056126 3300005578 Bacteria 2838
321 Ga0068854_100065930 3300005578 Bacteria 2634
322 Ga0068854_100398173 3300005578 Bacteria 1139
323 Ga0068854_100823579 3300005578 Bacteria 811
324 Ga0068854_100990318 3300005578 Bacteria 744
325 Ga0068854_102239201 3300005578 Bacteria 506
326 Ga0068856_100014707 3300005614 Bacteria 7553
327 Ga0068856_100129320 3300005614 Bacteria 2529
328 Ga0068856_100135206 3300005614 Unclassified 2471
329 Ga0068856_100151195 3300005614 Bacteria 2330
330 Ga0068856_100153638 3300005614 Bacteria 2311
331 Ga0068856_100168305 3300005614 Bacteria 2203
332 Ga0068856_100177636 3300005614 Unclassified 2141
333 Ga0068856_100196994 3300005614 Bacteria 2028
334 Ga0068856_100352124 3300005614 Bacteria 1491
335 Ga0068856_100358074 3300005614 Bacteria 1478
336 Ga0068856_101273049 3300005614 Bacteria 751
337 Ga0070702_100010172 3300005615 Unclassified 4624
338 Ga0070702_100022444 3300005615 Bacteria 3337
339 Ga0070702_100044741 3300005615 Unclassified 2501
340 Ga0070702_100220914 3300005615 Bacteria 1267
341 Ga0070702_100275950 3300005615 Unclassified 1152
342 Ga0070702_100500890 3300005615 Bacteria 892
343 Ga0068852_100005023 3300005616 Bacteria 9404
344 Ga0068852_100046589 3300005616 Bacteria 3695
345 Ga0068852_100138618 3300005616 Bacteria 2249
346 Ga0068852_100476381 3300005616 Unclassified 1240
347 Ga0068852_100550581 3300005616 Bacteria 1154
348 Ga0068859_100084191 3300005617 Bacteria 3225
349 Ga0068864_102111545 3300005618 Bacteria 570
350 Ga0068866_10006032 3300005718 Bacteria 5042
351 Ga0068866_10515562 3300005718 Unclassified 794
352 Ga0068866_10535513 3300005718 Bacteria 781
353 Ga0068861_100013642 3300005719 Bacteria 5689
354 Ga0068861_100038498 3300005719 Bacteria 3562
355 Ga0068861_100052992 3300005719 Bacteria 3085
356 Ga0068861_100731155 3300005719 Bacteria 923
357 Ga0068861_101046354 3300005719 Bacteria 782
358 Ga0068851_10387756 3300005834 Bacteria 820
359 Ga0068851_10664548 3300005834 Unclassified 639
360 Ga0068870_10224842 3300005840 Unclassified 1151
361 Ga0068863_100552428 3300005841 Bacteria 1137
362 Ga0068858_100140136 3300005842 Bacteria 2270
363 Ga0068858_100217577 3300005842 Bacteria 1808
364 Ga0068858_101191089 3300005842 Bacteria 749
365 Ga0068860_100040839 3300005843 Bacteria 4432
366 Ga0068860_101081608 3300005843 Unclassified 821
367 Ga0068862_100098128 3300005844 Bacteria 2559
368 Ga0068862_100120115 3300005844 Bacteria 2316
369 Ga0068862_100162103 3300005844 Bacteria 1997
370 Ga0068862_100232551 3300005844 Bacteria 1673
371 Ga0068862_100858410 3300005844 Bacteria 890
372 Ga0081455_10008363 3300005937 Bacteria 10770
373 Ga0081455_10013810 3300005937 Bacteria 7947
374 Ga0081455_10016696 3300005937 Bacteria 7072
375 Ga0081455_10038483 3300005937 Bacteria 4236
376 Ga0081455_10126415 3300005937 Unclassified 2006
377 Ga0081455_10763569 3300005937 Bacteria 610
378 Ga0081538_10000013 3300005981 Bacteria 151925
379 Ga0081538_10000169 3300005981 Bacteria 69684
380 Ga0081538_10000312 3300005981 Bacteria 55768
381 Ga0081538_10001407 3300005981 Bacteria 24723
382 Ga0081538_10004036 3300005981 Bacteria 13655
383 Ga0081538_10004074 3300005981 Bacteria 13596
384 Ga0081538_10004165 3300005981 Bacteria 13421
385 Ga0081538_10006358 3300005981 Bacteria 10420
386 Ga0081538_10007118 3300005981 Bacteria 9718
387 Ga0081538_10008139 3300005981 Bacteria 8944
388 Ga0081538_10014186 3300005981 Bacteria 6259
389 Ga0081538_10017335 3300005981 Bacteria 5471
390 Ga0081538_10042595 3300005981 Bacteria 2862
391 Ga0081538_10071028 3300005981 Bacteria 1918
392 Ga0081538_10088805 3300005981 Bacteria 1607
393 Ga0081538_10104794 3300005981 Bacteria 1410
394 Ga0081538_10173571 3300005981 Bacteria 936
395 Ga0081538_10193139 3300005981 Bacteria 850
396 Ga0081538_10287189 3300005981 Unclassified 609
397 Ga0081538_10314539 3300005981 Unclassified 572
398 Ga0081540_1227848 3300005983 Bacteria 659
399 Ga0081539_10022410 3300005985 Bacteria 4179
400 Ga0081539_10091737 3300005985 Bacteria 1568
401 Ga0081539_10472253 3300005985 Bacteria 519
402 Ga0070717_10017003 3300006028 Bacteria 5650
403 Ga0070717_10040364 3300006028 Bacteria 3801
404 Ga0070717_10066037 3300006028 Unclassified 3008
405 Ga0070717_10203330 3300006028 Unclassified 1736
406 Ga0070717_10341336 3300006028 Bacteria 1337
407 Ga0070717_10573589 3300006028 Unclassified 1023
408 Ga0070717_10639376 3300006028 Bacteria 966
409 Ga0070717_10729318 3300006028 Bacteria 901
410 Ga0075365_10073645 3300006038 Bacteria 2302
411 Ga0075365_10081253 3300006038 Unclassified 2196
412 Ga0075365_10122219 3300006038 Bacteria 1797
413 Ga0075363_100295244 3300006048 Bacteria 940
414 Ga0075364_10015582 3300006051 Bacteria 4716
415 Ga0075364_10539183 3300006051 Bacteria 798
416 Ga0075364_10639124 3300006051 Bacteria 727
417 Ga0075364_10782450 3300006051 Bacteria 651
418 Ga0075432_10073896 3300006058 Bacteria 1228
419 Ga0075432_10121650 3300006058 Bacteria 981
420 Ga0070715_10026026 3300006163 Bacteria 2323
421 Ga0070715_10076256 3300006163 Unclassified 1510
422 Ga0070716_100116344 3300006173 Bacteria 1666
423 Ga0070716_100145445 3300006173 Bacteria 1518
424 Ga0070716_100283281 3300006173 Bacteria 1145
425 Ga0070716_100375141 3300006173 Bacteria 1015
426 Ga0070716_100841602 3300006173 Bacteria 714
427 Ga0070712_100004431 3300006175 Bacteria 8665
428 Ga0070712_100022316 3300006175 Bacteria 4169
429 Ga0070712_100157763 3300006175 Bacteria 1749
430 Ga0070712_100344709 3300006175 Bacteria 1218
431 Ga0070712_100677103 3300006175 Bacteria 878
432 Ga0070712_100889047 3300006175 Unclassified 768
433 Ga0070712_101230233 3300006175 Bacteria 652
434 Ga0070712_101439411 3300006175 Unclassified 602
435 Ga0075362_10035978 3300006177 Bacteria 2163
436 Ga0075367_10329957 3300006178 Bacteria 962
437 Ga0075367_10640213 3300006178 Bacteria 676
438 Ga0075427_10019431 3300006194 Unclassified 1071
439 Ga0075427_10047472 3300006194 Bacteria 734
440 Ga0097621_100005052 3300006237 Bacteria 9267
441 Ga0068871_100207804 3300006358 Unclassified 1692
442 Ga0068871_100617894 3300006358 Unclassified 987
443 Ga0068871_100981847 3300006358 Unclassified 786
444 Ga0075428_100013903 3300006844 Bacteria 8963
445 Ga0075428_100029675 3300006844 Bacteria 6051
446 Ga0075428_100116229 3300006844 Bacteria 2914
447 Ga0075428_100147536 3300006844 Bacteria 2557
448 Ga0075428_100251524 3300006844 Bacteria 1905
449 Ga0075428_100281357 3300006844 Bacteria 1790
450 Ga0075428_100330067 3300006844 Bacteria 1638
451 Ga0075428_100924775 3300006844 Bacteria 925
452 Ga0075430_100024546 3300006846 Bacteria 5128
453 Ga0075430_100029281 3300006846 Bacteria 4673
454 Ga0075430_100082786 3300006846 Bacteria 2689
455 Ga0075430_100379413 3300006846 Bacteria 1167
456 Ga0075431_100042220 3300006847 Bacteria 4702
457 Ga0075431_100149921 3300006847 Bacteria 2402
458 Ga0075431_100309849 3300006847 Bacteria 1594
459 Ga0075431_100319133 3300006847 Bacteria 1567
460 Ga0075431_100421210 3300006847 Bacteria 1334
461 Ga0075431_100469761 3300006847 Bacteria 1252
462 Ga0075431_101087123 3300006847 Bacteria 765
463 Ga0075433_10000416 3300006852 Bacteria 27184
464 Ga0075433_10018210 3300006852 Bacteria 5833
465 Ga0075433_10039332 3300006852 Bacteria 4089
466 Ga0075433_10068696 3300006852 Bacteria 3111
467 Ga0075433_10385585 3300006852 Bacteria 1237
468 Ga0075434_100036046 3300006871 Bacteria 4891
469 Ga0075434_100261264 3300006871 Unclassified 1750
470 Ga0075434_100501291 3300006871 Bacteria 1235
471 Ga0075434_101055760 3300006871 Bacteria 826
472 Ga0075429_100030504 3300006880 Bacteria 4684
473 Ga0075429_100111063 3300006880 Bacteria 2396
474 Ga0075429_100607664 3300006880 Unclassified 958
475 Ga0075429_100687375 3300006880 Unclassified 896
476 Ga0075429_101140949 3300006880 Bacteria 681
477 Ga0068865_100001717 3300006881 Bacteria 12852
478 Ga0068865_100108711 3300006881 Unclassified 2042
479 Ga0068865_101159881 3300006881 Unclassified 683
480 Ga0075436_100016298 3300006914 Bacteria 5088
481 Ga0075436_100167361 3300006914 Bacteria 1551
482 Ga0075436_100334850 3300006914 Unclassified 1089
483 Ga0097620_100084191 3300006931 Bacteria 3225
484 Ga0075435_100001405 3300007076 Bacteria 15514
485 Ga0075435_100009412 3300007076 Bacteria 7071
486 Ga0075435_100010822 3300007076 Bacteria 6680
487 Ga0075435_100448879 3300007076 Bacteria 1112
488 Ga0075435_100806314 3300007076 Unclassified 817
489 Ga0075435_100917241 3300007076 Bacteria 764
490 Ga0099795_10176161 3300007788 Bacteria 891
491 Ga0105251_10617811 3300009011 Bacteria 516
492 Ga0105240_10103290 3300009093 Bacteria 3463
493 Ga0105240_10408271 3300009093 Bacteria 1528
494 Ga0105240_10614585 3300009093 Bacteria 1195
495 Ga0111539_10002945 3300009094 Bacteria 22581
496 Ga0111539_10009364 3300009094 Bacteria 12365
497 Ga0111539_10025490 3300009094 Bacteria 7250
498 Ga0111539_10066276 3300009094 Bacteria 4265
499 Ga0111539_10164231 3300009094 Bacteria 2597
500 Ga0111539_10182094 3300009094 Bacteria 2454
501 Ga0111539_10590617 3300009094 Bacteria 1293
502 Ga0111539_10794970 3300009094 Bacteria 1101
503 Ga0111539_11233969 3300009094 Bacteria 868
504 Ga0111539_12212767 3300009094 Bacteria 638
505 Ga0105245_10014118 3300009098 Bacteria 6959
506 Ga0105245_10047377 3300009098 Bacteria 3842
507 Ga0105245_10059580 3300009098 Bacteria 3438
508 Ga0105245_10120510 3300009098 Bacteria 2450
509 Ga0105245_10197889 3300009098 Unclassified 1928
510 Ga0105245_10456300 3300009098 Unclassified 1287
511 Ga0105245_11188105 3300009098 Unclassified 810
512 Ga0105247_10015844 3300009101 Bacteria 4513
513 Ga0114129_10009215 3300009147 Bacteria 14076
514 Ga0114129_10024585 3300009147 Bacteria 8535
515 Ga0114129_10029269 3300009147 Bacteria 7801
516 Ga0114129_10054396 3300009147 Bacteria 5611
517 Ga0114129_10067941 3300009147 Bacteria 4970
518 Ga0114129_10174092 3300009147 Bacteria 2932
519 Ga0114129_10249592 3300009147 Bacteria 2383
520 Ga0114129_10265403 3300009147 Bacteria 2299
521 Ga0114129_10380756 3300009147 Bacteria 1863
522 Ga0114129_10522575 3300009147 Bacteria 1547
523 Ga0114129_10527363 3300009147 Unclassified 1539
524 Ga0114129_10758499 3300009147 Bacteria 1241
525 Ga0114129_11274256 3300009147 Bacteria 912
526 Ga0114129_11766163 3300009147 Bacteria 753
527 Ga0114129_12237483 3300009147 Bacteria 657
528 Ga0114129_12259333 3300009147 Bacteria 654
529 Ga0114129_13266333 3300009147 Bacteria 525
530 Ga0105243_10037406 3300009148 Bacteria 3772
531 Ga0105243_10046688 3300009148 Bacteria 3408
532 Ga0105243_10083356 3300009148 Bacteria 2616
533 Ga0105243_10222749 3300009148 Bacteria 1668
534 Ga0105243_10414183 3300009148 Unclassified 1255
535 Ga0105243_10436640 3300009148 Bacteria 1225
536 Ga0105243_10464884 3300009148 Bacteria 1190
537 Ga0105243_11939858 3300009148 Bacteria 622
538 Ga0105243_12148119 3300009148 Unclassified 594
539 Ga0105241_10061345 3300009174 Bacteria 2895
540 Ga0105241_10097285 3300009174 Unclassified 2333
541 Ga0105241_10136441 3300009174 Unclassified 1993
542 Ga0105241_10287849 3300009174 Unclassified 1406
543 Ga0105242_10011104 3300009176 Bacteria 6922
544 Ga0105242_10064630 3300009176 Bacteria 3017
545 Ga0105242_10188035 3300009176 Unclassified 1826
546 Ga0105242_11397771 3300009176 Bacteria 727
547 Ga0105248_10022371 3300009177 Bacteria 7013
548 Ga0105248_10052205 3300009177 Bacteria 4588
549 Ga0105248_12122382 3300009177 Unclassified 639
550 Ga0105237_10010287 3300009545 Bacteria 9965
551 Ga0105237_10190688 3300009545 Bacteria 2050
552 Ga0105237_10268387 3300009545 Unclassified 1709
553 Ga0105237_11124701 3300009545 Unclassified 792
554 Ga0105237_12226953 3300009545 Bacteria 558
555 Ga0105238_10047776 3300009551 Bacteria 4314
556 Ga0105238_10077304 3300009551 Bacteria 3320
557 Ga0105238_10193214 3300009551 Bacteria 2011
558 Ga0105238_10552988 3300009551 Bacteria 1155
559 Ga0105238_10839901 3300009551 Bacteria 935
560 Ga0105238_10945985 3300009551 Bacteria 881
561 Ga0105238_12348458 3300009551 Bacteria 569
562 Ga0105249_10003715 3300009553 Bacteria 13162
563 Ga0105249_10007144 3300009553 Bacteria 9748
564 Ga0105249_10131571 3300009553 Unclassified 2389
565 Ga0105249_10157599 3300009553 Unclassified 2191
566 Ga0105249_10867900 3300009553 Bacteria 968
567 Ga0105249_10943147 3300009553 Unclassified 931
568 Ga0105249_11924096 3300009553 Bacteria 664
569 Ga0105147_103172 3300009982 Bacteria 1373
570 Ga0105239_10034604 3300010375 Bacteria 5548
571 Ga0105239_10112615 3300010375 Bacteria 3017
572 Ga0105239_10114295 3300010375 Bacteria 2994
573 Ga0105239_10189319 3300010375 Bacteria 2303
574 Ga0105239_10502493 3300010375 Bacteria 1378
575 Ga0105239_10677410 3300010375 Unclassified 1179
576 Ga0105239_10702156 3300010375 Unclassified 1157
577 Ga0105246_10022658 3300011119 Bacteria 4055
578 Ga0105246_10346568 3300011119 Bacteria 1216
579 Ga0105246_11663606 3300011119 Unclassified 605
580 Ga0157313_1040048 3300012503 Bacteria 571
581 Ga0157342_1044539 3300012507 Bacteria 605
582 Ga0157342_1074475 3300012507 Bacteria 523
583 Ga0157338_1013400 3300012515 Bacteria 870
584 Ga0157373_10276093 3300013100 Unclassified 1190
585 Ga0157373_10311385 3300013100 Bacteria 1119
586 Ga0157373_10686661 3300013100 Unclassified 749
587 Ga0157373_10723762 3300013100 Bacteria 730
588 Ga0157371_10210115 3300013102 Bacteria 1396
589 Ga0157371_10272281 3300013102 Bacteria 1222
590 Ga0157370_10011051 3300013104 Bacteria 9468
591 Ga0157370_10019665 3300013104 Bacteria 6763
592 Ga0157370_10030644 3300013104 Bacteria 5269
593 Ga0157370_10037034 3300013104 Bacteria 4732
594 Ga0157370_10878363 3300013104 Bacteria 814
595 Ga0157370_11083602 3300013104 Bacteria 724
596 Ga0157369_10024611 3300013105 Bacteria 6694
597 Ga0157369_10047050 3300013105 Bacteria 4686
598 Ga0157369_10053177 3300013105 Bacteria 4378
599 Ga0157369_10245867 3300013105 Unclassified 1868
600 Ga0157369_11082034 3300013105 Unclassified 820
601 Ga0157369_11653714 3300013105 Bacteria 651
602 Ga0157369_11743822 3300013105 Unclassified 633
603 Ga0157369_12612812 3300013105 Bacteria 510
604 Ga0157374_10012764 3300013296 Bacteria 7320
605 Ga0157374_10332553 3300013296 Bacteria 1507
606 Ga0157374_10696813 3300013296 Bacteria 1029
607 Ga0157378_10010459 3300013297 Bacteria 8105
608 Ga0157378_10095408 3300013297 Bacteria 2709
609 Ga0157378_10395810 3300013297 Bacteria 1360
610 Ga0157378_11589632 3300013297 Bacteria 699
611 Ga0163162_10078641 3300013306 Bacteria 3363
612 Ga0163162_10406019 3300013306 Bacteria 1495
613 Ga0157372_10147425 3300013307 Bacteria 2714
614 Ga0157372_10266290 3300013307 Unclassified 1990
615 Ga0157372_10267376 3300013307 Bacteria 1986
616 Ga0157372_10424512 3300013307 Bacteria 1549
617 Ga0157372_11167715 3300013307 Bacteria 890
618 Ga0157372_11533469 3300013307 Bacteria 767
619 Ga0157375_10014122 3300013308 Bacteria 7122
620 Ga0157375_10220067 3300013308 Bacteria 2057
621 Ga0163163_10219594 3300014325 Bacteria 1949
622 Ga0163163_10239174 3300014325 Unclassified 1865
623 Ga0163163_10437268 3300014325 Unclassified 1368
624 Ga0163163_10673326 3300014325 Bacteria 1098
625 Ga0157380_10300999 3300014326 Unclassified 1477
626 Ga0157380_10804976 3300014326 Unclassified 957
627 Ga0157380_11030904 3300014326 Bacteria 858
628 Ga0157380_11197476 3300014326 Bacteria 803
629 Ga0182008_10008535 3300014497 Bacteria 5592
630 Ga0182008_10044913 3300014497 Bacteria 2197
631 Ga0182008_10087200 3300014497 Bacteria 1537
632 Ga0182008_10609632 3300014497 Bacteria 614
633 Ga0157377_10004665 3300014745 Bacteria 6342
634 Ga0157377_10088989 3300014745 Unclassified 1819
635 Ga0157377_10562102 3300014745 Bacteria 808
636 Ga0157377_10654558 3300014745 Bacteria 757
637 Ga0157377_11415232 3300014745 Bacteria 549
638 Ga0157379_10223074 3300014968 Unclassified 1708
639 Ga0157379_10919076 3300014968 Unclassified 831
640 Ga0157379_10992169 3300014968 Unclassified 800
641 Ga0157379_12559976 3300014968 Bacteria 511
642 Ga0157376_10011995 3300014969 Bacteria 6412
643 Ga0157376_10763897 3300014969 Unclassified 977
644 Ga0157376_11768721 3300014969 Unclassified 654
645 Ga0157376_12910532 3300014969 Bacteria 518
646 Ga0182006_1074535 3300015261 Bacteria 1250
647 Ga0163161_10080803 3300017792 Bacteria 2393
648 Ga0163161_10292636 3300017792 Bacteria 1280
649 Ga0197907_10186633 3300020069 Bacteria 1706
650 Ga0197907_10423566 3300020069 Bacteria 3190
651 Ga0197907_10438343 3300020069 Bacteria 1668
652 Ga0197907_10442485 3300020069 Bacteria 947
653 Ga0197907_11417827 3300020069 Bacteria 1235
654 Ga0206356_10455236 3300020070 Bacteria 1569
655 Ga0206356_10720194 3300020070 Bacteria 1164
656 Ga0206356_10854187 3300020070 Bacteria 1830
657 Ga0206356_10908358 3300020070 Bacteria 1786
658 Ga0206356_11024134 3300020070 Unclassified 1088
659 Ga0206349_1050397 3300020075 Bacteria 1679
660 Ga0206349_1419654 3300020075 Bacteria 740
661 Ga0206349_1946013 3300020075 Bacteria 631
662 Ga0206355_1040879 3300020076 Bacteria 771
663 Ga0206355_1342106 3300020076 Bacteria 1675
664 Ga0206355_1462533 3300020076 Bacteria 1084
665 Ga0206351_10253461 3300020077 Bacteria 607
666 Ga0206351_10479706 3300020077 Bacteria 1349
667 Ga0206352_10253765 3300020078 Bacteria 1233
668 Ga0206352_11278387 3300020078 Bacteria 682
669 Ga0206350_11385448 3300020080 Unclassified 1464
670 Ga0206350_11604752 3300020080 Bacteria 1341
671 Ga0206354_10277449 3300020081 Bacteria 810
672 Ga0206354_10303994 3300020081 Unclassified 1389
673 Ga0206354_10999163 3300020081 Bacteria 4696
674 Ga0206354_11321052 3300020081 Bacteria 1605
675 Ga0206354_11379180 3300020081 Bacteria 703
676 Ga0206354_11387473 3300020081 Bacteria 1608
677 Ga0206354_11556505 3300020081 Bacteria 1787
678 Ga0206354_11716844 3300020081 Unclassified 1388
679 Ga0206353_10552814 3300020082 Bacteria 522
680 Ga0206353_10579291 3300020082 Unclassified 2363
681 Ga0206353_10646658 3300020082 Bacteria 5408
682 Ga0206353_10874027 3300020082 Bacteria 655
683 Ga0206353_11253320 3300020082 Bacteria 1680
684 Ga0206353_11303834 3300020082 Bacteria 1392
685 Ga0206353_11310262 3300020082 Bacteria 8565
686 Ga0154015_1027422 3300020610 Bacteria 938
687 Ga0154015_1072201 3300020610 Unclassified 793
688 Ga0154015_1370897 3300020610 Bacteria 969
689 Ga0154015_1538434 3300020610 Bacteria 919
690 Ga0213873_10019821 3300021358 Bacteria 1564
691 Ga0213871_10016008 3300021441 Bacteria 1801
692 Ga0224712_10017878 3300022467 Bacteria 2359
693 Ga0224712_10034170 3300022467 Bacteria 1868
694 Ga0224712_10053447 3300022467 Bacteria 1582
695 Ga0224712_10068687 3300022467 Bacteria 1433
696 Ga0224712_10142606 3300022467 Bacteria 1056
697 Ga0224712_10259724 3300022467 Bacteria 804
698 Ga0224712_10361840 3300022467 Bacteria 687
699 Ga0207656_10208724 3300025321 Unclassified 946
700 Ga0207653_10003662 3300025885 Bacteria 4835
701 Ga0207692_10032981 3300025898 Bacteria 2493
702 Ga0207692_10099533 3300025898 Bacteria 1593
703 Ga0207692_10184079 3300025898 Unclassified 1218
704 Ga0207692_10403944 3300025898 Unclassified 852
705 Ga0207692_10914269 3300025898 Bacteria 577
706 Ga0207642_10005110 3300025899 Bacteria 4268
707 Ga0207642_10291502 3300025899 Unclassified 943
708 Ga0207710_10186080 3300025900 Bacteria 1021
709 Ga0207688_10014788 3300025901 Bacteria 4235
710 Ga0207688_10017110 3300025901 Bacteria 3939
711 Ga0207688_10062626 3300025901 Bacteria 2097
712 Ga0207688_10135839 3300025901 Unclassified 1444
713 Ga0207688_10310269 3300025901 Unclassified 966
714 Ga0207688_10630944 3300025901 Bacteria 676
715 Ga0207680_10308212 3300025903 Unclassified 1105
716 Ga0207647_10123939 3300025904 Bacteria 1522
717 Ga0207699_10035352 3300025906 Bacteria 2842
718 Ga0207699_10073251 3300025906 Bacteria 2100
719 Ga0207699_10114925 3300025906 Unclassified 1731
720 Ga0207699_10555330 3300025906 Bacteria 833
721 Ga0207699_10650779 3300025906 Bacteria 770
722 Ga0207645_10036606 3300025907 Bacteria 3151
723 Ga0207643_10066060 3300025908 Bacteria 2073
724 Ga0207705_10015535 3300025909 Bacteria 5463
725 Ga0207705_10020921 3300025909 Bacteria 4667
726 Ga0207705_10168095 3300025909 Bacteria 1650
727 Ga0207705_10299797 3300025909 Bacteria 1233
728 Ga0207705_10337868 3300025909 Bacteria 1159
729 Ga0207705_11312032 3300025909 Bacteria 552
730 Ga0207684_10056939 3300025910 Unclassified 3317
731 Ga0207684_10137621 3300025910 Bacteria 2098
732 Ga0207684_10189604 3300025910 Unclassified 1773
733 Ga0207684_10268331 3300025910 Unclassified 1473
734 Ga0207684_10503909 3300025910 Unclassified 1037
735 Ga0207654_10045756 3300025911 Unclassified 2492
736 Ga0207654_10251041 3300025911 Bacteria 1186
737 Ga0207707_10016827 3300025912 Bacteria 6370
738 Ga0207707_10025557 3300025912 Bacteria 5166
739 Ga0207707_10047009 3300025912 Bacteria 3759
740 Ga0207707_10138497 3300025912 Bacteria 2128
741 Ga0207707_10372101 3300025912 Bacteria 1229
742 Ga0207707_10454853 3300025912 Bacteria 1095
743 Ga0207707_10677643 3300025912 Bacteria 867
744 Ga0207695_10448284 3300025913 Bacteria 1174
745 Ga0207695_10778546 3300025913 Bacteria 837
746 Ga0207671_10018528 3300025914 Bacteria 5337
747 Ga0207671_10120587 3300025914 Bacteria 2004
748 Ga0207693_10002934 3300025915 Bacteria 14759
749 Ga0207693_10005025 3300025915 Bacteria 11103
750 Ga0207693_10005819 3300025915 Bacteria 10230
751 Ga0207693_10199911 3300025915 Bacteria 1572
752 Ga0207693_10256109 3300025915 Unclassified 1373
753 Ga0207693_10296241 3300025915 Bacteria 1267
754 Ga0207693_10413753 3300025915 Bacteria 1054
755 Ga0207663_10017343 3300025916 Bacteria 4010
756 Ga0207663_10184610 3300025916 Unclassified 1492
757 Ga0207663_10206825 3300025916 Unclassified 1420
758 Ga0207663_10235829 3300025916 Archaea 1339
759 Ga0207663_10247972 3300025916 Unclassified 1309
760 Ga0207663_10275826 3300025916 Unclassified 1247
761 Ga0207663_10335249 3300025916 Bacteria 1141
762 Ga0207663_11042351 3300025916 Bacteria 657
763 Ga0207660_10008765 3300025917 Bacteria 6537
764 Ga0207660_10022435 3300025917 Unclassified 4253
765 Ga0207660_10074403 3300025917 Unclassified 2479
766 Ga0207660_10140050 3300025917 Bacteria 1849
767 Ga0207660_10249602 3300025917 Bacteria 1400
768 Ga0207660_10355376 3300025917 Bacteria 1175
769 Ga0207660_10437698 3300025917 Bacteria 1056
770 Ga0207662_10094944 3300025918 Bacteria 1840
771 Ga0207657_10002082 3300025919 Bacteria 21643
772 Ga0207657_10009553 3300025919 Bacteria 9734
773 Ga0207657_10017180 3300025919 Bacteria 6950
774 Ga0207657_10041276 3300025919 Bacteria 4081
775 Ga0207657_10192956 3300025919 Bacteria 1642
776 Ga0207657_10228365 3300025919 Bacteria 1489
777 Ga0207657_10229537 3300025919 Bacteria 1485
778 Ga0207657_10517293 3300025919 Bacteria 934
779 Ga0207649_10162074 3300025920 Bacteria 1550
780 Ga0207649_10207943 3300025920 Unclassified 1387
781 Ga0207652_10004034 3300025921 Bacteria 11985
782 Ga0207652_10020742 3300025921 Bacteria 5415
783 Ga0207652_10037172 3300025921 Bacteria 4120
784 Ga0207652_10138697 3300025921 Bacteria 2173
785 Ga0207652_10163371 3300025921 Bacteria 1996
786 Ga0207652_10615930 3300025921 Unclassified 973
787 Ga0207652_10820186 3300025921 Bacteria 825
788 Ga0207652_10882985 3300025921 Bacteria 790
789 Ga0207652_11588678 3300025921 Bacteria 558
790 Ga0207646_10022194 3300025922 Bacteria 5853
791 Ga0207646_10028189 3300025922 Bacteria 5114
792 Ga0207646_10211746 3300025922 Bacteria 1750
793 Ga0207646_10761723 3300025922 Bacteria 864
794 Ga0207646_11435495 3300025922 Bacteria 599
795 Ga0207694_10102940 3300025924 Bacteria 2264
796 Ga0207694_10158477 3300025924 Bacteria 1827
797 Ga0207694_10686119 3300025924 Bacteria 864
798 Ga0207694_10716419 3300025924 Bacteria 844
799 Ga0207650_10296870 3300025925 Unclassified 1319
800 Ga0207659_10337487 3300025926 Bacteria 1247
801 Ga0207687_10014069 3300025927 Bacteria 5232
802 Ga0207687_10018648 3300025927 Bacteria 4584
803 Ga0207687_10047767 3300025927 Unclassified 2969
804 Ga0207687_10107887 3300025927 Bacteria 2061
805 Ga0207687_10226649 3300025927 Unclassified 1474
806 Ga0207687_10578401 3300025927 Unclassified 945
807 Ga0207687_10591112 3300025927 Unclassified 935
808 Ga0207687_10604366 3300025927 Unclassified 924
809 Ga0207700_10000012 3300025928 Bacteria 231712
810 Ga0207700_10121115 3300025928 Bacteria 2122
811 Ga0207700_10160292 3300025928 Unclassified 1868
812 Ga0207700_10499687 3300025928 Bacteria 1076
813 Ga0207700_10552552 3300025928 Bacteria 1022
814 Ga0207664_10008169 3300025929 Bacteria 7287
815 Ga0207664_10029592 3300025929 Bacteria 4173
816 Ga0207664_10038172 3300025929 Bacteria 3723
817 Ga0207664_10066535 3300025929 Bacteria 2889
818 Ga0207664_10124229 3300025929 Bacteria 2164
819 Ga0207664_10235088 3300025929 Unclassified 1594
820 Ga0207664_10358454 3300025929 Bacteria 1292
821 Ga0207664_10359366 3300025929 Bacteria 1290
822 Ga0207664_10430807 3300025929 Bacteria 1176
823 Ga0207664_10572208 3300025929 Unclassified 1014
824 Ga0207644_10067637 3300025931 Bacteria 2604
825 Ga0207644_11122046 3300025931 Bacteria 661
826 Ga0207690_10137920 3300025932 Bacteria 1793
827 Ga0207690_10168766 3300025932 Unclassified 1637
828 Ga0207690_10209471 3300025932 Bacteria 1485
829 Ga0207690_10288650 3300025932 Bacteria 1280
830 Ga0207690_10833374 3300025932 Bacteria 763
831 Ga0207690_11218357 3300025932 Unclassified 629
832 Ga0207706_10013086 3300025933 Bacteria 7550
833 Ga0207706_10041233 3300025933 Bacteria 4093
834 Ga0207706_10082059 3300025933 Unclassified 2833
835 Ga0207706_10149077 3300025933 Bacteria 2057
836 Ga0207706_10290123 3300025933 Bacteria 1426
837 Ga0207706_11599020 3300025933 Bacteria 528
838 Ga0207686_10047247 3300025934 Bacteria 2660
839 Ga0207686_10207801 3300025934 Unclassified 1406
840 Ga0207686_10217756 3300025934 Bacteria 1377
841 Ga0207709_10001561 3300025935 Bacteria 15707
842 Ga0207709_10145348 3300025935 Bacteria 1635
843 Ga0207709_10215207 3300025935 Bacteria 1382
844 Ga0207709_10276779 3300025935 Unclassified 1238
845 Ga0207709_10380993 3300025935 Unclassified 1073
846 Ga0207709_10485945 3300025935 Bacteria 961
847 Ga0207670_10005360 3300025936 Bacteria 7034
848 Ga0207670_10171627 3300025936 Unclassified 1627
849 Ga0207669_10048585 3300025937 Bacteria 2522
850 Ga0207669_10050432 3300025937 Bacteria 2488
851 Ga0207669_11723840 3300025937 Bacteria 535
852 Ga0207704_10024454 3300025938 Bacteria 3276
853 Ga0207704_10924980 3300025938 Unclassified 734
854 Ga0207704_10951941 3300025938 Bacteria 724
855 Ga0207665_10006819 3300025939 Bacteria 7565
856 Ga0207665_10012875 3300025939 Bacteria 5500
857 Ga0207665_10017176 3300025939 Bacteria 4753
858 Ga0207665_10084679 3300025939 Bacteria 2188
859 Ga0207665_10180018 3300025939 Bacteria 1530
860 Ga0207691_10010135 3300025940 Bacteria 9046
861 Ga0207691_10104108 3300025940 Bacteria 2530
862 Ga0207691_10215480 3300025940 Bacteria 1666
863 Ga0207711_10329208 3300025941 Bacteria 1412
864 Ga0207711_10564105 3300025941 Unclassified 1062
865 Ga0207689_10031753 3300025942 Bacteria 4394
866 Ga0207689_10780856 3300025942 Bacteria 806
867 Ga0207661_10003963 3300025944 Bacteria 10341
868 Ga0207661_10011805 3300025944 Bacteria 6343
869 Ga0207661_10019765 3300025944 Bacteria 5027
870 Ga0207661_10027168 3300025944 Bacteria 4369
871 Ga0207661_10038872 3300025944 Bacteria 3732
872 Ga0207661_10040511 3300025944 Unclassified 3662
873 Ga0207661_10100835 3300025944 Bacteria 2424
874 Ga0207661_10179958 3300025944 Unclassified 1846
875 Ga0207661_10236842 3300025944 Unclassified 1618
876 Ga0207661_10366861 3300025944 Unclassified 1301
877 Ga0207661_10738323 3300025944 Bacteria 906
878 Ga0207661_11941638 3300025944 Bacteria 534
879 Ga0207679_10016754 3300025945 Bacteria 4870
880 Ga0207679_10245014 3300025945 Bacteria 1521
881 Ga0207679_10463826 3300025945 Bacteria 1125
882 Ga0207679_10716665 3300025945 Bacteria 909
883 Ga0207679_11390189 3300025945 Bacteria 644
884 Ga0207679_11535219 3300025945 Unclassified 611
885 Ga0207667_10237510 3300025949 Bacteria 1865
886 Ga0207667_10249078 3300025949 Unclassified 1817
887 Ga0207667_10324726 3300025949 Bacteria 1571
888 Ga0207667_10589060 3300025949 Bacteria 1122
889 Ga0207667_10878256 3300025949 Bacteria 890
890 Ga0207667_10946304 3300025949 Bacteria 851
891 Ga0207651_10065761 3300025960 Bacteria 2545
892 Ga0207651_10133669 3300025960 Unclassified 1904
893 Ga0207712_10005445 3300025961 Bacteria 8035
894 Ga0207712_10037558 3300025961 Bacteria 3306
895 Ga0207712_10245071 3300025961 Unclassified 1446
896 Ga0207712_10309915 3300025961 Bacteria 1299
897 Ga0207668_10007560 3300025972 Bacteria 6466
898 Ga0207668_10020001 3300025972 Bacteria 4246
899 Ga0207668_10149933 3300025972 Unclassified 1804
900 Ga0207640_10052679 3300025981 Bacteria 2652
901 Ga0207640_10313113 3300025981 Bacteria 1247
902 Ga0207640_10450141 3300025981 Bacteria 1061
903 Ga0207640_10472743 3300025981 Bacteria 1038
904 Ga0207640_10491890 3300025981 Bacteria 1020
905 Ga0207640_10603917 3300025981 Unclassified 929
906 Ga0207677_10034065 3300026023 Bacteria 3294
907 Ga0207677_10192696 3300026023 Bacteria 1613
908 Ga0207677_11329910 3300026023 Bacteria 660
909 Ga0207703_10118898 3300026035 Bacteria 2266
910 Ga0207703_10524292 3300026035 Bacteria 1115
911 Ga0207639_10189302 3300026041 Bacteria 1756
912 Ga0207639_10279679 3300026041 Bacteria 1467
913 Ga0207639_10850069 3300026041 Bacteria 852
914 Ga0207678_10027358 3300026067 Bacteria 4974
915 Ga0207678_10066311 3300026067 Bacteria 3100
916 Ga0207678_10321182 3300026067 Bacteria 1332
917 Ga0207678_11323859 3300026067 Bacteria 637
918 Ga0207678_11557216 3300026067 Unclassified 583
919 Ga0207708_10007870 3300026075 Bacteria 7895
920 Ga0207708_10010026 3300026075 Bacteria 7036
921 Ga0207708_10106644 3300026075 Unclassified 2173
922 Ga0207708_10122822 3300026075 Bacteria 2024
923 Ga0207708_10153264 3300026075 Bacteria 1816
924 Ga0207702_10139865 3300026078 Bacteria 2189
925 Ga0207702_10155110 3300026078 Bacteria 2087
926 Ga0207702_10196554 3300026078 Bacteria 1867
927 Ga0207702_10297043 3300026078 Bacteria 1532
928 Ga0207702_10555934 3300026078 Bacteria 1123
929 Ga0207702_10657934 3300026078 Unclassified 1031
930 Ga0207702_10717250 3300026078 Unclassified 986
931 Ga0207702_11612545 3300026078 Unclassified 642
932 Ga0207641_11981367 3300026088 Bacteria 584
933 Ga0207648_10003432 3300026089 Bacteria 16631
934 Ga0207648_10029730 3300026089 Bacteria 4845
935 Ga0207648_10057075 3300026089 Bacteria 3407
936 Ga0207648_11885600 3300026089 Bacteria 559
937 Ga0207676_10267278 3300026095 Bacteria 1547
938 Ga0207676_10717984 3300026095 Bacteria 970
939 Ga0207674_10012751 3300026116 Bacteria 9388
940 Ga0207674_10020476 3300026116 Bacteria 7146
941 Ga0207674_10021392 3300026116 Bacteria 6965
942 Ga0207674_10139131 3300026116 Bacteria 2388
943 Ga0207675_100000239 3300026118 Bacteria 52108
944 Ga0207675_100012469 3300026118 Bacteria 7940
945 Ga0207675_100050628 3300026118 Bacteria 3875
946 Ga0207675_100085447 3300026118 Bacteria 2961
947 Ga0207675_100876368 3300026118 Bacteria 913
948 Ga0207683_10000262 3300026121 Bacteria 47039
949 Ga0207683_10013297 3300026121 Bacteria 7017
950 Ga0207683_10263460 3300026121 Bacteria 1574
951 Ga0207683_10351529 3300026121 Unclassified 1353
952 Ga0207698_10001968 3300026142 Bacteria 12079
953 Ga0207698_10097076 3300026142 Bacteria 2431
954 Ga0207698_10114632 3300026142 Bacteria 2267
955 Ga0207698_10410040 3300026142 Bacteria 1297
956 Ga0207698_10954397 3300026142 Unclassified 867
957 Ga0210000_1021556 3300027462 Bacteria 987
958 Ga0209999_1040985 3300027543 Bacteria 868
959 Ga0209966_1032655 3300027695 Bacteria 1061
960 Ga0209974_10072189 3300027876 Bacteria 1179
961 Ga0207428_10005731 3300027907 Bacteria 11538
962 Ga0207428_10032631 3300027907 Bacteria 4281
963 Ga0207428_10037013 3300027907 Bacteria 3973
964 Ga0207428_10037899 3300027907 Bacteria 3922
965 Ga0207428_10092239 3300027907 Bacteria 2351
966 Ga0207428_10924218 3300027907 Bacteria 616
967 Ga0207428_10942007 3300027907 Unclassified 609
968 Ga0268266_10973573 3300028379 Unclassified 821
969 Ga0268265_10098586 3300028380 Unclassified 2354
970 Ga0268265_10102332 3300028380 Bacteria 2317
971 Ga0268265_11281917 3300028380 Unclassified 732
972 Ga0268264_10034340 3300028381 Bacteria 4171
973 Ga0268264_10640832 3300028381 Unclassified 1051
974 Ga0268264_11821089 3300028381 Unclassified 619
975 Ga0265337_1016381 3300028556 Bacteria 2398
976 Ga0265334_10073204 3300028573 Bacteria 1273
977 Ga0265318_10036326 3300028577 Unclassified 1891
978 Ga0265322_10021376 3300028654 Unclassified 1853
979 Ga0265336_10058625 3300028666 Bacteria 1155
980 Ga0265338_10005668 3300028800 Bacteria 16194
981 Ga0265338_10057127 3300028800 Bacteria 3454
982 Ga0265338_10179186 3300028800 Bacteria 1617
983 Ga0265330_10053272 3300031235 Bacteria 1771
984 Ga0265330_10062461 3300031235 Bacteria 1619
985 Ga0265330_10184926 3300031235 Bacteria 882
986 Ga0265332_10032013 3300031238 Bacteria 2293
987 Ga0265332_10147986 3300031238 Bacteria 983
988 Ga0265328_10194135 3300031239 Bacteria 770
989 Ga0265320_10111876 3300031240 Bacteria 1250
990 Ga0265325_10009148 3300031241 Bacteria 5801
991 Ga0265339_10003320 3300031249 Bacteria 11270
992 Ga0265339_10176991 3300031249 Bacteria 1064
993 Ga0265331_10054358 3300031250 Bacteria 1907
994 Ga0265331_10102625 3300031250 Bacteria 1315
995 Ga0265327_10034191 3300031251 Bacteria 2823
996 Ga0265316_10015468 3300031344 Bacteria 6670
997 Ga0265316_10261358 3300031344 Bacteria 1269
998 Ga0265316_10629822 3300031344 Bacteria 759
999 Ga0307408_100100073 3300031548 Bacteria 2207
1000 Ga0307408_100160718 3300031548 Bacteria 1784
1001 Ga0307408_100436281 3300031548 Bacteria 1133
1002 Ga0265313_10009855 3300031595 Bacteria 6147
1003 Ga0265313_10027633 3300031595 Bacteria 2966
1004 Ga0265314_10006982 3300031711 Bacteria 9878
1005 Ga0265314_10017534 3300031711 Bacteria 5617
1006 Ga0265314_10085399 3300031711 Unclassified 2069
1007 Ga0265342_10016426 3300031712 Bacteria 4839
1008 Ga0265342_10053971 3300031712 Bacteria 2390
1009 Ga0265342_10569043 3300031712 Unclassified 574
1010 Ga0307405_10022450 3300031731 Bacteria 3568
1011 Ga0307405_10133898 3300031731 Bacteria 1717
1012 Ga0307405_10373568 3300031731 Unclassified 1107
1013 Ga0307405_10380056 3300031731 Bacteria 1099
1014 Ga0307413_10000972 3300031824 Bacteria 10296
1015 Ga0307413_10016513 3300031824 Bacteria 3816
1016 Ga0307413_10172755 3300031824 Bacteria 1531
1017 Ga0307413_10538915 3300031824 Bacteria 944
1018 Ga0307410_10018807 3300031852 Bacteria 4185
1019 Ga0307410_10041612 3300031852 Unclassified 3031
1020 Ga0307410_10063946 3300031852 Bacteria 2526
1021 Ga0307410_10134913 3300031852 Bacteria 1818
1022 Ga0307410_10135610 3300031852 Bacteria 1814
1023 Ga0307410_10175842 3300031852 Bacteria 1617
1024 Ga0307410_10190172 3300031852 Bacteria 1560
1025 Ga0307410_10502020 3300031852 Bacteria 998
1026 Ga0307406_10007190 3300031901 Bacteria 6167
1027 Ga0307406_10008830 3300031901 Bacteria 5633
1028 Ga0307406_10025643 3300031901 Bacteria 3531
1029 Ga0307406_10050049 3300031901 Bacteria 2647
1030 Ga0307406_10085293 3300031901 Bacteria 2111
1031 Ga0307406_10892474 3300031901 Bacteria 756
1032 Ga0307406_12098580 3300031901 Unclassified 506
1033 Ga0307407_10031023 3300031903 Unclassified 2890
1034 Ga0307407_10048193 3300031903 Bacteria 2423
1035 Ga0307407_10135541 3300031903 Bacteria 1581
1036 Ga0307407_10138958 3300031903 Bacteria 1565
1037 Ga0307407_11198077 3300031903 Bacteria 593
1038 Ga0307412_10010513 3300031911 Bacteria 5332
1039 Ga0307412_10034476 3300031911 Bacteria 3226
1040 Ga0307412_10429330 3300031911 Bacteria 1083
1041 Ga0307412_10448658 3300031911 Bacteria 1062
1042 Ga0307412_10661016 3300031911 Bacteria 892
1043 Ga0307412_10867571 3300031911 Bacteria 789
1044 Ga0307412_10885263 3300031911 Bacteria 781
1045 Ga0307412_12183223 3300031911 Bacteria 515
1046 Ga0307409_100000515 3300031995 Bacteria 16695
1047 Ga0307409_100005794 3300031995 Bacteria 7166
1048 Ga0307409_100007378 3300031995 Bacteria 6571
1049 Ga0307409_100061112 3300031995 Bacteria 2942
1050 Ga0307409_100130596 3300031995 Bacteria 2146
1051 Ga0307409_100376229 3300031995 Bacteria 1348
1052 Ga0307409_100774858 3300031995 Bacteria 965
1053 Ga0307409_100933501 3300031995 Bacteria 883
1054 Ga0307409_101688527 3300031995 Bacteria 662
1055 Ga0307409_102021864 3300031995 Bacteria 606
1056 Ga0307416_100003349 3300032002 Bacteria 9381
1057 Ga0307416_100047663 3300032002 Bacteria 3393
1058 Ga0307416_100056638 3300032002 Bacteria 3165
1059 Ga0307416_100131881 3300032002 Bacteria 2251
1060 Ga0307416_100143210 3300032002 Bacteria 2177
1061 Ga0307416_100157287 3300032002 Bacteria 2094
1062 Ga0307416_100220086 3300032002 Bacteria 1820
1063 Ga0307416_100252874 3300032002 Bacteria 1716
1064 Ga0307416_100428015 3300032002 Bacteria 1370
1065 Ga0307416_100458655 3300032002 Bacteria 1329
1066 Ga0307416_100488169 3300032002 Bacteria 1293
1067 Ga0307416_100504864 3300032002 Bacteria 1274
1068 Ga0307416_100656230 3300032002 Bacteria 1134
1069 Ga0307416_100659895 3300032002 Bacteria 1131
1070 Ga0307414_10125501 3300032004 Bacteria 1982
1071 Ga0307414_10195703 3300032004 Bacteria 1640
1072 Ga0307414_10248874 3300032004 Bacteria 1476
1073 Ga0307414_10808261 3300032004 Unclassified 855
1074 Ga0307414_11008742 3300032004 Bacteria 766
1075 Ga0307411_10003787 3300032005 Bacteria 7107
1076 Ga0307411_10098304 3300032005 Bacteria 2062
1077 Ga0307411_10154707 3300032005 Bacteria 1709
1078 Ga0307415_100002034 3300032126 Bacteria 9975
1079 Ga0307415_100043617 3300032126 Bacteria 2993
1080 Ga0307415_100087272 3300032126 Bacteria 2247
1081 Ga0307415_100089802 3300032126 Bacteria 2220
1082 Ga0307415_100475460 3300032126 Bacteria 1086
1083 Ga0307415_100598109 3300032126 Bacteria 981
1084 Ga0307415_100603999 3300032126 Bacteria 977
1085 Ga0307415_100604603 3300032126 Bacteria 976
1086 Ga0307415_100905648 3300032126 Bacteria 813
1087 Ga0307415_100939544 3300032126 Bacteria 800
1088 Ga0307415_102253963 3300032126 Unclassified 534
1089 Ga0373948_0015230 3300034817 Unclassified 1410
1090 Ga0373950_0002713 3300034818 Bacteria 2465
1091 Ga0373950_0050489 3300034818 Bacteria 816
1092 Ga0373958_0010043 3300034819 Unclassified 1570
1093 Ga0373959_0063102 3300034820 Bacteria 824
1094 Ga0373959_0117209 3300034820 Unclassified 648
1095 Ga0373938_0016719 3300034957 Bacteria 1437
1096 Ga0373938_0060805 3300034957 Bacteria 883
1097 Ga0373928_0019989 3300035084 Unclassified 1401
1098 Ga0373928_0085099 3300035084 Bacteria 803
1099 Ga0373934_0501747 3300035086 Unclassified 510
1100 Ga0373940_0013500 3300035088 Bacteria 1978
1101 Ga0373940_0044496 3300035088 Bacteria 1230
1102 Ga0373944_0009829 3300035089 Bacteria 2601
1103 Ga0373944_0049658 3300035089 Bacteria 1319
1104 Ga0373949_0025859 3300035090 Bacteria 1372
1105 Ga0373951_0011199 3300035091 Unclassified 2011
1106 Ga0373952_0010857 3300035092 Unclassified 1767
1107 Ga0373952_0093012 3300035092 Unclassified 786
1108 Ga0373932_0005667 3300035112 Bacteria 2937
1109 Ga0373932_0219365 3300035112 Unclassified 683
1110 Ga0373936_0083095 3300035113 Unclassified 1335
1111 Ga0373939_0002231 3300035114 Bacteria 4590
1112 Ga0373939_0128922 3300035114 Bacteria 900
1113 Ga0373939_0444495 3300035114 Bacteria 545
1114 Ga0373941_0005966 3300035115 Bacteria 2904
1115 Ga0373945_0004274 3300035116 Bacteria 4532
1116 Ga0373956_0024412 3300035119 Bacteria 2605
1117 Ga0373957_0092227 3300035120 Unclassified 1205
1118 Ga0373960_0005256 3300035121 Bacteria 2991
1119 Ga0373960_0005339 3300035121 Bacteria 2971
1120 Ga0373960_0160788 3300035121 Unclassified 773
1121 Ga0373943_0000166 3300035170 Bacteria 25694
1122 Ga0373946_0003727 3300035171 Bacteria 5403
1123 Ga0373946_0112300 3300035171 Bacteria 1235
1124 Ga0373946_0369179 3300035171 Bacteria 720
1125 Ga0373946_0630756 3300035171 Bacteria 557
1126 Ga0373955_0148327 3300035172 Unclassified 1379
1127 Ga0373942_0012103 3300035207 Bacteria 2055
1128 Ga0373961_0009860 3300035241 Bacteria 2342
1129 Ga0373961_0038639 3300035241 Bacteria 1368
1130 Ga0373962_0005913 3300035242 Bacteria 2955
1131 Ga0373962_0013418 3300035242 Bacteria 2075
1132 Ga0373924_0179222 3300035410 Bacteria 932
1133 Ga0373931_0007745 3300035691 Bacteria 5071
1134 Ga0373931_0008823 3300035691 Bacteria 4797
1135 Ga0373931_0511305 3300035691 Unclassified 776
1136 Ga0373931_0805474 3300035691 Unclassified 626
1137 Ga0373935_0005283 3300035692 Bacteria 7599
1138 Ga0373935_0115654 3300035692 Bacteria 1786
1139 Ga0373935_0364423 3300035692 Bacteria 1032
1140 Ga0373927_0031467 3300035695 Bacteria 3458
1141 Ga0373933_0020179 3300035724 Bacteria 3776
1142 Ga0373947_0001188 3300035725 Bacteria 16031
1143 Ga0373947_0205036 3300035725 Bacteria 1291
1144 Ga0373947_0766688 3300035725 Bacteria 658
1145 Ga0373937_0140002 3300036401 Unclassified 2263
1146 Ga0373937_0749899 3300036401 Bacteria 924
1147 Ga0373937_1020462 3300036401 Bacteria 776
1148 Ga0373925_0036662 3300037068 Bacteria 3618
1149 Ga0373925_0194672 3300037068 Bacteria 1610
1150 Ga0373925_0254123 3300037068 Bacteria 1410
1151 Ga0373925_0684193 3300037068 Bacteria 846
1152 Ga0373925_1531577 3300037068 Unclassified 545
1153 Ga0395899_0006190 3300037312 Bacteria 9270
1154 Ga0395899_0007255 3300037312 Bacteria 8577
1155 Ga0395899_0037475 3300037312 Bacteria 3634
1156 Ga0395899_0049009 3300037312 Bacteria 3140
1157 Ga0395899_0068080 3300037312 Bacteria 2611
1158 Ga0395899_0068251 3300037312 Bacteria 2607
1159 Ga0395899_0081030 3300037312 Bacteria 2362
1160 Ga0395899_0091511 3300037312 Bacteria 2204
1161 Ga0395899_0096028 3300037312 Bacteria 2144
1162 Ga0395899_0103361 3300037312 Bacteria 2055
1163 Ga0395899_0174738 3300037312 Bacteria 1511
1164 Ga0395899_0295251 3300037312 Bacteria 1098
1165 Ga0395899_0567863 3300037312 Bacteria 727
1166 Ga0395899_0721112 3300037312 Bacteria 623
1167 Ga0395900_0002322 3300037418 Bacteria 21095
1168 Ga0395900_0012562 3300037418 Bacteria 8665
1169 Ga0395900_0012865 3300037418 Bacteria 8548
1170 Ga0395900_0017394 3300037418 Bacteria 7338
1171 Ga0395900_0021131 3300037418 Bacteria 6652
1172 Ga0395900_0022975 3300037418 Bacteria 6382
1173 Ga0395900_0023819 3300037418 Bacteria 6264
1174 Ga0395900_0024767 3300037418 Bacteria 6143
1175 Ga0395900_0030439 3300037418 Bacteria 5543
1176 Ga0395900_0040123 3300037418 Bacteria 4824
1177 Ga0395900_0054326 3300037418 Bacteria 4124
1178 Ga0395900_0065750 3300037418 Bacteria 3725
1179 Ga0395900_0077913 3300037418 Bacteria 3406
1180 Ga0395900_0106261 3300037418 Unclassified 2883
1181 Ga0395900_0172061 3300037418 Bacteria 2204
1182 Ga0395900_0175214 3300037418 Unclassified 2181
1183 Ga0395900_0185856 3300037418 Bacteria 2109
1184 Ga0395900_0191093 3300037418 Bacteria 2077
1185 Ga0395900_0223395 3300037418 Bacteria 1897
1186 Ga0395900_0226148 3300037418 Bacteria 1884
1187 Ga0395900_0286751 3300037418 Bacteria 1636
1188 Ga0395900_0441917 3300037418 Bacteria 1258
1189 Ga0395900_0526121 3300037418 Unclassified 1130
1190 Ga0395900_0574468 3300037418 Bacteria 1070
1191 Ga0395900_0667123 3300037418 Bacteria 975
1192 Ga0395900_1109429 3300037418 Unclassified 708
1193 Ga0395900_1252148 3300037418 Bacteria 656
1194 Ga0395898_0000795 3300037466 Bacteria 53570
1195 Ga0395898_0002193 3300037466 Bacteria 23839
1196 Ga0395898_0009079 3300037466 Bacteria 10470
1197 Ga0395898_0013830 3300037466 Bacteria 8295
1198 Ga0395898_0015806 3300037466 Bacteria 7735
1199 Ga0395898_0016921 3300037466 Bacteria 7444
1200 Ga0395898_0034133 3300037466 Bacteria 5073
1201 Ga0395898_0043576 3300037466 Bacteria 4421
1202 Ga0395898_0044296 3300037466 Bacteria 4382
1203 Ga0395898_0063856 3300037466 Bacteria 3573
1204 Ga0395898_0086424 3300037466 Unclassified 3022
1205 Ga0395898_0088576 3300037466 Bacteria 2979
1206 Ga0395898_0128762 3300037466 Bacteria 2425
1207 Ga0395898_0146755 3300037466 Unclassified 2258
1208 Ga0395898_0162608 3300037466 Bacteria 2135
1209 Ga0395898_0164186 3300037466 Bacteria 2124
1210 Ga0395898_0183502 3300037466 Bacteria 1999
1211 Ga0395898_0404434 3300037466 Bacteria 1302
1212 Ga0395898_0698304 3300037466 Bacteria 956
1213 Ga0395898_0707202 3300037466 Unclassified 949
1214 Ga0395898_0811683 3300037466 Bacteria 875
1215 Ga0395898_1525449 3300037466 Bacteria 594
1216 Ga0395905_0009609 3300037471 Bacteria 9442
1217 Ga0395905_0014210 3300037471 Bacteria 7605
1218 Ga0395905_0015516 3300037471 Bacteria 7242
1219 Ga0395905_0027661 3300037471 Bacteria 5348
1220 Ga0395905_0057969 3300037471 Bacteria 3622
1221 Ga0395905_0065451 3300037471 Bacteria 3403
1222 Ga0395905_0081208 3300037471 Bacteria 3038
1223 Ga0395905_0083987 3300037471 Bacteria 2983
1224 Ga0395905_0086678 3300037471 Bacteria 2935
1225 Ga0395905_0131221 3300037471 Bacteria 2356
1226 Ga0395905_0140628 3300037471 Bacteria 2271
1227 Ga0395905_0189510 3300037471 Bacteria 1929
1228 Ga0395905_0254187 3300037471 Bacteria 1641
1229 Ga0395905_0254700 3300037471 Bacteria 1639
1230 Ga0395905_0298389 3300037471 Bacteria 1498
1231 Ga0395905_0413140 3300037471 Bacteria 1245
1232 Ga0395905_0777745 3300037471 Unclassified 860
1233 Ga0395905_0798930 3300037471 Bacteria 846
1234 Ga0395905_0988605 3300037471 Unclassified 744
1235 Ga0395905_1176978 3300037471 Bacteria 670
1236 Ga0436364_1329343 3300037853 Bacteria 502
1237 Ga0395901_0003405 3300038443 Bacteria 16022
1238 Ga0395901_0004473 3300038443 Bacteria 14104
1239 Ga0395901_0004812 3300038443 Bacteria 13622
1240 Ga0395901_0007531 3300038443 Bacteria 10995
1241 Ga0395901_0010774 3300038443 Bacteria 9269
1242 Ga0395901_0014837 3300038443 Bacteria 7916
1243 Ga0395901_0016495 3300038443 Bacteria 7526
1244 Ga0395901_0017704 3300038443 Bacteria 7274
1245 Ga0395901_0019015 3300038443 Bacteria 7023
1246 Ga0395901_0024354 3300038443 Bacteria 6211
1247 Ga0395901_0034604 3300038443 Bacteria 5217
1248 Ga0395901_0065946 3300038443 Bacteria 3771
1249 Ga0395901_0082903 3300038443 Bacteria 3351
1250 Ga0395901_0093359 3300038443 Bacteria 3151
1251 Ga0395901_0125048 3300038443 Bacteria 2702
1252 Ga0395901_0141706 3300038443 Bacteria 2526
1253 Ga0395901_0147590 3300038443 Bacteria 2471
1254 Ga0395901_0152361 3300038443 Unclassified 2429
1255 Ga0395901_0191167 3300038443 Bacteria 2147
1256 Ga0395901_0193217 3300038443 Bacteria 2134
1257 Ga0395901_0254714 3300038443 Bacteria 1828
1258 Ga0395901_0288023 3300038443 Unclassified 1705
1259 Ga0395901_0370110 3300038443 Bacteria 1476
1260 Ga0395901_0373080 3300038443 Bacteria 1469
1261 Ga0395901_0408976 3300038443 Bacteria 1393
1262 Ga0395901_0415890 3300038443 Unclassified 1379
1263 Ga0395901_0604107 3300038443 Bacteria 1106
1264 Ga0395901_0635354 3300038443 Bacteria 1073
1265 Ga0395901_0734825 3300038443 Bacteria 981
1266 Ga0395901_1035763 3300038443 Bacteria 795
1267 Ga0395901_1419657 3300038443 Bacteria 652
1268 Ga0395901_1741222 3300038443 Bacteria 573
1269 Ga0395901_1756604 3300038443 Unclassified 570
1270 Ga0395901_1928031 3300038443 Bacteria 538
1271 Ga0242422_05981 3300038699 Bacteria 736
1272 Ga0242420_002041 3300038996 Bacteria 2822
1273 Ga0436365_0025901 3300039437 Bacteria 1249
1274 Ga0436365_0411377 3300039437 Bacteria 1745
1275 Ga0436365_1892433 3300039437 Bacteria 967
1276 Ga0436360_1251922 3300039438 Bacteria 6237
1277 Ga0436363_0196864 3300039450 Bacteria 866
1278 Ga0436362_0019340 3300039453 Bacteria 4933
1279 Ga0436362_0245167 3300039453 Bacteria 621
1280 Ga0436362_0676185 3300039453 Bacteria 3756
1281 Ga0451787_108320 3300041441 Bacteria 884
1282 Ga0451789_0065786 3300041443 Bacteria 627
1283 Ga0451791_1185374 3300041451 Bacteria 2941
1284 Ga0451804_0246043 3300041463 Bacteria 844
1285 Ga0451807_0796071 3300041486 Bacteria 1453
1286 Ga0451835_0664966 3300041492 Unclassified 613
1287 Ga0451841_0560786 3300041498 Bacteria 1272
1288 Ga0451853_2814187 3300041512 Unclassified 797
1289 Ga0439448_0194482 3300042005 Unclassified 710
1290 Ga0439450_036733 3300042008 Unclassified 1123
1291 Ga0439454_035206 3300042011 Unclassified 801
1292 Ga0439454_117523 3300042011 Bacteria 512
1293 Ga0439455_0139176 3300042012 Unclassified 687
1294 Ga0439463_074284 3300042016 Unclassified 872
1295 Ga0439463_199900 3300042016 Bacteria 519
1296 Ga0450898_137666 3300042134 Bacteria 529
1297 Ga0450902_036243 3300042137 Bacteria 835
1298 Ga0439446_0088901 3300042156 Bacteria 965
1299 Ga0439458_0030587 3300042157 Bacteria 1282
1300 Ga0439434_0112315 3300042435 Unclassified 883
1301 Ga0439444_0016653 3300042437 Unclassified 1254
1302 Ga0439460_0071371 3300042461 Bacteria 1076
1303 Ga0439440_0128365 3300042993 Bacteria 711
1304 Ga0466969_0160233 3300044656 Unclassified 1034
1305 Ga0466972_0204299 3300044658 Bacteria 925
1306 Ga0466972_0301592 3300044658 Viruses 749
1307 Ga0466972_0336484 3300044658 Bacteria 706
1308 Ga0466965_0315027 3300044683 Bacteria 851
1309 Ga0466966_0006534 3300044684 Bacteria 7715
1310 Ga0466966_0122730 3300044684 Unclassified 1595
1311 Ga0466961_0053483 3300044693 Unclassified 2576
1312 Ga0466961_0138741 3300044693 Unclassified 1523
1313 Ga0466961_0152125 3300044693 Bacteria 1444
1314 Ga0466961_0838177 3300044693 Unclassified 548
1315 Ga0466963_0011944 3300044694 Bacteria 5303
1316 Ga0466963_0017025 3300044694 Bacteria 4527
1317 Ga0466963_0035000 3300044694 Bacteria 3270
1318 Ga0466963_0065726 3300044694 Bacteria 2432
1319 Ga0466963_0959000 3300044694 Bacteria 602
1320 Ga0466964_0002888 3300044706 Bacteria 6204
1321 Ga0466964_0003812 3300044706 Bacteria 5530
1322 Ga0466964_0033123 3300044706 Unclassified 2057
1323 Ga0466964_0220273 3300044706 Bacteria 921
1324 Ga0466964_0300220 3300044706 Unclassified 809
1325 Ga0466964_0736770 3300044706 Bacteria 552
1326 Ga0466971_0144114 3300044719 Bacteria 1110
1327 Ga0466971_0224452 3300044719 Unclassified 891
1328 Ga0466968_0027489 3300044735 Bacteria 2342
1329 Ga0466968_0046132 3300044735 Bacteria 1851
1330 Ga0466968_0117146 3300044735 Unclassified 1203
1331 Ga0466968_0142424 3300044735 Unclassified 1097
1332 Ga0466970_0016182 3300044765 Unclassified 3842
1333 Ga0466970_0242029 3300044765 Bacteria 1010
1334 Ga0466957_0019251 3300044842 Bacteria 4015
1335 Ga0466957_0075311 3300044842 Unclassified 2094
1336 Ga0466957_0183008 3300044842 Bacteria 1369
1337 Ga0466957_0183040 3300044842 Unclassified 1369
1338 Ga0466957_0298889 3300044842 Bacteria 1081
1339 Ga0466957_0317723 3300044842 Bacteria 1050
1340 Ga0466957_0480830 3300044842 Bacteria 859
1341 Ga0466957_0664673 3300044842 Bacteria 733
1342 Ga0466957_0755974 3300044842 Bacteria 689
1343 Ga0466957_1119401 3300044842 Unclassified 568
1344 Ga0466960_0025586 3300044901 Bacteria 2672
1345 Ga0466960_0054678 3300044901 Unclassified 1939
1346 Ga0466960_0196058 3300044901 Bacteria 1101
1347 Ga0466960_0394268 3300044901 Bacteria 796
1348 Ga0466959_0022989 3300045049 Bacteria 4610
1349 Ga0466959_0185798 3300045049 Bacteria 1452
1350 Ga0466959_1123970 3300045049 Unclassified 522
1351 Ga0451576_0144297 3300045051 Bacteria 2482
1352 Ga0451576_1317862 3300045051 Bacteria 752
1353 Ga0451576_2642071 3300045051 Bacteria 512
1354 Ga0466958_0022336 3300045836 Bacteria 3705
1355 Ga0466958_0079748 3300045836 Bacteria 2013
1356 Ga0466958_0091737 3300045836 Unclassified 1881
1357 Ga0466958_0091870 3300045836 Unclassified 1879
1358 Ga0466958_0122391 3300045836 Unclassified 1629
1359 Ga0466958_0156642 3300045836 Unclassified 1438
1360 Ga0466958_0160033 3300045836 Bacteria 1422
1361 Ga0466958_0696156 3300045836 Bacteria 662
1362 Ga0466958_0822189 3300045836 Unclassified 606
1363 Ga0466967_0000648 3300045976 Bacteria 17473
1364 Ga0466967_0005057 3300045976 Bacteria 9044
1365 Ga0466967_0022282 3300045976 Bacteria 5165
1366 Ga0466967_0023072 3300045976 Bacteria 5093
1367 Ga0466967_0024240 3300045976 Bacteria 4986
1368 Ga0466967_0029014 3300045976 Bacteria 4625
1369 Ga0466967_0066322 3300045976 Bacteria 3216
1370 Ga0466967_0067554 3300045976 Bacteria 3189
1371 Ga0466967_0076699 3300045976 Bacteria 3007
1372 Ga0466967_0080031 3300045976 Bacteria 2947
1373 Ga0466967_0085775 3300045976 Bacteria 2851
1374 Ga0466967_0097688 3300045976 Bacteria 2681
1375 Ga0466967_0100171 3300045976 Bacteria 2647
1376 Ga0466967_0107193 3300045976 Bacteria 2562
1377 Ga0466967_0114681 3300045976 Bacteria 2481
1378 Ga0466967_0118295 3300045976 Bacteria 2444
1379 Ga0466967_0168883 3300045976 Bacteria 2057
1380 Ga0466967_0181871 3300045976 Bacteria 1983
1381 Ga0466967_0196051 3300045976 Unclassified 1911
1382 Ga0466967_0420525 3300045976 Bacteria 1302
1383 Ga0466967_0856428 3300045976 Bacteria 903
1384 Ga0466967_1175874 3300045976 Bacteria 764
1385 Ga0466967_1238906 3300045976 Unclassified 743
1386 Ga0495617_232252 3300046452 Unclassified 571
1387 Ga0495592_0057703 3300046454 Bacteria 2865
1388 Ga0495592_0096530 3300046454 Bacteria 2113
1389 Ga0495592_0477112 3300046454 Unclassified 777
1390 Ga0495603_0027930 3300046455 Bacteria 3403
1391 Ga0495590_0045844 3300046457 Unclassified 1525
1392 Ga0495590_0390171 3300046457 Bacteria 533
1393 Ga0495591_117065 3300046458 Unclassified 652
1394 Ga0495629_0001534 3300046459 Bacteria 18164
1395 Ga0495638_0606284 3300046460 Unclassified 537
1396 Ga0495641_0000634 3300046461 Bacteria 29644
1397 Ga0495641_0038789 3300046461 Bacteria 2224
1398 Ga0495651_0089649 3300046462 Bacteria 2308
1399 Ga0495651_0092854 3300046462 Unclassified 2260
1400 Ga0495651_0403143 3300046462 Unclassified 892
1401 Ga0495653_0033629 3300046463 Bacteria 4060
1402 Ga0495653_0036126 3300046463 Bacteria 3894
1403 Ga0495653_0082578 3300046463 Unclassified 2371
1404 Ga0495653_0087276 3300046463 Bacteria 2292
1405 Ga0495580_0252581 3300046472 Bacteria 1207
1406 Ga0495580_0404221 3300046472 Unclassified 920
1407 Ga0495582_0000041 3300046473 Bacteria 65919
1408 Ga0495582_0058402 3300046473 Bacteria 2127
1409 Ga0495582_0612761 3300046473 Bacteria 630
1410 Ga0495605_0039779 3300046474 Bacteria 2353
1411 Ga0495605_0218574 3300046474 Unclassified 824
1412 Ga0495639_0000616 3300046475 Bacteria 16538
1413 Ga0495639_0098150 3300046475 Bacteria 1381
1414 Ga0495662_0000805 3300046476 Bacteria 15225
1415 Ga0495662_0106325 3300046476 Bacteria 1374
1416 Ga0495664_0008900 3300046477 Bacteria 5610
1417 Ga0495664_0187080 3300046477 Bacteria 1255
1418 Ga0495664_0904364 3300046477 Unclassified 516
1419 Ga0495584_0084654 3300046491 Bacteria 1597
1420 Ga0495584_0132728 3300046491 Unclassified 1263
1421 Ga0495584_0244699 3300046491 Bacteria 912
1422 Ga0495584_0396172 3300046491 Bacteria 702
1423 Ga0495584_0624608 3300046491 Bacteria 549
1424 Ga0495585_0181927 3300046492 Unclassified 1080
1425 Ga0495585_0363787 3300046492 Bacteria 701
1426 Ga0495594_0077100 3300046499 Bacteria 1859
1427 Ga0495594_0386022 3300046499 Bacteria 797
1428 Ga0495596_0054557 3300046500 Bacteria 1563
1429 Ga0495596_0107330 3300046500 Unclassified 1084
1430 Ga0495596_0133404 3300046500 Bacteria 964
1431 Ga0495596_0332236 3300046500 Bacteria 591
1432 Ga0495596_0377000 3300046500 Bacteria 553
1433 Ga0495607_0210654 3300046501 Unclassified 956
1434 Ga0495608_0012187 3300046511 Bacteria 5975
1435 Ga0495608_0055687 3300046511 Unclassified 2613
1436 Ga0495608_0060546 3300046511 Bacteria 2491
1437 Ga0495616_0130617 3300046513 Unclassified 1151
1438 Ga0495618_0050411 3300046514 Bacteria 2629
1439 Ga0495618_0067553 3300046514 Bacteria 2273
1440 Ga0495620_0046531 3300046515 Bacteria 1873
1441 Ga0495620_0069802 3300046515 Unclassified 1440
1442 Ga0495628_0019330 3300046516 Bacteria 5633
1443 Ga0495628_0082548 3300046516 Bacteria 2496
1444 Ga0495628_1195090 3300046516 Bacteria 516
1445 Ga0495630_0009695 3300046517 Bacteria 6926
1446 Ga0495630_0010811 3300046517 Bacteria 6590
1447 Ga0495630_0033795 3300046517 Bacteria 3814
1448 Ga0495630_0037580 3300046517 Bacteria 3620
1449 Ga0495630_0052291 3300046517 Bacteria 3058
1450 Ga0495630_0417912 3300046517 Bacteria 1027
1451 Ga0495631_0043502 3300046518 Unclassified 1981
1452 Ga0495631_0407507 3300046518 Unclassified 579
1453 Ga0495637_0008598 3300046520 Bacteria 5010
1454 Ga0495637_0191837 3300046520 Bacteria 754
1455 Ga0495637_0215434 3300046520 Bacteria 701
1456 Ga0495643_0339422 3300046522 Unclassified 675
1457 Ga0495644_0076077 3300046523 Unclassified 1264
1458 Ga0495644_0131625 3300046523 Bacteria 953
1459 Ga0495644_0156161 3300046523 Bacteria 874
1460 Ga0495644_0271456 3300046523 Bacteria 661
1461 Ga0495644_0377472 3300046523 Bacteria 560
1462 Ga0495663_0026751 3300046525 Unclassified 1690
1463 Ga0495663_0223651 3300046525 Bacteria 662
1464 Ga0495666_0003576 3300046526 Bacteria 7857
1465 Ga0495666_0145108 3300046526 Bacteria 1105
1466 Ga0495642_0088262 3300046528 Bacteria 1311
1467 Ga0495652_0075905 3300046529 Bacteria 2790
1468 Ga0495652_0096763 3300046529 Bacteria 2403
1469 Ga0495654_0135920 3300046530 Unclassified 1100
1470 Ga0495665_0000948 3300046531 Bacteria 15293
1471 Ga0495665_0311918 3300046531 Bacteria 804
1472 Ga0495640_0005396 3300046533 Bacteria 10174
1473 Ga0495640_0013669 3300046533 Bacteria 6169
1474 Ga0495640_0246708 3300046533 Bacteria 1120
1475 Ga0495640_0410476 3300046533 Unclassified 830
1476 Ga0495587_0015391 3300046536 Bacteria 4778
1477 Ga0495587_0043037 3300046536 Bacteria 2691
1478 Ga0495598_0011663 3300046537 Unclassified 2137
1479 Ga0495609_0061834 3300046538 Unclassified 1654
1480 Ga0495609_0229633 3300046538 Bacteria 769
1481 Ga0495645_0100217 3300046543 Bacteria 2060
1482 Ga0495645_0395528 3300046543 Bacteria 881
1483 Ga0495645_0422118 3300046543 Unclassified 846
1484 Ga0495633_0076235 3300046558 Unclassified 1561
1485 Ga0495633_0526382 3300046558 Bacteria 533
1486 Ga0495667_0006769 3300046559 Bacteria 7781
1487 Ga0495667_0006801 3300046559 Bacteria 7763
1488 Ga0495667_0124818 3300046559 Unclassified 1661
1489 Ga0495667_0136955 3300046559 Bacteria 1578
1490 Ga0495667_0525170 3300046559 Bacteria 740
1491 Ga0495667_0603389 3300046559 Bacteria 684
1492 Ga0495656_0032966 3300046615 Bacteria 2111
1493 Ga0495668_0103060 3300046616 Unclassified 1561
1494 Ga0495634_0019887 3300046642 Bacteria 4766
1495 Ga0495634_0047336 3300046642 Bacteria 2898
1496 Ga0495611_0059244 3300046648 Bacteria 1738
1497 Ga0495611_0419099 3300046648 Bacteria 611
1498 Ga0495635_0007608 3300046663 Bacteria 7558
1499 Ga0495635_0010696 3300046663 Bacteria 6425
1500 Ga0495635_0016610 3300046663 Bacteria 5141
1501 Ga0495635_0054666 3300046663 Bacteria 2750
1502 Ga0495659_0027100 3300046664 Unclassified 1974
1503 Ga0495659_0030398 3300046664 Bacteria 1880
1504 Ga0495588_0162295 3300046674 Bacteria 1182
1505 Ga0495657_0354853 3300046675 Bacteria 867
1506 Ga0495657_0366400 3300046675 Bacteria 851
1507 Ga0495599_0026581 3300046678 Bacteria 3627
1508 Ga0495599_0879388 3300046678 Unclassified 508
1509 Ga0495623_0243689 3300046679 Bacteria 1014
1510 Ga0495646_0072746 3300046680 Bacteria 2021
1511 Ga0495647_0015964 3300046681 Bacteria 2638
1512 Ga0495647_0366852 3300046681 Bacteria 657
1513 Ga0495658_0000230 3300046683 Bacteria 32067
1514 Ga0495658_0553228 3300046683 Bacteria 737
1515 Ga0495669_0167450 3300046684 Unclassified 1044
1516 Ga0495669_0664237 3300046684 Bacteria 507
1517 Ga0495613_0002261 3300046689 Bacteria 14563
1518 Ga0495613_0069279 3300046689 Bacteria 2572
1519 Ga0495613_0097965 3300046689 Bacteria 2119
1520 Ga0495613_0354532 3300046689 Bacteria 1007
1521 Ga0495624_0034413 3300046690 Bacteria 3277
1522 Ga0495624_0042480 3300046690 Bacteria 2905
1523 Ga0495624_0071490 3300046690 Bacteria 2159
1524 Ga0495624_0135871 3300046690 Bacteria 1507
1525 Ga0495670_0061845 3300046691 Bacteria 1883
1526 Ga0495670_0113978 3300046691 Bacteria 1401
1527 Ga0495670_0130226 3300046691 Bacteria 1311
1528 Ga0495670_0394356 3300046691 Unclassified 747
1529 Ga0495671_0207562 3300046692 Unclassified 949
1530 Ga0495589_0186510 3300046794 Unclassified 982
1531 Ga0495589_0216702 3300046794 Bacteria 900
1532 Ga0495589_0249759 3300046794 Bacteria 829
1533 Ga0495589_0271721 3300046794 Bacteria 789
1534 Ga0495589_0600744 3300046794 Bacteria 501
1535 Ga0495600_0009782 3300046809 Bacteria 5928
1536 Ga0495600_0071819 3300046809 Bacteria 2261
1537 Ga0495600_0328083 3300046809 Bacteria 961
1538 Ga0495660_0044290 3300046810 Bacteria 2449
1539 Ga0495581_0001492 3300047315 Bacteria 13017
1540 Ga0495581_0006215 3300047315 Bacteria 6927
1541 Ga0495581_0631063 3300047315 Bacteria 620
1542 Ga0495604_0004934 3300047317 Bacteria 10580
1543 Ga0495636_0028072 3300047318 Unclassified 2293
1544 Ga0495636_0433675 3300047318 Bacteria 629
1545 Ga0495674_0003506 3300047319 Bacteria 15271
1546 Ga0495674_0014037 3300047319 Bacteria 7509
1547 Ga0495674_0025916 3300047319 Bacteria 5367
1548 Ga0495674_0061536 3300047319 Bacteria 3271
1549 Ga0495674_0257678 3300047319 Bacteria 1434
1550 Ga0495674_0312471 3300047319 Bacteria 1282
1551 Ga0495674_0404015 3300047319 Bacteria 1102
1552 Ga0495672_0047592 3300047320 Bacteria 2549
1553 Ga0495672_0097048 3300047320 Bacteria 1606
1554 Ga0495672_0328172 3300047320 Unclassified 717
1555 Ga0495676_0003276 3300047321 Bacteria 14628
1556 Ga0495676_0143321 3300047321 Bacteria 1710
1557 Ga0495676_0160306 3300047321 Bacteria 1592
1558 Ga0495680_0000521 3300047322 Bacteria 43463
1559 Ga0495680_0011431 3300047322 Bacteria 7859
1560 Ga0495680_0013248 3300047322 Bacteria 7204
1561 Ga0495680_0028536 3300047322 Bacteria 4574
1562 Ga0495680_0140083 3300047322 Unclassified 1770
1563 Ga0495683_0146492 3300047323 Unclassified 1103
1564 Ga0495675_0021501 3300047444 Bacteria 4109
1565 Ga0495675_0232831 3300047444 Bacteria 1111
1566 Ga0495677_0063993 3300047445 Unclassified 1366
1567 Ga0495679_068998 3300047446 Unclassified 1022
1568 Ga0495685_062706 3300047447 Unclassified 1251
1569 Ga0495681_0184959 3300047470 Unclassified 854
1570 Ga0495684_0009608 3300047471 Bacteria 7458
1571 Ga0495684_0020048 3300047471 Bacteria 5151
1572 Ga0495684_0051883 3300047471 Unclassified 3130
1573 Ga0495684_0092681 3300047471 Bacteria 2288
1574 Ga0495684_0748774 3300047471 Bacteria 643
1575 Ga0495602_0065858 3300048088 Bacteria 3124
1576 Ga0495602_0190273 3300048088 Bacteria 1574
1577 Ga0495602_1115762 3300048088 Bacteria 516
1578 Ga0495614_0014438 3300048089 Bacteria 3457
1579 Ga0495614_0058642 3300048089 Bacteria 1653
1580 Ga0495615_0220489 3300048090 Bacteria 592
1581 Ga0495615_0308307 3300048090 Bacteria 514
1582 Ga0495626_0047440 3300048091 Bacteria 1997
1583 Ga0496100_0002332 3300048903 Bacteria 9601
1584 Ga0496100_0005021 3300048903 Bacteria 7081
1585 Ga0496100_0013924 3300048903 Bacteria 4655
1586 Ga0496100_0013955 3300048903 Bacteria 4651
1587 Ga0496100_0106039 3300048903 Bacteria 1944
1588 Ga0496100_0576515 3300048903 Bacteria 872
1589 Ga0496100_0882414 3300048903 Bacteria 702
1590 Ga0496100_1010670 3300048903 Bacteria 654
1591 Ga0496101_0010235 3300048904 Bacteria 6190
1592 Ga0496101_0025266 3300048904 Bacteria 4119
1593 Ga0496101_0031082 3300048904 Bacteria 3750
1594 Ga0496101_0049497 3300048904 Bacteria 3023
1595 Ga0496101_0057179 3300048904 Bacteria 2820
1596 Ga0496101_0091160 3300048904 Unclassified 2268
1597 Ga0496101_0163902 3300048904 Bacteria 1706
1598 Ga0496101_0233618 3300048904 Bacteria 1430
1599 Ga0496101_0267975 3300048904 Unclassified 1333
1600 Ga0496101_0292547 3300048904 Bacteria 1274
1601 Ga0496101_1190624 3300048904 Bacteria 597
1602 Ga0496102_0002937 3300048905 Bacteria 14456
1603 Ga0496102_0033185 3300048905 Bacteria 4638
1604 Ga0496102_0071007 3300048905 Bacteria 3197
1605 Ga0496102_0077466 3300048905 Bacteria 3060
1606 Ga0496102_0131858 3300048905 Bacteria 2340
1607 Ga0496102_0380971 3300048905 Bacteria 1327
1608 Ga0496102_0601603 3300048905 Bacteria 1023
1609 Ga0496102_0698942 3300048905 Bacteria 937
1610 Ga0496103_0001614 3300048906 Bacteria 14805
1611 Ga0496103_0014534 3300048906 Bacteria 4674
1612 Ga0496103_0018880 3300048906 Bacteria 4140
1613 Ga0496103_0052355 3300048906 Unclassified 2528
1614 Ga0496103_0483712 3300048906 Bacteria 793
1615 Ga0496103_1013769 3300048906 Unclassified 516
1616 Ga0496104_0005516 3300048907 Bacteria 11081
1617 Ga0496104_0014035 3300048907 Bacteria 7230
1618 Ga0496104_0015209 3300048907 Bacteria 6967
1619 Ga0496104_0034799 3300048907 Bacteria 4699
1620 Ga0496104_0036463 3300048907 Bacteria 4598
1621 Ga0496104_0055819 3300048907 Bacteria 3734
1622 Ga0496104_0157455 3300048907 Bacteria 2180
1623 Ga0496104_0421722 3300048907 Bacteria 1246
1624 Ga0496104_0870183 3300048907 Bacteria 806
1625 Ga0496104_1272806 3300048907 Bacteria 639
1626 Ga0496104_1654741 3300048907 Bacteria 543
1627 Ga0496105_0010678 3300048908 Bacteria 7225
1628 Ga0496105_0027980 3300048908 Bacteria 4609
1629 Ga0496105_0070252 3300048908 Bacteria 2894
1630 Ga0496105_0093354 3300048908 Bacteria 2485
1631 Ga0496105_0110363 3300048908 Bacteria 2270
1632 Ga0496105_0122950 3300048908 Bacteria 2140
1633 Ga0496105_0304107 3300048908 Bacteria 1281
1634 Ga0496105_0499602 3300048908 Bacteria 955
1635 Ga0496106_0009352 3300048909 Bacteria 7245
1636 Ga0496106_0011541 3300048909 Bacteria 6531
1637 Ga0496106_0186802 3300048909 Bacteria 1646
1638 Ga0496106_0208317 3300048909 Bacteria 1557
1639 Ga0496106_0209843 3300048909 Unclassified 1551
1640 Ga0496106_0413942 3300048909 Unclassified 1083
1641 Ga0496106_1125642 3300048909 Unclassified 614
1642 Ga0496107_0006841 3300048910 Bacteria 7853
1643 Ga0496107_0009060 3300048910 Bacteria 6899
1644 Ga0496107_0029576 3300048910 Bacteria 3898
1645 Ga0496107_0074957 3300048910 Bacteria 2462
1646 Ga0496107_0085174 3300048910 Bacteria 2306
1647 Ga0496107_0477612 3300048910 Unclassified 925
1648 Ga0496107_0883198 3300048910 Unclassified 652
1649 Ga0496108_0000654 3300048911 Bacteria 26739
1650 Ga0496108_0002430 3300048911 Bacteria 14893
1651 Ga0496108_0047226 3300048911 Bacteria 3599
1652 Ga0496108_0133994 3300048911 Bacteria 2130
1653 Ga0496108_0137631 3300048911 Bacteria 2102
1654 Ga0496108_0172223 3300048911 Bacteria 1873
1655 Ga0496108_0293151 3300048911 Bacteria 1416
1656 Ga0496108_0364719 3300048911 Unclassified 1261
1657 Ga0496108_0518754 3300048911 Bacteria 1040
1658 Ga0496109_0002798 3300048912 Bacteria 14606
1659 Ga0496109_0012171 3300048912 Bacteria 7421
1660 Ga0496109_0013542 3300048912 Bacteria 7080
1661 Ga0496109_0016655 3300048912 Bacteria 6429
1662 Ga0496109_0024106 3300048912 Bacteria 5406
1663 Ga0496109_0030375 3300048912 Bacteria 4843
1664 Ga0496109_0037518 3300048912 Bacteria 4378
1665 Ga0496109_0038589 3300048912 Bacteria 4319
1666 Ga0496109_0053942 3300048912 Bacteria 3668
1667 Ga0496109_0113783 3300048912 Bacteria 2517
1668 Ga0496109_0204500 3300048912 Bacteria 1856
1669 Ga0496109_0259359 3300048912 Bacteria 1637
1670 Ga0496109_0625409 3300048912 Bacteria 1013
1671 Ga0496110_0001043 3300048913 Bacteria 19527
1672 Ga0496110_0001883 3300048913 Bacteria 15494
1673 Ga0496110_0003760 3300048913 Bacteria 11694
1674 Ga0496110_0014925 3300048913 Bacteria 6457
1675 Ga0496110_0024135 3300048913 Bacteria 5180
1676 Ga0496110_0043790 3300048913 Bacteria 3908
1677 Ga0496110_0247362 3300048913 Unclassified 1623
1678 Ga0496110_0281435 3300048913 Bacteria 1514
1679 Ga0496110_0361662 3300048913 Bacteria 1322
1680 Ga0496110_0368488 3300048913 Bacteria 1309
1681 Ga0496111_0000185 3300048914 Bacteria 28524
1682 Ga0496111_0002354 3300048914 Bacteria 11392
1683 Ga0496111_0007396 3300048914 Bacteria 7194
1684 Ga0496111_0017850 3300048914 Bacteria 4908
1685 Ga0496111_0027681 3300048914 Bacteria 4013
1686 Ga0496111_0069515 3300048914 Bacteria 2561
1687 Ga0496111_0105136 3300048914 Bacteria 2077
1688 Ga0496111_0127162 3300048914 Bacteria 1884
1689 Ga0496111_0145866 3300048914 Bacteria 1755
1690 Ga0496111_0153237 3300048914 Unclassified 1710
1691 Ga0496111_0282500 3300048914 Unclassified 1231
1692 Ga0496111_0537980 3300048914 Bacteria 858
1693 Ga0496111_0707391 3300048914 Unclassified 732
1694 Ga0496112_0004986 3300048915 Bacteria 11383
1695 Ga0496112_0010630 3300048915 Bacteria 8360
1696 Ga0496112_0026171 3300048915 Bacteria 5610
1697 Ga0496112_0027194 3300048915 Bacteria 5516
1698 Ga0496112_0037845 3300048915 Bacteria 4711
1699 Ga0496112_0087398 3300048915 Bacteria 3084
1700 Ga0496112_0091755 3300048915 Unclassified 3006
1701 Ga0496112_0092642 3300048915 Unclassified 2991
1702 Ga0496112_0160098 3300048915 Bacteria 2217
1703 Ga0496112_0163749 3300048915 Bacteria 2190
1704 Ga0496112_0226499 3300048915 Bacteria 1825
1705 Ga0496112_0360693 3300048915 Unclassified 1395
1706 Ga0496112_0428372 3300048915 Bacteria 1261
1707 Ga0496112_0782268 3300048915 Unclassified 879
1708 Ga0496112_1008376 3300048915 Unclassified 752
1709 Ga0496112_1166626 3300048915 Bacteria 687
1710 Ga0496113_0003813 3300048916 Bacteria 9121
1711 Ga0496113_0010963 3300048916 Bacteria 6020
1712 Ga0496113_0038773 3300048916 Bacteria 3504
1713 Ga0496113_0074078 3300048916 Unclassified 2595
1714 Ga0496113_0171295 3300048916 Bacteria 1719
1715 Ga0496113_0460268 3300048916 Unclassified 1022
1716 Ga0496114_0003803 3300048917 Bacteria 11641
1717 Ga0496114_0010950 3300048917 Bacteria 7231
1718 Ga0496114_0035029 3300048917 Bacteria 4144
1719 Ga0496114_0073138 3300048917 Bacteria 2884
1720 Ga0496114_0102340 3300048917 Bacteria 2447
1721 Ga0496114_0108216 3300048917 Bacteria 2379
1722 Ga0496114_0177986 3300048917 Bacteria 1856
1723 Ga0496114_0471620 3300048917 Bacteria 1111
1724 Ga0496114_0506190 3300048917 Bacteria 1068
1725 Ga0496114_0663439 3300048917 Bacteria 916
1726 Ga0496114_0772276 3300048917 Unclassified 839
1727 Ga0496115_0009651 3300048918 Bacteria 7181
1728 Ga0496115_0016074 3300048918 Bacteria 5691
1729 Ga0496115_0025999 3300048918 Bacteria 4563
1730 Ga0496115_0061248 3300048918 Unclassified 3034
1731 Ga0501290_078862 3300049513 Bacteria 558
1732 Ga0501300_066172 3300049523 Unclassified 579
1733 Ga0501311_081133 3300049527 Bacteria 552
1734 Ga0501317_085225 3300049533 Unclassified 552
1735 Ga0501320_067986 3300049536 Unclassified 511
1736 Ga0501031_0151420 3300049568 Bacteria 1516
1737 Ga0501031_0176762 3300049568 Bacteria 1395
1738 Ga0501031_1036008 3300049568 Bacteria 524
1739 Ga0501033_0126656 3300049570 Bacteria 1852
1740 Ga0501033_0423655 3300049570 Bacteria 927
1741 Ga0501034_0002607 3300049571 Bacteria 21420
1742 Ga0501036_0338224 3300049572 Bacteria 1257
1743 Ga0501036_0610949 3300049572 Unclassified 904
1744 Ga0501036_0851716 3300049572 Bacteria 749
1745 Ga0501037_0747106 3300049573 Bacteria 648
1746 Ga0501038_0325699 3300049574 Bacteria 1201
1747 Ga0501038_0604176 3300049574 Bacteria 830
1748 Ga0501038_0669436 3300049574 Bacteria 780
1749 Ga0501039_0115489 3300049575 Bacteria 2101
1750 Ga0501039_0460072 3300049575 Unclassified 999
1751 Ga0501039_0870216 3300049575 Bacteria 702
1752 Ga0501039_1329807 3300049575 Bacteria 554
1753 Ga0501040_0057771 3300049576 Bacteria 2664
1754 Ga0501040_0827480 3300049576 Bacteria 670
1755 Ga0501040_1238986 3300049576 Bacteria 541
1756 Ga0501041_0034630 3300049577 Bacteria 3058
1757 Ga0501042_0056258 3300049578 Bacteria 2807
1758 Ga0501042_0100926 3300049578 Bacteria 2075
1759 Ga0501042_0102890 3300049578 Bacteria 2055
1760 Ga0501043_0275034 3300049579 Bacteria 1292
1761 Ga0501043_0647683 3300049579 Bacteria 776
1762 Ga0501046_0086652 3300049580 Bacteria 2414
1763 Ga0501046_0422391 3300049580 Unclassified 961
1764 Ga0501046_1216392 3300049580 Bacteria 517
1765 Ga0501047_0050286 3300049581 Bacteria 4025
1766 Ga0501047_0153138 3300049581 Bacteria 2180
1767 Ga0501047_0356905 3300049581 Bacteria 1298
1768 Ga0501048_0045475 3300049582 Bacteria 3136
1769 Ga0501048_0176566 3300049582 Bacteria 1514
1770 Ga0501048_0180171 3300049582 Bacteria 1498
1771 Ga0501067_0006414 3300049583 Bacteria 6516
1772 Ga0501067_0119012 3300049583 Bacteria 1469
1773 Ga0501067_0282324 3300049583 Bacteria 924
1774 Ga0501068_0029729 3300049584 Bacteria 3237
1775 Ga0501069_0010802 3300049585 Bacteria 4841
1776 Ga0501069_0081900 3300049585 Unclassified 1818
1777 Ga0501069_0240130 3300049585 Bacteria 1056
1778 Ga0501069_0262639 3300049585 Bacteria 1008
1779 Ga0501069_0658110 3300049585 Bacteria 631
1780 Ga0501070_0024322 3300049586 Bacteria 5080
1781 Ga0501070_0026259 3300049586 Bacteria 4889
1782 Ga0501070_0069129 3300049586 Bacteria 2924
1783 Ga0501070_0089569 3300049586 Bacteria 2546
1784 Ga0501070_0203130 3300049586 Bacteria 1627
1785 Ga0501070_0401587 3300049586 Unclassified 1108
1786 Ga0501071_0198887 3300049587 Bacteria 1505
1787 Ga0501071_0399987 3300049587 Unclassified 1049
1788 Ga0501071_0552819 3300049587 Bacteria 884
1789 Ga0501071_0650799 3300049587 Bacteria 811
1790 Ga0501071_0901722 3300049587 Bacteria 682
1791 Ga0501072_0017987 3300049588 Bacteria 5434
1792 Ga0501072_0060596 3300049588 Bacteria 2984
1793 Ga0501072_0147858 3300049588 Bacteria 1873
1794 Ga0501072_0180091 3300049588 Bacteria 1686
1795 Ga0501072_0699099 3300049588 Unclassified 797
1796 Ga0501072_0926230 3300049588 Unclassified 680
1797 Ga0501073_0025031 3300049589 Bacteria 4283
1798 Ga0501073_0095561 3300049589 Unclassified 2064
1799 Ga0501074_0044931 3300049590 Bacteria 3196
1800 Ga0501074_0074051 3300049590 Bacteria 2445
1801 Ga0501074_0218039 3300049590 Unclassified 1359
1802 Ga0501074_0344366 3300049590 Bacteria 1058
1803 Ga0501074_0589765 3300049590 Bacteria 786
1804 Ga0501074_0612763 3300049590 Bacteria 770
1805 Ga0501074_0629608 3300049590 Unclassified 758
1806 Ga0501074_0645054 3300049590 Bacteria 748
1807 Ga0501075_0056530 3300049591 Bacteria 2954
1808 Ga0501075_0060095 3300049591 Bacteria 2864
1809 Ga0501075_0189699 3300049591 Bacteria 1568
1810 Ga0501075_0417473 3300049591 Bacteria 1023
1811 Ga0501075_0672457 3300049591 Bacteria 789
1812 Ga0501075_0906527 3300049591 Bacteria 670
1813 Ga0501075_1478257 3300049591 Bacteria 514
1814 Ga0501075_1497182 3300049591 Unclassified 511
1815 Ga0501076_0003024 3300049592 Bacteria 11684
1816 Ga0501076_0331672 3300049592 Bacteria 1248
1817 Ga0501076_0594169 3300049592 Bacteria 913
1818 Ga0501076_0758956 3300049592 Bacteria 800
1819 Ga0501077_0272084 3300049593 Unclassified 1078
1820 Ga0501077_0349046 3300049593 Bacteria 944
1821 Ga0501077_0405042 3300049593 Bacteria 872
1822 Ga0501077_0918466 3300049593 Unclassified 563
1823 Ga0501206_104648 3300049653 Bacteria 517
1824 Ga0501214_070599 3300049659 Unclassified 570
1825 Ga0501217_163530 3300049661 Bacteria 673
1826 Ga0501253_132060 3300049683 Bacteria 615
1827 Ga0501260_046275 3300049689 Unclassified 539
1828 Ga0501221_036754 3300049704 Bacteria 1051
1829 Ga0501245_040026 3300049708 Bacteria 803
1830 Ga0501079_0010185 3300049741 Bacteria 7137
1831 Ga0501079_0203861 3300049741 Bacteria 1545
1832 Ga0501079_0227271 3300049741 Bacteria 1458
1833 Ga0501079_0751300 3300049741 Unclassified 768
1834 Ga0501079_1655581 3300049741 Bacteria 503
1835 Ga0501080_0001559 3300049742 Bacteria 19371
1836 Ga0501080_0072319 3300049742 Bacteria 3208
1837 Ga0501080_0077249 3300049742 Bacteria 3096
1838 Ga0501080_0552552 3300049742 Bacteria 1025
1839 Ga0501080_0564702 3300049742 Bacteria 1013
1840 Ga0501080_1305676 3300049742 Bacteria 621
1841 Ga0501081_0070749 3300049743 Bacteria 2431
1842 Ga0501081_0822816 3300049743 Bacteria 699
1843 Ga0501083_0009330 3300049744 Bacteria 6926
1844 Ga0501271_015111 3300049768 Bacteria 860
1845 Ga0501275_011525 3300049772 Bacteria 961
1846 Ga0501275_029791 3300049772 Bacteria 717
1847 Ga0501035_0311358 3300049822 Bacteria 1325
1848 Ga0501035_0561404 3300049822 Bacteria 934
1849 Ga0501035_0706317 3300049822 Bacteria 813
1850 Ga0501044_0235687 3300049823 Bacteria 1776
1851 Ga0501044_1054356 3300049823 Bacteria 683
1852 Ga0501045_0055827 3300049824 Bacteria 2888
1853 Ga0501045_0259140 3300049824 Bacteria 1294
1854 Ga0501212_053227 3300049851 Bacteria 689
1855 nmdc:mga03n38_351972_c1 3300050490 Bacteria 802
1856 nmdc:mga00v17_387579_c1 3300050491 Bacteria 908
1857 nmdc:mga00v17_86460_c1 3300050491 Unclassified 1965
1858 nmdc:mga0yw44_80537_c1 3300050492 Bacteria 2040
1859 nmdc:mga06z11_56682_c1 3300050494 Bacteria 2027
1860 nmdc:mga04h51_315900_c1 3300050495 Bacteria 639
1861 nmdc:mga05p37_1109532_c1 3300050507 Bacteria 827
1862 nmdc:mga05p37_1203841_c1 3300050507 Bacteria 782
1863 nmdc:mga05p37_1224257_c1 3300050507 Unclassified 773
1864 nmdc:mga05p37_1262237_c1 3300050507 Bacteria 757
1865 nmdc:mga05p37_149800_c1 3300050507 Bacteria 2855
1866 nmdc:mga05p37_170716_c1 3300050507 Bacteria 2652
1867 nmdc:mga05p37_1868039_c1 3300050507 Bacteria 576
1868 nmdc:mga05p37_246225_c1 3300050507 Bacteria 2146
1869 nmdc:mga05p37_492557_c1 3300050507 Bacteria 1409
1870 nmdc:mga05p37_4971_c1 3300050507 Bacteria 15580
1871 nmdc:mga05p37_62009_c1 3300050507 Bacteria 4602
1872 nmdc:mga05p37_7365_c1 3300050507 Bacteria 12978
1873 nmdc:mga05p37_761181_c1 3300050507 Bacteria 1066
1874 nmdc:mga05p37_77309_c1 3300050507 Bacteria 4098
1875 nmdc:mga05p37_84532_c1 3300050507 Bacteria 3910
1876 nmdc:mga09592_102699_c1 3300050508 Bacteria 2449
1877 nmdc:mga09592_1162385_c1 3300050508 Bacteria 639
1878 nmdc:mga09592_232348_c1 3300050508 Bacteria 1598
1879 nmdc:mga09592_72196_c1 3300050508 Bacteria 2931
1880 nmdc:mga09592_916500_c1 3300050508 Bacteria 736
1881 nmdc:mga0qj67_127369_c1 3300050509 Bacteria 2061
1882 nmdc:mga0qj67_1408402_c1 3300050509 Bacteria 538
1883 nmdc:mga0qj67_209527_c1 3300050509 Bacteria 1583
1884 nmdc:mga0qj67_226189_c1 3300050509 Bacteria 1518
1885 nmdc:mga0qj67_24466_c1 3300050509 Bacteria 4655
1886 nmdc:mga0qj67_32683_c1 3300050509 Bacteria 4059
1887 nmdc:mga0qj67_362303_c1 3300050509 Bacteria 1171
1888 nmdc:mga0qj67_75256_c1 3300050509 Bacteria 2699
1889 nmdc:mga06r32_1145465_c1 3300050510 Unclassified 726
1890 nmdc:mga06r32_121829_c1 3300050510 Bacteria 2573
1891 nmdc:mga06r32_1437520_c1 3300050510 Bacteria 631
1892 nmdc:mga06r32_1556444_c1 3300050510 Bacteria 600
1893 nmdc:mga06r32_1789960_c1 3300050510 Bacteria 550
1894 nmdc:mga06r32_372967_c1 3300050510 Bacteria 1410
1895 nmdc:mga06r32_466067_c1 3300050510 Bacteria 1242
1896 nmdc:mga08y16_1257543_c1 3300050511 Bacteria 709
1897 nmdc:mga08y16_1262508_c1 3300050511 Bacteria 707
1898 nmdc:mga08y16_1809560_c1 3300050511 Bacteria 564
1899 nmdc:mga08y16_26832_c1 3300050511 Bacteria 6070
1900 nmdc:mga08y16_44850_c1 3300050511 Bacteria 4634
1901 nmdc:mga08y16_54775_c1 3300050511 Bacteria 4168
1902 nmdc:mga08y16_690772_c1 3300050511 Bacteria 1021
1903 nmdc:mga08y16_860011_c1 3300050511 Unclassified 896
1904 nmdc:mga0n895_121245_c1 3300050512 Bacteria 2636
1905 nmdc:mga0n895_1681299_c1 3300050512 Bacteria 598
1906 nmdc:mga0n895_276020_c1 3300050512 Bacteria 1705
1907 nmdc:mga0n895_87414_c1 3300050512 Unclassified 3115
1908 nmdc:mga0rr50_1412660_c1 3300050513 Bacteria 589
1909 nmdc:mga0rr50_295337_c1 3300050513 Bacteria 1355
1910 nmdc:mga0rr50_390262_c1 3300050513 Unclassified 1175
1911 nmdc:mga0rr50_427873_c1 3300050513 Bacteria 1120
1912 nmdc:mga0rr50_522876_c1 3300050513 Bacteria 1009
1913 nmdc:mga0rr50_580693_c1 3300050513 Bacteria 955
1914 nmdc:mga0rr50_610029_c1 3300050513 Unclassified 931
1915 nmdc:mga08x19_225124_c1 3300050514 Bacteria 1290
1916 nmdc:mga08x19_48942_c1 3300050514 Bacteria 2709
1917 nmdc:mga08x19_8549_c1 3300050514 Bacteria 6100
1918 nmdc:mga0a205_1198984_c1 3300050515 Bacteria 607
1919 nmdc:mga0a205_175073_c1 3300050515 Bacteria 2041
1920 nmdc:mga0a205_182072_c1 3300050515 Bacteria 1995
1921 nmdc:mga0a205_198097_c1 3300050515 Bacteria 1899
1922 nmdc:mga0a205_290404_c1 3300050515 Unclassified 1510
1923 nmdc:mga0a205_397506_c1 3300050515 Bacteria 1242
1924 nmdc:mga0a205_5684_c1 3300050515 Bacteria 11235
1925 nmdc:mga0a205_77948_c1 3300050515 Bacteria 3201
1926 Ga0495601_0070860 3300053077 Bacteria 2225
1927 Ga0495601_0338962 3300053077 Bacteria 978
1928 Ga0495655_0221643 3300053083 Unclassified 626
1929 Ga0495595_0002879 3300053084 Bacteria 6785
1930 Ga0495595_0016698 3300053084 Bacteria 3146
1931 Ga0495595_0085481 3300053084 Bacteria 1508
1932 Ga0495619_0004699 3300053085 Bacteria 8701
1933 Ga0495619_0005606 3300053085 Bacteria 7964
1934 Ga0495619_0007224 3300053085 Bacteria 7038
1935 Ga0495619_0054756 3300053085 Bacteria 2641
1936 Ga0495619_0293361 3300053085 Bacteria 1127
1937 Ga0501084_0051144 3300054114 Bacteria 3458
1938 Ga0501084_0141913 3300054114 Bacteria 2023
1939 Ga0501084_0169019 3300054114 Bacteria 1846
1940 Ga0501084_0409516 3300054114 Bacteria 1146
1941 Ga0501084_1346918 3300054114 Unclassified 598
1942 Ga0590075_045881 3300059424 Unclassified 1119
1943 Ga0590077_035030 3300059426 Unclassified 1105
1944 Ga0587084_040057 3300059477 Bacteria 792
1945 Ga0587084_051071 3300059477 Bacteria 732
1946 Ga0587084_102593 3300059477 Unclassified 582
1947 Ga0587084_138049 3300059477 Unclassified 526
1948 Ga0587066_108855 3300059490 Bacteria 640
1949 Ga0587066_217442 3300059490 Bacteria 511
1950 Ga0587070_101082 3300059491 Bacteria 663
1951 Ga0587070_214108 3300059491 Unclassified 519
1952 Ga0587073_0203116 3300059492 Bacteria 595
1953 Ga0587073_0292096 3300059492 Bacteria 527
1954 Ga0587077_095102 3300059493 Bacteria 707
1955 Ga0587077_212906 3300059493 Unclassified 541
1956 Ga0587080_061336 3300059503 Bacteria 733
1957 Ga0587080_101725 3300059503 Bacteria 616
1958 Ga0587080_141572 3300059503 Bacteria 550
1959 Ga0587080_146095 3300059503 Bacteria 544
1960 Ga0587082_161433 3300059504 Bacteria 537
1961 Ga0587085_074572 3300059506 Bacteria 671
1962 Ga0587085_172658 3300059506 Bacteria 513
1963 Ga0587088_151909 3300059508 Unclassified 561
1964 Ga0587090_009608 3300059510 Bacteria 1324
1965 Ga0587090_119262 3300059510 Unclassified 571
1966 Ga0587091_048029 3300059511 Unclassified 867
1967 Ga0587091_067568 3300059511 Bacteria 774
1968 Ga0587091_079722 3300059511 Bacteria 732
1969 Ga0587092_146162 3300059512 Bacteria 525
1970 Ga0587092_160686 3300059512 Bacteria 508
1971 Ga0587094_117740 3300059513 Bacteria 529
1972 Ga0587106_053879 3300059605 Unclassified 721
1973 Ga0587106_083455 3300059605 Bacteria 626
1974 Ga0587125_039416 3300059607 Bacteria 633
1975 Ga0587101_153969 3300059623 Unclassified 500
1976 Ga0587109_213982 3300059624 Bacteria 508
1977 Ga0587113_031987 3300059625 Bacteria 600
1978 Ga0587115_048274 3300059626 Unclassified 685
1979 Ga0587115_077529 3300059626 Bacteria 584
1980 Ga0587128_077829 3300059630 Bacteria 658
1981 Ga0587128_101224 3300059630 Bacteria 604
1982 Ga0587130_025002 3300059631 Unclassified 665
1983 Ga0587067_023074 3300059640 Bacteria 1088
1984 Ga0587067_065792 3300059640 Bacteria 771
1985 Ga0587067_099799 3300059640 Bacteria 670
1986 Ga0587067_112104 3300059640 Unclassified 645
1987 Ga0587068_113559 3300059641 Bacteria 581
1988 Ga0587072_203833 3300059643 Unclassified 504
1989 Ga0587072_207240 3300059643 Bacteria 501
1990 Ga0587075_133276 3300059644 Bacteria 525
1991 Ga0587076_137506 3300059645 Bacteria 581
1992 Ga0587076_198366 3300059645 Bacteria 515
1993 Ga0587078_045332 3300059646 Bacteria 632
1994 Ga0587078_066884 3300059646 Bacteria 554
1995 Ga0587078_074998 3300059646 Bacteria 534
1996 Ga0587079_114906 3300059647 Bacteria 659
1997 Ga0587079_169053 3300059647 Bacteria 577
1998 Ga0587079_189891 3300059647 Bacteria 555
1999 Ga0587079_221776 3300059647 Bacteria 526
2000 Ga0587102_013673 3300059649 Bacteria 843
2001 Ga0587102_053307 3300059649 Bacteria 549
2002 Ga0587104_024947 3300059650 Bacteria 515
2003 Ga0587107_098060 3300059652 Bacteria 576
2004 Ga0587114_055041 3300059655 Bacteria 684
2005 Ga0587114_076241 3300059655 Bacteria 616
2006 Ga0587114_120275 3300059655 Bacteria 531
2007 Ga0587119_084909 3300059658 Bacteria 521
2008 Ga0587119_086624 3300059658 Bacteria 517
2009 Ga0587071_046783 3300060344 Bacteria 884
2010 Ga0587071_115430 3300060344 Unclassified 636
2011 Ga0501082_0329920 3300060353 Bacteria 1329
2012 Ga0501082_0639635 3300060353 Bacteria 931
2013 Ga0501082_0806157 3300060353 Bacteria 821
2014 Ga0501082_0996221 3300060353 Bacteria 733
2015 Ga0501082_1038173 3300060353 Bacteria 717
2016 Ga0466962_0011514 3300061719 Bacteria 4259
2017 Ga0466962_0084132 3300061719 Bacteria 1522
2018 Ga0466962_0109045 3300061719 Unclassified 1332
2019 Ga0466962_0185163 3300061719 Unclassified 1015
2020 Ga0466962_0246087 3300061719 Bacteria 878
2021 Ga0466962_0487076 3300061719 Bacteria 623
2022 Ga0530510_0035924 3300061734 Bacteria 3572
2023 Ga0530510_0612454 3300061734 Bacteria 828
2024 Ga0530510_0710199 3300061734 Bacteria 766
2025 Ga0530510_0844244 3300061734 Bacteria 699
2026 JGI24746J21847_1025569
2027 ARcpr5oldR_c027731
2028 CNBas_1006135
2029 LJQas_1020834
2030 JGI24743J22301_10071213
2031 JGI24750J21931_1051334
2032 JGI24749J21850_1020376
2033 JGI24744J21845_10000270
2034 JGI24034J26672_10095216
2035 JGI24742J22300_10090598
2036 JGI24751J29686_10093803
2037 JGI25407J50210_10000043
2038 JGI25407J50210_10003008
2039 JGI25407J50210_10006055
2040 JGI25407J50210_10021102
2041 JGI25407J50210_10022167
2042 JGI25407J50210_10046390
2043 JGI25407J50210_10127885
2044 JGI25407J50210_10130891
2045 JGI25407J50210_10168277
2046 Ga0058863_10044069
2047 Ga0058863_11737441
2048 Ga0058863_11784839
2049 Ga0058861_10053199
2050 Ga0058861_11902183
2051 Ga0058861_11963800
2052 Ga0058861_11993075
2053 Ga0058861_12004511
2054 Ga0058860_12242813
2055 Ga0058862_10018425
2056 Ga0058862_12721611
2057 Ga0058862_12775560
2058 Ga0070658_10054807
2059 Ga0070658_10095618
2060 Ga0070658_10202218
2061 Ga0070658_10252336
2062 Ga0070658_10672640
2063 Ga0070676_10191228
2064 Ga0070676_10389742
2065 Ga0070676_10558129
2066 Ga0070683_100003875
2067 Ga0070683_100004942
2068 Ga0070683_100015367
2069 Ga0070683_100015562
2070 Ga0070683_100025417
2071 Ga0070683_100032284
2072 Ga0070683_100077333
2073 Ga0070683_100124300
2074 Ga0070683_100291562
2075 Ga0070683_100411015
2076 Ga0070683_100634372
2077 Ga0070683_101046941
2078 Ga0070670_100100103
2079 Ga0068869_100116112
2080 Ga0068869_100348491
2081 Ga0068869_100482914
2082 Ga0068869_101072642
2083 Ga0068869_101131859
2084 Ga0070680_100003134
2085 Ga0070680_100003591
2086 Ga0070680_100016764
2087 Ga0070680_100018725
2088 Ga0070680_100237959
2089 Ga0070680_100363144
2090 Ga0070682_100007166
2091 Ga0070682_100014648
2092 Ga0070682_100093804
2093 Ga0070682_100605447
2094 Ga0070682_100832095
2095 Ga0068868_100029713
2096 Ga0068868_100472709
2097 Ga0068868_100719330
2098 Ga0070660_100001983
2099 Ga0070660_100014687
2100 Ga0070660_100018912
2101 Ga0070660_100020348
2102 Ga0070660_100143962
2103 Ga0070660_100152947
2104 Ga0070660_100638019
2105 Ga0070689_100012172
2106 Ga0070689_100084769
2107 Ga0070691_10013505
2108 Ga0070691_10035242
2109 Ga0070691_10170363
2110 Ga0070687_100629844
2111 Ga0070687_100715936
2112 Ga0070661_100004275
2113 Ga0070661_100059829
2114 Ga0070661_100495188
2115 Ga0070661_100577518
2116 Ga0070661_100593087
2117 Ga0070661_100896747
2118 Ga0070692_10295024
2119 Ga0070692_10314616
2120 Ga0070692_10582475
2121 Ga0070668_100009147
2122 Ga0070668_100053183
2123 Ga0070668_100469842
2124 Ga0070668_100799891
2125 Ga0070675_100020633
2126 Ga0070675_100876949
2127 Ga0070671_100029788
2128 Ga0070671_100349998
2129 Ga0070674_100005639
2130 Ga0070674_100050682
2131 Ga0070673_100044430
2132 Ga0070673_100069317
2133 Ga0070673_100614903
2134 Ga0070688_100016002
2135 Ga0070688_100131972
2136 Ga0070688_100648451
2137 Ga0070659_100059318
2138 Ga0070659_100064034
2139 Ga0070659_100089872
2140 Ga0070659_100232868
2141 Ga0070659_100341947
2142 Ga0070659_100438748
2143 Ga0070659_100561683
2144 Ga0070659_100631050
2145 Ga0070667_100009082
2146 Ga0070703_10018550
2147 Ga0070703_10020258
2148 Ga0070703_10034127
2149 Ga0070703_10085263
2150 Ga0070703_10238877
2151 Ga0070709_10015555
2152 Ga0070709_10053684
2153 Ga0070709_10177399
2154 Ga0070709_10577651
2155 Ga0070709_10595674
2156 Ga0070714_100002694
2157 Ga0070714_100013536
2158 Ga0070714_100020417
2159 Ga0070714_100026064
2160 Ga0070714_100065451
2161 Ga0070714_100074062
2162 Ga0070714_100221880
2163 Ga0070714_100355538
2164 Ga0070714_100390529
2165 Ga0070714_100679528
2166 Ga0070714_100865879
2167 Ga0070714_101877387
2168 Ga0070713_100005694
2169 Ga0070713_100193807
2170 Ga0070713_100274991
2171 Ga0070713_100464891
2172 Ga0070713_100493504
2173 Ga0070713_101132422
2174 Ga0070713_102352094
2175 Ga0070710_10003097
2176 Ga0070710_10011088
2177 Ga0070710_10031029
2178 Ga0070710_10045000
2179 Ga0070710_11012383
2180 Ga0070710_11442429
2181 Ga0070710_11442770
2182 Ga0070701_10011918
2183 Ga0070701_10032032
2184 Ga0070701_10039684
2185 Ga0070711_100006000
2186 Ga0070711_100020967
2187 Ga0070711_100060127
2188 Ga0070711_100109928
2189 Ga0070711_100167465
2190 Ga0070711_100231071
2191 Ga0070711_100495444
2192 Ga0070711_100741187
2193 Ga0070705_100006630
2194 Ga0070705_100099872
2195 Ga0070705_101384348
2196 Ga0070700_100004550
2197 Ga0070700_100008039
2198 Ga0070700_100143935
2199 Ga0070700_100218527
2200 Ga0070700_100428767
2201 Ga0070700_101720119
2202 Ga0070694_100078212
2203 Ga0070694_100093263
2204 Ga0070694_100097550
2205 Ga0070694_100163564
2206 Ga0070694_100292928
2207 Ga0070694_100403141
2208 Ga0070694_100506252
2209 Ga0070694_100789431
2210 Ga0070708_100015786
2211 Ga0070708_100200605
2212 Ga0070708_100380528
2213 Ga0070708_100455620
2214 Ga0070708_100498394
2215 Ga0070708_101020057
2216 Ga0070663_100008031
2217 Ga0070663_100501777
2218 Ga0070678_100026628
2219 Ga0070678_100064976
2220 Ga0070678_100368470
2221 Ga0070678_100517760
2222 Ga0070678_100978404
2223 Ga0070662_100016960
2224 Ga0070662_100065436
2225 Ga0070662_100164627
2226 Ga0070662_100432141
2227 Ga0070681_10005686
2228 Ga0070681_10007190
2229 Ga0070681_10026484
2230 Ga0070681_10059689
2231 Ga0070681_10090820
2232 Ga0070681_10102077
2233 Ga0070681_10175042
2234 Ga0068867_100006973
2235 Ga0068867_100033254
2236 Ga0068867_100073840
2237 Ga0070685_10000816
2238 Ga0070685_10535385
2239 Ga0070685_10768751
2240 Ga0070706_100020865
2241 Ga0070706_100039379
2242 Ga0070706_100044894
2243 Ga0070706_100477554
2244 Ga0070706_100556298
2245 Ga0070707_100000949
2246 Ga0070707_100008460
2247 Ga0070707_100030747
2248 Ga0070707_100175479
2249 Ga0070707_100570562
2250 Ga0070707_100732611
2251 Ga0070707_101137811
2252 Ga0070698_100104407
2253 Ga0070698_100129651
2254 Ga0070698_100145113
2255 Ga0070698_100175800
2256 Ga0070698_100229696
2257 Ga0070698_100319812
2258 Ga0070698_100455753
2259 Ga0070699_100033241
2260 Ga0070699_100104436
2261 Ga0070699_100336076
2262 Ga0070699_100620979
2263 Ga0070699_100688635
2264 Ga0070699_101571820
2265 Ga0070679_100003327
2266 Ga0070679_100034667
2267 Ga0070679_100036280
2268 Ga0070679_100096267
2269 Ga0070679_100119568
2270 Ga0070679_100137031
2271 Ga0070679_100162691
2272 Ga0070679_100171898
2273 Ga0070679_100296057
2274 Ga0070679_100366707
2275 Ga0070679_100515577
2276 Ga0070679_100551128
2277 Ga0070684_100007962
2278 Ga0070684_100013215
2279 Ga0070684_100014125
2280 Ga0070684_100014774
2281 Ga0070684_100023477
2282 Ga0070684_100040341
2283 Ga0070684_100102459
2284 Ga0070684_100198141
2285 Ga0070684_100300933
2286 Ga0070684_100767353
2287 Ga0070684_101010462
2288 Ga0070697_100075441
2289 Ga0070697_100105678
2290 Ga0070697_100438398
2291 Ga0070697_100958980
2292 Ga0070697_101262820
2293 Ga0068853_100261655
2294 Ga0070672_100049761
2295 Ga0070672_100419912
2296 Ga0070686_100004382
2297 Ga0070686_100053104
2298 Ga0070686_100132245
2299 Ga0070695_100018875
2300 Ga0070695_100197479
2301 Ga0070695_100883184
2302 Ga0070696_100026892
2303 Ga0070696_100048064
2304 Ga0070696_100062253
2305 Ga0070696_100071072
2306 Ga0070696_100290075
2307 Ga0070693_100091560
2308 Ga0070693_100182878
2309 Ga0070693_100205863
2310 Ga0070693_100306115
2311 Ga0070693_100733012
2312 Ga0070693_100865643
2313 Ga0070693_101151193
2314 Ga0070693_101566402
2315 Ga0070665_100041443
2316 Ga0070665_100802888
2317 Ga0070704_100030154
2318 Ga0070704_100070736
2319 Ga0070704_100273762
2320 Ga0070704_100304591
2321 Ga0070704_100412772
2322 Ga0070704_100618445
2323 Ga0070704_100985148
2324 Ga0070704_101886147
2325 Ga0070704_102280652
2326 Ga0070704_102289475
2327 Ga0068855_100007343
2328 Ga0068855_100052133
2329 Ga0068855_100100393
2330 Ga0068855_100119357
2331 Ga0068855_100192027
2332 Ga0068855_100233615
2333 Ga0068855_100643935
2334 Ga0068855_102063349
2335 Ga0070664_100259034
2336 Ga0070664_100287489
2337 Ga0070664_100464054
2338 Ga0070664_100982632
2339 Ga0068857_100011204
2340 Ga0068857_100024729
2341 Ga0068857_100177906
2342 Ga0068857_100463588
2343 Ga0068857_101787033
2344 Ga0068854_100053511
2345 Ga0068854_100056126
2346 Ga0068854_100065930
2347 Ga0068854_100398173
2348 Ga0068854_100823579
2349 Ga0068854_100990318
2350 Ga0068854_102239201
2351 Ga0068856_100014707
2352 Ga0068856_100129320
2353 Ga0068856_100135206
2354 Ga0068856_100151195
2355 Ga0068856_100153638
2356 Ga0068856_100168305
2357 Ga0068856_100177636
2358 Ga0068856_100196994
2359 Ga0068856_100352124
2360 Ga0068856_100358074
2361 Ga0068856_101273049
2362 Ga0070702_100010172
2363 Ga0070702_100022444
2364 Ga0070702_100044741
2365 Ga0070702_100220914
2366 Ga0070702_100275950
2367 Ga0070702_100500890
2368 Ga0068852_100005023
2369 Ga0068852_100046589
2370 Ga0068852_100138618
2371 Ga0068852_100476381
2372 Ga0068852_100550581
2373 Ga0068859_100084191
2374 Ga0068864_102111545
2375 Ga0068866_10006032
2376 Ga0068866_10515562
2377 Ga0068866_10535513
2378 Ga0068861_100013642
2379 Ga0068861_100038498
2380 Ga0068861_100052992
2381 Ga0068861_100731155
2382 Ga0068861_101046354
2383 Ga0068851_10387756
2384 Ga0068851_10664548
2385 Ga0068870_10224842
2386 Ga0068863_100552428
2387 Ga0068858_100140136
2388 Ga0068858_100217577
2389 Ga0068858_101191089
2390 Ga0068860_100040839
2391 Ga0068860_101081608
2392 Ga0068862_100098128
2393 Ga0068862_100120115
2394 Ga0068862_100162103
2395 Ga0068862_100232551
2396 Ga0068862_100858410
2397 Ga0081455_10008363
2398 Ga0081455_10013810
2399 Ga0081455_10016696
2400 Ga0081455_10038483
2401 Ga0081455_10126415
2402 Ga0081455_10763569
2403 Ga0081538_10000013
2404 Ga0081538_10000169
2405 Ga0081538_10000312
2406 Ga0081538_10001407
2407 Ga0081538_10004036
2408 Ga0081538_10004074
2409 Ga0081538_10004165
2410 Ga0081538_10006358
2411 Ga0081538_10007118
2412 Ga0081538_10008139
2413 Ga0081538_10014186
2414 Ga0081538_10017335
2415 Ga0081538_10042595
2416 Ga0081538_10071028
2417 Ga0081538_10088805
2418 Ga0081538_10104794
2419 Ga0081538_10173571
2420 Ga0081538_10193139
2421 Ga0081538_10287189
2422 Ga0081538_10314539
2423 Ga0081540_1227848
2424 Ga0081539_10022410
2425 Ga0081539_10091737
2426 Ga0081539_10472253
2427 Ga0070717_10017003
2428 Ga0070717_10040364
2429 Ga0070717_10066037
2430 Ga0070717_10203330
2431 Ga0070717_10341336
2432 Ga0070717_10573589
2433 Ga0070717_10639376
2434 Ga0070717_10729318
2435 Ga0075365_10073645
2436 Ga0075365_10081253
2437 Ga0075365_10122219
2438 Ga0075363_100295244
2439 Ga0075364_10015582
2440 Ga0075364_10539183
2441 Ga0075364_10639124
2442 Ga0075364_10782450
2443 Ga0075432_10073896
2444 Ga0075432_10121650
2445 Ga0070715_10026026
2446 Ga0070715_10076256
2447 Ga0070716_100116344
2448 Ga0070716_100145445
2449 Ga0070716_100283281
2450 Ga0070716_100375141
2451 Ga0070716_100841602
2452 Ga0070712_100004431
2453 Ga0070712_100022316
2454 Ga0070712_100157763
2455 Ga0070712_100344709
2456 Ga0070712_100677103
2457 Ga0070712_100889047
2458 Ga0070712_101230233
2459 Ga0070712_101439411
2460 Ga0075362_10035978
2461 Ga0075367_10329957
2462 Ga0075367_10640213
2463 Ga0075427_10019431
2464 Ga0075427_10047472
2465 Ga0097621_100005052
2466 Ga0068871_100207804
2467 Ga0068871_100617894
2468 Ga0068871_100981847
2469 Ga0075428_100013903
2470 Ga0075428_100029675
2471 Ga0075428_100116229
2472 Ga0075428_100147536
2473 Ga0075428_100251524
2474 Ga0075428_100281357
2475 Ga0075428_100330067
2476 Ga0075428_100924775
2477 Ga0075430_100024546
2478 Ga0075430_100029281
2479 Ga0075430_100082786
2480 Ga0075430_100379413
2481 Ga0075431_100042220
2482 Ga0075431_100149921
2483 Ga0075431_100309849
2484 Ga0075431_100319133
2485 Ga0075431_100421210
2486 Ga0075431_100469761
2487 Ga0075431_101087123
2488 Ga0075433_10000416
2489 Ga0075433_10018210
2490 Ga0075433_10039332
2491 Ga0075433_10068696
2492 Ga0075433_10385585
2493 Ga0075434_100036046
2494 Ga0075434_100261264
2495 Ga0075434_100501291
2496 Ga0075434_101055760
2497 Ga0075429_100030504
2498 Ga0075429_100111063
2499 Ga0075429_100607664
2500 Ga0075429_100687375
2501 Ga0075429_101140949
2502 Ga0068865_100001717
2503 Ga0068865_100108711
2504 Ga0068865_101159881
2505 Ga0075436_100016298
2506 Ga0075436_100167361
2507 Ga0075436_100334850
2508 Ga0097620_100084191
2509 Ga0075435_100001405
2510 Ga0075435_100009412
2511 Ga0075435_100010822
2512 Ga0075435_100448879
2513 Ga0075435_100806314
2514 Ga0075435_100917241
2515 Ga0099795_10176161
2516 Ga0105251_10617811
2517 Ga0105240_10103290
2518 Ga0105240_10408271
2519 Ga0105240_10614585
2520 Ga0111539_10002945
2521 Ga0111539_10009364
2522 Ga0111539_10025490
2523 Ga0111539_10066276
2524 Ga0111539_10164231
2525 Ga0111539_10182094
2526 Ga0111539_10590617
2527 Ga0111539_10794970
2528 Ga0111539_11233969
2529 Ga0111539_12212767
2530 Ga0105245_10014118
2531 Ga0105245_10047377
2532 Ga0105245_10059580
2533 Ga0105245_10120510
2534 Ga0105245_10197889
2535 Ga0105245_10456300
2536 Ga0105245_11188105
2537 Ga0105247_10015844
2538 Ga0114129_10009215
2539 Ga0114129_10024585
2540 Ga0114129_10029269
2541 Ga0114129_10054396
2542 Ga0114129_10067941
2543 Ga0114129_10174092
2544 Ga0114129_10249592
2545 Ga0114129_10265403
2546 Ga0114129_10380756
2547 Ga0114129_10522575
2548 Ga0114129_10527363
2549 Ga0114129_10758499
2550 Ga0114129_11274256
2551 Ga0114129_11766163
2552 Ga0114129_12237483
2553 Ga0114129_12259333
2554 Ga0114129_13266333
2555 Ga0105243_10037406
2556 Ga0105243_10046688
2557 Ga0105243_10083356
2558 Ga0105243_10222749
2559 Ga0105243_10414183
2560 Ga0105243_10436640
2561 Ga0105243_10464884
2562 Ga0105243_11939858
2563 Ga0105243_12148119
2564 Ga0105241_10061345
2565 Ga0105241_10097285
2566 Ga0105241_10136441
2567 Ga0105241_10287849
2568 Ga0105242_10011104
2569 Ga0105242_10064630
2570 Ga0105242_10188035
2571 Ga0105242_11397771
2572 Ga0105248_10022371
2573 Ga0105248_10052205
2574 Ga0105248_12122382
2575 Ga0105237_10010287
2576 Ga0105237_10190688
2577 Ga0105237_10268387
2578 Ga0105237_11124701
2579 Ga0105237_12226953
2580 Ga0105238_10047776
2581 Ga0105238_10077304
2582 Ga0105238_10193214
2583 Ga0105238_10552988
2584 Ga0105238_10839901
2585 Ga0105238_10945985
2586 Ga0105238_12348458
2587 Ga0105249_10003715
2588 Ga0105249_10007144
2589 Ga0105249_10131571
2590 Ga0105249_10157599
2591 Ga0105249_10867900
2592 Ga0105249_10943147
2593 Ga0105249_11924096
2594 Ga0105147_103172
2595 Ga0105239_10034604
2596 Ga0105239_10112615
2597 Ga0105239_10114295
2598 Ga0105239_10189319
2599 Ga0105239_10502493
2600 Ga0105239_10677410
2601 Ga0105239_10702156
2602 Ga0105246_10022658
2603 Ga0105246_10346568
2604 Ga0105246_11663606
2605 Ga0157313_1040048
2606 Ga0157342_1044539
2607 Ga0157342_1074475
2608 Ga0157338_1013400
2609 Ga0157373_10276093
2610 Ga0157373_10311385
2611 Ga0157373_10686661
2612 Ga0157373_10723762
2613 Ga0157371_10210115
2614 Ga0157371_10272281
2615 Ga0157370_10011051
2616 Ga0157370_10019665
2617 Ga0157370_10030644
2618 Ga0157370_10037034
2619 Ga0157370_10878363
2620 Ga0157370_11083602
2621 Ga0157369_10024611
2622 Ga0157369_10047050
2623 Ga0157369_10053177
2624 Ga0157369_10245867
2625 Ga0157369_11082034
2626 Ga0157369_11653714
2627 Ga0157369_11743822
2628 Ga0157369_12612812
2629 Ga0157374_10012764
2630 Ga0157374_10332553
2631 Ga0157374_10696813
2632 Ga0157378_10010459
2633 Ga0157378_10095408
2634 Ga0157378_10395810
2635 Ga0157378_11589632
2636 Ga0163162_10078641
2637 Ga0163162_10406019
2638 Ga0157372_10147425
2639 Ga0157372_10266290
2640 Ga0157372_10267376
2641 Ga0157372_10424512
2642 Ga0157372_11167715
2643 Ga0157372_11533469
2644 Ga0157375_10014122
2645 Ga0157375_10220067
2646 Ga0163163_10219594
2647 Ga0163163_10239174
2648 Ga0163163_10437268
2649 Ga0163163_10673326
2650 Ga0157380_10300999
2651 Ga0157380_10804976
2652 Ga0157380_11030904
2653 Ga0157380_11197476
2654 Ga0182008_10008535
2655 Ga0182008_10044913
2656 Ga0182008_10087200
2657 Ga0182008_10609632
2658 Ga0157377_10004665
2659 Ga0157377_10088989
2660 Ga0157377_10562102
2661 Ga0157377_10654558
2662 Ga0157377_11415232
2663 Ga0157379_10223074
2664 Ga0157379_10919076
2665 Ga0157379_10992169
2666 Ga0157379_12559976
2667 Ga0157376_10011995
2668 Ga0157376_10763897
2669 Ga0157376_11768721
2670 Ga0157376_12910532
2671 Ga0182006_1074535
2672 Ga0163161_10080803
2673 Ga0163161_10292636
2674 Ga0197907_10186633
2675 Ga0197907_10423566
2676 Ga0197907_10438343
2677 Ga0197907_10442485
2678 Ga0197907_11417827
2679 Ga0206356_10455236
2680 Ga0206356_10720194
2681 Ga0206356_10854187
2682 Ga0206356_10908358
2683 Ga0206356_11024134
2684 Ga0206349_1050397
2685 Ga0206349_1419654
2686 Ga0206349_1946013
2687 Ga0206355_1040879
2688 Ga0206355_1342106
2689 Ga0206355_1462533
2690 Ga0206351_10253461
2691 Ga0206351_10479706
2692 Ga0206352_10253765
2693 Ga0206352_11278387
2694 Ga0206350_11385448
2695 Ga0206350_11604752
2696 Ga0206354_10277449
2697 Ga0206354_10303994
2698 Ga0206354_10999163
2699 Ga0206354_11321052
2700 Ga0206354_11379180
2701 Ga0206354_11387473
2702 Ga0206354_11556505
2703 Ga0206354_11716844
2704 Ga0206353_10552814
2705 Ga0206353_10579291
2706 Ga0206353_10646658
2707 Ga0206353_10874027
2708 Ga0206353_11253320
2709 Ga0206353_11303834
2710 Ga0206353_11310262
2711 Ga0154015_1027422
2712 Ga0154015_1072201
2713 Ga0154015_1370897
2714 Ga0154015_1538434
2715 Ga0213873_10019821
2716 Ga0213871_10016008
2717 Ga0224712_10017878
2718 Ga0224712_10034170
2719 Ga0224712_10053447
2720 Ga0224712_10068687
2721 Ga0224712_10142606
2722 Ga0224712_10259724
2723 Ga0224712_10361840
2724 Ga0207656_10208724
2725 Ga0207653_10003662
2726 Ga0207692_10032981
2727 Ga0207692_10099533
2728 Ga0207692_10184079
2729 Ga0207692_10403944
2730 Ga0207692_10914269
2731 Ga0207642_10005110
2732 Ga0207642_10291502
2733 Ga0207710_10186080
2734 Ga0207688_10014788
2735 Ga0207688_10017110
2736 Ga0207688_10062626
2737 Ga0207688_10135839
2738 Ga0207688_10310269
2739 Ga0207688_10630944
2740 Ga0207680_10308212
2741 Ga0207647_10123939
2742 Ga0207699_10035352
2743 Ga0207699_10073251
2744 Ga0207699_10114925
2745 Ga0207699_10555330
2746 Ga0207699_10650779
2747 Ga0207645_10036606
2748 Ga0207643_10066060
2749 Ga0207705_10015535
2750 Ga0207705_10020921
2751 Ga0207705_10168095
2752 Ga0207705_10299797
2753 Ga0207705_10337868
2754 Ga0207705_11312032
2755 Ga0207684_10056939
2756 Ga0207684_10137621
2757 Ga0207684_10189604
2758 Ga0207684_10268331
2759 Ga0207684_10503909
2760 Ga0207654_10045756
2761 Ga0207654_10251041
2762 Ga0207707_10016827
2763 Ga0207707_10025557
2764 Ga0207707_10047009
2765 Ga0207707_10138497
2766 Ga0207707_10372101
2767 Ga0207707_10454853
2768 Ga0207707_10677643
2769 Ga0207695_10448284
2770 Ga0207695_10778546
2771 Ga0207671_10018528
2772 Ga0207671_10120587
2773 Ga0207693_10002934
2774 Ga0207693_10005025
2775 Ga0207693_10005819
2776 Ga0207693_10199911
2777 Ga0207693_10256109
2778 Ga0207693_10296241
2779 Ga0207693_10413753
2780 Ga0207663_10017343
2781 Ga0207663_10184610
2782 Ga0207663_10206825
2783 Ga0207663_10235829
2784 Ga0207663_10247972
2785 Ga0207663_10275826
2786 Ga0207663_10335249
2787 Ga0207663_11042351
2788 Ga0207660_10008765
2789 Ga0207660_10022435
2790 Ga0207660_10074403
2791 Ga0207660_10140050
2792 Ga0207660_10249602
2793 Ga0207660_10355376
2794 Ga0207660_10437698
2795 Ga0207662_10094944
2796 Ga0207657_10002082
2797 Ga0207657_10009553
2798 Ga0207657_10017180
2799 Ga0207657_10041276
2800 Ga0207657_10192956
2801 Ga0207657_10228365
2802 Ga0207657_10229537
2803 Ga0207657_10517293
2804 Ga0207649_10162074
2805 Ga0207649_10207943
2806 Ga0207652_10004034
2807 Ga0207652_10020742
2808 Ga0207652_10037172
2809 Ga0207652_10138697
2810 Ga0207652_10163371
2811 Ga0207652_10615930
2812 Ga0207652_10820186
2813 Ga0207652_10882985
2814 Ga0207652_11588678
2815 Ga0207646_10022194
2816 Ga0207646_10028189
2817 Ga0207646_10211746
2818 Ga0207646_10761723
2819 Ga0207646_11435495
2820 Ga0207694_10102940
2821 Ga0207694_10158477
2822 Ga0207694_10686119
2823 Ga0207694_10716419
2824 Ga0207650_10296870
2825 Ga0207659_10337487
2826 Ga0207687_10014069
2827 Ga0207687_10018648
2828 Ga0207687_10047767
2829 Ga0207687_10107887
2830 Ga0207687_10226649
2831 Ga0207687_10578401
2832 Ga0207687_10591112
2833 Ga0207687_10604366
2834 Ga0207700_10000012
2835 Ga0207700_10121115
2836 Ga0207700_10160292
2837 Ga0207700_10499687
2838 Ga0207700_10552552
2839 Ga0207664_10008169
2840 Ga0207664_10029592
2841 Ga0207664_10038172
2842 Ga0207664_10066535
2843 Ga0207664_10124229
2844 Ga0207664_10235088
2845 Ga0207664_10358454
2846 Ga0207664_10359366
2847 Ga0207664_10430807
2848 Ga0207664_10572208
2849 Ga0207644_10067637
2850 Ga0207644_11122046
2851 Ga0207690_10137920
2852 Ga0207690_10168766
2853 Ga0207690_10209471
2854 Ga0207690_10288650
2855 Ga0207690_10833374
2856 Ga0207690_11218357
2857 Ga0207706_10013086
2858 Ga0207706_10041233
2859 Ga0207706_10082059
2860 Ga0207706_10149077
2861 Ga0207706_10290123
2862 Ga0207706_11599020
2863 Ga0207686_10047247
2864 Ga0207686_10207801
2865 Ga0207686_10217756
2866 Ga0207709_10001561
2867 Ga0207709_10145348
2868 Ga0207709_10215207
2869 Ga0207709_10276779
2870 Ga0207709_10380993
2871 Ga0207709_10485945
2872 Ga0207670_10005360
2873 Ga0207670_10171627
2874 Ga0207669_10048585
2875 Ga0207669_10050432
2876 Ga0207669_11723840
2877 Ga0207704_10024454
2878 Ga0207704_10924980
2879 Ga0207704_10951941
2880 Ga0207665_10006819
2881 Ga0207665_10012875
2882 Ga0207665_10017176
2883 Ga0207665_10084679
2884 Ga0207665_10180018
2885 Ga0207691_10010135
2886 Ga0207691_10104108
2887 Ga0207691_10215480
2888 Ga0207711_10329208
2889 Ga0207711_10564105
2890 Ga0207689_10031753
2891 Ga0207689_10780856
2892 Ga0207661_10003963
2893 Ga0207661_10011805
2894 Ga0207661_10019765
2895 Ga0207661_10027168
2896 Ga0207661_10038872
2897 Ga0207661_10040511
2898 Ga0207661_10100835
2899 Ga0207661_10179958
2900 Ga0207661_10236842
2901 Ga0207661_10366861
2902 Ga0207661_10738323
2903 Ga0207661_11941638
2904 Ga0207679_10016754
2905 Ga0207679_10245014
2906 Ga0207679_10463826
2907 Ga0207679_10716665
2908 Ga0207679_11390189
2909 Ga0207679_11535219
2910 Ga0207667_10237510
2911 Ga0207667_10249078
2912 Ga0207667_10324726
2913 Ga0207667_10589060
2914 Ga0207667_10878256
2915 Ga0207667_10946304
2916 Ga0207651_10065761
2917 Ga0207651_10133669
2918 Ga0207712_10005445
2919 Ga0207712_10037558
2920 Ga0207712_10245071
2921 Ga0207712_10309915
2922 Ga0207668_10007560
2923 Ga0207668_10020001
2924 Ga0207668_10149933
2925 Ga0207640_10052679
2926 Ga0207640_10313113
2927 Ga0207640_10450141
2928 Ga0207640_10472743
2929 Ga0207640_10491890
2930 Ga0207640_10603917
2931 Ga0207677_10034065
2932 Ga0207677_10192696
2933 Ga0207677_11329910
2934 Ga0207703_10118898
2935 Ga0207703_10524292
2936 Ga0207639_10189302
2937 Ga0207639_10279679
2938 Ga0207639_10850069
2939 Ga0207678_10027358
2940 Ga0207678_10066311
2941 Ga0207678_10321182
2942 Ga0207678_11323859
2943 Ga0207678_11557216
2944 Ga0207708_10007870
2945 Ga0207708_10010026
2946 Ga0207708_10106644
2947 Ga0207708_10122822
2948 Ga0207708_10153264
2949 Ga0207702_10139865
2950 Ga0207702_10155110
2951 Ga0207702_10196554
2952 Ga0207702_10297043
2953 Ga0207702_10555934
2954 Ga0207702_10657934
2955 Ga0207702_10717250
2956 Ga0207702_11612545
2957 Ga0207641_11981367
2958 Ga0207648_10003432
2959 Ga0207648_10029730
2960 Ga0207648_10057075
2961 Ga0207648_11885600
2962 Ga0207676_10267278
2963 Ga0207676_10717984
2964 Ga0207674_10012751
2965 Ga0207674_10020476
2966 Ga0207674_10021392
2967 Ga0207674_10139131
2968 Ga0207675_100000239
2969 Ga0207675_100012469
2970 Ga0207675_100050628
2971 Ga0207675_100085447
2972 Ga0207675_100876368
2973 Ga0207683_10000262
2974 Ga0207683_10013297
2975 Ga0207683_10263460
2976 Ga0207683_10351529
2977 Ga0207698_10001968
2978 Ga0207698_10097076
2979 Ga0207698_10114632
2980 Ga0207698_10410040
2981 Ga0207698_10954397
2982 Ga0210000_1021556
2983 Ga0209999_1040985
2984 Ga0209966_1032655
2985 Ga0209974_10072189
2986 Ga0207428_10005731
2987 Ga0207428_10032631
2988 Ga0207428_10037013
2989 Ga0207428_10037899
2990 Ga0207428_10092239
2991 Ga0207428_10924218
2992 Ga0207428_10942007
2993 Ga0268266_10973573
2994 Ga0268265_10098586
2995 Ga0268265_10102332
2996 Ga0268265_11281917
2997 Ga0268264_10034340
2998 Ga0268264_10640832
2999 Ga0268264_11821089
3000 Ga0265337_1016381
3001 Ga0265334_10073204
3002 Ga0265318_10036326
3003 Ga0265322_10021376
3004 Ga0265336_10058625
3005 Ga0265338_10005668
3006 Ga0265338_10057127
3007 Ga0265338_10179186
3008 Ga0265330_10053272
3009 Ga0265330_10062461
3010 Ga0265330_10184926
3011 Ga0265332_10032013
3012 Ga0265332_10147986
3013 Ga0265328_10194135
3014 Ga0265320_10111876
3015 Ga0265325_10009148
3016 Ga0265339_10003320
3017 Ga0265339_10176991
3018 Ga0265331_10054358
3019 Ga0265331_10102625
3020 Ga0265327_10034191
3021 Ga0265316_10015468
3022 Ga0265316_10261358
3023 Ga0265316_10629822
3024 Ga0307408_100100073
3025 Ga0307408_100160718
3026 Ga0307408_100436281
3027 Ga0265313_10009855
3028 Ga0265313_10027633
3029 Ga0265314_10006982
3030 Ga0265314_10017534
3031 Ga0265314_10085399
3032 Ga0265342_10016426
3033 Ga0265342_10053971
3034 Ga0265342_10569043
3035 Ga0307405_10022450
3036 Ga0307405_10133898
3037 Ga0307405_10373568
3038 Ga0307405_10380056
3039 Ga0307413_10000972
3040 Ga0307413_10016513
3041 Ga0307413_10172755
3042 Ga0307413_10538915
3043 Ga0307410_10018807
3044 Ga0307410_10041612
3045 Ga0307410_10063946
3046 Ga0307410_10134913
3047 Ga0307410_10135610
3048 Ga0307410_10175842
3049 Ga0307410_10190172
3050 Ga0307410_10502020
3051 Ga0307406_10007190
3052 Ga0307406_10008830
3053 Ga0307406_10025643
3054 Ga0307406_10050049
3055 Ga0307406_10085293
3056 Ga0307406_10892474
3057 Ga0307406_12098580
3058 Ga0307407_10031023
3059 Ga0307407_10048193
3060 Ga0307407_10135541
3061 Ga0307407_10138958
3062 Ga0307407_11198077
3063 Ga0307412_10010513
3064 Ga0307412_10034476
3065 Ga0307412_10429330
3066 Ga0307412_10448658
3067 Ga0307412_10661016
3068 Ga0307412_10867571
3069 Ga0307412_10885263
3070 Ga0307412_12183223
3071 Ga0307409_100000515
3072 Ga0307409_100005794
3073 Ga0307409_100007378
3074 Ga0307409_100061112
3075 Ga0307409_100130596
3076 Ga0307409_100376229
3077 Ga0307409_100774858
3078 Ga0307409_100933501
3079 Ga0307409_101688527
3080 Ga0307409_102021864
3081 Ga0307416_100003349
3082 Ga0307416_100047663
3083 Ga0307416_100056638
3084 Ga0307416_100131881
3085 Ga0307416_100143210
3086 Ga0307416_100157287
3087 Ga0307416_100220086
3088 Ga0307416_100252874
3089 Ga0307416_100428015
3090 Ga0307416_100458655
3091 Ga0307416_100488169
3092 Ga0307416_100504864
3093 Ga0307416_100656230
3094 Ga0307416_100659895
3095 Ga0307414_10125501
3096 Ga0307414_10195703
3097 Ga0307414_10248874
3098 Ga0307414_10808261
3099 Ga0307414_11008742
3100 Ga0307411_10003787
3101 Ga0307411_10098304
3102 Ga0307411_10154707
3103 Ga0307415_100002034
3104 Ga0307415_100043617
3105 Ga0307415_100087272
3106 Ga0307415_100089802
3107 Ga0307415_100475460
3108 Ga0307415_100598109
3109 Ga0307415_100603999
3110 Ga0307415_100604603
3111 Ga0307415_100905648
3112 Ga0307415_100939544
3113 Ga0307415_102253963
3114 Ga0373948_0015230
3115 Ga0373950_0002713
3116 Ga0373950_0050489
3117 Ga0373958_0010043
3118 Ga0373959_0063102
3119 Ga0373959_0117209
3120 Ga0373938_0016719
3121 Ga0373938_0060805
3122 Ga0373928_0019989
3123 Ga0373928_0085099
3124 Ga0373934_0501747
3125 Ga0373940_0013500
3126 Ga0373940_0044496
3127 Ga0373944_0009829
3128 Ga0373944_0049658
3129 Ga0373949_0025859
3130 Ga0373951_0011199
3131 Ga0373952_0010857
3132 Ga0373952_0093012
3133 Ga0373932_0005667
3134 Ga0373932_0219365
3135 Ga0373936_0083095
3136 Ga0373939_0002231
3137 Ga0373939_0128922
3138 Ga0373939_0444495
3139 Ga0373941_0005966
3140 Ga0373945_0004274
3141 Ga0373956_0024412
3142 Ga0373957_0092227
3143 Ga0373960_0005256
3144 Ga0373960_0005339
3145 Ga0373960_0160788
3146 Ga0373943_0000166
3147 Ga0373946_0003727
3148 Ga0373946_0112300
3149 Ga0373946_0369179
3150 Ga0373946_0630756
3151 Ga0373955_0148327
3152 Ga0373942_0012103
3153 Ga0373961_0009860
3154 Ga0373961_0038639
3155 Ga0373962_0005913
3156 Ga0373962_0013418
3157 Ga0373924_0179222
3158 Ga0373931_0007745
3159 Ga0373931_0008823
3160 Ga0373931_0511305
3161 Ga0373931_0805474
3162 Ga0373935_0005283
3163 Ga0373935_0115654
3164 Ga0373935_0364423
3165 Ga0373927_0031467
3166 Ga0373933_0020179
3167 Ga0373947_0001188
3168 Ga0373947_0205036
3169 Ga0373947_0766688
3170 Ga0373937_0140002
3171 Ga0373937_0749899
3172 Ga0373937_1020462
3173 Ga0373925_0036662
3174 Ga0373925_0194672
3175 Ga0373925_0254123
3176 Ga0373925_0684193
3177 Ga0373925_1531577
3178 Ga0395899_0006190
3179 Ga0395899_0007255
3180 Ga0395899_0037475
3181 Ga0395899_0049009
3182 Ga0395899_0068080
3183 Ga0395899_0068251
3184 Ga0395899_0081030
3185 Ga0395899_0091511
3186 Ga0395899_0096028
3187 Ga0395899_0103361
3188 Ga0395899_0174738
3189 Ga0395899_0295251
3190 Ga0395899_0567863
3191 Ga0395899_0721112
3192 Ga0395900_0002322
3193 Ga0395900_0012562
3194 Ga0395900_0012865
3195 Ga0395900_0017394
3196 Ga0395900_0021131
3197 Ga0395900_0022975
3198 Ga0395900_0023819
3199 Ga0395900_0024767
3200 Ga0395900_0030439
3201 Ga0395900_0040123
3202 Ga0395900_0054326
3203 Ga0395900_0065750
3204 Ga0395900_0077913
3205 Ga0395900_0106261
3206 Ga0395900_0172061
3207 Ga0395900_0175214
3208 Ga0395900_0185856
3209 Ga0395900_0191093
3210 Ga0395900_0223395
3211 Ga0395900_0226148
3212 Ga0395900_0286751
3213 Ga0395900_0441917
3214 Ga0395900_0526121
3215 Ga0395900_0574468
3216 Ga0395900_0667123
3217 Ga0395900_1109429
3218 Ga0395900_1252148
3219 Ga0395898_0000795
3220 Ga0395898_0002193
3221 Ga0395898_0009079
3222 Ga0395898_0013830
3223 Ga0395898_0015806
3224 Ga0395898_0016921
3225 Ga0395898_0034133
3226 Ga0395898_0043576
3227 Ga0395898_0044296
3228 Ga0395898_0063856
3229 Ga0395898_0086424
3230 Ga0395898_0088576
3231 Ga0395898_0128762
3232 Ga0395898_0146755
3233 Ga0395898_0162608
3234 Ga0395898_0164186
3235 Ga0395898_0183502
3236 Ga0395898_0404434
3237 Ga0395898_0698304
3238 Ga0395898_0707202
3239 Ga0395898_0811683
3240 Ga0395898_1525449
3241 Ga0395905_0009609
3242 Ga0395905_0014210
3243 Ga0395905_0015516
3244 Ga0395905_0027661
3245 Ga0395905_0057969
3246 Ga0395905_0065451
3247 Ga0395905_0081208
3248 Ga0395905_0083987
3249 Ga0395905_0086678
3250 Ga0395905_0131221
3251 Ga0395905_0140628
3252 Ga0395905_0189510
3253 Ga0395905_0254187
3254 Ga0395905_0254700
3255 Ga0395905_0298389
3256 Ga0395905_0413140
3257 Ga0395905_0777745
3258 Ga0395905_0798930
3259 Ga0395905_0988605
3260 Ga0395905_1176978
3261 Ga0436364_1329343
3262 Ga0395901_0003405
3263 Ga0395901_0004473
3264 Ga0395901_0004812
3265 Ga0395901_0007531
3266 Ga0395901_0010774
3267 Ga0395901_0014837
3268 Ga0395901_0016495
3269 Ga0395901_0017704
3270 Ga0395901_0019015
3271 Ga0395901_0024354
3272 Ga0395901_0034604
3273 Ga0395901_0065946
3274 Ga0395901_0082903
3275 Ga0395901_0093359
3276 Ga0395901_0125048
3277 Ga0395901_0141706
3278 Ga0395901_0147590
3279 Ga0395901_0152361
3280 Ga0395901_0191167
3281 Ga0395901_0193217
3282 Ga0395901_0254714
3283 Ga0395901_0288023
3284 Ga0395901_0370110
3285 Ga0395901_0373080
3286 Ga0395901_0408976
3287 Ga0395901_0415890
3288 Ga0395901_0604107
3289 Ga0395901_0635354
3290 Ga0395901_0734825
3291 Ga0395901_1035763
3292 Ga0395901_1419657
3293 Ga0395901_1741222
3294 Ga0395901_1756604
3295 Ga0395901_1928031
3296 Ga0242422_05981
3297 Ga0242420_002041
3298 Ga0436365_0025901
3299 Ga0436365_0411377
3300 Ga0436365_1892433
3301 Ga0436360_1251922
3302 Ga0436363_0196864
3303 Ga0436362_0019340
3304 Ga0436362_0245167
3305 Ga0436362_0676185
3306 Ga0451787_108320
3307 Ga0451789_0065786
3308 Ga0451791_1185374
3309 Ga0451804_0246043
3310 Ga0451807_0796071
3311 Ga0451835_0664966
3312 Ga0451841_0560786
3313 Ga0451853_2814187
3314 Ga0439448_0194482
3315 Ga0439450_036733
3316 Ga0439454_035206
3317 Ga0439454_117523
3318 Ga0439455_0139176
3319 Ga0439463_074284
3320 Ga0439463_199900
3321 Ga0450898_137666
3322 Ga0450902_036243
3323 Ga0439446_0088901
3324 Ga0439458_0030587
3325 Ga0439434_0112315
3326 Ga0439444_0016653
3327 Ga0439460_0071371
3328 Ga0439440_0128365
3329 Ga0466969_0160233
3330 Ga0466972_0204299
3331 Ga0466972_0301592
3332 Ga0466972_0336484
3333 Ga0466965_0315027
3334 Ga0466966_0006534
3335 Ga0466966_0122730
3336 Ga0466961_0053483
3337 Ga0466961_0138741
3338 Ga0466961_0152125
3339 Ga0466961_0838177
3340 Ga0466963_0011944
3341 Ga0466963_0017025
3342 Ga0466963_0035000
3343 Ga0466963_0065726
3344 Ga0466963_0959000
3345 Ga0466964_0002888
3346 Ga0466964_0003812
3347 Ga0466964_0033123
3348 Ga0466964_0220273
3349 Ga0466964_0300220
3350 Ga0466964_0736770
3351 Ga0466971_0144114
3352 Ga0466971_0224452
3353 Ga0466968_0027489
3354 Ga0466968_0046132
3355 Ga0466968_0117146
3356 Ga0466968_0142424
3357 Ga0466970_0016182
3358 Ga0466970_0242029
3359 Ga0466957_0019251
3360 Ga0466957_0075311
3361 Ga0466957_0183008
3362 Ga0466957_0183040
3363 Ga0466957_0298889
3364 Ga0466957_0317723
3365 Ga0466957_0480830
3366 Ga0466957_0664673
3367 Ga0466957_0755974
3368 Ga0466957_1119401
3369 Ga0466960_0025586
3370 Ga0466960_0054678
3371 Ga0466960_0196058
3372 Ga0466960_0394268
3373 Ga0466959_0022989
3374 Ga0466959_0185798
3375 Ga0466959_1123970
3376 Ga0451576_0144297
3377 Ga0451576_1317862
3378 Ga0451576_2642071
3379 Ga0466958_0022336
3380 Ga0466958_0079748
3381 Ga0466958_0091737
3382 Ga0466958_0091870
3383 Ga0466958_0122391
3384 Ga0466958_0156642
3385 Ga0466958_0160033
3386 Ga0466958_0696156
3387 Ga0466958_0822189
3388 Ga0466967_0000648
3389 Ga0466967_0005057
3390 Ga0466967_0022282
3391 Ga0466967_0023072
3392 Ga0466967_0024240
3393 Ga0466967_0029014
3394 Ga0466967_0066322
3395 Ga0466967_0067554
3396 Ga0466967_0076699
3397 Ga0466967_0080031
3398 Ga0466967_0085775
3399 Ga0466967_0097688
3400 Ga0466967_0100171
3401 Ga0466967_0107193
3402 Ga0466967_0114681
3403 Ga0466967_0118295
3404 Ga0466967_0168883
3405 Ga0466967_0181871
3406 Ga0466967_0196051
3407 Ga0466967_0420525
3408 Ga0466967_0856428
3409 Ga0466967_1175874
3410 Ga0466967_1238906
3411 Ga0495617_232252
3412 Ga0495592_0057703
3413 Ga0495592_0096530
3414 Ga0495592_0477112
3415 Ga0495603_0027930
3416 Ga0495590_0045844
3417 Ga0495590_0390171
3418 Ga0495591_117065
3419 Ga0495629_0001534
3420 Ga0495638_0606284
3421 Ga0495641_0000634
3422 Ga0495641_0038789
3423 Ga0495651_0089649
3424 Ga0495651_0092854
3425 Ga0495651_0403143
3426 Ga0495653_0033629
3427 Ga0495653_0036126
3428 Ga0495653_0082578
3429 Ga0495653_0087276
3430 Ga0495580_0252581
3431 Ga0495580_0404221
3432 Ga0495582_0000041
3433 Ga0495582_0058402
3434 Ga0495582_0612761
3435 Ga0495605_0039779
3436 Ga0495605_0218574
3437 Ga0495639_0000616
3438 Ga0495639_0098150
3439 Ga0495662_0000805
3440 Ga0495662_0106325
3441 Ga0495664_0008900
3442 Ga0495664_0187080
3443 Ga0495664_0904364
3444 Ga0495584_0084654
3445 Ga0495584_0132728
3446 Ga0495584_0244699
3447 Ga0495584_0396172
3448 Ga0495584_0624608
3449 Ga0495585_0181927
3450 Ga0495585_0363787
3451 Ga0495594_0077100
3452 Ga0495594_0386022
3453 Ga0495596_0054557
3454 Ga0495596_0107330
3455 Ga0495596_0133404
3456 Ga0495596_0332236
3457 Ga0495596_0377000
3458 Ga0495607_0210654
3459 Ga0495608_0012187
3460 Ga0495608_0055687
3461 Ga0495608_0060546
3462 Ga0495616_0130617
3463 Ga0495618_0050411
3464 Ga0495618_0067553
3465 Ga0495620_0046531
3466 Ga0495620_0069802
3467 Ga0495628_0019330
3468 Ga0495628_0082548
3469 Ga0495628_1195090
3470 Ga0495630_0009695
3471 Ga0495630_0010811
3472 Ga0495630_0033795
3473 Ga0495630_0037580
3474 Ga0495630_0052291
3475 Ga0495630_0417912
3476 Ga0495631_0043502
3477 Ga0495631_0407507
3478 Ga0495637_0008598
3479 Ga0495637_0191837
3480 Ga0495637_0215434
3481 Ga0495643_0339422
3482 Ga0495644_0076077
3483 Ga0495644_0131625
3484 Ga0495644_0156161
3485 Ga0495644_0271456
3486 Ga0495644_0377472
3487 Ga0495663_0026751
3488 Ga0495663_0223651
3489 Ga0495666_0003576
3490 Ga0495666_0145108
3491 Ga0495642_0088262
3492 Ga0495652_0075905
3493 Ga0495652_0096763
3494 Ga0495654_0135920
3495 Ga0495665_0000948
3496 Ga0495665_0311918
3497 Ga0495640_0005396
3498 Ga0495640_0013669
3499 Ga0495640_0246708
3500 Ga0495640_0410476
3501 Ga0495587_0015391
3502 Ga0495587_0043037
3503 Ga0495598_0011663
3504 Ga0495609_0061834
3505 Ga0495609_0229633
3506 Ga0495645_0100217
3507 Ga0495645_0395528
3508 Ga0495645_0422118
3509 Ga0495633_0076235
3510 Ga0495633_0526382
3511 Ga0495667_0006769
3512 Ga0495667_0006801
3513 Ga0495667_0124818
3514 Ga0495667_0136955
3515 Ga0495667_0525170
3516 Ga0495667_0603389
3517 Ga0495656_0032966
3518 Ga0495668_0103060
3519 Ga0495634_0019887
3520 Ga0495634_0047336
3521 Ga0495611_0059244
3522 Ga0495611_0419099
3523 Ga0495635_0007608
3524 Ga0495635_0010696
3525 Ga0495635_0016610
3526 Ga0495635_0054666
3527 Ga0495659_0027100
3528 Ga0495659_0030398
3529 Ga0495588_0162295
3530 Ga0495657_0354853
3531 Ga0495657_0366400
3532 Ga0495599_0026581
3533 Ga0495599_0879388
3534 Ga0495623_0243689
3535 Ga0495646_0072746
3536 Ga0495647_0015964
3537 Ga0495647_0366852
3538 Ga0495658_0000230
3539 Ga0495658_0553228
3540 Ga0495669_0167450
3541 Ga0495669_0664237
3542 Ga0495613_0002261
3543 Ga0495613_0069279
3544 Ga0495613_0097965
3545 Ga0495613_0354532
3546 Ga0495624_0034413
3547 Ga0495624_0042480
3548 Ga0495624_0071490
3549 Ga0495624_0135871
3550 Ga0495670_0061845
3551 Ga0495670_0113978
3552 Ga0495670_0130226
3553 Ga0495670_0394356
3554 Ga0495671_0207562
3555 Ga0495589_0186510
3556 Ga0495589_0216702
3557 Ga0495589_0249759
3558 Ga0495589_0271721
3559 Ga0495589_0600744
3560 Ga0495600_0009782
3561 Ga0495600_0071819
3562 Ga0495600_0328083
3563 Ga0495660_0044290
3564 Ga0495581_0001492
3565 Ga0495581_0006215
3566 Ga0495581_0631063
3567 Ga0495604_0004934
3568 Ga0495636_0028072
3569 Ga0495636_0433675
3570 Ga0495674_0003506
3571 Ga0495674_0014037
3572 Ga0495674_0025916
3573 Ga0495674_0061536
3574 Ga0495674_0257678
3575 Ga0495674_0312471
3576 Ga0495674_0404015
3577 Ga0495672_0047592
3578 Ga0495672_0097048
3579 Ga0495672_0328172
3580 Ga0495676_0003276
3581 Ga0495676_0143321
3582 Ga0495676_0160306
3583 Ga0495680_0000521
3584 Ga0495680_0011431
3585 Ga0495680_0013248
3586 Ga0495680_0028536
3587 Ga0495680_0140083
3588 Ga0495683_0146492
3589 Ga0495675_0021501
3590 Ga0495675_0232831
3591 Ga0495677_0063993
3592 Ga0495679_068998
3593 Ga0495685_062706
3594 Ga0495681_0184959
3595 Ga0495684_0009608
3596 Ga0495684_0020048
3597 Ga0495684_0051883
3598 Ga0495684_0092681
3599 Ga0495684_0748774
3600 Ga0495602_0065858
3601 Ga0495602_0190273
3602 Ga0495602_1115762
3603 Ga0495614_0014438
3604 Ga0495614_0058642
3605 Ga0495615_0220489
3606 Ga0495615_0308307
3607 Ga0495626_0047440
3608 Ga0496100_0002332
3609 Ga0496100_0005021
3610 Ga0496100_0013924
3611 Ga0496100_0013955
3612 Ga0496100_0106039
3613 Ga0496100_0576515
3614 Ga0496100_0882414
3615 Ga0496100_1010670
3616 Ga0496101_0010235
3617 Ga0496101_0025266
3618 Ga0496101_0031082
3619 Ga0496101_0049497
3620 Ga0496101_0057179
3621 Ga0496101_0091160
3622 Ga0496101_0163902
3623 Ga0496101_0233618
3624 Ga0496101_0267975
3625 Ga0496101_0292547
3626 Ga0496101_1190624
3627 Ga0496102_0002937
3628 Ga0496102_0033185
3629 Ga0496102_0071007
3630 Ga0496102_0077466
3631 Ga0496102_0131858
3632 Ga0496102_0380971
3633 Ga0496102_0601603
3634 Ga0496102_0698942
3635 Ga0496103_0001614
3636 Ga0496103_0014534
3637 Ga0496103_0018880
3638 Ga0496103_0052355
3639 Ga0496103_0483712
3640 Ga0496103_1013769
3641 Ga0496104_0005516
3642 Ga0496104_0014035
3643 Ga0496104_0015209
3644 Ga0496104_0034799
3645 Ga0496104_0036463
3646 Ga0496104_0055819
3647 Ga0496104_0157455
3648 Ga0496104_0421722
3649 Ga0496104_0870183
3650 Ga0496104_1272806
3651 Ga0496104_1654741
3652 Ga0496105_0010678
3653 Ga0496105_0027980
3654 Ga0496105_0070252
3655 Ga0496105_0093354
3656 Ga0496105_0110363
3657 Ga0496105_0122950
3658 Ga0496105_0304107
3659 Ga0496105_0499602
3660 Ga0496106_0009352
3661 Ga0496106_0011541
3662 Ga0496106_0186802
3663 Ga0496106_0208317
3664 Ga0496106_0209843
3665 Ga0496106_0413942
3666 Ga0496106_1125642
3667 Ga0496107_0006841
3668 Ga0496107_0009060
3669 Ga0496107_0029576
3670 Ga0496107_0074957
3671 Ga0496107_0085174
3672 Ga0496107_0477612
3673 Ga0496107_0883198
3674 Ga0496108_0000654
3675 Ga0496108_0002430
3676 Ga0496108_0047226
3677 Ga0496108_0133994
3678 Ga0496108_0137631
3679 Ga0496108_0172223
3680 Ga0496108_0293151
3681 Ga0496108_0364719
3682 Ga0496108_0518754
3683 Ga0496109_0002798
3684 Ga0496109_0012171
3685 Ga0496109_0013542
3686 Ga0496109_0016655
3687 Ga0496109_0024106
3688 Ga0496109_0030375
3689 Ga0496109_0037518
3690 Ga0496109_0038589
3691 Ga0496109_0053942
3692 Ga0496109_0113783
3693 Ga0496109_0204500
3694 Ga0496109_0259359
3695 Ga0496109_0625409
3696 Ga0496110_0001043
3697 Ga0496110_0001883
3698 Ga0496110_0003760
3699 Ga0496110_0014925
3700 Ga0496110_0024135
3701 Ga0496110_0043790
3702 Ga0496110_0247362
3703 Ga0496110_0281435
3704 Ga0496110_0361662
3705 Ga0496110_0368488
3706 Ga0496111_0000185
3707 Ga0496111_0002354
3708 Ga0496111_0007396
3709 Ga0496111_0017850
3710 Ga0496111_0027681
3711 Ga0496111_0069515
3712 Ga0496111_0105136
3713 Ga0496111_0127162
3714 Ga0496111_0145866
3715 Ga0496111_0153237
3716 Ga0496111_0282500
3717 Ga0496111_0537980
3718 Ga0496111_0707391
3719 Ga0496112_0004986
3720 Ga0496112_0010630
3721 Ga0496112_0026171
3722 Ga0496112_0027194
3723 Ga0496112_0037845
3724 Ga0496112_0087398
3725 Ga0496112_0091755
3726 Ga0496112_0092642
3727 Ga0496112_0160098
3728 Ga0496112_0163749
3729 Ga0496112_0226499
3730 Ga0496112_0360693
3731 Ga0496112_0428372
3732 Ga0496112_0782268
3733 Ga0496112_1008376
3734 Ga0496112_1166626
3735 Ga0496113_0003813
3736 Ga0496113_0010963
3737 Ga0496113_0038773
3738 Ga0496113_0074078
3739 Ga0496113_0171295
3740 Ga0496113_0460268
3741 Ga0496114_0003803
3742 Ga0496114_0010950
3743 Ga0496114_0035029
3744 Ga0496114_0073138
3745 Ga0496114_0102340
3746 Ga0496114_0108216
3747 Ga0496114_0177986
3748 Ga0496114_0471620
3749 Ga0496114_0506190
3750 Ga0496114_0663439
3751 Ga0496114_0772276
3752 Ga0496115_0009651
3753 Ga0496115_0016074
3754 Ga0496115_0025999
3755 Ga0496115_0061248
3756 Ga0501290_078862
3757 Ga0501300_066172
3758 Ga0501311_081133
3759 Ga0501317_085225
3760 Ga0501320_067986
3761 Ga0501031_0151420
3762 Ga0501031_0176762
3763 Ga0501031_1036008
3764 Ga0501033_0126656
3765 Ga0501033_0423655
3766 Ga0501034_0002607
3767 Ga0501036_0338224
3768 Ga0501036_0610949
3769 Ga0501036_0851716
3770 Ga0501037_0747106
3771 Ga0501038_0325699
3772 Ga0501038_0604176
3773 Ga0501038_0669436
3774 Ga0501039_0115489
3775 Ga0501039_0460072
3776 Ga0501039_0870216
3777 Ga0501039_1329807
3778 Ga0501040_0057771
3779 Ga0501040_0827480
3780 Ga0501040_1238986
3781 Ga0501041_0034630
3782 Ga0501042_0056258
3783 Ga0501042_0100926
3784 Ga0501042_0102890
3785 Ga0501043_0275034
3786 Ga0501043_0647683
3787 Ga0501046_0086652
3788 Ga0501046_0422391
3789 Ga0501046_1216392
3790 Ga0501047_0050286
3791 Ga0501047_0153138
3792 Ga0501047_0356905
3793 Ga0501048_0045475
3794 Ga0501048_0176566
3795 Ga0501048_0180171
3796 Ga0501067_0006414
3797 Ga0501067_0119012
3798 Ga0501067_0282324
3799 Ga0501068_0029729
3800 Ga0501069_0010802
3801 Ga0501069_0081900
3802 Ga0501069_0240130
3803 Ga0501069_0262639
3804 Ga0501069_0658110
3805 Ga0501070_0024322
3806 Ga0501070_0026259
3807 Ga0501070_0069129
3808 Ga0501070_0089569
3809 Ga0501070_0203130
3810 Ga0501070_0401587
3811 Ga0501071_0198887
3812 Ga0501071_0399987
3813 Ga0501071_0552819
3814 Ga0501071_0650799
3815 Ga0501071_0901722
3816 Ga0501072_0017987
3817 Ga0501072_0060596
3818 Ga0501072_0147858
3819 Ga0501072_0180091
3820 Ga0501072_0699099
3821 Ga0501072_0926230
3822 Ga0501073_0025031
3823 Ga0501073_0095561
3824 Ga0501074_0044931
3825 Ga0501074_0074051
3826 Ga0501074_0218039
3827 Ga0501074_0344366
3828 Ga0501074_0589765
3829 Ga0501074_0612763
3830 Ga0501074_0629608
3831 Ga0501074_0645054
3832 Ga0501075_0056530
3833 Ga0501075_0060095
3834 Ga0501075_0189699
3835 Ga0501075_0417473
3836 Ga0501075_0672457
3837 Ga0501075_0906527
3838 Ga0501075_1478257
3839 Ga0501075_1497182
3840 Ga0501076_0003024
3841 Ga0501076_0331672
3842 Ga0501076_0594169
3843 Ga0501076_0758956
3844 Ga0501077_0272084
3845 Ga0501077_0349046
3846 Ga0501077_0405042
3847 Ga0501077_0918466
3848 Ga0501206_104648
3849 Ga0501214_070599
3850 Ga0501217_163530
3851 Ga0501253_132060
3852 Ga0501260_046275
3853 Ga0501221_036754
3854 Ga0501245_040026
3855 Ga0501079_0010185
3856 Ga0501079_0203861
3857 Ga0501079_0227271
3858 Ga0501079_0751300
3859 Ga0501079_1655581
3860 Ga0501080_0001559
3861 Ga0501080_0072319
3862 Ga0501080_0077249
3863 Ga0501080_0552552
3864 Ga0501080_0564702
3865 Ga0501080_1305676
3866 Ga0501081_0070749
3867 Ga0501081_0822816
3868 Ga0501083_0009330
3869 Ga0501271_015111
3870 Ga0501275_011525
3871 Ga0501275_029791
3872 Ga0501035_0311358
3873 Ga0501035_0561404
3874 Ga0501035_0706317
3875 Ga0501044_0235687
3876 Ga0501044_1054356
3877 Ga0501045_0055827
3878 Ga0501045_0259140
3879 Ga0501212_053227
3880 nmdc:mga03n38_351972_c1
3881 nmdc:mga00v17_387579_c1
3882 nmdc:mga00v17_86460_c1
3883 nmdc:mga0yw44_80537_c1
3884 nmdc:mga06z11_56682_c1
3885 nmdc:mga04h51_315900_c1
3886 nmdc:mga05p37_1109532_c1
3887 nmdc:mga05p37_1203841_c1
3888 nmdc:mga05p37_1224257_c1
3889 nmdc:mga05p37_1262237_c1
3890 nmdc:mga05p37_149800_c1
3891 nmdc:mga05p37_170716_c1
3892 nmdc:mga05p37_1868039_c1
3893 nmdc:mga05p37_246225_c1
3894 nmdc:mga05p37_492557_c1
3895 nmdc:mga05p37_4971_c1
3896 nmdc:mga05p37_62009_c1
3897 nmdc:mga05p37_7365_c1
3898 nmdc:mga05p37_761181_c1
3899 nmdc:mga05p37_77309_c1
3900 nmdc:mga05p37_84532_c1
3901 nmdc:mga09592_102699_c1
3902 nmdc:mga09592_1162385_c1
3903 nmdc:mga09592_232348_c1
3904 nmdc:mga09592_72196_c1
3905 nmdc:mga09592_916500_c1
3906 nmdc:mga0qj67_127369_c1
3907 nmdc:mga0qj67_1408402_c1
3908 nmdc:mga0qj67_209527_c1
3909 nmdc:mga0qj67_226189_c1
3910 nmdc:mga0qj67_24466_c1
3911 nmdc:mga0qj67_32683_c1
3912 nmdc:mga0qj67_362303_c1
3913 nmdc:mga0qj67_75256_c1
3914 nmdc:mga06r32_1145465_c1
3915 nmdc:mga06r32_121829_c1
3916 nmdc:mga06r32_1437520_c1
3917 nmdc:mga06r32_1556444_c1
3918 nmdc:mga06r32_1789960_c1
3919 nmdc:mga06r32_372967_c1
3920 nmdc:mga06r32_466067_c1
3921 nmdc:mga08y16_1257543_c1
3922 nmdc:mga08y16_1262508_c1
3923 nmdc:mga08y16_1809560_c1
3924 nmdc:mga08y16_26832_c1
3925 nmdc:mga08y16_44850_c1
3926 nmdc:mga08y16_54775_c1
3927 nmdc:mga08y16_690772_c1
3928 nmdc:mga08y16_860011_c1
3929 nmdc:mga0n895_121245_c1
3930 nmdc:mga0n895_1681299_c1
3931 nmdc:mga0n895_276020_c1
3932 nmdc:mga0n895_87414_c1
3933 nmdc:mga0rr50_1412660_c1
3934 nmdc:mga0rr50_295337_c1
3935 nmdc:mga0rr50_390262_c1
3936 nmdc:mga0rr50_427873_c1
3937 nmdc:mga0rr50_522876_c1
3938 nmdc:mga0rr50_580693_c1
3939 nmdc:mga0rr50_610029_c1
3940 nmdc:mga08x19_225124_c1
3941 nmdc:mga08x19_48942_c1
3942 nmdc:mga08x19_8549_c1
3943 nmdc:mga0a205_1198984_c1
3944 nmdc:mga0a205_175073_c1
3945 nmdc:mga0a205_182072_c1
3946 nmdc:mga0a205_198097_c1
3947 nmdc:mga0a205_290404_c1
3948 nmdc:mga0a205_397506_c1
3949 nmdc:mga0a205_5684_c1
3950 nmdc:mga0a205_77948_c1
3951 Ga0495601_0070860
3952 Ga0495601_0338962
3953 Ga0495655_0221643
3954 Ga0495595_0002879
3955 Ga0495595_0016698
3956 Ga0495595_0085481
3957 Ga0495619_0004699
3958 Ga0495619_0005606
3959 Ga0495619_0007224
3960 Ga0495619_0054756
3961 Ga0495619_0293361
3962 Ga0501084_0051144
3963 Ga0501084_0141913
3964 Ga0501084_0169019
3965 Ga0501084_0409516
3966 Ga0501084_1346918
3967 Ga0590075_045881
3968 Ga0590077_035030
3969 Ga0587084_040057
3970 Ga0587084_051071
3971 Ga0587084_102593
3972 Ga0587084_138049
3973 Ga0587066_108855
3974 Ga0587066_217442
3975 Ga0587070_101082
3976 Ga0587070_214108
3977 Ga0587073_0203116
3978 Ga0587073_0292096
3979 Ga0587077_095102
3980 Ga0587077_212906
3981 Ga0587080_061336
3982 Ga0587080_101725
3983 Ga0587080_141572
3984 Ga0587080_146095
3985 Ga0587082_161433
3986 Ga0587085_074572
3987 Ga0587085_172658
3988 Ga0587088_151909
3989 Ga0587090_009608
3990 Ga0587090_119262
3991 Ga0587091_048029
3992 Ga0587091_067568
3993 Ga0587091_079722
3994 Ga0587092_146162
3995 Ga0587092_160686
3996 Ga0587094_117740
3997 Ga0587106_053879
3998 Ga0587106_083455
3999 Ga0587125_039416
4000 Ga0587101_153969
4001 Ga0587109_213982
4002 Ga0587113_031987
4003 Ga0587115_048274
4004 Ga0587115_077529
4005 Ga0587128_077829
4006 Ga0587128_101224
4007 Ga0587130_025002
4008 Ga0587067_023074
4009 Ga0587067_065792
4010 Ga0587067_099799
4011 Ga0587067_112104
4012 Ga0587068_113559
4013 Ga0587072_203833
4014 Ga0587072_207240
4015 Ga0587075_133276
4016 Ga0587076_137506
4017 Ga0587076_198366
4018 Ga0587078_045332
4019 Ga0587078_066884
4020 Ga0587078_074998
4021 Ga0587079_114906
4022 Ga0587079_169053
4023 Ga0587079_189891
4024 Ga0587079_221776
4025 Ga0587102_013673
4026 Ga0587102_053307
4027 Ga0587104_024947
4028 Ga0587107_098060
4029 Ga0587114_055041
4030 Ga0587114_076241
4031 Ga0587114_120275
4032 Ga0587119_084909
4033 Ga0587119_086624
4034 Ga0587071_046783
4035 Ga0587071_115430
4036 Ga0501082_0329920
4037 Ga0501082_0639635
4038 Ga0501082_0806157
4039 Ga0501082_0996221
4040 Ga0501082_1038173
4041 Ga0466962_0011514
4042 Ga0466962_0084132
4043 Ga0466962_0109045
4044 Ga0466962_0185163
4045 Ga0466962_0246087
4046 Ga0466962_0487076
4047 Ga0530510_0035924
4048 Ga0530510_0612454
4049 Ga0530510_0710199
4050 Ga0530510_0844244

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

5

111

0.96

PF13466

STAS_2

STAS domain

17

99

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9269 3 114
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9118 2 100
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.91 2 102
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9072 5 113
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9068 1 113
ID Description Score Start End Superfamily
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9115 3 113 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9085 3 116 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9033 1 106 3.30.750.24
af_O07728_25_138_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8881 2 110 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8876 1 106 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A838I9W5-F1-model_v4 Anti-sigma factor antagonist 0.9742 1 86 GO:0043856
AF-A0A1V5ILW0-F1-model_v4 Anti-sigma factor antagonist 0.9722 3 114 GO:0043856
AF-A0A538KEL9-F1-model_v4 Anti-sigma factor antagonist 0.9681 2 114 GO:0043856
AF-K4QXE7-F1-model_v4 Anti-sigma factor antagonist 0.9672 7 115 GO:0043856
AF-A0A7V9GVD6-F1-model_v4 Anti-sigma factor antagonist 0.9664 1 116 GO:0043856

Map