F496279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2025 | 552 | 4050 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300001977|JGI24746J21847_1025569|JGI24746J21847_10255692 |
| Length | 123 |
| Sequence | MNFDIKTEELANGAYVIALTGEVDLYTAPEFKQQLLEVEVIGQGAKEVVVDFSDTTFIDSTTLGVLVGGVKRLRPNGGRLSLVCNDRNITKIFEITGLNKVFPIYESRAEAVESVGQEAQAQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 133 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 134 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 156 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 163 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 164 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 285 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 301 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 307 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 312 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 318 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 319 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 320 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 321 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 322 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 323 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 324 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 325 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 326 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 327 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 328 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 329 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 330 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 331 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 332 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 333 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 341 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 448 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 449 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 450 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 479 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 480 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 481 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 482 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 483 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 484 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 485 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 490 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 491 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 495 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 496 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 497 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 498 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 499 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 500 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 515 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 516 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 552 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.58 |
| Metatranscriptomes | 6.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 7.56 |
| Rhizosphere | 91.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1025569 | 3300001977 | Bacteria | 817 |
| 2 | ARcpr5oldR_c027731 | 3300000041 | Unclassified | 525 |
| 3 | CNBas_1006135 | 3300000531 | Bacteria | 692 |
| 4 | LJQas_1020834 | 3300000549 | Bacteria | 762 |
| 5 | JGI24743J22301_10071213 | 3300001991 | Unclassified | 726 |
| 6 | JGI24750J21931_1051334 | 3300002070 | Bacteria | 644 |
| 7 | JGI24749J21850_1020376 | 3300002076 | Unclassified | 936 |
| 8 | JGI24744J21845_10000270 | 3300002077 | Bacteria | 8479 |
| 9 | JGI24034J26672_10095216 | 3300002239 | Unclassified | 556 |
| 10 | JGI24742J22300_10090598 | 3300002244 | Unclassified | 584 |
| 11 | JGI24751J29686_10093803 | 3300002459 | Unclassified | 625 |
| 12 | JGI25407J50210_10000043 | 3300003373 | Bacteria | 14036 |
| 13 | JGI25407J50210_10003008 | 3300003373 | Bacteria | 4027 |
| 14 | JGI25407J50210_10006055 | 3300003373 | Bacteria | 2998 |
| 15 | JGI25407J50210_10021102 | 3300003373 | Bacteria | 1694 |
| 16 | JGI25407J50210_10022167 | 3300003373 | Bacteria | 1651 |
| 17 | JGI25407J50210_10046390 | 3300003373 | Unclassified | 1106 |
| 18 | JGI25407J50210_10127885 | 3300003373 | Bacteria | 625 |
| 19 | JGI25407J50210_10130891 | 3300003373 | Bacteria | 618 |
| 20 | JGI25407J50210_10168277 | 3300003373 | Bacteria | 540 |
| 21 | Ga0058863_10044069 | 3300004799 | Bacteria | 1059 |
| 22 | Ga0058863_11737441 | 3300004799 | Bacteria | 564 |
| 23 | Ga0058863_11784839 | 3300004799 | Bacteria | 1916 |
| 24 | Ga0058861_10053199 | 3300004800 | Bacteria | 554 |
| 25 | Ga0058861_11902183 | 3300004800 | Bacteria | 1615 |
| 26 | Ga0058861_11963800 | 3300004800 | Bacteria | 912 |
| 27 | Ga0058861_11993075 | 3300004800 | Bacteria | 949 |
| 28 | Ga0058861_12004511 | 3300004800 | Bacteria | 542 |
| 29 | Ga0058860_12242813 | 3300004801 | Unclassified | 582 |
| 30 | Ga0058862_10018425 | 3300004803 | Bacteria | 909 |
| 31 | Ga0058862_12721611 | 3300004803 | Bacteria | 1861 |
| 32 | Ga0058862_12775560 | 3300004803 | Bacteria | 1663 |
| 33 | Ga0070658_10054807 | 3300005327 | Bacteria | 3237 |
| 34 | Ga0070658_10095618 | 3300005327 | Bacteria | 2452 |
| 35 | Ga0070658_10202218 | 3300005327 | Bacteria | 1676 |
| 36 | Ga0070658_10252336 | 3300005327 | Unclassified | 1497 |
| 37 | Ga0070658_10672640 | 3300005327 | Bacteria | 898 |
| 38 | Ga0070676_10191228 | 3300005328 | Bacteria | 1336 |
| 39 | Ga0070676_10389742 | 3300005328 | Bacteria | 967 |
| 40 | Ga0070676_10558129 | 3300005328 | Bacteria | 821 |
| 41 | Ga0070683_100003875 | 3300005329 | Bacteria | 12235 |
| 42 | Ga0070683_100004942 | 3300005329 | Bacteria | 11056 |
| 43 | Ga0070683_100015367 | 3300005329 | Bacteria | 6722 |
| 44 | Ga0070683_100015562 | 3300005329 | Bacteria | 6685 |
| 45 | Ga0070683_100025417 | 3300005329 | Bacteria | 5319 |
| 46 | Ga0070683_100032284 | 3300005329 | Bacteria | 4768 |
| 47 | Ga0070683_100077333 | 3300005329 | Unclassified | 3112 |
| 48 | Ga0070683_100124300 | 3300005329 | Bacteria | 2438 |
| 49 | Ga0070683_100291562 | 3300005329 | Unclassified | 1552 |
| 50 | Ga0070683_100411015 | 3300005329 | Bacteria | 1291 |
| 51 | Ga0070683_100634372 | 3300005329 | Bacteria | 1023 |
| 52 | Ga0070683_101046941 | 3300005329 | Unclassified | 784 |
| 53 | Ga0070670_100100103 | 3300005331 | Bacteria | 2495 |
| 54 | Ga0068869_100116112 | 3300005334 | Bacteria | 2042 |
| 55 | Ga0068869_100348491 | 3300005334 | Unclassified | 1207 |
| 56 | Ga0068869_100482914 | 3300005334 | Bacteria | 1032 |
| 57 | Ga0068869_101072642 | 3300005334 | Bacteria | 704 |
| 58 | Ga0068869_101131859 | 3300005334 | Unclassified | 686 |
| 59 | Ga0070680_100003134 | 3300005336 | Bacteria | 12287 |
| 60 | Ga0070680_100003591 | 3300005336 | Bacteria | 11582 |
| 61 | Ga0070680_100016764 | 3300005336 | Bacteria | 5765 |
| 62 | Ga0070680_100018725 | 3300005336 | Bacteria | 5478 |
| 63 | Ga0070680_100237959 | 3300005336 | Unclassified | 1538 |
| 64 | Ga0070680_100363144 | 3300005336 | Unclassified | 1232 |
| 65 | Ga0070682_100007166 | 3300005337 | Bacteria | 6281 |
| 66 | Ga0070682_100014648 | 3300005337 | Bacteria | 4534 |
| 67 | Ga0070682_100093804 | 3300005337 | Bacteria | 1968 |
| 68 | Ga0070682_100605447 | 3300005337 | Unclassified | 866 |
| 69 | Ga0070682_100832095 | 3300005337 | Bacteria | 753 |
| 70 | Ga0068868_100029713 | 3300005338 | Bacteria | 4187 |
| 71 | Ga0068868_100472709 | 3300005338 | Unclassified | 1094 |
| 72 | Ga0068868_100719330 | 3300005338 | Unclassified | 895 |
| 73 | Ga0070660_100001983 | 3300005339 | Bacteria | 14122 |
| 74 | Ga0070660_100014687 | 3300005339 | Bacteria | 5650 |
| 75 | Ga0070660_100018912 | 3300005339 | Bacteria | 5043 |
| 76 | Ga0070660_100020348 | 3300005339 | Bacteria | 4876 |
| 77 | Ga0070660_100143962 | 3300005339 | Bacteria | 1914 |
| 78 | Ga0070660_100152947 | 3300005339 | Unclassified | 1856 |
| 79 | Ga0070660_100638019 | 3300005339 | Bacteria | 892 |
| 80 | Ga0070689_100012172 | 3300005340 | Bacteria | 6188 |
| 81 | Ga0070689_100084769 | 3300005340 | Bacteria | 2491 |
| 82 | Ga0070691_10013505 | 3300005341 | Bacteria | 3741 |
| 83 | Ga0070691_10035242 | 3300005341 | Bacteria | 2356 |
| 84 | Ga0070691_10170363 | 3300005341 | Bacteria | 1128 |
| 85 | Ga0070687_100629844 | 3300005343 | Bacteria | 741 |
| 86 | Ga0070687_100715936 | 3300005343 | Bacteria | 701 |
| 87 | Ga0070661_100004275 | 3300005344 | Bacteria | 9850 |
| 88 | Ga0070661_100059829 | 3300005344 | Bacteria | 2795 |
| 89 | Ga0070661_100495188 | 3300005344 | Bacteria | 978 |
| 90 | Ga0070661_100577518 | 3300005344 | Unclassified | 907 |
| 91 | Ga0070661_100593087 | 3300005344 | Unclassified | 895 |
| 92 | Ga0070661_100896747 | 3300005344 | Unclassified | 732 |
| 93 | Ga0070692_10295024 | 3300005345 | Bacteria | 988 |
| 94 | Ga0070692_10314616 | 3300005345 | Unclassified | 960 |
| 95 | Ga0070692_10582475 | 3300005345 | Bacteria | 738 |
| 96 | Ga0070668_100009147 | 3300005347 | Bacteria | 7352 |
| 97 | Ga0070668_100053183 | 3300005347 | Unclassified | 3123 |
| 98 | Ga0070668_100469842 | 3300005347 | Unclassified | 1084 |
| 99 | Ga0070668_100799891 | 3300005347 | Bacteria | 838 |
| 100 | Ga0070675_100020633 | 3300005354 | Bacteria | 5258 |
| 101 | Ga0070675_100876949 | 3300005354 | Unclassified | 822 |
| 102 | Ga0070671_100029788 | 3300005355 | Bacteria | 4502 |
| 103 | Ga0070671_100349998 | 3300005355 | Unclassified | 1261 |
| 104 | Ga0070674_100005639 | 3300005356 | Bacteria | 7253 |
| 105 | Ga0070674_100050682 | 3300005356 | Unclassified | 2858 |
| 106 | Ga0070673_100044430 | 3300005364 | Bacteria | 3440 |
| 107 | Ga0070673_100069317 | 3300005364 | Bacteria | 2826 |
| 108 | Ga0070673_100614903 | 3300005364 | Bacteria | 992 |
| 109 | Ga0070688_100016002 | 3300005365 | Bacteria | 4279 |
| 110 | Ga0070688_100131972 | 3300005365 | Bacteria | 1686 |
| 111 | Ga0070688_100648451 | 3300005365 | Bacteria | 813 |
| 112 | Ga0070659_100059318 | 3300005366 | Bacteria | 3021 |
| 113 | Ga0070659_100064034 | 3300005366 | Bacteria | 2909 |
| 114 | Ga0070659_100089872 | 3300005366 | Bacteria | 2461 |
| 115 | Ga0070659_100232868 | 3300005366 | Unclassified | 1522 |
| 116 | Ga0070659_100341947 | 3300005366 | Bacteria | 1254 |
| 117 | Ga0070659_100438748 | 3300005366 | Bacteria | 1106 |
| 118 | Ga0070659_100561683 | 3300005366 | Bacteria | 978 |
| 119 | Ga0070659_100631050 | 3300005366 | Bacteria | 923 |
| 120 | Ga0070667_100009082 | 3300005367 | Bacteria | 8224 |
| 121 | Ga0070703_10018550 | 3300005406 | Bacteria | 2013 |
| 122 | Ga0070703_10020258 | 3300005406 | Unclassified | 1934 |
| 123 | Ga0070703_10034127 | 3300005406 | Unclassified | 1552 |
| 124 | Ga0070703_10085263 | 3300005406 | Bacteria | 1085 |
| 125 | Ga0070703_10238877 | 3300005406 | Bacteria | 732 |
| 126 | Ga0070709_10015555 | 3300005434 | Bacteria | 4332 |
| 127 | Ga0070709_10053684 | 3300005434 | Bacteria | 2538 |
| 128 | Ga0070709_10177399 | 3300005434 | Bacteria | 1494 |
| 129 | Ga0070709_10577651 | 3300005434 | Unclassified | 863 |
| 130 | Ga0070709_10595674 | 3300005434 | Unclassified | 850 |
| 131 | Ga0070714_100002694 | 3300005435 | Bacteria | 13092 |
| 132 | Ga0070714_100013536 | 3300005435 | Bacteria | 6538 |
| 133 | Ga0070714_100020417 | 3300005435 | Bacteria | 5409 |
| 134 | Ga0070714_100026064 | 3300005435 | Bacteria | 4829 |
| 135 | Ga0070714_100065451 | 3300005435 | Bacteria | 3130 |
| 136 | Ga0070714_100074062 | 3300005435 | Bacteria | 2951 |
| 137 | Ga0070714_100221880 | 3300005435 | Bacteria | 1737 |
| 138 | Ga0070714_100355538 | 3300005435 | Bacteria | 1376 |
| 139 | Ga0070714_100390529 | 3300005435 | Bacteria | 1313 |
| 140 | Ga0070714_100679528 | 3300005435 | Bacteria | 992 |
| 141 | Ga0070714_100865879 | 3300005435 | Bacteria | 877 |
| 142 | Ga0070714_101877387 | 3300005435 | Unclassified | 585 |
| 143 | Ga0070713_100005694 | 3300005436 | Bacteria | 8554 |
| 144 | Ga0070713_100193807 | 3300005436 | Unclassified | 1832 |
| 145 | Ga0070713_100274991 | 3300005436 | Unclassified | 1543 |
| 146 | Ga0070713_100464891 | 3300005436 | Bacteria | 1190 |
| 147 | Ga0070713_100493504 | 3300005436 | Bacteria | 1155 |
| 148 | Ga0070713_101132422 | 3300005436 | Bacteria | 757 |
| 149 | Ga0070713_102352094 | 3300005436 | Bacteria | 515 |
| 150 | Ga0070710_10003097 | 3300005437 | Bacteria | 7894 |
| 151 | Ga0070710_10011088 | 3300005437 | Bacteria | 4444 |
| 152 | Ga0070710_10031029 | 3300005437 | Unclassified | 2880 |
| 153 | Ga0070710_10045000 | 3300005437 | Bacteria | 2451 |
| 154 | Ga0070710_11012383 | 3300005437 | Bacteria | 606 |
| 155 | Ga0070710_11442429 | 3300005437 | Bacteria | 516 |
| 156 | Ga0070710_11442770 | 3300005437 | Bacteria | 516 |
| 157 | Ga0070701_10011918 | 3300005438 | Bacteria | 3904 |
| 158 | Ga0070701_10032032 | 3300005438 | Bacteria | 2614 |
| 159 | Ga0070701_10039684 | 3300005438 | Bacteria | 2390 |
| 160 | Ga0070711_100006000 | 3300005439 | Bacteria | 7293 |
| 161 | Ga0070711_100020967 | 3300005439 | Bacteria | 4220 |
| 162 | Ga0070711_100060127 | 3300005439 | Bacteria | 2640 |
| 163 | Ga0070711_100109928 | 3300005439 | Unclassified | 2021 |
| 164 | Ga0070711_100167465 | 3300005439 | Unclassified | 1672 |
| 165 | Ga0070711_100231071 | 3300005439 | Bacteria | 1442 |
| 166 | Ga0070711_100495444 | 3300005439 | Bacteria | 1006 |
| 167 | Ga0070711_100741187 | 3300005439 | Bacteria | 830 |
| 168 | Ga0070705_100006630 | 3300005440 | Bacteria | 5687 |
| 169 | Ga0070705_100099872 | 3300005440 | Unclassified | 1830 |
| 170 | Ga0070705_101384348 | 3300005440 | Bacteria | 586 |
| 171 | Ga0070700_100004550 | 3300005441 | Bacteria | 7256 |
| 172 | Ga0070700_100008039 | 3300005441 | Bacteria | 5733 |
| 173 | Ga0070700_100143935 | 3300005441 | Unclassified | 1623 |
| 174 | Ga0070700_100218527 | 3300005441 | Unclassified | 1349 |
| 175 | Ga0070700_100428767 | 3300005441 | Archaea | 1001 |
| 176 | Ga0070700_101720119 | 3300005441 | Unclassified | 538 |
| 177 | Ga0070694_100078212 | 3300005444 | Bacteria | 2294 |
| 178 | Ga0070694_100093263 | 3300005444 | Bacteria | 2116 |
| 179 | Ga0070694_100097550 | 3300005444 | Unclassified | 2074 |
| 180 | Ga0070694_100163564 | 3300005444 | Bacteria | 1635 |
| 181 | Ga0070694_100292928 | 3300005444 | Bacteria | 1245 |
| 182 | Ga0070694_100403141 | 3300005444 | Unclassified | 1071 |
| 183 | Ga0070694_100506252 | 3300005444 | Bacteria | 961 |
| 184 | Ga0070694_100789431 | 3300005444 | Bacteria | 778 |
| 185 | Ga0070708_100015786 | 3300005445 | Bacteria | 6243 |
| 186 | Ga0070708_100200605 | 3300005445 | Unclassified | 1867 |
| 187 | Ga0070708_100380528 | 3300005445 | Bacteria | 1331 |
| 188 | Ga0070708_100455620 | 3300005445 | Bacteria | 1207 |
| 189 | Ga0070708_100498394 | 3300005445 | Unclassified | 1149 |
| 190 | Ga0070708_101020057 | 3300005445 | Unclassified | 776 |
| 191 | Ga0070663_100008031 | 3300005455 | Bacteria | 6469 |
| 192 | Ga0070663_100501777 | 3300005455 | Bacteria | 1008 |
| 193 | Ga0070678_100026628 | 3300005456 | Bacteria | 3913 |
| 194 | Ga0070678_100064976 | 3300005456 | Bacteria | 2707 |
| 195 | Ga0070678_100368470 | 3300005456 | Unclassified | 1240 |
| 196 | Ga0070678_100517760 | 3300005456 | Unclassified | 1055 |
| 197 | Ga0070678_100978404 | 3300005456 | Unclassified | 777 |
| 198 | Ga0070662_100016960 | 3300005457 | Bacteria | 4898 |
| 199 | Ga0070662_100065436 | 3300005457 | Bacteria | 2665 |
| 200 | Ga0070662_100164627 | 3300005457 | Bacteria | 1737 |
| 201 | Ga0070662_100432141 | 3300005457 | Bacteria | 1091 |
| 202 | Ga0070681_10005686 | 3300005458 | Bacteria | 12051 |
| 203 | Ga0070681_10007190 | 3300005458 | Bacteria | 10848 |
| 204 | Ga0070681_10026484 | 3300005458 | Bacteria | 5827 |
| 205 | Ga0070681_10059689 | 3300005458 | Unclassified | 3793 |
| 206 | Ga0070681_10090820 | 3300005458 | Bacteria | 3004 |
| 207 | Ga0070681_10102077 | 3300005458 | Bacteria | 2813 |
| 208 | Ga0070681_10175042 | 3300005458 | Bacteria | 2068 |
| 209 | Ga0068867_100006973 | 3300005459 | Bacteria | 7986 |
| 210 | Ga0068867_100033254 | 3300005459 | Bacteria | 3733 |
| 211 | Ga0068867_100073840 | 3300005459 | Bacteria | 2554 |
| 212 | Ga0070685_10000816 | 3300005466 | Bacteria | 16917 |
| 213 | Ga0070685_10535385 | 3300005466 | Bacteria | 834 |
| 214 | Ga0070685_10768751 | 3300005466 | Bacteria | 708 |
| 215 | Ga0070706_100020865 | 3300005467 | Bacteria | 6031 |
| 216 | Ga0070706_100039379 | 3300005467 | Unclassified | 4364 |
| 217 | Ga0070706_100044894 | 3300005467 | Bacteria | 4082 |
| 218 | Ga0070706_100477554 | 3300005467 | Bacteria | 1160 |
| 219 | Ga0070706_100556298 | 3300005467 | Unclassified | 1067 |
| 220 | Ga0070707_100000949 | 3300005468 | Bacteria | 28781 |
| 221 | Ga0070707_100008460 | 3300005468 | Bacteria | 9557 |
| 222 | Ga0070707_100030747 | 3300005468 | Bacteria | 5114 |
| 223 | Ga0070707_100175479 | 3300005468 | Bacteria | 2089 |
| 224 | Ga0070707_100570562 | 3300005468 | Bacteria | 1094 |
| 225 | Ga0070707_100732611 | 3300005468 | Bacteria | 952 |
| 226 | Ga0070707_101137811 | 3300005468 | Unclassified | 746 |
| 227 | Ga0070698_100104407 | 3300005471 | Bacteria | 2804 |
| 228 | Ga0070698_100129651 | 3300005471 | Bacteria | 2478 |
| 229 | Ga0070698_100145113 | 3300005471 | Unclassified | 2323 |
| 230 | Ga0070698_100175800 | 3300005471 | Unclassified | 2080 |
| 231 | Ga0070698_100229696 | 3300005471 | Bacteria | 1789 |
| 232 | Ga0070698_100319812 | 3300005471 | Bacteria | 1482 |
| 233 | Ga0070698_100455753 | 3300005471 | Bacteria | 1215 |
| 234 | Ga0070699_100033241 | 3300005518 | Bacteria | 4455 |
| 235 | Ga0070699_100104436 | 3300005518 | Unclassified | 2485 |
| 236 | Ga0070699_100336076 | 3300005518 | Bacteria | 1359 |
| 237 | Ga0070699_100620979 | 3300005518 | Unclassified | 986 |
| 238 | Ga0070699_100688635 | 3300005518 | Unclassified | 934 |
| 239 | Ga0070699_101571820 | 3300005518 | Bacteria | 603 |
| 240 | Ga0070679_100003327 | 3300005530 | Bacteria | 14715 |
| 241 | Ga0070679_100034667 | 3300005530 | Bacteria | 5002 |
| 242 | Ga0070679_100036280 | 3300005530 | Bacteria | 4893 |
| 243 | Ga0070679_100096267 | 3300005530 | Unclassified | 2948 |
| 244 | Ga0070679_100119568 | 3300005530 | Bacteria | 2619 |
| 245 | Ga0070679_100137031 | 3300005530 | Bacteria | 2429 |
| 246 | Ga0070679_100162691 | 3300005530 | Bacteria | 2206 |
| 247 | Ga0070679_100171898 | 3300005530 | Unclassified | 2139 |
| 248 | Ga0070679_100296057 | 3300005530 | Unclassified | 1569 |
| 249 | Ga0070679_100366707 | 3300005530 | Bacteria | 1387 |
| 250 | Ga0070679_100515577 | 3300005530 | Unclassified | 1139 |
| 251 | Ga0070679_100551128 | 3300005530 | Unclassified | 1097 |
| 252 | Ga0070684_100007962 | 3300005535 | Bacteria | 8272 |
| 253 | Ga0070684_100013215 | 3300005535 | Bacteria | 6648 |
| 254 | Ga0070684_100014125 | 3300005535 | Bacteria | 6457 |
| 255 | Ga0070684_100014774 | 3300005535 | Bacteria | 6336 |
| 256 | Ga0070684_100023477 | 3300005535 | Bacteria | 5160 |
| 257 | Ga0070684_100040341 | 3300005535 | Bacteria | 4019 |
| 258 | Ga0070684_100102459 | 3300005535 | Unclassified | 2559 |
| 259 | Ga0070684_100198141 | 3300005535 | Unclassified | 1829 |
| 260 | Ga0070684_100300933 | 3300005535 | Bacteria | 1472 |
| 261 | Ga0070684_100767353 | 3300005535 | Bacteria | 901 |
| 262 | Ga0070684_101010462 | 3300005535 | Bacteria | 781 |
| 263 | Ga0070697_100075441 | 3300005536 | Bacteria | 2772 |
| 264 | Ga0070697_100105678 | 3300005536 | Bacteria | 2342 |
| 265 | Ga0070697_100438398 | 3300005536 | Bacteria | 1137 |
| 266 | Ga0070697_100958980 | 3300005536 | Bacteria | 760 |
| 267 | Ga0070697_101262820 | 3300005536 | Bacteria | 659 |
| 268 | Ga0068853_100261655 | 3300005539 | Bacteria | 1591 |
| 269 | Ga0070672_100049761 | 3300005543 | Bacteria | 3262 |
| 270 | Ga0070672_100419912 | 3300005543 | Unclassified | 1149 |
| 271 | Ga0070686_100004382 | 3300005544 | Bacteria | 7782 |
| 272 | Ga0070686_100053104 | 3300005544 | Unclassified | 2586 |
| 273 | Ga0070686_100132245 | 3300005544 | Bacteria | 1727 |
| 274 | Ga0070695_100018875 | 3300005545 | Unclassified | 4192 |
| 275 | Ga0070695_100197479 | 3300005545 | Bacteria | 1435 |
| 276 | Ga0070695_100883184 | 3300005545 | Bacteria | 721 |
| 277 | Ga0070696_100026892 | 3300005546 | Bacteria | 3916 |
| 278 | Ga0070696_100048064 | 3300005546 | Bacteria | 2961 |
| 279 | Ga0070696_100062253 | 3300005546 | Bacteria | 2611 |
| 280 | Ga0070696_100071072 | 3300005546 | Bacteria | 2449 |
| 281 | Ga0070696_100290075 | 3300005546 | Bacteria | 1250 |
| 282 | Ga0070693_100091560 | 3300005547 | Bacteria | 1834 |
| 283 | Ga0070693_100182878 | 3300005547 | Unclassified | 1350 |
| 284 | Ga0070693_100205863 | 3300005547 | Bacteria | 1281 |
| 285 | Ga0070693_100306115 | 3300005547 | Bacteria | 1073 |
| 286 | Ga0070693_100733012 | 3300005547 | Bacteria | 727 |
| 287 | Ga0070693_100865643 | 3300005547 | Bacteria | 675 |
| 288 | Ga0070693_101151193 | 3300005547 | Bacteria | 594 |
| 289 | Ga0070693_101566402 | 3300005547 | Bacteria | 517 |
| 290 | Ga0070665_100041443 | 3300005548 | Bacteria | 4628 |
| 291 | Ga0070665_100802888 | 3300005548 | Unclassified | 954 |
| 292 | Ga0070704_100030154 | 3300005549 | Bacteria | 3631 |
| 293 | Ga0070704_100070736 | 3300005549 | Bacteria | 2533 |
| 294 | Ga0070704_100273762 | 3300005549 | Bacteria | 1396 |
| 295 | Ga0070704_100304591 | 3300005549 | Unclassified | 1329 |
| 296 | Ga0070704_100412772 | 3300005549 | Bacteria | 1155 |
| 297 | Ga0070704_100618445 | 3300005549 | Bacteria | 953 |
| 298 | Ga0070704_100985148 | 3300005549 | Bacteria | 762 |
| 299 | Ga0070704_101886147 | 3300005549 | Unclassified | 554 |
| 300 | Ga0070704_102280652 | 3300005549 | Bacteria | 504 |
| 301 | Ga0070704_102289475 | 3300005549 | Bacteria | 503 |
| 302 | Ga0068855_100007343 | 3300005563 | Bacteria | 13353 |
| 303 | Ga0068855_100052133 | 3300005563 | Bacteria | 4817 |
| 304 | Ga0068855_100100393 | 3300005563 | Bacteria | 3332 |
| 305 | Ga0068855_100119357 | 3300005563 | Bacteria | 3019 |
| 306 | Ga0068855_100192027 | 3300005563 | Bacteria | 2303 |
| 307 | Ga0068855_100233615 | 3300005563 | Bacteria | 2057 |
| 308 | Ga0068855_100643935 | 3300005563 | Bacteria | 1139 |
| 309 | Ga0068855_102063349 | 3300005563 | Bacteria | 575 |
| 310 | Ga0070664_100259034 | 3300005564 | Bacteria | 1565 |
| 311 | Ga0070664_100287489 | 3300005564 | Bacteria | 1484 |
| 312 | Ga0070664_100464054 | 3300005564 | Bacteria | 1164 |
| 313 | Ga0070664_100982632 | 3300005564 | Bacteria | 793 |
| 314 | Ga0068857_100011204 | 3300005577 | Bacteria | 7799 |
| 315 | Ga0068857_100024729 | 3300005577 | Bacteria | 5290 |
| 316 | Ga0068857_100177906 | 3300005577 | Bacteria | 1935 |
| 317 | Ga0068857_100463588 | 3300005577 | Unclassified | 1186 |
| 318 | Ga0068857_101787033 | 3300005577 | Bacteria | 602 |
| 319 | Ga0068854_100053511 | 3300005578 | Bacteria | 2899 |
| 320 | Ga0068854_100056126 | 3300005578 | Bacteria | 2838 |
| 321 | Ga0068854_100065930 | 3300005578 | Bacteria | 2634 |
| 322 | Ga0068854_100398173 | 3300005578 | Bacteria | 1139 |
| 323 | Ga0068854_100823579 | 3300005578 | Bacteria | 811 |
| 324 | Ga0068854_100990318 | 3300005578 | Bacteria | 744 |
| 325 | Ga0068854_102239201 | 3300005578 | Bacteria | 506 |
| 326 | Ga0068856_100014707 | 3300005614 | Bacteria | 7553 |
| 327 | Ga0068856_100129320 | 3300005614 | Bacteria | 2529 |
| 328 | Ga0068856_100135206 | 3300005614 | Unclassified | 2471 |
| 329 | Ga0068856_100151195 | 3300005614 | Bacteria | 2330 |
| 330 | Ga0068856_100153638 | 3300005614 | Bacteria | 2311 |
| 331 | Ga0068856_100168305 | 3300005614 | Bacteria | 2203 |
| 332 | Ga0068856_100177636 | 3300005614 | Unclassified | 2141 |
| 333 | Ga0068856_100196994 | 3300005614 | Bacteria | 2028 |
| 334 | Ga0068856_100352124 | 3300005614 | Bacteria | 1491 |
| 335 | Ga0068856_100358074 | 3300005614 | Bacteria | 1478 |
| 336 | Ga0068856_101273049 | 3300005614 | Bacteria | 751 |
| 337 | Ga0070702_100010172 | 3300005615 | Unclassified | 4624 |
| 338 | Ga0070702_100022444 | 3300005615 | Bacteria | 3337 |
| 339 | Ga0070702_100044741 | 3300005615 | Unclassified | 2501 |
| 340 | Ga0070702_100220914 | 3300005615 | Bacteria | 1267 |
| 341 | Ga0070702_100275950 | 3300005615 | Unclassified | 1152 |
| 342 | Ga0070702_100500890 | 3300005615 | Bacteria | 892 |
| 343 | Ga0068852_100005023 | 3300005616 | Bacteria | 9404 |
| 344 | Ga0068852_100046589 | 3300005616 | Bacteria | 3695 |
| 345 | Ga0068852_100138618 | 3300005616 | Bacteria | 2249 |
| 346 | Ga0068852_100476381 | 3300005616 | Unclassified | 1240 |
| 347 | Ga0068852_100550581 | 3300005616 | Bacteria | 1154 |
| 348 | Ga0068859_100084191 | 3300005617 | Bacteria | 3225 |
| 349 | Ga0068864_102111545 | 3300005618 | Bacteria | 570 |
| 350 | Ga0068866_10006032 | 3300005718 | Bacteria | 5042 |
| 351 | Ga0068866_10515562 | 3300005718 | Unclassified | 794 |
| 352 | Ga0068866_10535513 | 3300005718 | Bacteria | 781 |
| 353 | Ga0068861_100013642 | 3300005719 | Bacteria | 5689 |
| 354 | Ga0068861_100038498 | 3300005719 | Bacteria | 3562 |
| 355 | Ga0068861_100052992 | 3300005719 | Bacteria | 3085 |
| 356 | Ga0068861_100731155 | 3300005719 | Bacteria | 923 |
| 357 | Ga0068861_101046354 | 3300005719 | Bacteria | 782 |
| 358 | Ga0068851_10387756 | 3300005834 | Bacteria | 820 |
| 359 | Ga0068851_10664548 | 3300005834 | Unclassified | 639 |
| 360 | Ga0068870_10224842 | 3300005840 | Unclassified | 1151 |
| 361 | Ga0068863_100552428 | 3300005841 | Bacteria | 1137 |
| 362 | Ga0068858_100140136 | 3300005842 | Bacteria | 2270 |
| 363 | Ga0068858_100217577 | 3300005842 | Bacteria | 1808 |
| 364 | Ga0068858_101191089 | 3300005842 | Bacteria | 749 |
| 365 | Ga0068860_100040839 | 3300005843 | Bacteria | 4432 |
| 366 | Ga0068860_101081608 | 3300005843 | Unclassified | 821 |
| 367 | Ga0068862_100098128 | 3300005844 | Bacteria | 2559 |
| 368 | Ga0068862_100120115 | 3300005844 | Bacteria | 2316 |
| 369 | Ga0068862_100162103 | 3300005844 | Bacteria | 1997 |
| 370 | Ga0068862_100232551 | 3300005844 | Bacteria | 1673 |
| 371 | Ga0068862_100858410 | 3300005844 | Bacteria | 890 |
| 372 | Ga0081455_10008363 | 3300005937 | Bacteria | 10770 |
| 373 | Ga0081455_10013810 | 3300005937 | Bacteria | 7947 |
| 374 | Ga0081455_10016696 | 3300005937 | Bacteria | 7072 |
| 375 | Ga0081455_10038483 | 3300005937 | Bacteria | 4236 |
| 376 | Ga0081455_10126415 | 3300005937 | Unclassified | 2006 |
| 377 | Ga0081455_10763569 | 3300005937 | Bacteria | 610 |
| 378 | Ga0081538_10000013 | 3300005981 | Bacteria | 151925 |
| 379 | Ga0081538_10000169 | 3300005981 | Bacteria | 69684 |
| 380 | Ga0081538_10000312 | 3300005981 | Bacteria | 55768 |
| 381 | Ga0081538_10001407 | 3300005981 | Bacteria | 24723 |
| 382 | Ga0081538_10004036 | 3300005981 | Bacteria | 13655 |
| 383 | Ga0081538_10004074 | 3300005981 | Bacteria | 13596 |
| 384 | Ga0081538_10004165 | 3300005981 | Bacteria | 13421 |
| 385 | Ga0081538_10006358 | 3300005981 | Bacteria | 10420 |
| 386 | Ga0081538_10007118 | 3300005981 | Bacteria | 9718 |
| 387 | Ga0081538_10008139 | 3300005981 | Bacteria | 8944 |
| 388 | Ga0081538_10014186 | 3300005981 | Bacteria | 6259 |
| 389 | Ga0081538_10017335 | 3300005981 | Bacteria | 5471 |
| 390 | Ga0081538_10042595 | 3300005981 | Bacteria | 2862 |
| 391 | Ga0081538_10071028 | 3300005981 | Bacteria | 1918 |
| 392 | Ga0081538_10088805 | 3300005981 | Bacteria | 1607 |
| 393 | Ga0081538_10104794 | 3300005981 | Bacteria | 1410 |
| 394 | Ga0081538_10173571 | 3300005981 | Bacteria | 936 |
| 395 | Ga0081538_10193139 | 3300005981 | Bacteria | 850 |
| 396 | Ga0081538_10287189 | 3300005981 | Unclassified | 609 |
| 397 | Ga0081538_10314539 | 3300005981 | Unclassified | 572 |
| 398 | Ga0081540_1227848 | 3300005983 | Bacteria | 659 |
| 399 | Ga0081539_10022410 | 3300005985 | Bacteria | 4179 |
| 400 | Ga0081539_10091737 | 3300005985 | Bacteria | 1568 |
| 401 | Ga0081539_10472253 | 3300005985 | Bacteria | 519 |
| 402 | Ga0070717_10017003 | 3300006028 | Bacteria | 5650 |
| 403 | Ga0070717_10040364 | 3300006028 | Bacteria | 3801 |
| 404 | Ga0070717_10066037 | 3300006028 | Unclassified | 3008 |
| 405 | Ga0070717_10203330 | 3300006028 | Unclassified | 1736 |
| 406 | Ga0070717_10341336 | 3300006028 | Bacteria | 1337 |
| 407 | Ga0070717_10573589 | 3300006028 | Unclassified | 1023 |
| 408 | Ga0070717_10639376 | 3300006028 | Bacteria | 966 |
| 409 | Ga0070717_10729318 | 3300006028 | Bacteria | 901 |
| 410 | Ga0075365_10073645 | 3300006038 | Bacteria | 2302 |
| 411 | Ga0075365_10081253 | 3300006038 | Unclassified | 2196 |
| 412 | Ga0075365_10122219 | 3300006038 | Bacteria | 1797 |
| 413 | Ga0075363_100295244 | 3300006048 | Bacteria | 940 |
| 414 | Ga0075364_10015582 | 3300006051 | Bacteria | 4716 |
| 415 | Ga0075364_10539183 | 3300006051 | Bacteria | 798 |
| 416 | Ga0075364_10639124 | 3300006051 | Bacteria | 727 |
| 417 | Ga0075364_10782450 | 3300006051 | Bacteria | 651 |
| 418 | Ga0075432_10073896 | 3300006058 | Bacteria | 1228 |
| 419 | Ga0075432_10121650 | 3300006058 | Bacteria | 981 |
| 420 | Ga0070715_10026026 | 3300006163 | Bacteria | 2323 |
| 421 | Ga0070715_10076256 | 3300006163 | Unclassified | 1510 |
| 422 | Ga0070716_100116344 | 3300006173 | Bacteria | 1666 |
| 423 | Ga0070716_100145445 | 3300006173 | Bacteria | 1518 |
| 424 | Ga0070716_100283281 | 3300006173 | Bacteria | 1145 |
| 425 | Ga0070716_100375141 | 3300006173 | Bacteria | 1015 |
| 426 | Ga0070716_100841602 | 3300006173 | Bacteria | 714 |
| 427 | Ga0070712_100004431 | 3300006175 | Bacteria | 8665 |
| 428 | Ga0070712_100022316 | 3300006175 | Bacteria | 4169 |
| 429 | Ga0070712_100157763 | 3300006175 | Bacteria | 1749 |
| 430 | Ga0070712_100344709 | 3300006175 | Bacteria | 1218 |
| 431 | Ga0070712_100677103 | 3300006175 | Bacteria | 878 |
| 432 | Ga0070712_100889047 | 3300006175 | Unclassified | 768 |
| 433 | Ga0070712_101230233 | 3300006175 | Bacteria | 652 |
| 434 | Ga0070712_101439411 | 3300006175 | Unclassified | 602 |
| 435 | Ga0075362_10035978 | 3300006177 | Bacteria | 2163 |
| 436 | Ga0075367_10329957 | 3300006178 | Bacteria | 962 |
| 437 | Ga0075367_10640213 | 3300006178 | Bacteria | 676 |
| 438 | Ga0075427_10019431 | 3300006194 | Unclassified | 1071 |
| 439 | Ga0075427_10047472 | 3300006194 | Bacteria | 734 |
| 440 | Ga0097621_100005052 | 3300006237 | Bacteria | 9267 |
| 441 | Ga0068871_100207804 | 3300006358 | Unclassified | 1692 |
| 442 | Ga0068871_100617894 | 3300006358 | Unclassified | 987 |
| 443 | Ga0068871_100981847 | 3300006358 | Unclassified | 786 |
| 444 | Ga0075428_100013903 | 3300006844 | Bacteria | 8963 |
| 445 | Ga0075428_100029675 | 3300006844 | Bacteria | 6051 |
| 446 | Ga0075428_100116229 | 3300006844 | Bacteria | 2914 |
| 447 | Ga0075428_100147536 | 3300006844 | Bacteria | 2557 |
| 448 | Ga0075428_100251524 | 3300006844 | Bacteria | 1905 |
| 449 | Ga0075428_100281357 | 3300006844 | Bacteria | 1790 |
| 450 | Ga0075428_100330067 | 3300006844 | Bacteria | 1638 |
| 451 | Ga0075428_100924775 | 3300006844 | Bacteria | 925 |
| 452 | Ga0075430_100024546 | 3300006846 | Bacteria | 5128 |
| 453 | Ga0075430_100029281 | 3300006846 | Bacteria | 4673 |
| 454 | Ga0075430_100082786 | 3300006846 | Bacteria | 2689 |
| 455 | Ga0075430_100379413 | 3300006846 | Bacteria | 1167 |
| 456 | Ga0075431_100042220 | 3300006847 | Bacteria | 4702 |
| 457 | Ga0075431_100149921 | 3300006847 | Bacteria | 2402 |
| 458 | Ga0075431_100309849 | 3300006847 | Bacteria | 1594 |
| 459 | Ga0075431_100319133 | 3300006847 | Bacteria | 1567 |
| 460 | Ga0075431_100421210 | 3300006847 | Bacteria | 1334 |
| 461 | Ga0075431_100469761 | 3300006847 | Bacteria | 1252 |
| 462 | Ga0075431_101087123 | 3300006847 | Bacteria | 765 |
| 463 | Ga0075433_10000416 | 3300006852 | Bacteria | 27184 |
| 464 | Ga0075433_10018210 | 3300006852 | Bacteria | 5833 |
| 465 | Ga0075433_10039332 | 3300006852 | Bacteria | 4089 |
| 466 | Ga0075433_10068696 | 3300006852 | Bacteria | 3111 |
| 467 | Ga0075433_10385585 | 3300006852 | Bacteria | 1237 |
| 468 | Ga0075434_100036046 | 3300006871 | Bacteria | 4891 |
| 469 | Ga0075434_100261264 | 3300006871 | Unclassified | 1750 |
| 470 | Ga0075434_100501291 | 3300006871 | Bacteria | 1235 |
| 471 | Ga0075434_101055760 | 3300006871 | Bacteria | 826 |
| 472 | Ga0075429_100030504 | 3300006880 | Bacteria | 4684 |
| 473 | Ga0075429_100111063 | 3300006880 | Bacteria | 2396 |
| 474 | Ga0075429_100607664 | 3300006880 | Unclassified | 958 |
| 475 | Ga0075429_100687375 | 3300006880 | Unclassified | 896 |
| 476 | Ga0075429_101140949 | 3300006880 | Bacteria | 681 |
| 477 | Ga0068865_100001717 | 3300006881 | Bacteria | 12852 |
| 478 | Ga0068865_100108711 | 3300006881 | Unclassified | 2042 |
| 479 | Ga0068865_101159881 | 3300006881 | Unclassified | 683 |
| 480 | Ga0075436_100016298 | 3300006914 | Bacteria | 5088 |
| 481 | Ga0075436_100167361 | 3300006914 | Bacteria | 1551 |
| 482 | Ga0075436_100334850 | 3300006914 | Unclassified | 1089 |
| 483 | Ga0097620_100084191 | 3300006931 | Bacteria | 3225 |
| 484 | Ga0075435_100001405 | 3300007076 | Bacteria | 15514 |
| 485 | Ga0075435_100009412 | 3300007076 | Bacteria | 7071 |
| 486 | Ga0075435_100010822 | 3300007076 | Bacteria | 6680 |
| 487 | Ga0075435_100448879 | 3300007076 | Bacteria | 1112 |
| 488 | Ga0075435_100806314 | 3300007076 | Unclassified | 817 |
| 489 | Ga0075435_100917241 | 3300007076 | Bacteria | 764 |
| 490 | Ga0099795_10176161 | 3300007788 | Bacteria | 891 |
| 491 | Ga0105251_10617811 | 3300009011 | Bacteria | 516 |
| 492 | Ga0105240_10103290 | 3300009093 | Bacteria | 3463 |
| 493 | Ga0105240_10408271 | 3300009093 | Bacteria | 1528 |
| 494 | Ga0105240_10614585 | 3300009093 | Bacteria | 1195 |
| 495 | Ga0111539_10002945 | 3300009094 | Bacteria | 22581 |
| 496 | Ga0111539_10009364 | 3300009094 | Bacteria | 12365 |
| 497 | Ga0111539_10025490 | 3300009094 | Bacteria | 7250 |
| 498 | Ga0111539_10066276 | 3300009094 | Bacteria | 4265 |
| 499 | Ga0111539_10164231 | 3300009094 | Bacteria | 2597 |
| 500 | Ga0111539_10182094 | 3300009094 | Bacteria | 2454 |
| 501 | Ga0111539_10590617 | 3300009094 | Bacteria | 1293 |
| 502 | Ga0111539_10794970 | 3300009094 | Bacteria | 1101 |
| 503 | Ga0111539_11233969 | 3300009094 | Bacteria | 868 |
| 504 | Ga0111539_12212767 | 3300009094 | Bacteria | 638 |
| 505 | Ga0105245_10014118 | 3300009098 | Bacteria | 6959 |
| 506 | Ga0105245_10047377 | 3300009098 | Bacteria | 3842 |
| 507 | Ga0105245_10059580 | 3300009098 | Bacteria | 3438 |
| 508 | Ga0105245_10120510 | 3300009098 | Bacteria | 2450 |
| 509 | Ga0105245_10197889 | 3300009098 | Unclassified | 1928 |
| 510 | Ga0105245_10456300 | 3300009098 | Unclassified | 1287 |
| 511 | Ga0105245_11188105 | 3300009098 | Unclassified | 810 |
| 512 | Ga0105247_10015844 | 3300009101 | Bacteria | 4513 |
| 513 | Ga0114129_10009215 | 3300009147 | Bacteria | 14076 |
| 514 | Ga0114129_10024585 | 3300009147 | Bacteria | 8535 |
| 515 | Ga0114129_10029269 | 3300009147 | Bacteria | 7801 |
| 516 | Ga0114129_10054396 | 3300009147 | Bacteria | 5611 |
| 517 | Ga0114129_10067941 | 3300009147 | Bacteria | 4970 |
| 518 | Ga0114129_10174092 | 3300009147 | Bacteria | 2932 |
| 519 | Ga0114129_10249592 | 3300009147 | Bacteria | 2383 |
| 520 | Ga0114129_10265403 | 3300009147 | Bacteria | 2299 |
| 521 | Ga0114129_10380756 | 3300009147 | Bacteria | 1863 |
| 522 | Ga0114129_10522575 | 3300009147 | Bacteria | 1547 |
| 523 | Ga0114129_10527363 | 3300009147 | Unclassified | 1539 |
| 524 | Ga0114129_10758499 | 3300009147 | Bacteria | 1241 |
| 525 | Ga0114129_11274256 | 3300009147 | Bacteria | 912 |
| 526 | Ga0114129_11766163 | 3300009147 | Bacteria | 753 |
| 527 | Ga0114129_12237483 | 3300009147 | Bacteria | 657 |
| 528 | Ga0114129_12259333 | 3300009147 | Bacteria | 654 |
| 529 | Ga0114129_13266333 | 3300009147 | Bacteria | 525 |
| 530 | Ga0105243_10037406 | 3300009148 | Bacteria | 3772 |
| 531 | Ga0105243_10046688 | 3300009148 | Bacteria | 3408 |
| 532 | Ga0105243_10083356 | 3300009148 | Bacteria | 2616 |
| 533 | Ga0105243_10222749 | 3300009148 | Bacteria | 1668 |
| 534 | Ga0105243_10414183 | 3300009148 | Unclassified | 1255 |
| 535 | Ga0105243_10436640 | 3300009148 | Bacteria | 1225 |
| 536 | Ga0105243_10464884 | 3300009148 | Bacteria | 1190 |
| 537 | Ga0105243_11939858 | 3300009148 | Bacteria | 622 |
| 538 | Ga0105243_12148119 | 3300009148 | Unclassified | 594 |
| 539 | Ga0105241_10061345 | 3300009174 | Bacteria | 2895 |
| 540 | Ga0105241_10097285 | 3300009174 | Unclassified | 2333 |
| 541 | Ga0105241_10136441 | 3300009174 | Unclassified | 1993 |
| 542 | Ga0105241_10287849 | 3300009174 | Unclassified | 1406 |
| 543 | Ga0105242_10011104 | 3300009176 | Bacteria | 6922 |
| 544 | Ga0105242_10064630 | 3300009176 | Bacteria | 3017 |
| 545 | Ga0105242_10188035 | 3300009176 | Unclassified | 1826 |
| 546 | Ga0105242_11397771 | 3300009176 | Bacteria | 727 |
| 547 | Ga0105248_10022371 | 3300009177 | Bacteria | 7013 |
| 548 | Ga0105248_10052205 | 3300009177 | Bacteria | 4588 |
| 549 | Ga0105248_12122382 | 3300009177 | Unclassified | 639 |
| 550 | Ga0105237_10010287 | 3300009545 | Bacteria | 9965 |
| 551 | Ga0105237_10190688 | 3300009545 | Bacteria | 2050 |
| 552 | Ga0105237_10268387 | 3300009545 | Unclassified | 1709 |
| 553 | Ga0105237_11124701 | 3300009545 | Unclassified | 792 |
| 554 | Ga0105237_12226953 | 3300009545 | Bacteria | 558 |
| 555 | Ga0105238_10047776 | 3300009551 | Bacteria | 4314 |
| 556 | Ga0105238_10077304 | 3300009551 | Bacteria | 3320 |
| 557 | Ga0105238_10193214 | 3300009551 | Bacteria | 2011 |
| 558 | Ga0105238_10552988 | 3300009551 | Bacteria | 1155 |
| 559 | Ga0105238_10839901 | 3300009551 | Bacteria | 935 |
| 560 | Ga0105238_10945985 | 3300009551 | Bacteria | 881 |
| 561 | Ga0105238_12348458 | 3300009551 | Bacteria | 569 |
| 562 | Ga0105249_10003715 | 3300009553 | Bacteria | 13162 |
| 563 | Ga0105249_10007144 | 3300009553 | Bacteria | 9748 |
| 564 | Ga0105249_10131571 | 3300009553 | Unclassified | 2389 |
| 565 | Ga0105249_10157599 | 3300009553 | Unclassified | 2191 |
| 566 | Ga0105249_10867900 | 3300009553 | Bacteria | 968 |
| 567 | Ga0105249_10943147 | 3300009553 | Unclassified | 931 |
| 568 | Ga0105249_11924096 | 3300009553 | Bacteria | 664 |
| 569 | Ga0105147_103172 | 3300009982 | Bacteria | 1373 |
| 570 | Ga0105239_10034604 | 3300010375 | Bacteria | 5548 |
| 571 | Ga0105239_10112615 | 3300010375 | Bacteria | 3017 |
| 572 | Ga0105239_10114295 | 3300010375 | Bacteria | 2994 |
| 573 | Ga0105239_10189319 | 3300010375 | Bacteria | 2303 |
| 574 | Ga0105239_10502493 | 3300010375 | Bacteria | 1378 |
| 575 | Ga0105239_10677410 | 3300010375 | Unclassified | 1179 |
| 576 | Ga0105239_10702156 | 3300010375 | Unclassified | 1157 |
| 577 | Ga0105246_10022658 | 3300011119 | Bacteria | 4055 |
| 578 | Ga0105246_10346568 | 3300011119 | Bacteria | 1216 |
| 579 | Ga0105246_11663606 | 3300011119 | Unclassified | 605 |
| 580 | Ga0157313_1040048 | 3300012503 | Bacteria | 571 |
| 581 | Ga0157342_1044539 | 3300012507 | Bacteria | 605 |
| 582 | Ga0157342_1074475 | 3300012507 | Bacteria | 523 |
| 583 | Ga0157338_1013400 | 3300012515 | Bacteria | 870 |
| 584 | Ga0157373_10276093 | 3300013100 | Unclassified | 1190 |
| 585 | Ga0157373_10311385 | 3300013100 | Bacteria | 1119 |
| 586 | Ga0157373_10686661 | 3300013100 | Unclassified | 749 |
| 587 | Ga0157373_10723762 | 3300013100 | Bacteria | 730 |
| 588 | Ga0157371_10210115 | 3300013102 | Bacteria | 1396 |
| 589 | Ga0157371_10272281 | 3300013102 | Bacteria | 1222 |
| 590 | Ga0157370_10011051 | 3300013104 | Bacteria | 9468 |
| 591 | Ga0157370_10019665 | 3300013104 | Bacteria | 6763 |
| 592 | Ga0157370_10030644 | 3300013104 | Bacteria | 5269 |
| 593 | Ga0157370_10037034 | 3300013104 | Bacteria | 4732 |
| 594 | Ga0157370_10878363 | 3300013104 | Bacteria | 814 |
| 595 | Ga0157370_11083602 | 3300013104 | Bacteria | 724 |
| 596 | Ga0157369_10024611 | 3300013105 | Bacteria | 6694 |
| 597 | Ga0157369_10047050 | 3300013105 | Bacteria | 4686 |
| 598 | Ga0157369_10053177 | 3300013105 | Bacteria | 4378 |
| 599 | Ga0157369_10245867 | 3300013105 | Unclassified | 1868 |
| 600 | Ga0157369_11082034 | 3300013105 | Unclassified | 820 |
| 601 | Ga0157369_11653714 | 3300013105 | Bacteria | 651 |
| 602 | Ga0157369_11743822 | 3300013105 | Unclassified | 633 |
| 603 | Ga0157369_12612812 | 3300013105 | Bacteria | 510 |
| 604 | Ga0157374_10012764 | 3300013296 | Bacteria | 7320 |
| 605 | Ga0157374_10332553 | 3300013296 | Bacteria | 1507 |
| 606 | Ga0157374_10696813 | 3300013296 | Bacteria | 1029 |
| 607 | Ga0157378_10010459 | 3300013297 | Bacteria | 8105 |
| 608 | Ga0157378_10095408 | 3300013297 | Bacteria | 2709 |
| 609 | Ga0157378_10395810 | 3300013297 | Bacteria | 1360 |
| 610 | Ga0157378_11589632 | 3300013297 | Bacteria | 699 |
| 611 | Ga0163162_10078641 | 3300013306 | Bacteria | 3363 |
| 612 | Ga0163162_10406019 | 3300013306 | Bacteria | 1495 |
| 613 | Ga0157372_10147425 | 3300013307 | Bacteria | 2714 |
| 614 | Ga0157372_10266290 | 3300013307 | Unclassified | 1990 |
| 615 | Ga0157372_10267376 | 3300013307 | Bacteria | 1986 |
| 616 | Ga0157372_10424512 | 3300013307 | Bacteria | 1549 |
| 617 | Ga0157372_11167715 | 3300013307 | Bacteria | 890 |
| 618 | Ga0157372_11533469 | 3300013307 | Bacteria | 767 |
| 619 | Ga0157375_10014122 | 3300013308 | Bacteria | 7122 |
| 620 | Ga0157375_10220067 | 3300013308 | Bacteria | 2057 |
| 621 | Ga0163163_10219594 | 3300014325 | Bacteria | 1949 |
| 622 | Ga0163163_10239174 | 3300014325 | Unclassified | 1865 |
| 623 | Ga0163163_10437268 | 3300014325 | Unclassified | 1368 |
| 624 | Ga0163163_10673326 | 3300014325 | Bacteria | 1098 |
| 625 | Ga0157380_10300999 | 3300014326 | Unclassified | 1477 |
| 626 | Ga0157380_10804976 | 3300014326 | Unclassified | 957 |
| 627 | Ga0157380_11030904 | 3300014326 | Bacteria | 858 |
| 628 | Ga0157380_11197476 | 3300014326 | Bacteria | 803 |
| 629 | Ga0182008_10008535 | 3300014497 | Bacteria | 5592 |
| 630 | Ga0182008_10044913 | 3300014497 | Bacteria | 2197 |
| 631 | Ga0182008_10087200 | 3300014497 | Bacteria | 1537 |
| 632 | Ga0182008_10609632 | 3300014497 | Bacteria | 614 |
| 633 | Ga0157377_10004665 | 3300014745 | Bacteria | 6342 |
| 634 | Ga0157377_10088989 | 3300014745 | Unclassified | 1819 |
| 635 | Ga0157377_10562102 | 3300014745 | Bacteria | 808 |
| 636 | Ga0157377_10654558 | 3300014745 | Bacteria | 757 |
| 637 | Ga0157377_11415232 | 3300014745 | Bacteria | 549 |
| 638 | Ga0157379_10223074 | 3300014968 | Unclassified | 1708 |
| 639 | Ga0157379_10919076 | 3300014968 | Unclassified | 831 |
| 640 | Ga0157379_10992169 | 3300014968 | Unclassified | 800 |
| 641 | Ga0157379_12559976 | 3300014968 | Bacteria | 511 |
| 642 | Ga0157376_10011995 | 3300014969 | Bacteria | 6412 |
| 643 | Ga0157376_10763897 | 3300014969 | Unclassified | 977 |
| 644 | Ga0157376_11768721 | 3300014969 | Unclassified | 654 |
| 645 | Ga0157376_12910532 | 3300014969 | Bacteria | 518 |
| 646 | Ga0182006_1074535 | 3300015261 | Bacteria | 1250 |
| 647 | Ga0163161_10080803 | 3300017792 | Bacteria | 2393 |
| 648 | Ga0163161_10292636 | 3300017792 | Bacteria | 1280 |
| 649 | Ga0197907_10186633 | 3300020069 | Bacteria | 1706 |
| 650 | Ga0197907_10423566 | 3300020069 | Bacteria | 3190 |
| 651 | Ga0197907_10438343 | 3300020069 | Bacteria | 1668 |
| 652 | Ga0197907_10442485 | 3300020069 | Bacteria | 947 |
| 653 | Ga0197907_11417827 | 3300020069 | Bacteria | 1235 |
| 654 | Ga0206356_10455236 | 3300020070 | Bacteria | 1569 |
| 655 | Ga0206356_10720194 | 3300020070 | Bacteria | 1164 |
| 656 | Ga0206356_10854187 | 3300020070 | Bacteria | 1830 |
| 657 | Ga0206356_10908358 | 3300020070 | Bacteria | 1786 |
| 658 | Ga0206356_11024134 | 3300020070 | Unclassified | 1088 |
| 659 | Ga0206349_1050397 | 3300020075 | Bacteria | 1679 |
| 660 | Ga0206349_1419654 | 3300020075 | Bacteria | 740 |
| 661 | Ga0206349_1946013 | 3300020075 | Bacteria | 631 |
| 662 | Ga0206355_1040879 | 3300020076 | Bacteria | 771 |
| 663 | Ga0206355_1342106 | 3300020076 | Bacteria | 1675 |
| 664 | Ga0206355_1462533 | 3300020076 | Bacteria | 1084 |
| 665 | Ga0206351_10253461 | 3300020077 | Bacteria | 607 |
| 666 | Ga0206351_10479706 | 3300020077 | Bacteria | 1349 |
| 667 | Ga0206352_10253765 | 3300020078 | Bacteria | 1233 |
| 668 | Ga0206352_11278387 | 3300020078 | Bacteria | 682 |
| 669 | Ga0206350_11385448 | 3300020080 | Unclassified | 1464 |
| 670 | Ga0206350_11604752 | 3300020080 | Bacteria | 1341 |
| 671 | Ga0206354_10277449 | 3300020081 | Bacteria | 810 |
| 672 | Ga0206354_10303994 | 3300020081 | Unclassified | 1389 |
| 673 | Ga0206354_10999163 | 3300020081 | Bacteria | 4696 |
| 674 | Ga0206354_11321052 | 3300020081 | Bacteria | 1605 |
| 675 | Ga0206354_11379180 | 3300020081 | Bacteria | 703 |
| 676 | Ga0206354_11387473 | 3300020081 | Bacteria | 1608 |
| 677 | Ga0206354_11556505 | 3300020081 | Bacteria | 1787 |
| 678 | Ga0206354_11716844 | 3300020081 | Unclassified | 1388 |
| 679 | Ga0206353_10552814 | 3300020082 | Bacteria | 522 |
| 680 | Ga0206353_10579291 | 3300020082 | Unclassified | 2363 |
| 681 | Ga0206353_10646658 | 3300020082 | Bacteria | 5408 |
| 682 | Ga0206353_10874027 | 3300020082 | Bacteria | 655 |
| 683 | Ga0206353_11253320 | 3300020082 | Bacteria | 1680 |
| 684 | Ga0206353_11303834 | 3300020082 | Bacteria | 1392 |
| 685 | Ga0206353_11310262 | 3300020082 | Bacteria | 8565 |
| 686 | Ga0154015_1027422 | 3300020610 | Bacteria | 938 |
| 687 | Ga0154015_1072201 | 3300020610 | Unclassified | 793 |
| 688 | Ga0154015_1370897 | 3300020610 | Bacteria | 969 |
| 689 | Ga0154015_1538434 | 3300020610 | Bacteria | 919 |
| 690 | Ga0213873_10019821 | 3300021358 | Bacteria | 1564 |
| 691 | Ga0213871_10016008 | 3300021441 | Bacteria | 1801 |
| 692 | Ga0224712_10017878 | 3300022467 | Bacteria | 2359 |
| 693 | Ga0224712_10034170 | 3300022467 | Bacteria | 1868 |
| 694 | Ga0224712_10053447 | 3300022467 | Bacteria | 1582 |
| 695 | Ga0224712_10068687 | 3300022467 | Bacteria | 1433 |
| 696 | Ga0224712_10142606 | 3300022467 | Bacteria | 1056 |
| 697 | Ga0224712_10259724 | 3300022467 | Bacteria | 804 |
| 698 | Ga0224712_10361840 | 3300022467 | Bacteria | 687 |
| 699 | Ga0207656_10208724 | 3300025321 | Unclassified | 946 |
| 700 | Ga0207653_10003662 | 3300025885 | Bacteria | 4835 |
| 701 | Ga0207692_10032981 | 3300025898 | Bacteria | 2493 |
| 702 | Ga0207692_10099533 | 3300025898 | Bacteria | 1593 |
| 703 | Ga0207692_10184079 | 3300025898 | Unclassified | 1218 |
| 704 | Ga0207692_10403944 | 3300025898 | Unclassified | 852 |
| 705 | Ga0207692_10914269 | 3300025898 | Bacteria | 577 |
| 706 | Ga0207642_10005110 | 3300025899 | Bacteria | 4268 |
| 707 | Ga0207642_10291502 | 3300025899 | Unclassified | 943 |
| 708 | Ga0207710_10186080 | 3300025900 | Bacteria | 1021 |
| 709 | Ga0207688_10014788 | 3300025901 | Bacteria | 4235 |
| 710 | Ga0207688_10017110 | 3300025901 | Bacteria | 3939 |
| 711 | Ga0207688_10062626 | 3300025901 | Bacteria | 2097 |
| 712 | Ga0207688_10135839 | 3300025901 | Unclassified | 1444 |
| 713 | Ga0207688_10310269 | 3300025901 | Unclassified | 966 |
| 714 | Ga0207688_10630944 | 3300025901 | Bacteria | 676 |
| 715 | Ga0207680_10308212 | 3300025903 | Unclassified | 1105 |
| 716 | Ga0207647_10123939 | 3300025904 | Bacteria | 1522 |
| 717 | Ga0207699_10035352 | 3300025906 | Bacteria | 2842 |
| 718 | Ga0207699_10073251 | 3300025906 | Bacteria | 2100 |
| 719 | Ga0207699_10114925 | 3300025906 | Unclassified | 1731 |
| 720 | Ga0207699_10555330 | 3300025906 | Bacteria | 833 |
| 721 | Ga0207699_10650779 | 3300025906 | Bacteria | 770 |
| 722 | Ga0207645_10036606 | 3300025907 | Bacteria | 3151 |
| 723 | Ga0207643_10066060 | 3300025908 | Bacteria | 2073 |
| 724 | Ga0207705_10015535 | 3300025909 | Bacteria | 5463 |
| 725 | Ga0207705_10020921 | 3300025909 | Bacteria | 4667 |
| 726 | Ga0207705_10168095 | 3300025909 | Bacteria | 1650 |
| 727 | Ga0207705_10299797 | 3300025909 | Bacteria | 1233 |
| 728 | Ga0207705_10337868 | 3300025909 | Bacteria | 1159 |
| 729 | Ga0207705_11312032 | 3300025909 | Bacteria | 552 |
| 730 | Ga0207684_10056939 | 3300025910 | Unclassified | 3317 |
| 731 | Ga0207684_10137621 | 3300025910 | Bacteria | 2098 |
| 732 | Ga0207684_10189604 | 3300025910 | Unclassified | 1773 |
| 733 | Ga0207684_10268331 | 3300025910 | Unclassified | 1473 |
| 734 | Ga0207684_10503909 | 3300025910 | Unclassified | 1037 |
| 735 | Ga0207654_10045756 | 3300025911 | Unclassified | 2492 |
| 736 | Ga0207654_10251041 | 3300025911 | Bacteria | 1186 |
| 737 | Ga0207707_10016827 | 3300025912 | Bacteria | 6370 |
| 738 | Ga0207707_10025557 | 3300025912 | Bacteria | 5166 |
| 739 | Ga0207707_10047009 | 3300025912 | Bacteria | 3759 |
| 740 | Ga0207707_10138497 | 3300025912 | Bacteria | 2128 |
| 741 | Ga0207707_10372101 | 3300025912 | Bacteria | 1229 |
| 742 | Ga0207707_10454853 | 3300025912 | Bacteria | 1095 |
| 743 | Ga0207707_10677643 | 3300025912 | Bacteria | 867 |
| 744 | Ga0207695_10448284 | 3300025913 | Bacteria | 1174 |
| 745 | Ga0207695_10778546 | 3300025913 | Bacteria | 837 |
| 746 | Ga0207671_10018528 | 3300025914 | Bacteria | 5337 |
| 747 | Ga0207671_10120587 | 3300025914 | Bacteria | 2004 |
| 748 | Ga0207693_10002934 | 3300025915 | Bacteria | 14759 |
| 749 | Ga0207693_10005025 | 3300025915 | Bacteria | 11103 |
| 750 | Ga0207693_10005819 | 3300025915 | Bacteria | 10230 |
| 751 | Ga0207693_10199911 | 3300025915 | Bacteria | 1572 |
| 752 | Ga0207693_10256109 | 3300025915 | Unclassified | 1373 |
| 753 | Ga0207693_10296241 | 3300025915 | Bacteria | 1267 |
| 754 | Ga0207693_10413753 | 3300025915 | Bacteria | 1054 |
| 755 | Ga0207663_10017343 | 3300025916 | Bacteria | 4010 |
| 756 | Ga0207663_10184610 | 3300025916 | Unclassified | 1492 |
| 757 | Ga0207663_10206825 | 3300025916 | Unclassified | 1420 |
| 758 | Ga0207663_10235829 | 3300025916 | Archaea | 1339 |
| 759 | Ga0207663_10247972 | 3300025916 | Unclassified | 1309 |
| 760 | Ga0207663_10275826 | 3300025916 | Unclassified | 1247 |
| 761 | Ga0207663_10335249 | 3300025916 | Bacteria | 1141 |
| 762 | Ga0207663_11042351 | 3300025916 | Bacteria | 657 |
| 763 | Ga0207660_10008765 | 3300025917 | Bacteria | 6537 |
| 764 | Ga0207660_10022435 | 3300025917 | Unclassified | 4253 |
| 765 | Ga0207660_10074403 | 3300025917 | Unclassified | 2479 |
| 766 | Ga0207660_10140050 | 3300025917 | Bacteria | 1849 |
| 767 | Ga0207660_10249602 | 3300025917 | Bacteria | 1400 |
| 768 | Ga0207660_10355376 | 3300025917 | Bacteria | 1175 |
| 769 | Ga0207660_10437698 | 3300025917 | Bacteria | 1056 |
| 770 | Ga0207662_10094944 | 3300025918 | Bacteria | 1840 |
| 771 | Ga0207657_10002082 | 3300025919 | Bacteria | 21643 |
| 772 | Ga0207657_10009553 | 3300025919 | Bacteria | 9734 |
| 773 | Ga0207657_10017180 | 3300025919 | Bacteria | 6950 |
| 774 | Ga0207657_10041276 | 3300025919 | Bacteria | 4081 |
| 775 | Ga0207657_10192956 | 3300025919 | Bacteria | 1642 |
| 776 | Ga0207657_10228365 | 3300025919 | Bacteria | 1489 |
| 777 | Ga0207657_10229537 | 3300025919 | Bacteria | 1485 |
| 778 | Ga0207657_10517293 | 3300025919 | Bacteria | 934 |
| 779 | Ga0207649_10162074 | 3300025920 | Bacteria | 1550 |
| 780 | Ga0207649_10207943 | 3300025920 | Unclassified | 1387 |
| 781 | Ga0207652_10004034 | 3300025921 | Bacteria | 11985 |
| 782 | Ga0207652_10020742 | 3300025921 | Bacteria | 5415 |
| 783 | Ga0207652_10037172 | 3300025921 | Bacteria | 4120 |
| 784 | Ga0207652_10138697 | 3300025921 | Bacteria | 2173 |
| 785 | Ga0207652_10163371 | 3300025921 | Bacteria | 1996 |
| 786 | Ga0207652_10615930 | 3300025921 | Unclassified | 973 |
| 787 | Ga0207652_10820186 | 3300025921 | Bacteria | 825 |
| 788 | Ga0207652_10882985 | 3300025921 | Bacteria | 790 |
| 789 | Ga0207652_11588678 | 3300025921 | Bacteria | 558 |
| 790 | Ga0207646_10022194 | 3300025922 | Bacteria | 5853 |
| 791 | Ga0207646_10028189 | 3300025922 | Bacteria | 5114 |
| 792 | Ga0207646_10211746 | 3300025922 | Bacteria | 1750 |
| 793 | Ga0207646_10761723 | 3300025922 | Bacteria | 864 |
| 794 | Ga0207646_11435495 | 3300025922 | Bacteria | 599 |
| 795 | Ga0207694_10102940 | 3300025924 | Bacteria | 2264 |
| 796 | Ga0207694_10158477 | 3300025924 | Bacteria | 1827 |
| 797 | Ga0207694_10686119 | 3300025924 | Bacteria | 864 |
| 798 | Ga0207694_10716419 | 3300025924 | Bacteria | 844 |
| 799 | Ga0207650_10296870 | 3300025925 | Unclassified | 1319 |
| 800 | Ga0207659_10337487 | 3300025926 | Bacteria | 1247 |
| 801 | Ga0207687_10014069 | 3300025927 | Bacteria | 5232 |
| 802 | Ga0207687_10018648 | 3300025927 | Bacteria | 4584 |
| 803 | Ga0207687_10047767 | 3300025927 | Unclassified | 2969 |
| 804 | Ga0207687_10107887 | 3300025927 | Bacteria | 2061 |
| 805 | Ga0207687_10226649 | 3300025927 | Unclassified | 1474 |
| 806 | Ga0207687_10578401 | 3300025927 | Unclassified | 945 |
| 807 | Ga0207687_10591112 | 3300025927 | Unclassified | 935 |
| 808 | Ga0207687_10604366 | 3300025927 | Unclassified | 924 |
| 809 | Ga0207700_10000012 | 3300025928 | Bacteria | 231712 |
| 810 | Ga0207700_10121115 | 3300025928 | Bacteria | 2122 |
| 811 | Ga0207700_10160292 | 3300025928 | Unclassified | 1868 |
| 812 | Ga0207700_10499687 | 3300025928 | Bacteria | 1076 |
| 813 | Ga0207700_10552552 | 3300025928 | Bacteria | 1022 |
| 814 | Ga0207664_10008169 | 3300025929 | Bacteria | 7287 |
| 815 | Ga0207664_10029592 | 3300025929 | Bacteria | 4173 |
| 816 | Ga0207664_10038172 | 3300025929 | Bacteria | 3723 |
| 817 | Ga0207664_10066535 | 3300025929 | Bacteria | 2889 |
| 818 | Ga0207664_10124229 | 3300025929 | Bacteria | 2164 |
| 819 | Ga0207664_10235088 | 3300025929 | Unclassified | 1594 |
| 820 | Ga0207664_10358454 | 3300025929 | Bacteria | 1292 |
| 821 | Ga0207664_10359366 | 3300025929 | Bacteria | 1290 |
| 822 | Ga0207664_10430807 | 3300025929 | Bacteria | 1176 |
| 823 | Ga0207664_10572208 | 3300025929 | Unclassified | 1014 |
| 824 | Ga0207644_10067637 | 3300025931 | Bacteria | 2604 |
| 825 | Ga0207644_11122046 | 3300025931 | Bacteria | 661 |
| 826 | Ga0207690_10137920 | 3300025932 | Bacteria | 1793 |
| 827 | Ga0207690_10168766 | 3300025932 | Unclassified | 1637 |
| 828 | Ga0207690_10209471 | 3300025932 | Bacteria | 1485 |
| 829 | Ga0207690_10288650 | 3300025932 | Bacteria | 1280 |
| 830 | Ga0207690_10833374 | 3300025932 | Bacteria | 763 |
| 831 | Ga0207690_11218357 | 3300025932 | Unclassified | 629 |
| 832 | Ga0207706_10013086 | 3300025933 | Bacteria | 7550 |
| 833 | Ga0207706_10041233 | 3300025933 | Bacteria | 4093 |
| 834 | Ga0207706_10082059 | 3300025933 | Unclassified | 2833 |
| 835 | Ga0207706_10149077 | 3300025933 | Bacteria | 2057 |
| 836 | Ga0207706_10290123 | 3300025933 | Bacteria | 1426 |
| 837 | Ga0207706_11599020 | 3300025933 | Bacteria | 528 |
| 838 | Ga0207686_10047247 | 3300025934 | Bacteria | 2660 |
| 839 | Ga0207686_10207801 | 3300025934 | Unclassified | 1406 |
| 840 | Ga0207686_10217756 | 3300025934 | Bacteria | 1377 |
| 841 | Ga0207709_10001561 | 3300025935 | Bacteria | 15707 |
| 842 | Ga0207709_10145348 | 3300025935 | Bacteria | 1635 |
| 843 | Ga0207709_10215207 | 3300025935 | Bacteria | 1382 |
| 844 | Ga0207709_10276779 | 3300025935 | Unclassified | 1238 |
| 845 | Ga0207709_10380993 | 3300025935 | Unclassified | 1073 |
| 846 | Ga0207709_10485945 | 3300025935 | Bacteria | 961 |
| 847 | Ga0207670_10005360 | 3300025936 | Bacteria | 7034 |
| 848 | Ga0207670_10171627 | 3300025936 | Unclassified | 1627 |
| 849 | Ga0207669_10048585 | 3300025937 | Bacteria | 2522 |
| 850 | Ga0207669_10050432 | 3300025937 | Bacteria | 2488 |
| 851 | Ga0207669_11723840 | 3300025937 | Bacteria | 535 |
| 852 | Ga0207704_10024454 | 3300025938 | Bacteria | 3276 |
| 853 | Ga0207704_10924980 | 3300025938 | Unclassified | 734 |
| 854 | Ga0207704_10951941 | 3300025938 | Bacteria | 724 |
| 855 | Ga0207665_10006819 | 3300025939 | Bacteria | 7565 |
| 856 | Ga0207665_10012875 | 3300025939 | Bacteria | 5500 |
| 857 | Ga0207665_10017176 | 3300025939 | Bacteria | 4753 |
| 858 | Ga0207665_10084679 | 3300025939 | Bacteria | 2188 |
| 859 | Ga0207665_10180018 | 3300025939 | Bacteria | 1530 |
| 860 | Ga0207691_10010135 | 3300025940 | Bacteria | 9046 |
| 861 | Ga0207691_10104108 | 3300025940 | Bacteria | 2530 |
| 862 | Ga0207691_10215480 | 3300025940 | Bacteria | 1666 |
| 863 | Ga0207711_10329208 | 3300025941 | Bacteria | 1412 |
| 864 | Ga0207711_10564105 | 3300025941 | Unclassified | 1062 |
| 865 | Ga0207689_10031753 | 3300025942 | Bacteria | 4394 |
| 866 | Ga0207689_10780856 | 3300025942 | Bacteria | 806 |
| 867 | Ga0207661_10003963 | 3300025944 | Bacteria | 10341 |
| 868 | Ga0207661_10011805 | 3300025944 | Bacteria | 6343 |
| 869 | Ga0207661_10019765 | 3300025944 | Bacteria | 5027 |
| 870 | Ga0207661_10027168 | 3300025944 | Bacteria | 4369 |
| 871 | Ga0207661_10038872 | 3300025944 | Bacteria | 3732 |
| 872 | Ga0207661_10040511 | 3300025944 | Unclassified | 3662 |
| 873 | Ga0207661_10100835 | 3300025944 | Bacteria | 2424 |
| 874 | Ga0207661_10179958 | 3300025944 | Unclassified | 1846 |
| 875 | Ga0207661_10236842 | 3300025944 | Unclassified | 1618 |
| 876 | Ga0207661_10366861 | 3300025944 | Unclassified | 1301 |
| 877 | Ga0207661_10738323 | 3300025944 | Bacteria | 906 |
| 878 | Ga0207661_11941638 | 3300025944 | Bacteria | 534 |
| 879 | Ga0207679_10016754 | 3300025945 | Bacteria | 4870 |
| 880 | Ga0207679_10245014 | 3300025945 | Bacteria | 1521 |
| 881 | Ga0207679_10463826 | 3300025945 | Bacteria | 1125 |
| 882 | Ga0207679_10716665 | 3300025945 | Bacteria | 909 |
| 883 | Ga0207679_11390189 | 3300025945 | Bacteria | 644 |
| 884 | Ga0207679_11535219 | 3300025945 | Unclassified | 611 |
| 885 | Ga0207667_10237510 | 3300025949 | Bacteria | 1865 |
| 886 | Ga0207667_10249078 | 3300025949 | Unclassified | 1817 |
| 887 | Ga0207667_10324726 | 3300025949 | Bacteria | 1571 |
| 888 | Ga0207667_10589060 | 3300025949 | Bacteria | 1122 |
| 889 | Ga0207667_10878256 | 3300025949 | Bacteria | 890 |
| 890 | Ga0207667_10946304 | 3300025949 | Bacteria | 851 |
| 891 | Ga0207651_10065761 | 3300025960 | Bacteria | 2545 |
| 892 | Ga0207651_10133669 | 3300025960 | Unclassified | 1904 |
| 893 | Ga0207712_10005445 | 3300025961 | Bacteria | 8035 |
| 894 | Ga0207712_10037558 | 3300025961 | Bacteria | 3306 |
| 895 | Ga0207712_10245071 | 3300025961 | Unclassified | 1446 |
| 896 | Ga0207712_10309915 | 3300025961 | Bacteria | 1299 |
| 897 | Ga0207668_10007560 | 3300025972 | Bacteria | 6466 |
| 898 | Ga0207668_10020001 | 3300025972 | Bacteria | 4246 |
| 899 | Ga0207668_10149933 | 3300025972 | Unclassified | 1804 |
| 900 | Ga0207640_10052679 | 3300025981 | Bacteria | 2652 |
| 901 | Ga0207640_10313113 | 3300025981 | Bacteria | 1247 |
| 902 | Ga0207640_10450141 | 3300025981 | Bacteria | 1061 |
| 903 | Ga0207640_10472743 | 3300025981 | Bacteria | 1038 |
| 904 | Ga0207640_10491890 | 3300025981 | Bacteria | 1020 |
| 905 | Ga0207640_10603917 | 3300025981 | Unclassified | 929 |
| 906 | Ga0207677_10034065 | 3300026023 | Bacteria | 3294 |
| 907 | Ga0207677_10192696 | 3300026023 | Bacteria | 1613 |
| 908 | Ga0207677_11329910 | 3300026023 | Bacteria | 660 |
| 909 | Ga0207703_10118898 | 3300026035 | Bacteria | 2266 |
| 910 | Ga0207703_10524292 | 3300026035 | Bacteria | 1115 |
| 911 | Ga0207639_10189302 | 3300026041 | Bacteria | 1756 |
| 912 | Ga0207639_10279679 | 3300026041 | Bacteria | 1467 |
| 913 | Ga0207639_10850069 | 3300026041 | Bacteria | 852 |
| 914 | Ga0207678_10027358 | 3300026067 | Bacteria | 4974 |
| 915 | Ga0207678_10066311 | 3300026067 | Bacteria | 3100 |
| 916 | Ga0207678_10321182 | 3300026067 | Bacteria | 1332 |
| 917 | Ga0207678_11323859 | 3300026067 | Bacteria | 637 |
| 918 | Ga0207678_11557216 | 3300026067 | Unclassified | 583 |
| 919 | Ga0207708_10007870 | 3300026075 | Bacteria | 7895 |
| 920 | Ga0207708_10010026 | 3300026075 | Bacteria | 7036 |
| 921 | Ga0207708_10106644 | 3300026075 | Unclassified | 2173 |
| 922 | Ga0207708_10122822 | 3300026075 | Bacteria | 2024 |
| 923 | Ga0207708_10153264 | 3300026075 | Bacteria | 1816 |
| 924 | Ga0207702_10139865 | 3300026078 | Bacteria | 2189 |
| 925 | Ga0207702_10155110 | 3300026078 | Bacteria | 2087 |
| 926 | Ga0207702_10196554 | 3300026078 | Bacteria | 1867 |
| 927 | Ga0207702_10297043 | 3300026078 | Bacteria | 1532 |
| 928 | Ga0207702_10555934 | 3300026078 | Bacteria | 1123 |
| 929 | Ga0207702_10657934 | 3300026078 | Unclassified | 1031 |
| 930 | Ga0207702_10717250 | 3300026078 | Unclassified | 986 |
| 931 | Ga0207702_11612545 | 3300026078 | Unclassified | 642 |
| 932 | Ga0207641_11981367 | 3300026088 | Bacteria | 584 |
| 933 | Ga0207648_10003432 | 3300026089 | Bacteria | 16631 |
| 934 | Ga0207648_10029730 | 3300026089 | Bacteria | 4845 |
| 935 | Ga0207648_10057075 | 3300026089 | Bacteria | 3407 |
| 936 | Ga0207648_11885600 | 3300026089 | Bacteria | 559 |
| 937 | Ga0207676_10267278 | 3300026095 | Bacteria | 1547 |
| 938 | Ga0207676_10717984 | 3300026095 | Bacteria | 970 |
| 939 | Ga0207674_10012751 | 3300026116 | Bacteria | 9388 |
| 940 | Ga0207674_10020476 | 3300026116 | Bacteria | 7146 |
| 941 | Ga0207674_10021392 | 3300026116 | Bacteria | 6965 |
| 942 | Ga0207674_10139131 | 3300026116 | Bacteria | 2388 |
| 943 | Ga0207675_100000239 | 3300026118 | Bacteria | 52108 |
| 944 | Ga0207675_100012469 | 3300026118 | Bacteria | 7940 |
| 945 | Ga0207675_100050628 | 3300026118 | Bacteria | 3875 |
| 946 | Ga0207675_100085447 | 3300026118 | Bacteria | 2961 |
| 947 | Ga0207675_100876368 | 3300026118 | Bacteria | 913 |
| 948 | Ga0207683_10000262 | 3300026121 | Bacteria | 47039 |
| 949 | Ga0207683_10013297 | 3300026121 | Bacteria | 7017 |
| 950 | Ga0207683_10263460 | 3300026121 | Bacteria | 1574 |
| 951 | Ga0207683_10351529 | 3300026121 | Unclassified | 1353 |
| 952 | Ga0207698_10001968 | 3300026142 | Bacteria | 12079 |
| 953 | Ga0207698_10097076 | 3300026142 | Bacteria | 2431 |
| 954 | Ga0207698_10114632 | 3300026142 | Bacteria | 2267 |
| 955 | Ga0207698_10410040 | 3300026142 | Bacteria | 1297 |
| 956 | Ga0207698_10954397 | 3300026142 | Unclassified | 867 |
| 957 | Ga0210000_1021556 | 3300027462 | Bacteria | 987 |
| 958 | Ga0209999_1040985 | 3300027543 | Bacteria | 868 |
| 959 | Ga0209966_1032655 | 3300027695 | Bacteria | 1061 |
| 960 | Ga0209974_10072189 | 3300027876 | Bacteria | 1179 |
| 961 | Ga0207428_10005731 | 3300027907 | Bacteria | 11538 |
| 962 | Ga0207428_10032631 | 3300027907 | Bacteria | 4281 |
| 963 | Ga0207428_10037013 | 3300027907 | Bacteria | 3973 |
| 964 | Ga0207428_10037899 | 3300027907 | Bacteria | 3922 |
| 965 | Ga0207428_10092239 | 3300027907 | Bacteria | 2351 |
| 966 | Ga0207428_10924218 | 3300027907 | Bacteria | 616 |
| 967 | Ga0207428_10942007 | 3300027907 | Unclassified | 609 |
| 968 | Ga0268266_10973573 | 3300028379 | Unclassified | 821 |
| 969 | Ga0268265_10098586 | 3300028380 | Unclassified | 2354 |
| 970 | Ga0268265_10102332 | 3300028380 | Bacteria | 2317 |
| 971 | Ga0268265_11281917 | 3300028380 | Unclassified | 732 |
| 972 | Ga0268264_10034340 | 3300028381 | Bacteria | 4171 |
| 973 | Ga0268264_10640832 | 3300028381 | Unclassified | 1051 |
| 974 | Ga0268264_11821089 | 3300028381 | Unclassified | 619 |
| 975 | Ga0265337_1016381 | 3300028556 | Bacteria | 2398 |
| 976 | Ga0265334_10073204 | 3300028573 | Bacteria | 1273 |
| 977 | Ga0265318_10036326 | 3300028577 | Unclassified | 1891 |
| 978 | Ga0265322_10021376 | 3300028654 | Unclassified | 1853 |
| 979 | Ga0265336_10058625 | 3300028666 | Bacteria | 1155 |
| 980 | Ga0265338_10005668 | 3300028800 | Bacteria | 16194 |
| 981 | Ga0265338_10057127 | 3300028800 | Bacteria | 3454 |
| 982 | Ga0265338_10179186 | 3300028800 | Bacteria | 1617 |
| 983 | Ga0265330_10053272 | 3300031235 | Bacteria | 1771 |
| 984 | Ga0265330_10062461 | 3300031235 | Bacteria | 1619 |
| 985 | Ga0265330_10184926 | 3300031235 | Bacteria | 882 |
| 986 | Ga0265332_10032013 | 3300031238 | Bacteria | 2293 |
| 987 | Ga0265332_10147986 | 3300031238 | Bacteria | 983 |
| 988 | Ga0265328_10194135 | 3300031239 | Bacteria | 770 |
| 989 | Ga0265320_10111876 | 3300031240 | Bacteria | 1250 |
| 990 | Ga0265325_10009148 | 3300031241 | Bacteria | 5801 |
| 991 | Ga0265339_10003320 | 3300031249 | Bacteria | 11270 |
| 992 | Ga0265339_10176991 | 3300031249 | Bacteria | 1064 |
| 993 | Ga0265331_10054358 | 3300031250 | Bacteria | 1907 |
| 994 | Ga0265331_10102625 | 3300031250 | Bacteria | 1315 |
| 995 | Ga0265327_10034191 | 3300031251 | Bacteria | 2823 |
| 996 | Ga0265316_10015468 | 3300031344 | Bacteria | 6670 |
| 997 | Ga0265316_10261358 | 3300031344 | Bacteria | 1269 |
| 998 | Ga0265316_10629822 | 3300031344 | Bacteria | 759 |
| 999 | Ga0307408_100100073 | 3300031548 | Bacteria | 2207 |
| 1000 | Ga0307408_100160718 | 3300031548 | Bacteria | 1784 |
| 1001 | Ga0307408_100436281 | 3300031548 | Bacteria | 1133 |
| 1002 | Ga0265313_10009855 | 3300031595 | Bacteria | 6147 |
| 1003 | Ga0265313_10027633 | 3300031595 | Bacteria | 2966 |
| 1004 | Ga0265314_10006982 | 3300031711 | Bacteria | 9878 |
| 1005 | Ga0265314_10017534 | 3300031711 | Bacteria | 5617 |
| 1006 | Ga0265314_10085399 | 3300031711 | Unclassified | 2069 |
| 1007 | Ga0265342_10016426 | 3300031712 | Bacteria | 4839 |
| 1008 | Ga0265342_10053971 | 3300031712 | Bacteria | 2390 |
| 1009 | Ga0265342_10569043 | 3300031712 | Unclassified | 574 |
| 1010 | Ga0307405_10022450 | 3300031731 | Bacteria | 3568 |
| 1011 | Ga0307405_10133898 | 3300031731 | Bacteria | 1717 |
| 1012 | Ga0307405_10373568 | 3300031731 | Unclassified | 1107 |
| 1013 | Ga0307405_10380056 | 3300031731 | Bacteria | 1099 |
| 1014 | Ga0307413_10000972 | 3300031824 | Bacteria | 10296 |
| 1015 | Ga0307413_10016513 | 3300031824 | Bacteria | 3816 |
| 1016 | Ga0307413_10172755 | 3300031824 | Bacteria | 1531 |
| 1017 | Ga0307413_10538915 | 3300031824 | Bacteria | 944 |
| 1018 | Ga0307410_10018807 | 3300031852 | Bacteria | 4185 |
| 1019 | Ga0307410_10041612 | 3300031852 | Unclassified | 3031 |
| 1020 | Ga0307410_10063946 | 3300031852 | Bacteria | 2526 |
| 1021 | Ga0307410_10134913 | 3300031852 | Bacteria | 1818 |
| 1022 | Ga0307410_10135610 | 3300031852 | Bacteria | 1814 |
| 1023 | Ga0307410_10175842 | 3300031852 | Bacteria | 1617 |
| 1024 | Ga0307410_10190172 | 3300031852 | Bacteria | 1560 |
| 1025 | Ga0307410_10502020 | 3300031852 | Bacteria | 998 |
| 1026 | Ga0307406_10007190 | 3300031901 | Bacteria | 6167 |
| 1027 | Ga0307406_10008830 | 3300031901 | Bacteria | 5633 |
| 1028 | Ga0307406_10025643 | 3300031901 | Bacteria | 3531 |
| 1029 | Ga0307406_10050049 | 3300031901 | Bacteria | 2647 |
| 1030 | Ga0307406_10085293 | 3300031901 | Bacteria | 2111 |
| 1031 | Ga0307406_10892474 | 3300031901 | Bacteria | 756 |
| 1032 | Ga0307406_12098580 | 3300031901 | Unclassified | 506 |
| 1033 | Ga0307407_10031023 | 3300031903 | Unclassified | 2890 |
| 1034 | Ga0307407_10048193 | 3300031903 | Bacteria | 2423 |
| 1035 | Ga0307407_10135541 | 3300031903 | Bacteria | 1581 |
| 1036 | Ga0307407_10138958 | 3300031903 | Bacteria | 1565 |
| 1037 | Ga0307407_11198077 | 3300031903 | Bacteria | 593 |
| 1038 | Ga0307412_10010513 | 3300031911 | Bacteria | 5332 |
| 1039 | Ga0307412_10034476 | 3300031911 | Bacteria | 3226 |
| 1040 | Ga0307412_10429330 | 3300031911 | Bacteria | 1083 |
| 1041 | Ga0307412_10448658 | 3300031911 | Bacteria | 1062 |
| 1042 | Ga0307412_10661016 | 3300031911 | Bacteria | 892 |
| 1043 | Ga0307412_10867571 | 3300031911 | Bacteria | 789 |
| 1044 | Ga0307412_10885263 | 3300031911 | Bacteria | 781 |
| 1045 | Ga0307412_12183223 | 3300031911 | Bacteria | 515 |
| 1046 | Ga0307409_100000515 | 3300031995 | Bacteria | 16695 |
| 1047 | Ga0307409_100005794 | 3300031995 | Bacteria | 7166 |
| 1048 | Ga0307409_100007378 | 3300031995 | Bacteria | 6571 |
| 1049 | Ga0307409_100061112 | 3300031995 | Bacteria | 2942 |
| 1050 | Ga0307409_100130596 | 3300031995 | Bacteria | 2146 |
| 1051 | Ga0307409_100376229 | 3300031995 | Bacteria | 1348 |
| 1052 | Ga0307409_100774858 | 3300031995 | Bacteria | 965 |
| 1053 | Ga0307409_100933501 | 3300031995 | Bacteria | 883 |
| 1054 | Ga0307409_101688527 | 3300031995 | Bacteria | 662 |
| 1055 | Ga0307409_102021864 | 3300031995 | Bacteria | 606 |
| 1056 | Ga0307416_100003349 | 3300032002 | Bacteria | 9381 |
| 1057 | Ga0307416_100047663 | 3300032002 | Bacteria | 3393 |
| 1058 | Ga0307416_100056638 | 3300032002 | Bacteria | 3165 |
| 1059 | Ga0307416_100131881 | 3300032002 | Bacteria | 2251 |
| 1060 | Ga0307416_100143210 | 3300032002 | Bacteria | 2177 |
| 1061 | Ga0307416_100157287 | 3300032002 | Bacteria | 2094 |
| 1062 | Ga0307416_100220086 | 3300032002 | Bacteria | 1820 |
| 1063 | Ga0307416_100252874 | 3300032002 | Bacteria | 1716 |
| 1064 | Ga0307416_100428015 | 3300032002 | Bacteria | 1370 |
| 1065 | Ga0307416_100458655 | 3300032002 | Bacteria | 1329 |
| 1066 | Ga0307416_100488169 | 3300032002 | Bacteria | 1293 |
| 1067 | Ga0307416_100504864 | 3300032002 | Bacteria | 1274 |
| 1068 | Ga0307416_100656230 | 3300032002 | Bacteria | 1134 |
| 1069 | Ga0307416_100659895 | 3300032002 | Bacteria | 1131 |
| 1070 | Ga0307414_10125501 | 3300032004 | Bacteria | 1982 |
| 1071 | Ga0307414_10195703 | 3300032004 | Bacteria | 1640 |
| 1072 | Ga0307414_10248874 | 3300032004 | Bacteria | 1476 |
| 1073 | Ga0307414_10808261 | 3300032004 | Unclassified | 855 |
| 1074 | Ga0307414_11008742 | 3300032004 | Bacteria | 766 |
| 1075 | Ga0307411_10003787 | 3300032005 | Bacteria | 7107 |
| 1076 | Ga0307411_10098304 | 3300032005 | Bacteria | 2062 |
| 1077 | Ga0307411_10154707 | 3300032005 | Bacteria | 1709 |
| 1078 | Ga0307415_100002034 | 3300032126 | Bacteria | 9975 |
| 1079 | Ga0307415_100043617 | 3300032126 | Bacteria | 2993 |
| 1080 | Ga0307415_100087272 | 3300032126 | Bacteria | 2247 |
| 1081 | Ga0307415_100089802 | 3300032126 | Bacteria | 2220 |
| 1082 | Ga0307415_100475460 | 3300032126 | Bacteria | 1086 |
| 1083 | Ga0307415_100598109 | 3300032126 | Bacteria | 981 |
| 1084 | Ga0307415_100603999 | 3300032126 | Bacteria | 977 |
| 1085 | Ga0307415_100604603 | 3300032126 | Bacteria | 976 |
| 1086 | Ga0307415_100905648 | 3300032126 | Bacteria | 813 |
| 1087 | Ga0307415_100939544 | 3300032126 | Bacteria | 800 |
| 1088 | Ga0307415_102253963 | 3300032126 | Unclassified | 534 |
| 1089 | Ga0373948_0015230 | 3300034817 | Unclassified | 1410 |
| 1090 | Ga0373950_0002713 | 3300034818 | Bacteria | 2465 |
| 1091 | Ga0373950_0050489 | 3300034818 | Bacteria | 816 |
| 1092 | Ga0373958_0010043 | 3300034819 | Unclassified | 1570 |
| 1093 | Ga0373959_0063102 | 3300034820 | Bacteria | 824 |
| 1094 | Ga0373959_0117209 | 3300034820 | Unclassified | 648 |
| 1095 | Ga0373938_0016719 | 3300034957 | Bacteria | 1437 |
| 1096 | Ga0373938_0060805 | 3300034957 | Bacteria | 883 |
| 1097 | Ga0373928_0019989 | 3300035084 | Unclassified | 1401 |
| 1098 | Ga0373928_0085099 | 3300035084 | Bacteria | 803 |
| 1099 | Ga0373934_0501747 | 3300035086 | Unclassified | 510 |
| 1100 | Ga0373940_0013500 | 3300035088 | Bacteria | 1978 |
| 1101 | Ga0373940_0044496 | 3300035088 | Bacteria | 1230 |
| 1102 | Ga0373944_0009829 | 3300035089 | Bacteria | 2601 |
| 1103 | Ga0373944_0049658 | 3300035089 | Bacteria | 1319 |
| 1104 | Ga0373949_0025859 | 3300035090 | Bacteria | 1372 |
| 1105 | Ga0373951_0011199 | 3300035091 | Unclassified | 2011 |
| 1106 | Ga0373952_0010857 | 3300035092 | Unclassified | 1767 |
| 1107 | Ga0373952_0093012 | 3300035092 | Unclassified | 786 |
| 1108 | Ga0373932_0005667 | 3300035112 | Bacteria | 2937 |
| 1109 | Ga0373932_0219365 | 3300035112 | Unclassified | 683 |
| 1110 | Ga0373936_0083095 | 3300035113 | Unclassified | 1335 |
| 1111 | Ga0373939_0002231 | 3300035114 | Bacteria | 4590 |
| 1112 | Ga0373939_0128922 | 3300035114 | Bacteria | 900 |
| 1113 | Ga0373939_0444495 | 3300035114 | Bacteria | 545 |
| 1114 | Ga0373941_0005966 | 3300035115 | Bacteria | 2904 |
| 1115 | Ga0373945_0004274 | 3300035116 | Bacteria | 4532 |
| 1116 | Ga0373956_0024412 | 3300035119 | Bacteria | 2605 |
| 1117 | Ga0373957_0092227 | 3300035120 | Unclassified | 1205 |
| 1118 | Ga0373960_0005256 | 3300035121 | Bacteria | 2991 |
| 1119 | Ga0373960_0005339 | 3300035121 | Bacteria | 2971 |
| 1120 | Ga0373960_0160788 | 3300035121 | Unclassified | 773 |
| 1121 | Ga0373943_0000166 | 3300035170 | Bacteria | 25694 |
| 1122 | Ga0373946_0003727 | 3300035171 | Bacteria | 5403 |
| 1123 | Ga0373946_0112300 | 3300035171 | Bacteria | 1235 |
| 1124 | Ga0373946_0369179 | 3300035171 | Bacteria | 720 |
| 1125 | Ga0373946_0630756 | 3300035171 | Bacteria | 557 |
| 1126 | Ga0373955_0148327 | 3300035172 | Unclassified | 1379 |
| 1127 | Ga0373942_0012103 | 3300035207 | Bacteria | 2055 |
| 1128 | Ga0373961_0009860 | 3300035241 | Bacteria | 2342 |
| 1129 | Ga0373961_0038639 | 3300035241 | Bacteria | 1368 |
| 1130 | Ga0373962_0005913 | 3300035242 | Bacteria | 2955 |
| 1131 | Ga0373962_0013418 | 3300035242 | Bacteria | 2075 |
| 1132 | Ga0373924_0179222 | 3300035410 | Bacteria | 932 |
| 1133 | Ga0373931_0007745 | 3300035691 | Bacteria | 5071 |
| 1134 | Ga0373931_0008823 | 3300035691 | Bacteria | 4797 |
| 1135 | Ga0373931_0511305 | 3300035691 | Unclassified | 776 |
| 1136 | Ga0373931_0805474 | 3300035691 | Unclassified | 626 |
| 1137 | Ga0373935_0005283 | 3300035692 | Bacteria | 7599 |
| 1138 | Ga0373935_0115654 | 3300035692 | Bacteria | 1786 |
| 1139 | Ga0373935_0364423 | 3300035692 | Bacteria | 1032 |
| 1140 | Ga0373927_0031467 | 3300035695 | Bacteria | 3458 |
| 1141 | Ga0373933_0020179 | 3300035724 | Bacteria | 3776 |
| 1142 | Ga0373947_0001188 | 3300035725 | Bacteria | 16031 |
| 1143 | Ga0373947_0205036 | 3300035725 | Bacteria | 1291 |
| 1144 | Ga0373947_0766688 | 3300035725 | Bacteria | 658 |
| 1145 | Ga0373937_0140002 | 3300036401 | Unclassified | 2263 |
| 1146 | Ga0373937_0749899 | 3300036401 | Bacteria | 924 |
| 1147 | Ga0373937_1020462 | 3300036401 | Bacteria | 776 |
| 1148 | Ga0373925_0036662 | 3300037068 | Bacteria | 3618 |
| 1149 | Ga0373925_0194672 | 3300037068 | Bacteria | 1610 |
| 1150 | Ga0373925_0254123 | 3300037068 | Bacteria | 1410 |
| 1151 | Ga0373925_0684193 | 3300037068 | Bacteria | 846 |
| 1152 | Ga0373925_1531577 | 3300037068 | Unclassified | 545 |
| 1153 | Ga0395899_0006190 | 3300037312 | Bacteria | 9270 |
| 1154 | Ga0395899_0007255 | 3300037312 | Bacteria | 8577 |
| 1155 | Ga0395899_0037475 | 3300037312 | Bacteria | 3634 |
| 1156 | Ga0395899_0049009 | 3300037312 | Bacteria | 3140 |
| 1157 | Ga0395899_0068080 | 3300037312 | Bacteria | 2611 |
| 1158 | Ga0395899_0068251 | 3300037312 | Bacteria | 2607 |
| 1159 | Ga0395899_0081030 | 3300037312 | Bacteria | 2362 |
| 1160 | Ga0395899_0091511 | 3300037312 | Bacteria | 2204 |
| 1161 | Ga0395899_0096028 | 3300037312 | Bacteria | 2144 |
| 1162 | Ga0395899_0103361 | 3300037312 | Bacteria | 2055 |
| 1163 | Ga0395899_0174738 | 3300037312 | Bacteria | 1511 |
| 1164 | Ga0395899_0295251 | 3300037312 | Bacteria | 1098 |
| 1165 | Ga0395899_0567863 | 3300037312 | Bacteria | 727 |
| 1166 | Ga0395899_0721112 | 3300037312 | Bacteria | 623 |
| 1167 | Ga0395900_0002322 | 3300037418 | Bacteria | 21095 |
| 1168 | Ga0395900_0012562 | 3300037418 | Bacteria | 8665 |
| 1169 | Ga0395900_0012865 | 3300037418 | Bacteria | 8548 |
| 1170 | Ga0395900_0017394 | 3300037418 | Bacteria | 7338 |
| 1171 | Ga0395900_0021131 | 3300037418 | Bacteria | 6652 |
| 1172 | Ga0395900_0022975 | 3300037418 | Bacteria | 6382 |
| 1173 | Ga0395900_0023819 | 3300037418 | Bacteria | 6264 |
| 1174 | Ga0395900_0024767 | 3300037418 | Bacteria | 6143 |
| 1175 | Ga0395900_0030439 | 3300037418 | Bacteria | 5543 |
| 1176 | Ga0395900_0040123 | 3300037418 | Bacteria | 4824 |
| 1177 | Ga0395900_0054326 | 3300037418 | Bacteria | 4124 |
| 1178 | Ga0395900_0065750 | 3300037418 | Bacteria | 3725 |
| 1179 | Ga0395900_0077913 | 3300037418 | Bacteria | 3406 |
| 1180 | Ga0395900_0106261 | 3300037418 | Unclassified | 2883 |
| 1181 | Ga0395900_0172061 | 3300037418 | Bacteria | 2204 |
| 1182 | Ga0395900_0175214 | 3300037418 | Unclassified | 2181 |
| 1183 | Ga0395900_0185856 | 3300037418 | Bacteria | 2109 |
| 1184 | Ga0395900_0191093 | 3300037418 | Bacteria | 2077 |
| 1185 | Ga0395900_0223395 | 3300037418 | Bacteria | 1897 |
| 1186 | Ga0395900_0226148 | 3300037418 | Bacteria | 1884 |
| 1187 | Ga0395900_0286751 | 3300037418 | Bacteria | 1636 |
| 1188 | Ga0395900_0441917 | 3300037418 | Bacteria | 1258 |
| 1189 | Ga0395900_0526121 | 3300037418 | Unclassified | 1130 |
| 1190 | Ga0395900_0574468 | 3300037418 | Bacteria | 1070 |
| 1191 | Ga0395900_0667123 | 3300037418 | Bacteria | 975 |
| 1192 | Ga0395900_1109429 | 3300037418 | Unclassified | 708 |
| 1193 | Ga0395900_1252148 | 3300037418 | Bacteria | 656 |
| 1194 | Ga0395898_0000795 | 3300037466 | Bacteria | 53570 |
| 1195 | Ga0395898_0002193 | 3300037466 | Bacteria | 23839 |
| 1196 | Ga0395898_0009079 | 3300037466 | Bacteria | 10470 |
| 1197 | Ga0395898_0013830 | 3300037466 | Bacteria | 8295 |
| 1198 | Ga0395898_0015806 | 3300037466 | Bacteria | 7735 |
| 1199 | Ga0395898_0016921 | 3300037466 | Bacteria | 7444 |
| 1200 | Ga0395898_0034133 | 3300037466 | Bacteria | 5073 |
| 1201 | Ga0395898_0043576 | 3300037466 | Bacteria | 4421 |
| 1202 | Ga0395898_0044296 | 3300037466 | Bacteria | 4382 |
| 1203 | Ga0395898_0063856 | 3300037466 | Bacteria | 3573 |
| 1204 | Ga0395898_0086424 | 3300037466 | Unclassified | 3022 |
| 1205 | Ga0395898_0088576 | 3300037466 | Bacteria | 2979 |
| 1206 | Ga0395898_0128762 | 3300037466 | Bacteria | 2425 |
| 1207 | Ga0395898_0146755 | 3300037466 | Unclassified | 2258 |
| 1208 | Ga0395898_0162608 | 3300037466 | Bacteria | 2135 |
| 1209 | Ga0395898_0164186 | 3300037466 | Bacteria | 2124 |
| 1210 | Ga0395898_0183502 | 3300037466 | Bacteria | 1999 |
| 1211 | Ga0395898_0404434 | 3300037466 | Bacteria | 1302 |
| 1212 | Ga0395898_0698304 | 3300037466 | Bacteria | 956 |
| 1213 | Ga0395898_0707202 | 3300037466 | Unclassified | 949 |
| 1214 | Ga0395898_0811683 | 3300037466 | Bacteria | 875 |
| 1215 | Ga0395898_1525449 | 3300037466 | Bacteria | 594 |
| 1216 | Ga0395905_0009609 | 3300037471 | Bacteria | 9442 |
| 1217 | Ga0395905_0014210 | 3300037471 | Bacteria | 7605 |
| 1218 | Ga0395905_0015516 | 3300037471 | Bacteria | 7242 |
| 1219 | Ga0395905_0027661 | 3300037471 | Bacteria | 5348 |
| 1220 | Ga0395905_0057969 | 3300037471 | Bacteria | 3622 |
| 1221 | Ga0395905_0065451 | 3300037471 | Bacteria | 3403 |
| 1222 | Ga0395905_0081208 | 3300037471 | Bacteria | 3038 |
| 1223 | Ga0395905_0083987 | 3300037471 | Bacteria | 2983 |
| 1224 | Ga0395905_0086678 | 3300037471 | Bacteria | 2935 |
| 1225 | Ga0395905_0131221 | 3300037471 | Bacteria | 2356 |
| 1226 | Ga0395905_0140628 | 3300037471 | Bacteria | 2271 |
| 1227 | Ga0395905_0189510 | 3300037471 | Bacteria | 1929 |
| 1228 | Ga0395905_0254187 | 3300037471 | Bacteria | 1641 |
| 1229 | Ga0395905_0254700 | 3300037471 | Bacteria | 1639 |
| 1230 | Ga0395905_0298389 | 3300037471 | Bacteria | 1498 |
| 1231 | Ga0395905_0413140 | 3300037471 | Bacteria | 1245 |
| 1232 | Ga0395905_0777745 | 3300037471 | Unclassified | 860 |
| 1233 | Ga0395905_0798930 | 3300037471 | Bacteria | 846 |
| 1234 | Ga0395905_0988605 | 3300037471 | Unclassified | 744 |
| 1235 | Ga0395905_1176978 | 3300037471 | Bacteria | 670 |
| 1236 | Ga0436364_1329343 | 3300037853 | Bacteria | 502 |
| 1237 | Ga0395901_0003405 | 3300038443 | Bacteria | 16022 |
| 1238 | Ga0395901_0004473 | 3300038443 | Bacteria | 14104 |
| 1239 | Ga0395901_0004812 | 3300038443 | Bacteria | 13622 |
| 1240 | Ga0395901_0007531 | 3300038443 | Bacteria | 10995 |
| 1241 | Ga0395901_0010774 | 3300038443 | Bacteria | 9269 |
| 1242 | Ga0395901_0014837 | 3300038443 | Bacteria | 7916 |
| 1243 | Ga0395901_0016495 | 3300038443 | Bacteria | 7526 |
| 1244 | Ga0395901_0017704 | 3300038443 | Bacteria | 7274 |
| 1245 | Ga0395901_0019015 | 3300038443 | Bacteria | 7023 |
| 1246 | Ga0395901_0024354 | 3300038443 | Bacteria | 6211 |
| 1247 | Ga0395901_0034604 | 3300038443 | Bacteria | 5217 |
| 1248 | Ga0395901_0065946 | 3300038443 | Bacteria | 3771 |
| 1249 | Ga0395901_0082903 | 3300038443 | Bacteria | 3351 |
| 1250 | Ga0395901_0093359 | 3300038443 | Bacteria | 3151 |
| 1251 | Ga0395901_0125048 | 3300038443 | Bacteria | 2702 |
| 1252 | Ga0395901_0141706 | 3300038443 | Bacteria | 2526 |
| 1253 | Ga0395901_0147590 | 3300038443 | Bacteria | 2471 |
| 1254 | Ga0395901_0152361 | 3300038443 | Unclassified | 2429 |
| 1255 | Ga0395901_0191167 | 3300038443 | Bacteria | 2147 |
| 1256 | Ga0395901_0193217 | 3300038443 | Bacteria | 2134 |
| 1257 | Ga0395901_0254714 | 3300038443 | Bacteria | 1828 |
| 1258 | Ga0395901_0288023 | 3300038443 | Unclassified | 1705 |
| 1259 | Ga0395901_0370110 | 3300038443 | Bacteria | 1476 |
| 1260 | Ga0395901_0373080 | 3300038443 | Bacteria | 1469 |
| 1261 | Ga0395901_0408976 | 3300038443 | Bacteria | 1393 |
| 1262 | Ga0395901_0415890 | 3300038443 | Unclassified | 1379 |
| 1263 | Ga0395901_0604107 | 3300038443 | Bacteria | 1106 |
| 1264 | Ga0395901_0635354 | 3300038443 | Bacteria | 1073 |
| 1265 | Ga0395901_0734825 | 3300038443 | Bacteria | 981 |
| 1266 | Ga0395901_1035763 | 3300038443 | Bacteria | 795 |
| 1267 | Ga0395901_1419657 | 3300038443 | Bacteria | 652 |
| 1268 | Ga0395901_1741222 | 3300038443 | Bacteria | 573 |
| 1269 | Ga0395901_1756604 | 3300038443 | Unclassified | 570 |
| 1270 | Ga0395901_1928031 | 3300038443 | Bacteria | 538 |
| 1271 | Ga0242422_05981 | 3300038699 | Bacteria | 736 |
| 1272 | Ga0242420_002041 | 3300038996 | Bacteria | 2822 |
| 1273 | Ga0436365_0025901 | 3300039437 | Bacteria | 1249 |
| 1274 | Ga0436365_0411377 | 3300039437 | Bacteria | 1745 |
| 1275 | Ga0436365_1892433 | 3300039437 | Bacteria | 967 |
| 1276 | Ga0436360_1251922 | 3300039438 | Bacteria | 6237 |
| 1277 | Ga0436363_0196864 | 3300039450 | Bacteria | 866 |
| 1278 | Ga0436362_0019340 | 3300039453 | Bacteria | 4933 |
| 1279 | Ga0436362_0245167 | 3300039453 | Bacteria | 621 |
| 1280 | Ga0436362_0676185 | 3300039453 | Bacteria | 3756 |
| 1281 | Ga0451787_108320 | 3300041441 | Bacteria | 884 |
| 1282 | Ga0451789_0065786 | 3300041443 | Bacteria | 627 |
| 1283 | Ga0451791_1185374 | 3300041451 | Bacteria | 2941 |
| 1284 | Ga0451804_0246043 | 3300041463 | Bacteria | 844 |
| 1285 | Ga0451807_0796071 | 3300041486 | Bacteria | 1453 |
| 1286 | Ga0451835_0664966 | 3300041492 | Unclassified | 613 |
| 1287 | Ga0451841_0560786 | 3300041498 | Bacteria | 1272 |
| 1288 | Ga0451853_2814187 | 3300041512 | Unclassified | 797 |
| 1289 | Ga0439448_0194482 | 3300042005 | Unclassified | 710 |
| 1290 | Ga0439450_036733 | 3300042008 | Unclassified | 1123 |
| 1291 | Ga0439454_035206 | 3300042011 | Unclassified | 801 |
| 1292 | Ga0439454_117523 | 3300042011 | Bacteria | 512 |
| 1293 | Ga0439455_0139176 | 3300042012 | Unclassified | 687 |
| 1294 | Ga0439463_074284 | 3300042016 | Unclassified | 872 |
| 1295 | Ga0439463_199900 | 3300042016 | Bacteria | 519 |
| 1296 | Ga0450898_137666 | 3300042134 | Bacteria | 529 |
| 1297 | Ga0450902_036243 | 3300042137 | Bacteria | 835 |
| 1298 | Ga0439446_0088901 | 3300042156 | Bacteria | 965 |
| 1299 | Ga0439458_0030587 | 3300042157 | Bacteria | 1282 |
| 1300 | Ga0439434_0112315 | 3300042435 | Unclassified | 883 |
| 1301 | Ga0439444_0016653 | 3300042437 | Unclassified | 1254 |
| 1302 | Ga0439460_0071371 | 3300042461 | Bacteria | 1076 |
| 1303 | Ga0439440_0128365 | 3300042993 | Bacteria | 711 |
| 1304 | Ga0466969_0160233 | 3300044656 | Unclassified | 1034 |
| 1305 | Ga0466972_0204299 | 3300044658 | Bacteria | 925 |
| 1306 | Ga0466972_0301592 | 3300044658 | Viruses | 749 |
| 1307 | Ga0466972_0336484 | 3300044658 | Bacteria | 706 |
| 1308 | Ga0466965_0315027 | 3300044683 | Bacteria | 851 |
| 1309 | Ga0466966_0006534 | 3300044684 | Bacteria | 7715 |
| 1310 | Ga0466966_0122730 | 3300044684 | Unclassified | 1595 |
| 1311 | Ga0466961_0053483 | 3300044693 | Unclassified | 2576 |
| 1312 | Ga0466961_0138741 | 3300044693 | Unclassified | 1523 |
| 1313 | Ga0466961_0152125 | 3300044693 | Bacteria | 1444 |
| 1314 | Ga0466961_0838177 | 3300044693 | Unclassified | 548 |
| 1315 | Ga0466963_0011944 | 3300044694 | Bacteria | 5303 |
| 1316 | Ga0466963_0017025 | 3300044694 | Bacteria | 4527 |
| 1317 | Ga0466963_0035000 | 3300044694 | Bacteria | 3270 |
| 1318 | Ga0466963_0065726 | 3300044694 | Bacteria | 2432 |
| 1319 | Ga0466963_0959000 | 3300044694 | Bacteria | 602 |
| 1320 | Ga0466964_0002888 | 3300044706 | Bacteria | 6204 |
| 1321 | Ga0466964_0003812 | 3300044706 | Bacteria | 5530 |
| 1322 | Ga0466964_0033123 | 3300044706 | Unclassified | 2057 |
| 1323 | Ga0466964_0220273 | 3300044706 | Bacteria | 921 |
| 1324 | Ga0466964_0300220 | 3300044706 | Unclassified | 809 |
| 1325 | Ga0466964_0736770 | 3300044706 | Bacteria | 552 |
| 1326 | Ga0466971_0144114 | 3300044719 | Bacteria | 1110 |
| 1327 | Ga0466971_0224452 | 3300044719 | Unclassified | 891 |
| 1328 | Ga0466968_0027489 | 3300044735 | Bacteria | 2342 |
| 1329 | Ga0466968_0046132 | 3300044735 | Bacteria | 1851 |
| 1330 | Ga0466968_0117146 | 3300044735 | Unclassified | 1203 |
| 1331 | Ga0466968_0142424 | 3300044735 | Unclassified | 1097 |
| 1332 | Ga0466970_0016182 | 3300044765 | Unclassified | 3842 |
| 1333 | Ga0466970_0242029 | 3300044765 | Bacteria | 1010 |
| 1334 | Ga0466957_0019251 | 3300044842 | Bacteria | 4015 |
| 1335 | Ga0466957_0075311 | 3300044842 | Unclassified | 2094 |
| 1336 | Ga0466957_0183008 | 3300044842 | Bacteria | 1369 |
| 1337 | Ga0466957_0183040 | 3300044842 | Unclassified | 1369 |
| 1338 | Ga0466957_0298889 | 3300044842 | Bacteria | 1081 |
| 1339 | Ga0466957_0317723 | 3300044842 | Bacteria | 1050 |
| 1340 | Ga0466957_0480830 | 3300044842 | Bacteria | 859 |
| 1341 | Ga0466957_0664673 | 3300044842 | Bacteria | 733 |
| 1342 | Ga0466957_0755974 | 3300044842 | Bacteria | 689 |
| 1343 | Ga0466957_1119401 | 3300044842 | Unclassified | 568 |
| 1344 | Ga0466960_0025586 | 3300044901 | Bacteria | 2672 |
| 1345 | Ga0466960_0054678 | 3300044901 | Unclassified | 1939 |
| 1346 | Ga0466960_0196058 | 3300044901 | Bacteria | 1101 |
| 1347 | Ga0466960_0394268 | 3300044901 | Bacteria | 796 |
| 1348 | Ga0466959_0022989 | 3300045049 | Bacteria | 4610 |
| 1349 | Ga0466959_0185798 | 3300045049 | Bacteria | 1452 |
| 1350 | Ga0466959_1123970 | 3300045049 | Unclassified | 522 |
| 1351 | Ga0451576_0144297 | 3300045051 | Bacteria | 2482 |
| 1352 | Ga0451576_1317862 | 3300045051 | Bacteria | 752 |
| 1353 | Ga0451576_2642071 | 3300045051 | Bacteria | 512 |
| 1354 | Ga0466958_0022336 | 3300045836 | Bacteria | 3705 |
| 1355 | Ga0466958_0079748 | 3300045836 | Bacteria | 2013 |
| 1356 | Ga0466958_0091737 | 3300045836 | Unclassified | 1881 |
| 1357 | Ga0466958_0091870 | 3300045836 | Unclassified | 1879 |
| 1358 | Ga0466958_0122391 | 3300045836 | Unclassified | 1629 |
| 1359 | Ga0466958_0156642 | 3300045836 | Unclassified | 1438 |
| 1360 | Ga0466958_0160033 | 3300045836 | Bacteria | 1422 |
| 1361 | Ga0466958_0696156 | 3300045836 | Bacteria | 662 |
| 1362 | Ga0466958_0822189 | 3300045836 | Unclassified | 606 |
| 1363 | Ga0466967_0000648 | 3300045976 | Bacteria | 17473 |
| 1364 | Ga0466967_0005057 | 3300045976 | Bacteria | 9044 |
| 1365 | Ga0466967_0022282 | 3300045976 | Bacteria | 5165 |
| 1366 | Ga0466967_0023072 | 3300045976 | Bacteria | 5093 |
| 1367 | Ga0466967_0024240 | 3300045976 | Bacteria | 4986 |
| 1368 | Ga0466967_0029014 | 3300045976 | Bacteria | 4625 |
| 1369 | Ga0466967_0066322 | 3300045976 | Bacteria | 3216 |
| 1370 | Ga0466967_0067554 | 3300045976 | Bacteria | 3189 |
| 1371 | Ga0466967_0076699 | 3300045976 | Bacteria | 3007 |
| 1372 | Ga0466967_0080031 | 3300045976 | Bacteria | 2947 |
| 1373 | Ga0466967_0085775 | 3300045976 | Bacteria | 2851 |
| 1374 | Ga0466967_0097688 | 3300045976 | Bacteria | 2681 |
| 1375 | Ga0466967_0100171 | 3300045976 | Bacteria | 2647 |
| 1376 | Ga0466967_0107193 | 3300045976 | Bacteria | 2562 |
| 1377 | Ga0466967_0114681 | 3300045976 | Bacteria | 2481 |
| 1378 | Ga0466967_0118295 | 3300045976 | Bacteria | 2444 |
| 1379 | Ga0466967_0168883 | 3300045976 | Bacteria | 2057 |
| 1380 | Ga0466967_0181871 | 3300045976 | Bacteria | 1983 |
| 1381 | Ga0466967_0196051 | 3300045976 | Unclassified | 1911 |
| 1382 | Ga0466967_0420525 | 3300045976 | Bacteria | 1302 |
| 1383 | Ga0466967_0856428 | 3300045976 | Bacteria | 903 |
| 1384 | Ga0466967_1175874 | 3300045976 | Bacteria | 764 |
| 1385 | Ga0466967_1238906 | 3300045976 | Unclassified | 743 |
| 1386 | Ga0495617_232252 | 3300046452 | Unclassified | 571 |
| 1387 | Ga0495592_0057703 | 3300046454 | Bacteria | 2865 |
| 1388 | Ga0495592_0096530 | 3300046454 | Bacteria | 2113 |
| 1389 | Ga0495592_0477112 | 3300046454 | Unclassified | 777 |
| 1390 | Ga0495603_0027930 | 3300046455 | Bacteria | 3403 |
| 1391 | Ga0495590_0045844 | 3300046457 | Unclassified | 1525 |
| 1392 | Ga0495590_0390171 | 3300046457 | Bacteria | 533 |
| 1393 | Ga0495591_117065 | 3300046458 | Unclassified | 652 |
| 1394 | Ga0495629_0001534 | 3300046459 | Bacteria | 18164 |
| 1395 | Ga0495638_0606284 | 3300046460 | Unclassified | 537 |
| 1396 | Ga0495641_0000634 | 3300046461 | Bacteria | 29644 |
| 1397 | Ga0495641_0038789 | 3300046461 | Bacteria | 2224 |
| 1398 | Ga0495651_0089649 | 3300046462 | Bacteria | 2308 |
| 1399 | Ga0495651_0092854 | 3300046462 | Unclassified | 2260 |
| 1400 | Ga0495651_0403143 | 3300046462 | Unclassified | 892 |
| 1401 | Ga0495653_0033629 | 3300046463 | Bacteria | 4060 |
| 1402 | Ga0495653_0036126 | 3300046463 | Bacteria | 3894 |
| 1403 | Ga0495653_0082578 | 3300046463 | Unclassified | 2371 |
| 1404 | Ga0495653_0087276 | 3300046463 | Bacteria | 2292 |
| 1405 | Ga0495580_0252581 | 3300046472 | Bacteria | 1207 |
| 1406 | Ga0495580_0404221 | 3300046472 | Unclassified | 920 |
| 1407 | Ga0495582_0000041 | 3300046473 | Bacteria | 65919 |
| 1408 | Ga0495582_0058402 | 3300046473 | Bacteria | 2127 |
| 1409 | Ga0495582_0612761 | 3300046473 | Bacteria | 630 |
| 1410 | Ga0495605_0039779 | 3300046474 | Bacteria | 2353 |
| 1411 | Ga0495605_0218574 | 3300046474 | Unclassified | 824 |
| 1412 | Ga0495639_0000616 | 3300046475 | Bacteria | 16538 |
| 1413 | Ga0495639_0098150 | 3300046475 | Bacteria | 1381 |
| 1414 | Ga0495662_0000805 | 3300046476 | Bacteria | 15225 |
| 1415 | Ga0495662_0106325 | 3300046476 | Bacteria | 1374 |
| 1416 | Ga0495664_0008900 | 3300046477 | Bacteria | 5610 |
| 1417 | Ga0495664_0187080 | 3300046477 | Bacteria | 1255 |
| 1418 | Ga0495664_0904364 | 3300046477 | Unclassified | 516 |
| 1419 | Ga0495584_0084654 | 3300046491 | Bacteria | 1597 |
| 1420 | Ga0495584_0132728 | 3300046491 | Unclassified | 1263 |
| 1421 | Ga0495584_0244699 | 3300046491 | Bacteria | 912 |
| 1422 | Ga0495584_0396172 | 3300046491 | Bacteria | 702 |
| 1423 | Ga0495584_0624608 | 3300046491 | Bacteria | 549 |
| 1424 | Ga0495585_0181927 | 3300046492 | Unclassified | 1080 |
| 1425 | Ga0495585_0363787 | 3300046492 | Bacteria | 701 |
| 1426 | Ga0495594_0077100 | 3300046499 | Bacteria | 1859 |
| 1427 | Ga0495594_0386022 | 3300046499 | Bacteria | 797 |
| 1428 | Ga0495596_0054557 | 3300046500 | Bacteria | 1563 |
| 1429 | Ga0495596_0107330 | 3300046500 | Unclassified | 1084 |
| 1430 | Ga0495596_0133404 | 3300046500 | Bacteria | 964 |
| 1431 | Ga0495596_0332236 | 3300046500 | Bacteria | 591 |
| 1432 | Ga0495596_0377000 | 3300046500 | Bacteria | 553 |
| 1433 | Ga0495607_0210654 | 3300046501 | Unclassified | 956 |
| 1434 | Ga0495608_0012187 | 3300046511 | Bacteria | 5975 |
| 1435 | Ga0495608_0055687 | 3300046511 | Unclassified | 2613 |
| 1436 | Ga0495608_0060546 | 3300046511 | Bacteria | 2491 |
| 1437 | Ga0495616_0130617 | 3300046513 | Unclassified | 1151 |
| 1438 | Ga0495618_0050411 | 3300046514 | Bacteria | 2629 |
| 1439 | Ga0495618_0067553 | 3300046514 | Bacteria | 2273 |
| 1440 | Ga0495620_0046531 | 3300046515 | Bacteria | 1873 |
| 1441 | Ga0495620_0069802 | 3300046515 | Unclassified | 1440 |
| 1442 | Ga0495628_0019330 | 3300046516 | Bacteria | 5633 |
| 1443 | Ga0495628_0082548 | 3300046516 | Bacteria | 2496 |
| 1444 | Ga0495628_1195090 | 3300046516 | Bacteria | 516 |
| 1445 | Ga0495630_0009695 | 3300046517 | Bacteria | 6926 |
| 1446 | Ga0495630_0010811 | 3300046517 | Bacteria | 6590 |
| 1447 | Ga0495630_0033795 | 3300046517 | Bacteria | 3814 |
| 1448 | Ga0495630_0037580 | 3300046517 | Bacteria | 3620 |
| 1449 | Ga0495630_0052291 | 3300046517 | Bacteria | 3058 |
| 1450 | Ga0495630_0417912 | 3300046517 | Bacteria | 1027 |
| 1451 | Ga0495631_0043502 | 3300046518 | Unclassified | 1981 |
| 1452 | Ga0495631_0407507 | 3300046518 | Unclassified | 579 |
| 1453 | Ga0495637_0008598 | 3300046520 | Bacteria | 5010 |
| 1454 | Ga0495637_0191837 | 3300046520 | Bacteria | 754 |
| 1455 | Ga0495637_0215434 | 3300046520 | Bacteria | 701 |
| 1456 | Ga0495643_0339422 | 3300046522 | Unclassified | 675 |
| 1457 | Ga0495644_0076077 | 3300046523 | Unclassified | 1264 |
| 1458 | Ga0495644_0131625 | 3300046523 | Bacteria | 953 |
| 1459 | Ga0495644_0156161 | 3300046523 | Bacteria | 874 |
| 1460 | Ga0495644_0271456 | 3300046523 | Bacteria | 661 |
| 1461 | Ga0495644_0377472 | 3300046523 | Bacteria | 560 |
| 1462 | Ga0495663_0026751 | 3300046525 | Unclassified | 1690 |
| 1463 | Ga0495663_0223651 | 3300046525 | Bacteria | 662 |
| 1464 | Ga0495666_0003576 | 3300046526 | Bacteria | 7857 |
| 1465 | Ga0495666_0145108 | 3300046526 | Bacteria | 1105 |
| 1466 | Ga0495642_0088262 | 3300046528 | Bacteria | 1311 |
| 1467 | Ga0495652_0075905 | 3300046529 | Bacteria | 2790 |
| 1468 | Ga0495652_0096763 | 3300046529 | Bacteria | 2403 |
| 1469 | Ga0495654_0135920 | 3300046530 | Unclassified | 1100 |
| 1470 | Ga0495665_0000948 | 3300046531 | Bacteria | 15293 |
| 1471 | Ga0495665_0311918 | 3300046531 | Bacteria | 804 |
| 1472 | Ga0495640_0005396 | 3300046533 | Bacteria | 10174 |
| 1473 | Ga0495640_0013669 | 3300046533 | Bacteria | 6169 |
| 1474 | Ga0495640_0246708 | 3300046533 | Bacteria | 1120 |
| 1475 | Ga0495640_0410476 | 3300046533 | Unclassified | 830 |
| 1476 | Ga0495587_0015391 | 3300046536 | Bacteria | 4778 |
| 1477 | Ga0495587_0043037 | 3300046536 | Bacteria | 2691 |
| 1478 | Ga0495598_0011663 | 3300046537 | Unclassified | 2137 |
| 1479 | Ga0495609_0061834 | 3300046538 | Unclassified | 1654 |
| 1480 | Ga0495609_0229633 | 3300046538 | Bacteria | 769 |
| 1481 | Ga0495645_0100217 | 3300046543 | Bacteria | 2060 |
| 1482 | Ga0495645_0395528 | 3300046543 | Bacteria | 881 |
| 1483 | Ga0495645_0422118 | 3300046543 | Unclassified | 846 |
| 1484 | Ga0495633_0076235 | 3300046558 | Unclassified | 1561 |
| 1485 | Ga0495633_0526382 | 3300046558 | Bacteria | 533 |
| 1486 | Ga0495667_0006769 | 3300046559 | Bacteria | 7781 |
| 1487 | Ga0495667_0006801 | 3300046559 | Bacteria | 7763 |
| 1488 | Ga0495667_0124818 | 3300046559 | Unclassified | 1661 |
| 1489 | Ga0495667_0136955 | 3300046559 | Bacteria | 1578 |
| 1490 | Ga0495667_0525170 | 3300046559 | Bacteria | 740 |
| 1491 | Ga0495667_0603389 | 3300046559 | Bacteria | 684 |
| 1492 | Ga0495656_0032966 | 3300046615 | Bacteria | 2111 |
| 1493 | Ga0495668_0103060 | 3300046616 | Unclassified | 1561 |
| 1494 | Ga0495634_0019887 | 3300046642 | Bacteria | 4766 |
| 1495 | Ga0495634_0047336 | 3300046642 | Bacteria | 2898 |
| 1496 | Ga0495611_0059244 | 3300046648 | Bacteria | 1738 |
| 1497 | Ga0495611_0419099 | 3300046648 | Bacteria | 611 |
| 1498 | Ga0495635_0007608 | 3300046663 | Bacteria | 7558 |
| 1499 | Ga0495635_0010696 | 3300046663 | Bacteria | 6425 |
| 1500 | Ga0495635_0016610 | 3300046663 | Bacteria | 5141 |
| 1501 | Ga0495635_0054666 | 3300046663 | Bacteria | 2750 |
| 1502 | Ga0495659_0027100 | 3300046664 | Unclassified | 1974 |
| 1503 | Ga0495659_0030398 | 3300046664 | Bacteria | 1880 |
| 1504 | Ga0495588_0162295 | 3300046674 | Bacteria | 1182 |
| 1505 | Ga0495657_0354853 | 3300046675 | Bacteria | 867 |
| 1506 | Ga0495657_0366400 | 3300046675 | Bacteria | 851 |
| 1507 | Ga0495599_0026581 | 3300046678 | Bacteria | 3627 |
| 1508 | Ga0495599_0879388 | 3300046678 | Unclassified | 508 |
| 1509 | Ga0495623_0243689 | 3300046679 | Bacteria | 1014 |
| 1510 | Ga0495646_0072746 | 3300046680 | Bacteria | 2021 |
| 1511 | Ga0495647_0015964 | 3300046681 | Bacteria | 2638 |
| 1512 | Ga0495647_0366852 | 3300046681 | Bacteria | 657 |
| 1513 | Ga0495658_0000230 | 3300046683 | Bacteria | 32067 |
| 1514 | Ga0495658_0553228 | 3300046683 | Bacteria | 737 |
| 1515 | Ga0495669_0167450 | 3300046684 | Unclassified | 1044 |
| 1516 | Ga0495669_0664237 | 3300046684 | Bacteria | 507 |
| 1517 | Ga0495613_0002261 | 3300046689 | Bacteria | 14563 |
| 1518 | Ga0495613_0069279 | 3300046689 | Bacteria | 2572 |
| 1519 | Ga0495613_0097965 | 3300046689 | Bacteria | 2119 |
| 1520 | Ga0495613_0354532 | 3300046689 | Bacteria | 1007 |
| 1521 | Ga0495624_0034413 | 3300046690 | Bacteria | 3277 |
| 1522 | Ga0495624_0042480 | 3300046690 | Bacteria | 2905 |
| 1523 | Ga0495624_0071490 | 3300046690 | Bacteria | 2159 |
| 1524 | Ga0495624_0135871 | 3300046690 | Bacteria | 1507 |
| 1525 | Ga0495670_0061845 | 3300046691 | Bacteria | 1883 |
| 1526 | Ga0495670_0113978 | 3300046691 | Bacteria | 1401 |
| 1527 | Ga0495670_0130226 | 3300046691 | Bacteria | 1311 |
| 1528 | Ga0495670_0394356 | 3300046691 | Unclassified | 747 |
| 1529 | Ga0495671_0207562 | 3300046692 | Unclassified | 949 |
| 1530 | Ga0495589_0186510 | 3300046794 | Unclassified | 982 |
| 1531 | Ga0495589_0216702 | 3300046794 | Bacteria | 900 |
| 1532 | Ga0495589_0249759 | 3300046794 | Bacteria | 829 |
| 1533 | Ga0495589_0271721 | 3300046794 | Bacteria | 789 |
| 1534 | Ga0495589_0600744 | 3300046794 | Bacteria | 501 |
| 1535 | Ga0495600_0009782 | 3300046809 | Bacteria | 5928 |
| 1536 | Ga0495600_0071819 | 3300046809 | Bacteria | 2261 |
| 1537 | Ga0495600_0328083 | 3300046809 | Bacteria | 961 |
| 1538 | Ga0495660_0044290 | 3300046810 | Bacteria | 2449 |
| 1539 | Ga0495581_0001492 | 3300047315 | Bacteria | 13017 |
| 1540 | Ga0495581_0006215 | 3300047315 | Bacteria | 6927 |
| 1541 | Ga0495581_0631063 | 3300047315 | Bacteria | 620 |
| 1542 | Ga0495604_0004934 | 3300047317 | Bacteria | 10580 |
| 1543 | Ga0495636_0028072 | 3300047318 | Unclassified | 2293 |
| 1544 | Ga0495636_0433675 | 3300047318 | Bacteria | 629 |
| 1545 | Ga0495674_0003506 | 3300047319 | Bacteria | 15271 |
| 1546 | Ga0495674_0014037 | 3300047319 | Bacteria | 7509 |
| 1547 | Ga0495674_0025916 | 3300047319 | Bacteria | 5367 |
| 1548 | Ga0495674_0061536 | 3300047319 | Bacteria | 3271 |
| 1549 | Ga0495674_0257678 | 3300047319 | Bacteria | 1434 |
| 1550 | Ga0495674_0312471 | 3300047319 | Bacteria | 1282 |
| 1551 | Ga0495674_0404015 | 3300047319 | Bacteria | 1102 |
| 1552 | Ga0495672_0047592 | 3300047320 | Bacteria | 2549 |
| 1553 | Ga0495672_0097048 | 3300047320 | Bacteria | 1606 |
| 1554 | Ga0495672_0328172 | 3300047320 | Unclassified | 717 |
| 1555 | Ga0495676_0003276 | 3300047321 | Bacteria | 14628 |
| 1556 | Ga0495676_0143321 | 3300047321 | Bacteria | 1710 |
| 1557 | Ga0495676_0160306 | 3300047321 | Bacteria | 1592 |
| 1558 | Ga0495680_0000521 | 3300047322 | Bacteria | 43463 |
| 1559 | Ga0495680_0011431 | 3300047322 | Bacteria | 7859 |
| 1560 | Ga0495680_0013248 | 3300047322 | Bacteria | 7204 |
| 1561 | Ga0495680_0028536 | 3300047322 | Bacteria | 4574 |
| 1562 | Ga0495680_0140083 | 3300047322 | Unclassified | 1770 |
| 1563 | Ga0495683_0146492 | 3300047323 | Unclassified | 1103 |
| 1564 | Ga0495675_0021501 | 3300047444 | Bacteria | 4109 |
| 1565 | Ga0495675_0232831 | 3300047444 | Bacteria | 1111 |
| 1566 | Ga0495677_0063993 | 3300047445 | Unclassified | 1366 |
| 1567 | Ga0495679_068998 | 3300047446 | Unclassified | 1022 |
| 1568 | Ga0495685_062706 | 3300047447 | Unclassified | 1251 |
| 1569 | Ga0495681_0184959 | 3300047470 | Unclassified | 854 |
| 1570 | Ga0495684_0009608 | 3300047471 | Bacteria | 7458 |
| 1571 | Ga0495684_0020048 | 3300047471 | Bacteria | 5151 |
| 1572 | Ga0495684_0051883 | 3300047471 | Unclassified | 3130 |
| 1573 | Ga0495684_0092681 | 3300047471 | Bacteria | 2288 |
| 1574 | Ga0495684_0748774 | 3300047471 | Bacteria | 643 |
| 1575 | Ga0495602_0065858 | 3300048088 | Bacteria | 3124 |
| 1576 | Ga0495602_0190273 | 3300048088 | Bacteria | 1574 |
| 1577 | Ga0495602_1115762 | 3300048088 | Bacteria | 516 |
| 1578 | Ga0495614_0014438 | 3300048089 | Bacteria | 3457 |
| 1579 | Ga0495614_0058642 | 3300048089 | Bacteria | 1653 |
| 1580 | Ga0495615_0220489 | 3300048090 | Bacteria | 592 |
| 1581 | Ga0495615_0308307 | 3300048090 | Bacteria | 514 |
| 1582 | Ga0495626_0047440 | 3300048091 | Bacteria | 1997 |
| 1583 | Ga0496100_0002332 | 3300048903 | Bacteria | 9601 |
| 1584 | Ga0496100_0005021 | 3300048903 | Bacteria | 7081 |
| 1585 | Ga0496100_0013924 | 3300048903 | Bacteria | 4655 |
| 1586 | Ga0496100_0013955 | 3300048903 | Bacteria | 4651 |
| 1587 | Ga0496100_0106039 | 3300048903 | Bacteria | 1944 |
| 1588 | Ga0496100_0576515 | 3300048903 | Bacteria | 872 |
| 1589 | Ga0496100_0882414 | 3300048903 | Bacteria | 702 |
| 1590 | Ga0496100_1010670 | 3300048903 | Bacteria | 654 |
| 1591 | Ga0496101_0010235 | 3300048904 | Bacteria | 6190 |
| 1592 | Ga0496101_0025266 | 3300048904 | Bacteria | 4119 |
| 1593 | Ga0496101_0031082 | 3300048904 | Bacteria | 3750 |
| 1594 | Ga0496101_0049497 | 3300048904 | Bacteria | 3023 |
| 1595 | Ga0496101_0057179 | 3300048904 | Bacteria | 2820 |
| 1596 | Ga0496101_0091160 | 3300048904 | Unclassified | 2268 |
| 1597 | Ga0496101_0163902 | 3300048904 | Bacteria | 1706 |
| 1598 | Ga0496101_0233618 | 3300048904 | Bacteria | 1430 |
| 1599 | Ga0496101_0267975 | 3300048904 | Unclassified | 1333 |
| 1600 | Ga0496101_0292547 | 3300048904 | Bacteria | 1274 |
| 1601 | Ga0496101_1190624 | 3300048904 | Bacteria | 597 |
| 1602 | Ga0496102_0002937 | 3300048905 | Bacteria | 14456 |
| 1603 | Ga0496102_0033185 | 3300048905 | Bacteria | 4638 |
| 1604 | Ga0496102_0071007 | 3300048905 | Bacteria | 3197 |
| 1605 | Ga0496102_0077466 | 3300048905 | Bacteria | 3060 |
| 1606 | Ga0496102_0131858 | 3300048905 | Bacteria | 2340 |
| 1607 | Ga0496102_0380971 | 3300048905 | Bacteria | 1327 |
| 1608 | Ga0496102_0601603 | 3300048905 | Bacteria | 1023 |
| 1609 | Ga0496102_0698942 | 3300048905 | Bacteria | 937 |
| 1610 | Ga0496103_0001614 | 3300048906 | Bacteria | 14805 |
| 1611 | Ga0496103_0014534 | 3300048906 | Bacteria | 4674 |
| 1612 | Ga0496103_0018880 | 3300048906 | Bacteria | 4140 |
| 1613 | Ga0496103_0052355 | 3300048906 | Unclassified | 2528 |
| 1614 | Ga0496103_0483712 | 3300048906 | Bacteria | 793 |
| 1615 | Ga0496103_1013769 | 3300048906 | Unclassified | 516 |
| 1616 | Ga0496104_0005516 | 3300048907 | Bacteria | 11081 |
| 1617 | Ga0496104_0014035 | 3300048907 | Bacteria | 7230 |
| 1618 | Ga0496104_0015209 | 3300048907 | Bacteria | 6967 |
| 1619 | Ga0496104_0034799 | 3300048907 | Bacteria | 4699 |
| 1620 | Ga0496104_0036463 | 3300048907 | Bacteria | 4598 |
| 1621 | Ga0496104_0055819 | 3300048907 | Bacteria | 3734 |
| 1622 | Ga0496104_0157455 | 3300048907 | Bacteria | 2180 |
| 1623 | Ga0496104_0421722 | 3300048907 | Bacteria | 1246 |
| 1624 | Ga0496104_0870183 | 3300048907 | Bacteria | 806 |
| 1625 | Ga0496104_1272806 | 3300048907 | Bacteria | 639 |
| 1626 | Ga0496104_1654741 | 3300048907 | Bacteria | 543 |
| 1627 | Ga0496105_0010678 | 3300048908 | Bacteria | 7225 |
| 1628 | Ga0496105_0027980 | 3300048908 | Bacteria | 4609 |
| 1629 | Ga0496105_0070252 | 3300048908 | Bacteria | 2894 |
| 1630 | Ga0496105_0093354 | 3300048908 | Bacteria | 2485 |
| 1631 | Ga0496105_0110363 | 3300048908 | Bacteria | 2270 |
| 1632 | Ga0496105_0122950 | 3300048908 | Bacteria | 2140 |
| 1633 | Ga0496105_0304107 | 3300048908 | Bacteria | 1281 |
| 1634 | Ga0496105_0499602 | 3300048908 | Bacteria | 955 |
| 1635 | Ga0496106_0009352 | 3300048909 | Bacteria | 7245 |
| 1636 | Ga0496106_0011541 | 3300048909 | Bacteria | 6531 |
| 1637 | Ga0496106_0186802 | 3300048909 | Bacteria | 1646 |
| 1638 | Ga0496106_0208317 | 3300048909 | Bacteria | 1557 |
| 1639 | Ga0496106_0209843 | 3300048909 | Unclassified | 1551 |
| 1640 | Ga0496106_0413942 | 3300048909 | Unclassified | 1083 |
| 1641 | Ga0496106_1125642 | 3300048909 | Unclassified | 614 |
| 1642 | Ga0496107_0006841 | 3300048910 | Bacteria | 7853 |
| 1643 | Ga0496107_0009060 | 3300048910 | Bacteria | 6899 |
| 1644 | Ga0496107_0029576 | 3300048910 | Bacteria | 3898 |
| 1645 | Ga0496107_0074957 | 3300048910 | Bacteria | 2462 |
| 1646 | Ga0496107_0085174 | 3300048910 | Bacteria | 2306 |
| 1647 | Ga0496107_0477612 | 3300048910 | Unclassified | 925 |
| 1648 | Ga0496107_0883198 | 3300048910 | Unclassified | 652 |
| 1649 | Ga0496108_0000654 | 3300048911 | Bacteria | 26739 |
| 1650 | Ga0496108_0002430 | 3300048911 | Bacteria | 14893 |
| 1651 | Ga0496108_0047226 | 3300048911 | Bacteria | 3599 |
| 1652 | Ga0496108_0133994 | 3300048911 | Bacteria | 2130 |
| 1653 | Ga0496108_0137631 | 3300048911 | Bacteria | 2102 |
| 1654 | Ga0496108_0172223 | 3300048911 | Bacteria | 1873 |
| 1655 | Ga0496108_0293151 | 3300048911 | Bacteria | 1416 |
| 1656 | Ga0496108_0364719 | 3300048911 | Unclassified | 1261 |
| 1657 | Ga0496108_0518754 | 3300048911 | Bacteria | 1040 |
| 1658 | Ga0496109_0002798 | 3300048912 | Bacteria | 14606 |
| 1659 | Ga0496109_0012171 | 3300048912 | Bacteria | 7421 |
| 1660 | Ga0496109_0013542 | 3300048912 | Bacteria | 7080 |
| 1661 | Ga0496109_0016655 | 3300048912 | Bacteria | 6429 |
| 1662 | Ga0496109_0024106 | 3300048912 | Bacteria | 5406 |
| 1663 | Ga0496109_0030375 | 3300048912 | Bacteria | 4843 |
| 1664 | Ga0496109_0037518 | 3300048912 | Bacteria | 4378 |
| 1665 | Ga0496109_0038589 | 3300048912 | Bacteria | 4319 |
| 1666 | Ga0496109_0053942 | 3300048912 | Bacteria | 3668 |
| 1667 | Ga0496109_0113783 | 3300048912 | Bacteria | 2517 |
| 1668 | Ga0496109_0204500 | 3300048912 | Bacteria | 1856 |
| 1669 | Ga0496109_0259359 | 3300048912 | Bacteria | 1637 |
| 1670 | Ga0496109_0625409 | 3300048912 | Bacteria | 1013 |
| 1671 | Ga0496110_0001043 | 3300048913 | Bacteria | 19527 |
| 1672 | Ga0496110_0001883 | 3300048913 | Bacteria | 15494 |
| 1673 | Ga0496110_0003760 | 3300048913 | Bacteria | 11694 |
| 1674 | Ga0496110_0014925 | 3300048913 | Bacteria | 6457 |
| 1675 | Ga0496110_0024135 | 3300048913 | Bacteria | 5180 |
| 1676 | Ga0496110_0043790 | 3300048913 | Bacteria | 3908 |
| 1677 | Ga0496110_0247362 | 3300048913 | Unclassified | 1623 |
| 1678 | Ga0496110_0281435 | 3300048913 | Bacteria | 1514 |
| 1679 | Ga0496110_0361662 | 3300048913 | Bacteria | 1322 |
| 1680 | Ga0496110_0368488 | 3300048913 | Bacteria | 1309 |
| 1681 | Ga0496111_0000185 | 3300048914 | Bacteria | 28524 |
| 1682 | Ga0496111_0002354 | 3300048914 | Bacteria | 11392 |
| 1683 | Ga0496111_0007396 | 3300048914 | Bacteria | 7194 |
| 1684 | Ga0496111_0017850 | 3300048914 | Bacteria | 4908 |
| 1685 | Ga0496111_0027681 | 3300048914 | Bacteria | 4013 |
| 1686 | Ga0496111_0069515 | 3300048914 | Bacteria | 2561 |
| 1687 | Ga0496111_0105136 | 3300048914 | Bacteria | 2077 |
| 1688 | Ga0496111_0127162 | 3300048914 | Bacteria | 1884 |
| 1689 | Ga0496111_0145866 | 3300048914 | Bacteria | 1755 |
| 1690 | Ga0496111_0153237 | 3300048914 | Unclassified | 1710 |
| 1691 | Ga0496111_0282500 | 3300048914 | Unclassified | 1231 |
| 1692 | Ga0496111_0537980 | 3300048914 | Bacteria | 858 |
| 1693 | Ga0496111_0707391 | 3300048914 | Unclassified | 732 |
| 1694 | Ga0496112_0004986 | 3300048915 | Bacteria | 11383 |
| 1695 | Ga0496112_0010630 | 3300048915 | Bacteria | 8360 |
| 1696 | Ga0496112_0026171 | 3300048915 | Bacteria | 5610 |
| 1697 | Ga0496112_0027194 | 3300048915 | Bacteria | 5516 |
| 1698 | Ga0496112_0037845 | 3300048915 | Bacteria | 4711 |
| 1699 | Ga0496112_0087398 | 3300048915 | Bacteria | 3084 |
| 1700 | Ga0496112_0091755 | 3300048915 | Unclassified | 3006 |
| 1701 | Ga0496112_0092642 | 3300048915 | Unclassified | 2991 |
| 1702 | Ga0496112_0160098 | 3300048915 | Bacteria | 2217 |
| 1703 | Ga0496112_0163749 | 3300048915 | Bacteria | 2190 |
| 1704 | Ga0496112_0226499 | 3300048915 | Bacteria | 1825 |
| 1705 | Ga0496112_0360693 | 3300048915 | Unclassified | 1395 |
| 1706 | Ga0496112_0428372 | 3300048915 | Bacteria | 1261 |
| 1707 | Ga0496112_0782268 | 3300048915 | Unclassified | 879 |
| 1708 | Ga0496112_1008376 | 3300048915 | Unclassified | 752 |
| 1709 | Ga0496112_1166626 | 3300048915 | Bacteria | 687 |
| 1710 | Ga0496113_0003813 | 3300048916 | Bacteria | 9121 |
| 1711 | Ga0496113_0010963 | 3300048916 | Bacteria | 6020 |
| 1712 | Ga0496113_0038773 | 3300048916 | Bacteria | 3504 |
| 1713 | Ga0496113_0074078 | 3300048916 | Unclassified | 2595 |
| 1714 | Ga0496113_0171295 | 3300048916 | Bacteria | 1719 |
| 1715 | Ga0496113_0460268 | 3300048916 | Unclassified | 1022 |
| 1716 | Ga0496114_0003803 | 3300048917 | Bacteria | 11641 |
| 1717 | Ga0496114_0010950 | 3300048917 | Bacteria | 7231 |
| 1718 | Ga0496114_0035029 | 3300048917 | Bacteria | 4144 |
| 1719 | Ga0496114_0073138 | 3300048917 | Bacteria | 2884 |
| 1720 | Ga0496114_0102340 | 3300048917 | Bacteria | 2447 |
| 1721 | Ga0496114_0108216 | 3300048917 | Bacteria | 2379 |
| 1722 | Ga0496114_0177986 | 3300048917 | Bacteria | 1856 |
| 1723 | Ga0496114_0471620 | 3300048917 | Bacteria | 1111 |
| 1724 | Ga0496114_0506190 | 3300048917 | Bacteria | 1068 |
| 1725 | Ga0496114_0663439 | 3300048917 | Bacteria | 916 |
| 1726 | Ga0496114_0772276 | 3300048917 | Unclassified | 839 |
| 1727 | Ga0496115_0009651 | 3300048918 | Bacteria | 7181 |
| 1728 | Ga0496115_0016074 | 3300048918 | Bacteria | 5691 |
| 1729 | Ga0496115_0025999 | 3300048918 | Bacteria | 4563 |
| 1730 | Ga0496115_0061248 | 3300048918 | Unclassified | 3034 |
| 1731 | Ga0501290_078862 | 3300049513 | Bacteria | 558 |
| 1732 | Ga0501300_066172 | 3300049523 | Unclassified | 579 |
| 1733 | Ga0501311_081133 | 3300049527 | Bacteria | 552 |
| 1734 | Ga0501317_085225 | 3300049533 | Unclassified | 552 |
| 1735 | Ga0501320_067986 | 3300049536 | Unclassified | 511 |
| 1736 | Ga0501031_0151420 | 3300049568 | Bacteria | 1516 |
| 1737 | Ga0501031_0176762 | 3300049568 | Bacteria | 1395 |
| 1738 | Ga0501031_1036008 | 3300049568 | Bacteria | 524 |
| 1739 | Ga0501033_0126656 | 3300049570 | Bacteria | 1852 |
| 1740 | Ga0501033_0423655 | 3300049570 | Bacteria | 927 |
| 1741 | Ga0501034_0002607 | 3300049571 | Bacteria | 21420 |
| 1742 | Ga0501036_0338224 | 3300049572 | Bacteria | 1257 |
| 1743 | Ga0501036_0610949 | 3300049572 | Unclassified | 904 |
| 1744 | Ga0501036_0851716 | 3300049572 | Bacteria | 749 |
| 1745 | Ga0501037_0747106 | 3300049573 | Bacteria | 648 |
| 1746 | Ga0501038_0325699 | 3300049574 | Bacteria | 1201 |
| 1747 | Ga0501038_0604176 | 3300049574 | Bacteria | 830 |
| 1748 | Ga0501038_0669436 | 3300049574 | Bacteria | 780 |
| 1749 | Ga0501039_0115489 | 3300049575 | Bacteria | 2101 |
| 1750 | Ga0501039_0460072 | 3300049575 | Unclassified | 999 |
| 1751 | Ga0501039_0870216 | 3300049575 | Bacteria | 702 |
| 1752 | Ga0501039_1329807 | 3300049575 | Bacteria | 554 |
| 1753 | Ga0501040_0057771 | 3300049576 | Bacteria | 2664 |
| 1754 | Ga0501040_0827480 | 3300049576 | Bacteria | 670 |
| 1755 | Ga0501040_1238986 | 3300049576 | Bacteria | 541 |
| 1756 | Ga0501041_0034630 | 3300049577 | Bacteria | 3058 |
| 1757 | Ga0501042_0056258 | 3300049578 | Bacteria | 2807 |
| 1758 | Ga0501042_0100926 | 3300049578 | Bacteria | 2075 |
| 1759 | Ga0501042_0102890 | 3300049578 | Bacteria | 2055 |
| 1760 | Ga0501043_0275034 | 3300049579 | Bacteria | 1292 |
| 1761 | Ga0501043_0647683 | 3300049579 | Bacteria | 776 |
| 1762 | Ga0501046_0086652 | 3300049580 | Bacteria | 2414 |
| 1763 | Ga0501046_0422391 | 3300049580 | Unclassified | 961 |
| 1764 | Ga0501046_1216392 | 3300049580 | Bacteria | 517 |
| 1765 | Ga0501047_0050286 | 3300049581 | Bacteria | 4025 |
| 1766 | Ga0501047_0153138 | 3300049581 | Bacteria | 2180 |
| 1767 | Ga0501047_0356905 | 3300049581 | Bacteria | 1298 |
| 1768 | Ga0501048_0045475 | 3300049582 | Bacteria | 3136 |
| 1769 | Ga0501048_0176566 | 3300049582 | Bacteria | 1514 |
| 1770 | Ga0501048_0180171 | 3300049582 | Bacteria | 1498 |
| 1771 | Ga0501067_0006414 | 3300049583 | Bacteria | 6516 |
| 1772 | Ga0501067_0119012 | 3300049583 | Bacteria | 1469 |
| 1773 | Ga0501067_0282324 | 3300049583 | Bacteria | 924 |
| 1774 | Ga0501068_0029729 | 3300049584 | Bacteria | 3237 |
| 1775 | Ga0501069_0010802 | 3300049585 | Bacteria | 4841 |
| 1776 | Ga0501069_0081900 | 3300049585 | Unclassified | 1818 |
| 1777 | Ga0501069_0240130 | 3300049585 | Bacteria | 1056 |
| 1778 | Ga0501069_0262639 | 3300049585 | Bacteria | 1008 |
| 1779 | Ga0501069_0658110 | 3300049585 | Bacteria | 631 |
| 1780 | Ga0501070_0024322 | 3300049586 | Bacteria | 5080 |
| 1781 | Ga0501070_0026259 | 3300049586 | Bacteria | 4889 |
| 1782 | Ga0501070_0069129 | 3300049586 | Bacteria | 2924 |
| 1783 | Ga0501070_0089569 | 3300049586 | Bacteria | 2546 |
| 1784 | Ga0501070_0203130 | 3300049586 | Bacteria | 1627 |
| 1785 | Ga0501070_0401587 | 3300049586 | Unclassified | 1108 |
| 1786 | Ga0501071_0198887 | 3300049587 | Bacteria | 1505 |
| 1787 | Ga0501071_0399987 | 3300049587 | Unclassified | 1049 |
| 1788 | Ga0501071_0552819 | 3300049587 | Bacteria | 884 |
| 1789 | Ga0501071_0650799 | 3300049587 | Bacteria | 811 |
| 1790 | Ga0501071_0901722 | 3300049587 | Bacteria | 682 |
| 1791 | Ga0501072_0017987 | 3300049588 | Bacteria | 5434 |
| 1792 | Ga0501072_0060596 | 3300049588 | Bacteria | 2984 |
| 1793 | Ga0501072_0147858 | 3300049588 | Bacteria | 1873 |
| 1794 | Ga0501072_0180091 | 3300049588 | Bacteria | 1686 |
| 1795 | Ga0501072_0699099 | 3300049588 | Unclassified | 797 |
| 1796 | Ga0501072_0926230 | 3300049588 | Unclassified | 680 |
| 1797 | Ga0501073_0025031 | 3300049589 | Bacteria | 4283 |
| 1798 | Ga0501073_0095561 | 3300049589 | Unclassified | 2064 |
| 1799 | Ga0501074_0044931 | 3300049590 | Bacteria | 3196 |
| 1800 | Ga0501074_0074051 | 3300049590 | Bacteria | 2445 |
| 1801 | Ga0501074_0218039 | 3300049590 | Unclassified | 1359 |
| 1802 | Ga0501074_0344366 | 3300049590 | Bacteria | 1058 |
| 1803 | Ga0501074_0589765 | 3300049590 | Bacteria | 786 |
| 1804 | Ga0501074_0612763 | 3300049590 | Bacteria | 770 |
| 1805 | Ga0501074_0629608 | 3300049590 | Unclassified | 758 |
| 1806 | Ga0501074_0645054 | 3300049590 | Bacteria | 748 |
| 1807 | Ga0501075_0056530 | 3300049591 | Bacteria | 2954 |
| 1808 | Ga0501075_0060095 | 3300049591 | Bacteria | 2864 |
| 1809 | Ga0501075_0189699 | 3300049591 | Bacteria | 1568 |
| 1810 | Ga0501075_0417473 | 3300049591 | Bacteria | 1023 |
| 1811 | Ga0501075_0672457 | 3300049591 | Bacteria | 789 |
| 1812 | Ga0501075_0906527 | 3300049591 | Bacteria | 670 |
| 1813 | Ga0501075_1478257 | 3300049591 | Bacteria | 514 |
| 1814 | Ga0501075_1497182 | 3300049591 | Unclassified | 511 |
| 1815 | Ga0501076_0003024 | 3300049592 | Bacteria | 11684 |
| 1816 | Ga0501076_0331672 | 3300049592 | Bacteria | 1248 |
| 1817 | Ga0501076_0594169 | 3300049592 | Bacteria | 913 |
| 1818 | Ga0501076_0758956 | 3300049592 | Bacteria | 800 |
| 1819 | Ga0501077_0272084 | 3300049593 | Unclassified | 1078 |
| 1820 | Ga0501077_0349046 | 3300049593 | Bacteria | 944 |
| 1821 | Ga0501077_0405042 | 3300049593 | Bacteria | 872 |
| 1822 | Ga0501077_0918466 | 3300049593 | Unclassified | 563 |
| 1823 | Ga0501206_104648 | 3300049653 | Bacteria | 517 |
| 1824 | Ga0501214_070599 | 3300049659 | Unclassified | 570 |
| 1825 | Ga0501217_163530 | 3300049661 | Bacteria | 673 |
| 1826 | Ga0501253_132060 | 3300049683 | Bacteria | 615 |
| 1827 | Ga0501260_046275 | 3300049689 | Unclassified | 539 |
| 1828 | Ga0501221_036754 | 3300049704 | Bacteria | 1051 |
| 1829 | Ga0501245_040026 | 3300049708 | Bacteria | 803 |
| 1830 | Ga0501079_0010185 | 3300049741 | Bacteria | 7137 |
| 1831 | Ga0501079_0203861 | 3300049741 | Bacteria | 1545 |
| 1832 | Ga0501079_0227271 | 3300049741 | Bacteria | 1458 |
| 1833 | Ga0501079_0751300 | 3300049741 | Unclassified | 768 |
| 1834 | Ga0501079_1655581 | 3300049741 | Bacteria | 503 |
| 1835 | Ga0501080_0001559 | 3300049742 | Bacteria | 19371 |
| 1836 | Ga0501080_0072319 | 3300049742 | Bacteria | 3208 |
| 1837 | Ga0501080_0077249 | 3300049742 | Bacteria | 3096 |
| 1838 | Ga0501080_0552552 | 3300049742 | Bacteria | 1025 |
| 1839 | Ga0501080_0564702 | 3300049742 | Bacteria | 1013 |
| 1840 | Ga0501080_1305676 | 3300049742 | Bacteria | 621 |
| 1841 | Ga0501081_0070749 | 3300049743 | Bacteria | 2431 |
| 1842 | Ga0501081_0822816 | 3300049743 | Bacteria | 699 |
| 1843 | Ga0501083_0009330 | 3300049744 | Bacteria | 6926 |
| 1844 | Ga0501271_015111 | 3300049768 | Bacteria | 860 |
| 1845 | Ga0501275_011525 | 3300049772 | Bacteria | 961 |
| 1846 | Ga0501275_029791 | 3300049772 | Bacteria | 717 |
| 1847 | Ga0501035_0311358 | 3300049822 | Bacteria | 1325 |
| 1848 | Ga0501035_0561404 | 3300049822 | Bacteria | 934 |
| 1849 | Ga0501035_0706317 | 3300049822 | Bacteria | 813 |
| 1850 | Ga0501044_0235687 | 3300049823 | Bacteria | 1776 |
| 1851 | Ga0501044_1054356 | 3300049823 | Bacteria | 683 |
| 1852 | Ga0501045_0055827 | 3300049824 | Bacteria | 2888 |
| 1853 | Ga0501045_0259140 | 3300049824 | Bacteria | 1294 |
| 1854 | Ga0501212_053227 | 3300049851 | Bacteria | 689 |
| 1855 | nmdc:mga03n38_351972_c1 | 3300050490 | Bacteria | 802 |
| 1856 | nmdc:mga00v17_387579_c1 | 3300050491 | Bacteria | 908 |
| 1857 | nmdc:mga00v17_86460_c1 | 3300050491 | Unclassified | 1965 |
| 1858 | nmdc:mga0yw44_80537_c1 | 3300050492 | Bacteria | 2040 |
| 1859 | nmdc:mga06z11_56682_c1 | 3300050494 | Bacteria | 2027 |
| 1860 | nmdc:mga04h51_315900_c1 | 3300050495 | Bacteria | 639 |
| 1861 | nmdc:mga05p37_1109532_c1 | 3300050507 | Bacteria | 827 |
| 1862 | nmdc:mga05p37_1203841_c1 | 3300050507 | Bacteria | 782 |
| 1863 | nmdc:mga05p37_1224257_c1 | 3300050507 | Unclassified | 773 |
| 1864 | nmdc:mga05p37_1262237_c1 | 3300050507 | Bacteria | 757 |
| 1865 | nmdc:mga05p37_149800_c1 | 3300050507 | Bacteria | 2855 |
| 1866 | nmdc:mga05p37_170716_c1 | 3300050507 | Bacteria | 2652 |
| 1867 | nmdc:mga05p37_1868039_c1 | 3300050507 | Bacteria | 576 |
| 1868 | nmdc:mga05p37_246225_c1 | 3300050507 | Bacteria | 2146 |
| 1869 | nmdc:mga05p37_492557_c1 | 3300050507 | Bacteria | 1409 |
| 1870 | nmdc:mga05p37_4971_c1 | 3300050507 | Bacteria | 15580 |
| 1871 | nmdc:mga05p37_62009_c1 | 3300050507 | Bacteria | 4602 |
| 1872 | nmdc:mga05p37_7365_c1 | 3300050507 | Bacteria | 12978 |
| 1873 | nmdc:mga05p37_761181_c1 | 3300050507 | Bacteria | 1066 |
| 1874 | nmdc:mga05p37_77309_c1 | 3300050507 | Bacteria | 4098 |
| 1875 | nmdc:mga05p37_84532_c1 | 3300050507 | Bacteria | 3910 |
| 1876 | nmdc:mga09592_102699_c1 | 3300050508 | Bacteria | 2449 |
| 1877 | nmdc:mga09592_1162385_c1 | 3300050508 | Bacteria | 639 |
| 1878 | nmdc:mga09592_232348_c1 | 3300050508 | Bacteria | 1598 |
| 1879 | nmdc:mga09592_72196_c1 | 3300050508 | Bacteria | 2931 |
| 1880 | nmdc:mga09592_916500_c1 | 3300050508 | Bacteria | 736 |
| 1881 | nmdc:mga0qj67_127369_c1 | 3300050509 | Bacteria | 2061 |
| 1882 | nmdc:mga0qj67_1408402_c1 | 3300050509 | Bacteria | 538 |
| 1883 | nmdc:mga0qj67_209527_c1 | 3300050509 | Bacteria | 1583 |
| 1884 | nmdc:mga0qj67_226189_c1 | 3300050509 | Bacteria | 1518 |
| 1885 | nmdc:mga0qj67_24466_c1 | 3300050509 | Bacteria | 4655 |
| 1886 | nmdc:mga0qj67_32683_c1 | 3300050509 | Bacteria | 4059 |
| 1887 | nmdc:mga0qj67_362303_c1 | 3300050509 | Bacteria | 1171 |
| 1888 | nmdc:mga0qj67_75256_c1 | 3300050509 | Bacteria | 2699 |
| 1889 | nmdc:mga06r32_1145465_c1 | 3300050510 | Unclassified | 726 |
| 1890 | nmdc:mga06r32_121829_c1 | 3300050510 | Bacteria | 2573 |
| 1891 | nmdc:mga06r32_1437520_c1 | 3300050510 | Bacteria | 631 |
| 1892 | nmdc:mga06r32_1556444_c1 | 3300050510 | Bacteria | 600 |
| 1893 | nmdc:mga06r32_1789960_c1 | 3300050510 | Bacteria | 550 |
| 1894 | nmdc:mga06r32_372967_c1 | 3300050510 | Bacteria | 1410 |
| 1895 | nmdc:mga06r32_466067_c1 | 3300050510 | Bacteria | 1242 |
| 1896 | nmdc:mga08y16_1257543_c1 | 3300050511 | Bacteria | 709 |
| 1897 | nmdc:mga08y16_1262508_c1 | 3300050511 | Bacteria | 707 |
| 1898 | nmdc:mga08y16_1809560_c1 | 3300050511 | Bacteria | 564 |
| 1899 | nmdc:mga08y16_26832_c1 | 3300050511 | Bacteria | 6070 |
| 1900 | nmdc:mga08y16_44850_c1 | 3300050511 | Bacteria | 4634 |
| 1901 | nmdc:mga08y16_54775_c1 | 3300050511 | Bacteria | 4168 |
| 1902 | nmdc:mga08y16_690772_c1 | 3300050511 | Bacteria | 1021 |
| 1903 | nmdc:mga08y16_860011_c1 | 3300050511 | Unclassified | 896 |
| 1904 | nmdc:mga0n895_121245_c1 | 3300050512 | Bacteria | 2636 |
| 1905 | nmdc:mga0n895_1681299_c1 | 3300050512 | Bacteria | 598 |
| 1906 | nmdc:mga0n895_276020_c1 | 3300050512 | Bacteria | 1705 |
| 1907 | nmdc:mga0n895_87414_c1 | 3300050512 | Unclassified | 3115 |
| 1908 | nmdc:mga0rr50_1412660_c1 | 3300050513 | Bacteria | 589 |
| 1909 | nmdc:mga0rr50_295337_c1 | 3300050513 | Bacteria | 1355 |
| 1910 | nmdc:mga0rr50_390262_c1 | 3300050513 | Unclassified | 1175 |
| 1911 | nmdc:mga0rr50_427873_c1 | 3300050513 | Bacteria | 1120 |
| 1912 | nmdc:mga0rr50_522876_c1 | 3300050513 | Bacteria | 1009 |
| 1913 | nmdc:mga0rr50_580693_c1 | 3300050513 | Bacteria | 955 |
| 1914 | nmdc:mga0rr50_610029_c1 | 3300050513 | Unclassified | 931 |
| 1915 | nmdc:mga08x19_225124_c1 | 3300050514 | Bacteria | 1290 |
| 1916 | nmdc:mga08x19_48942_c1 | 3300050514 | Bacteria | 2709 |
| 1917 | nmdc:mga08x19_8549_c1 | 3300050514 | Bacteria | 6100 |
| 1918 | nmdc:mga0a205_1198984_c1 | 3300050515 | Bacteria | 607 |
| 1919 | nmdc:mga0a205_175073_c1 | 3300050515 | Bacteria | 2041 |
| 1920 | nmdc:mga0a205_182072_c1 | 3300050515 | Bacteria | 1995 |
| 1921 | nmdc:mga0a205_198097_c1 | 3300050515 | Bacteria | 1899 |
| 1922 | nmdc:mga0a205_290404_c1 | 3300050515 | Unclassified | 1510 |
| 1923 | nmdc:mga0a205_397506_c1 | 3300050515 | Bacteria | 1242 |
| 1924 | nmdc:mga0a205_5684_c1 | 3300050515 | Bacteria | 11235 |
| 1925 | nmdc:mga0a205_77948_c1 | 3300050515 | Bacteria | 3201 |
| 1926 | Ga0495601_0070860 | 3300053077 | Bacteria | 2225 |
| 1927 | Ga0495601_0338962 | 3300053077 | Bacteria | 978 |
| 1928 | Ga0495655_0221643 | 3300053083 | Unclassified | 626 |
| 1929 | Ga0495595_0002879 | 3300053084 | Bacteria | 6785 |
| 1930 | Ga0495595_0016698 | 3300053084 | Bacteria | 3146 |
| 1931 | Ga0495595_0085481 | 3300053084 | Bacteria | 1508 |
| 1932 | Ga0495619_0004699 | 3300053085 | Bacteria | 8701 |
| 1933 | Ga0495619_0005606 | 3300053085 | Bacteria | 7964 |
| 1934 | Ga0495619_0007224 | 3300053085 | Bacteria | 7038 |
| 1935 | Ga0495619_0054756 | 3300053085 | Bacteria | 2641 |
| 1936 | Ga0495619_0293361 | 3300053085 | Bacteria | 1127 |
| 1937 | Ga0501084_0051144 | 3300054114 | Bacteria | 3458 |
| 1938 | Ga0501084_0141913 | 3300054114 | Bacteria | 2023 |
| 1939 | Ga0501084_0169019 | 3300054114 | Bacteria | 1846 |
| 1940 | Ga0501084_0409516 | 3300054114 | Bacteria | 1146 |
| 1941 | Ga0501084_1346918 | 3300054114 | Unclassified | 598 |
| 1942 | Ga0590075_045881 | 3300059424 | Unclassified | 1119 |
| 1943 | Ga0590077_035030 | 3300059426 | Unclassified | 1105 |
| 1944 | Ga0587084_040057 | 3300059477 | Bacteria | 792 |
| 1945 | Ga0587084_051071 | 3300059477 | Bacteria | 732 |
| 1946 | Ga0587084_102593 | 3300059477 | Unclassified | 582 |
| 1947 | Ga0587084_138049 | 3300059477 | Unclassified | 526 |
| 1948 | Ga0587066_108855 | 3300059490 | Bacteria | 640 |
| 1949 | Ga0587066_217442 | 3300059490 | Bacteria | 511 |
| 1950 | Ga0587070_101082 | 3300059491 | Bacteria | 663 |
| 1951 | Ga0587070_214108 | 3300059491 | Unclassified | 519 |
| 1952 | Ga0587073_0203116 | 3300059492 | Bacteria | 595 |
| 1953 | Ga0587073_0292096 | 3300059492 | Bacteria | 527 |
| 1954 | Ga0587077_095102 | 3300059493 | Bacteria | 707 |
| 1955 | Ga0587077_212906 | 3300059493 | Unclassified | 541 |
| 1956 | Ga0587080_061336 | 3300059503 | Bacteria | 733 |
| 1957 | Ga0587080_101725 | 3300059503 | Bacteria | 616 |
| 1958 | Ga0587080_141572 | 3300059503 | Bacteria | 550 |
| 1959 | Ga0587080_146095 | 3300059503 | Bacteria | 544 |
| 1960 | Ga0587082_161433 | 3300059504 | Bacteria | 537 |
| 1961 | Ga0587085_074572 | 3300059506 | Bacteria | 671 |
| 1962 | Ga0587085_172658 | 3300059506 | Bacteria | 513 |
| 1963 | Ga0587088_151909 | 3300059508 | Unclassified | 561 |
| 1964 | Ga0587090_009608 | 3300059510 | Bacteria | 1324 |
| 1965 | Ga0587090_119262 | 3300059510 | Unclassified | 571 |
| 1966 | Ga0587091_048029 | 3300059511 | Unclassified | 867 |
| 1967 | Ga0587091_067568 | 3300059511 | Bacteria | 774 |
| 1968 | Ga0587091_079722 | 3300059511 | Bacteria | 732 |
| 1969 | Ga0587092_146162 | 3300059512 | Bacteria | 525 |
| 1970 | Ga0587092_160686 | 3300059512 | Bacteria | 508 |
| 1971 | Ga0587094_117740 | 3300059513 | Bacteria | 529 |
| 1972 | Ga0587106_053879 | 3300059605 | Unclassified | 721 |
| 1973 | Ga0587106_083455 | 3300059605 | Bacteria | 626 |
| 1974 | Ga0587125_039416 | 3300059607 | Bacteria | 633 |
| 1975 | Ga0587101_153969 | 3300059623 | Unclassified | 500 |
| 1976 | Ga0587109_213982 | 3300059624 | Bacteria | 508 |
| 1977 | Ga0587113_031987 | 3300059625 | Bacteria | 600 |
| 1978 | Ga0587115_048274 | 3300059626 | Unclassified | 685 |
| 1979 | Ga0587115_077529 | 3300059626 | Bacteria | 584 |
| 1980 | Ga0587128_077829 | 3300059630 | Bacteria | 658 |
| 1981 | Ga0587128_101224 | 3300059630 | Bacteria | 604 |
| 1982 | Ga0587130_025002 | 3300059631 | Unclassified | 665 |
| 1983 | Ga0587067_023074 | 3300059640 | Bacteria | 1088 |
| 1984 | Ga0587067_065792 | 3300059640 | Bacteria | 771 |
| 1985 | Ga0587067_099799 | 3300059640 | Bacteria | 670 |
| 1986 | Ga0587067_112104 | 3300059640 | Unclassified | 645 |
| 1987 | Ga0587068_113559 | 3300059641 | Bacteria | 581 |
| 1988 | Ga0587072_203833 | 3300059643 | Unclassified | 504 |
| 1989 | Ga0587072_207240 | 3300059643 | Bacteria | 501 |
| 1990 | Ga0587075_133276 | 3300059644 | Bacteria | 525 |
| 1991 | Ga0587076_137506 | 3300059645 | Bacteria | 581 |
| 1992 | Ga0587076_198366 | 3300059645 | Bacteria | 515 |
| 1993 | Ga0587078_045332 | 3300059646 | Bacteria | 632 |
| 1994 | Ga0587078_066884 | 3300059646 | Bacteria | 554 |
| 1995 | Ga0587078_074998 | 3300059646 | Bacteria | 534 |
| 1996 | Ga0587079_114906 | 3300059647 | Bacteria | 659 |
| 1997 | Ga0587079_169053 | 3300059647 | Bacteria | 577 |
| 1998 | Ga0587079_189891 | 3300059647 | Bacteria | 555 |
| 1999 | Ga0587079_221776 | 3300059647 | Bacteria | 526 |
| 2000 | Ga0587102_013673 | 3300059649 | Bacteria | 843 |
| 2001 | Ga0587102_053307 | 3300059649 | Bacteria | 549 |
| 2002 | Ga0587104_024947 | 3300059650 | Bacteria | 515 |
| 2003 | Ga0587107_098060 | 3300059652 | Bacteria | 576 |
| 2004 | Ga0587114_055041 | 3300059655 | Bacteria | 684 |
| 2005 | Ga0587114_076241 | 3300059655 | Bacteria | 616 |
| 2006 | Ga0587114_120275 | 3300059655 | Bacteria | 531 |
| 2007 | Ga0587119_084909 | 3300059658 | Bacteria | 521 |
| 2008 | Ga0587119_086624 | 3300059658 | Bacteria | 517 |
| 2009 | Ga0587071_046783 | 3300060344 | Bacteria | 884 |
| 2010 | Ga0587071_115430 | 3300060344 | Unclassified | 636 |
| 2011 | Ga0501082_0329920 | 3300060353 | Bacteria | 1329 |
| 2012 | Ga0501082_0639635 | 3300060353 | Bacteria | 931 |
| 2013 | Ga0501082_0806157 | 3300060353 | Bacteria | 821 |
| 2014 | Ga0501082_0996221 | 3300060353 | Bacteria | 733 |
| 2015 | Ga0501082_1038173 | 3300060353 | Bacteria | 717 |
| 2016 | Ga0466962_0011514 | 3300061719 | Bacteria | 4259 |
| 2017 | Ga0466962_0084132 | 3300061719 | Bacteria | 1522 |
| 2018 | Ga0466962_0109045 | 3300061719 | Unclassified | 1332 |
| 2019 | Ga0466962_0185163 | 3300061719 | Unclassified | 1015 |
| 2020 | Ga0466962_0246087 | 3300061719 | Bacteria | 878 |
| 2021 | Ga0466962_0487076 | 3300061719 | Bacteria | 623 |
| 2022 | Ga0530510_0035924 | 3300061734 | Bacteria | 3572 |
| 2023 | Ga0530510_0612454 | 3300061734 | Bacteria | 828 |
| 2024 | Ga0530510_0710199 | 3300061734 | Bacteria | 766 |
| 2025 | Ga0530510_0844244 | 3300061734 | Bacteria | 699 |
| 2026 | JGI24746J21847_1025569 | |||
| 2027 | ARcpr5oldR_c027731 | |||
| 2028 | CNBas_1006135 | |||
| 2029 | LJQas_1020834 | |||
| 2030 | JGI24743J22301_10071213 | |||
| 2031 | JGI24750J21931_1051334 | |||
| 2032 | JGI24749J21850_1020376 | |||
| 2033 | JGI24744J21845_10000270 | |||
| 2034 | JGI24034J26672_10095216 | |||
| 2035 | JGI24742J22300_10090598 | |||
| 2036 | JGI24751J29686_10093803 | |||
| 2037 | JGI25407J50210_10000043 | |||
| 2038 | JGI25407J50210_10003008 | |||
| 2039 | JGI25407J50210_10006055 | |||
| 2040 | JGI25407J50210_10021102 | |||
| 2041 | JGI25407J50210_10022167 | |||
| 2042 | JGI25407J50210_10046390 | |||
| 2043 | JGI25407J50210_10127885 | |||
| 2044 | JGI25407J50210_10130891 | |||
| 2045 | JGI25407J50210_10168277 | |||
| 2046 | Ga0058863_10044069 | |||
| 2047 | Ga0058863_11737441 | |||
| 2048 | Ga0058863_11784839 | |||
| 2049 | Ga0058861_10053199 | |||
| 2050 | Ga0058861_11902183 | |||
| 2051 | Ga0058861_11963800 | |||
| 2052 | Ga0058861_11993075 | |||
| 2053 | Ga0058861_12004511 | |||
| 2054 | Ga0058860_12242813 | |||
| 2055 | Ga0058862_10018425 | |||
| 2056 | Ga0058862_12721611 | |||
| 2057 | Ga0058862_12775560 | |||
| 2058 | Ga0070658_10054807 | |||
| 2059 | Ga0070658_10095618 | |||
| 2060 | Ga0070658_10202218 | |||
| 2061 | Ga0070658_10252336 | |||
| 2062 | Ga0070658_10672640 | |||
| 2063 | Ga0070676_10191228 | |||
| 2064 | Ga0070676_10389742 | |||
| 2065 | Ga0070676_10558129 | |||
| 2066 | Ga0070683_100003875 | |||
| 2067 | Ga0070683_100004942 | |||
| 2068 | Ga0070683_100015367 | |||
| 2069 | Ga0070683_100015562 | |||
| 2070 | Ga0070683_100025417 | |||
| 2071 | Ga0070683_100032284 | |||
| 2072 | Ga0070683_100077333 | |||
| 2073 | Ga0070683_100124300 | |||
| 2074 | Ga0070683_100291562 | |||
| 2075 | Ga0070683_100411015 | |||
| 2076 | Ga0070683_100634372 | |||
| 2077 | Ga0070683_101046941 | |||
| 2078 | Ga0070670_100100103 | |||
| 2079 | Ga0068869_100116112 | |||
| 2080 | Ga0068869_100348491 | |||
| 2081 | Ga0068869_100482914 | |||
| 2082 | Ga0068869_101072642 | |||
| 2083 | Ga0068869_101131859 | |||
| 2084 | Ga0070680_100003134 | |||
| 2085 | Ga0070680_100003591 | |||
| 2086 | Ga0070680_100016764 | |||
| 2087 | Ga0070680_100018725 | |||
| 2088 | Ga0070680_100237959 | |||
| 2089 | Ga0070680_100363144 | |||
| 2090 | Ga0070682_100007166 | |||
| 2091 | Ga0070682_100014648 | |||
| 2092 | Ga0070682_100093804 | |||
| 2093 | Ga0070682_100605447 | |||
| 2094 | Ga0070682_100832095 | |||
| 2095 | Ga0068868_100029713 | |||
| 2096 | Ga0068868_100472709 | |||
| 2097 | Ga0068868_100719330 | |||
| 2098 | Ga0070660_100001983 | |||
| 2099 | Ga0070660_100014687 | |||
| 2100 | Ga0070660_100018912 | |||
| 2101 | Ga0070660_100020348 | |||
| 2102 | Ga0070660_100143962 | |||
| 2103 | Ga0070660_100152947 | |||
| 2104 | Ga0070660_100638019 | |||
| 2105 | Ga0070689_100012172 | |||
| 2106 | Ga0070689_100084769 | |||
| 2107 | Ga0070691_10013505 | |||
| 2108 | Ga0070691_10035242 | |||
| 2109 | Ga0070691_10170363 | |||
| 2110 | Ga0070687_100629844 | |||
| 2111 | Ga0070687_100715936 | |||
| 2112 | Ga0070661_100004275 | |||
| 2113 | Ga0070661_100059829 | |||
| 2114 | Ga0070661_100495188 | |||
| 2115 | Ga0070661_100577518 | |||
| 2116 | Ga0070661_100593087 | |||
| 2117 | Ga0070661_100896747 | |||
| 2118 | Ga0070692_10295024 | |||
| 2119 | Ga0070692_10314616 | |||
| 2120 | Ga0070692_10582475 | |||
| 2121 | Ga0070668_100009147 | |||
| 2122 | Ga0070668_100053183 | |||
| 2123 | Ga0070668_100469842 | |||
| 2124 | Ga0070668_100799891 | |||
| 2125 | Ga0070675_100020633 | |||
| 2126 | Ga0070675_100876949 | |||
| 2127 | Ga0070671_100029788 | |||
| 2128 | Ga0070671_100349998 | |||
| 2129 | Ga0070674_100005639 | |||
| 2130 | Ga0070674_100050682 | |||
| 2131 | Ga0070673_100044430 | |||
| 2132 | Ga0070673_100069317 | |||
| 2133 | Ga0070673_100614903 | |||
| 2134 | Ga0070688_100016002 | |||
| 2135 | Ga0070688_100131972 | |||
| 2136 | Ga0070688_100648451 | |||
| 2137 | Ga0070659_100059318 | |||
| 2138 | Ga0070659_100064034 | |||
| 2139 | Ga0070659_100089872 | |||
| 2140 | Ga0070659_100232868 | |||
| 2141 | Ga0070659_100341947 | |||
| 2142 | Ga0070659_100438748 | |||
| 2143 | Ga0070659_100561683 | |||
| 2144 | Ga0070659_100631050 | |||
| 2145 | Ga0070667_100009082 | |||
| 2146 | Ga0070703_10018550 | |||
| 2147 | Ga0070703_10020258 | |||
| 2148 | Ga0070703_10034127 | |||
| 2149 | Ga0070703_10085263 | |||
| 2150 | Ga0070703_10238877 | |||
| 2151 | Ga0070709_10015555 | |||
| 2152 | Ga0070709_10053684 | |||
| 2153 | Ga0070709_10177399 | |||
| 2154 | Ga0070709_10577651 | |||
| 2155 | Ga0070709_10595674 | |||
| 2156 | Ga0070714_100002694 | |||
| 2157 | Ga0070714_100013536 | |||
| 2158 | Ga0070714_100020417 | |||
| 2159 | Ga0070714_100026064 | |||
| 2160 | Ga0070714_100065451 | |||
| 2161 | Ga0070714_100074062 | |||
| 2162 | Ga0070714_100221880 | |||
| 2163 | Ga0070714_100355538 | |||
| 2164 | Ga0070714_100390529 | |||
| 2165 | Ga0070714_100679528 | |||
| 2166 | Ga0070714_100865879 | |||
| 2167 | Ga0070714_101877387 | |||
| 2168 | Ga0070713_100005694 | |||
| 2169 | Ga0070713_100193807 | |||
| 2170 | Ga0070713_100274991 | |||
| 2171 | Ga0070713_100464891 | |||
| 2172 | Ga0070713_100493504 | |||
| 2173 | Ga0070713_101132422 | |||
| 2174 | Ga0070713_102352094 | |||
| 2175 | Ga0070710_10003097 | |||
| 2176 | Ga0070710_10011088 | |||
| 2177 | Ga0070710_10031029 | |||
| 2178 | Ga0070710_10045000 | |||
| 2179 | Ga0070710_11012383 | |||
| 2180 | Ga0070710_11442429 | |||
| 2181 | Ga0070710_11442770 | |||
| 2182 | Ga0070701_10011918 | |||
| 2183 | Ga0070701_10032032 | |||
| 2184 | Ga0070701_10039684 | |||
| 2185 | Ga0070711_100006000 | |||
| 2186 | Ga0070711_100020967 | |||
| 2187 | Ga0070711_100060127 | |||
| 2188 | Ga0070711_100109928 | |||
| 2189 | Ga0070711_100167465 | |||
| 2190 | Ga0070711_100231071 | |||
| 2191 | Ga0070711_100495444 | |||
| 2192 | Ga0070711_100741187 | |||
| 2193 | Ga0070705_100006630 | |||
| 2194 | Ga0070705_100099872 | |||
| 2195 | Ga0070705_101384348 | |||
| 2196 | Ga0070700_100004550 | |||
| 2197 | Ga0070700_100008039 | |||
| 2198 | Ga0070700_100143935 | |||
| 2199 | Ga0070700_100218527 | |||
| 2200 | Ga0070700_100428767 | |||
| 2201 | Ga0070700_101720119 | |||
| 2202 | Ga0070694_100078212 | |||
| 2203 | Ga0070694_100093263 | |||
| 2204 | Ga0070694_100097550 | |||
| 2205 | Ga0070694_100163564 | |||
| 2206 | Ga0070694_100292928 | |||
| 2207 | Ga0070694_100403141 | |||
| 2208 | Ga0070694_100506252 | |||
| 2209 | Ga0070694_100789431 | |||
| 2210 | Ga0070708_100015786 | |||
| 2211 | Ga0070708_100200605 | |||
| 2212 | Ga0070708_100380528 | |||
| 2213 | Ga0070708_100455620 | |||
| 2214 | Ga0070708_100498394 | |||
| 2215 | Ga0070708_101020057 | |||
| 2216 | Ga0070663_100008031 | |||
| 2217 | Ga0070663_100501777 | |||
| 2218 | Ga0070678_100026628 | |||
| 2219 | Ga0070678_100064976 | |||
| 2220 | Ga0070678_100368470 | |||
| 2221 | Ga0070678_100517760 | |||
| 2222 | Ga0070678_100978404 | |||
| 2223 | Ga0070662_100016960 | |||
| 2224 | Ga0070662_100065436 | |||
| 2225 | Ga0070662_100164627 | |||
| 2226 | Ga0070662_100432141 | |||
| 2227 | Ga0070681_10005686 | |||
| 2228 | Ga0070681_10007190 | |||
| 2229 | Ga0070681_10026484 | |||
| 2230 | Ga0070681_10059689 | |||
| 2231 | Ga0070681_10090820 | |||
| 2232 | Ga0070681_10102077 | |||
| 2233 | Ga0070681_10175042 | |||
| 2234 | Ga0068867_100006973 | |||
| 2235 | Ga0068867_100033254 | |||
| 2236 | Ga0068867_100073840 | |||
| 2237 | Ga0070685_10000816 | |||
| 2238 | Ga0070685_10535385 | |||
| 2239 | Ga0070685_10768751 | |||
| 2240 | Ga0070706_100020865 | |||
| 2241 | Ga0070706_100039379 | |||
| 2242 | Ga0070706_100044894 | |||
| 2243 | Ga0070706_100477554 | |||
| 2244 | Ga0070706_100556298 | |||
| 2245 | Ga0070707_100000949 | |||
| 2246 | Ga0070707_100008460 | |||
| 2247 | Ga0070707_100030747 | |||
| 2248 | Ga0070707_100175479 | |||
| 2249 | Ga0070707_100570562 | |||
| 2250 | Ga0070707_100732611 | |||
| 2251 | Ga0070707_101137811 | |||
| 2252 | Ga0070698_100104407 | |||
| 2253 | Ga0070698_100129651 | |||
| 2254 | Ga0070698_100145113 | |||
| 2255 | Ga0070698_100175800 | |||
| 2256 | Ga0070698_100229696 | |||
| 2257 | Ga0070698_100319812 | |||
| 2258 | Ga0070698_100455753 | |||
| 2259 | Ga0070699_100033241 | |||
| 2260 | Ga0070699_100104436 | |||
| 2261 | Ga0070699_100336076 | |||
| 2262 | Ga0070699_100620979 | |||
| 2263 | Ga0070699_100688635 | |||
| 2264 | Ga0070699_101571820 | |||
| 2265 | Ga0070679_100003327 | |||
| 2266 | Ga0070679_100034667 | |||
| 2267 | Ga0070679_100036280 | |||
| 2268 | Ga0070679_100096267 | |||
| 2269 | Ga0070679_100119568 | |||
| 2270 | Ga0070679_100137031 | |||
| 2271 | Ga0070679_100162691 | |||
| 2272 | Ga0070679_100171898 | |||
| 2273 | Ga0070679_100296057 | |||
| 2274 | Ga0070679_100366707 | |||
| 2275 | Ga0070679_100515577 | |||
| 2276 | Ga0070679_100551128 | |||
| 2277 | Ga0070684_100007962 | |||
| 2278 | Ga0070684_100013215 | |||
| 2279 | Ga0070684_100014125 | |||
| 2280 | Ga0070684_100014774 | |||
| 2281 | Ga0070684_100023477 | |||
| 2282 | Ga0070684_100040341 | |||
| 2283 | Ga0070684_100102459 | |||
| 2284 | Ga0070684_100198141 | |||
| 2285 | Ga0070684_100300933 | |||
| 2286 | Ga0070684_100767353 | |||
| 2287 | Ga0070684_101010462 | |||
| 2288 | Ga0070697_100075441 | |||
| 2289 | Ga0070697_100105678 | |||
| 2290 | Ga0070697_100438398 | |||
| 2291 | Ga0070697_100958980 | |||
| 2292 | Ga0070697_101262820 | |||
| 2293 | Ga0068853_100261655 | |||
| 2294 | Ga0070672_100049761 | |||
| 2295 | Ga0070672_100419912 | |||
| 2296 | Ga0070686_100004382 | |||
| 2297 | Ga0070686_100053104 | |||
| 2298 | Ga0070686_100132245 | |||
| 2299 | Ga0070695_100018875 | |||
| 2300 | Ga0070695_100197479 | |||
| 2301 | Ga0070695_100883184 | |||
| 2302 | Ga0070696_100026892 | |||
| 2303 | Ga0070696_100048064 | |||
| 2304 | Ga0070696_100062253 | |||
| 2305 | Ga0070696_100071072 | |||
| 2306 | Ga0070696_100290075 | |||
| 2307 | Ga0070693_100091560 | |||
| 2308 | Ga0070693_100182878 | |||
| 2309 | Ga0070693_100205863 | |||
| 2310 | Ga0070693_100306115 | |||
| 2311 | Ga0070693_100733012 | |||
| 2312 | Ga0070693_100865643 | |||
| 2313 | Ga0070693_101151193 | |||
| 2314 | Ga0070693_101566402 | |||
| 2315 | Ga0070665_100041443 | |||
| 2316 | Ga0070665_100802888 | |||
| 2317 | Ga0070704_100030154 | |||
| 2318 | Ga0070704_100070736 | |||
| 2319 | Ga0070704_100273762 | |||
| 2320 | Ga0070704_100304591 | |||
| 2321 | Ga0070704_100412772 | |||
| 2322 | Ga0070704_100618445 | |||
| 2323 | Ga0070704_100985148 | |||
| 2324 | Ga0070704_101886147 | |||
| 2325 | Ga0070704_102280652 | |||
| 2326 | Ga0070704_102289475 | |||
| 2327 | Ga0068855_100007343 | |||
| 2328 | Ga0068855_100052133 | |||
| 2329 | Ga0068855_100100393 | |||
| 2330 | Ga0068855_100119357 | |||
| 2331 | Ga0068855_100192027 | |||
| 2332 | Ga0068855_100233615 | |||
| 2333 | Ga0068855_100643935 | |||
| 2334 | Ga0068855_102063349 | |||
| 2335 | Ga0070664_100259034 | |||
| 2336 | Ga0070664_100287489 | |||
| 2337 | Ga0070664_100464054 | |||
| 2338 | Ga0070664_100982632 | |||
| 2339 | Ga0068857_100011204 | |||
| 2340 | Ga0068857_100024729 | |||
| 2341 | Ga0068857_100177906 | |||
| 2342 | Ga0068857_100463588 | |||
| 2343 | Ga0068857_101787033 | |||
| 2344 | Ga0068854_100053511 | |||
| 2345 | Ga0068854_100056126 | |||
| 2346 | Ga0068854_100065930 | |||
| 2347 | Ga0068854_100398173 | |||
| 2348 | Ga0068854_100823579 | |||
| 2349 | Ga0068854_100990318 | |||
| 2350 | Ga0068854_102239201 | |||
| 2351 | Ga0068856_100014707 | |||
| 2352 | Ga0068856_100129320 | |||
| 2353 | Ga0068856_100135206 | |||
| 2354 | Ga0068856_100151195 | |||
| 2355 | Ga0068856_100153638 | |||
| 2356 | Ga0068856_100168305 | |||
| 2357 | Ga0068856_100177636 | |||
| 2358 | Ga0068856_100196994 | |||
| 2359 | Ga0068856_100352124 | |||
| 2360 | Ga0068856_100358074 | |||
| 2361 | Ga0068856_101273049 | |||
| 2362 | Ga0070702_100010172 | |||
| 2363 | Ga0070702_100022444 | |||
| 2364 | Ga0070702_100044741 | |||
| 2365 | Ga0070702_100220914 | |||
| 2366 | Ga0070702_100275950 | |||
| 2367 | Ga0070702_100500890 | |||
| 2368 | Ga0068852_100005023 | |||
| 2369 | Ga0068852_100046589 | |||
| 2370 | Ga0068852_100138618 | |||
| 2371 | Ga0068852_100476381 | |||
| 2372 | Ga0068852_100550581 | |||
| 2373 | Ga0068859_100084191 | |||
| 2374 | Ga0068864_102111545 | |||
| 2375 | Ga0068866_10006032 | |||
| 2376 | Ga0068866_10515562 | |||
| 2377 | Ga0068866_10535513 | |||
| 2378 | Ga0068861_100013642 | |||
| 2379 | Ga0068861_100038498 | |||
| 2380 | Ga0068861_100052992 | |||
| 2381 | Ga0068861_100731155 | |||
| 2382 | Ga0068861_101046354 | |||
| 2383 | Ga0068851_10387756 | |||
| 2384 | Ga0068851_10664548 | |||
| 2385 | Ga0068870_10224842 | |||
| 2386 | Ga0068863_100552428 | |||
| 2387 | Ga0068858_100140136 | |||
| 2388 | Ga0068858_100217577 | |||
| 2389 | Ga0068858_101191089 | |||
| 2390 | Ga0068860_100040839 | |||
| 2391 | Ga0068860_101081608 | |||
| 2392 | Ga0068862_100098128 | |||
| 2393 | Ga0068862_100120115 | |||
| 2394 | Ga0068862_100162103 | |||
| 2395 | Ga0068862_100232551 | |||
| 2396 | Ga0068862_100858410 | |||
| 2397 | Ga0081455_10008363 | |||
| 2398 | Ga0081455_10013810 | |||
| 2399 | Ga0081455_10016696 | |||
| 2400 | Ga0081455_10038483 | |||
| 2401 | Ga0081455_10126415 | |||
| 2402 | Ga0081455_10763569 | |||
| 2403 | Ga0081538_10000013 | |||
| 2404 | Ga0081538_10000169 | |||
| 2405 | Ga0081538_10000312 | |||
| 2406 | Ga0081538_10001407 | |||
| 2407 | Ga0081538_10004036 | |||
| 2408 | Ga0081538_10004074 | |||
| 2409 | Ga0081538_10004165 | |||
| 2410 | Ga0081538_10006358 | |||
| 2411 | Ga0081538_10007118 | |||
| 2412 | Ga0081538_10008139 | |||
| 2413 | Ga0081538_10014186 | |||
| 2414 | Ga0081538_10017335 | |||
| 2415 | Ga0081538_10042595 | |||
| 2416 | Ga0081538_10071028 | |||
| 2417 | Ga0081538_10088805 | |||
| 2418 | Ga0081538_10104794 | |||
| 2419 | Ga0081538_10173571 | |||
| 2420 | Ga0081538_10193139 | |||
| 2421 | Ga0081538_10287189 | |||
| 2422 | Ga0081538_10314539 | |||
| 2423 | Ga0081540_1227848 | |||
| 2424 | Ga0081539_10022410 | |||
| 2425 | Ga0081539_10091737 | |||
| 2426 | Ga0081539_10472253 | |||
| 2427 | Ga0070717_10017003 | |||
| 2428 | Ga0070717_10040364 | |||
| 2429 | Ga0070717_10066037 | |||
| 2430 | Ga0070717_10203330 | |||
| 2431 | Ga0070717_10341336 | |||
| 2432 | Ga0070717_10573589 | |||
| 2433 | Ga0070717_10639376 | |||
| 2434 | Ga0070717_10729318 | |||
| 2435 | Ga0075365_10073645 | |||
| 2436 | Ga0075365_10081253 | |||
| 2437 | Ga0075365_10122219 | |||
| 2438 | Ga0075363_100295244 | |||
| 2439 | Ga0075364_10015582 | |||
| 2440 | Ga0075364_10539183 | |||
| 2441 | Ga0075364_10639124 | |||
| 2442 | Ga0075364_10782450 | |||
| 2443 | Ga0075432_10073896 | |||
| 2444 | Ga0075432_10121650 | |||
| 2445 | Ga0070715_10026026 | |||
| 2446 | Ga0070715_10076256 | |||
| 2447 | Ga0070716_100116344 | |||
| 2448 | Ga0070716_100145445 | |||
| 2449 | Ga0070716_100283281 | |||
| 2450 | Ga0070716_100375141 | |||
| 2451 | Ga0070716_100841602 | |||
| 2452 | Ga0070712_100004431 | |||
| 2453 | Ga0070712_100022316 | |||
| 2454 | Ga0070712_100157763 | |||
| 2455 | Ga0070712_100344709 | |||
| 2456 | Ga0070712_100677103 | |||
| 2457 | Ga0070712_100889047 | |||
| 2458 | Ga0070712_101230233 | |||
| 2459 | Ga0070712_101439411 | |||
| 2460 | Ga0075362_10035978 | |||
| 2461 | Ga0075367_10329957 | |||
| 2462 | Ga0075367_10640213 | |||
| 2463 | Ga0075427_10019431 | |||
| 2464 | Ga0075427_10047472 | |||
| 2465 | Ga0097621_100005052 | |||
| 2466 | Ga0068871_100207804 | |||
| 2467 | Ga0068871_100617894 | |||
| 2468 | Ga0068871_100981847 | |||
| 2469 | Ga0075428_100013903 | |||
| 2470 | Ga0075428_100029675 | |||
| 2471 | Ga0075428_100116229 | |||
| 2472 | Ga0075428_100147536 | |||
| 2473 | Ga0075428_100251524 | |||
| 2474 | Ga0075428_100281357 | |||
| 2475 | Ga0075428_100330067 | |||
| 2476 | Ga0075428_100924775 | |||
| 2477 | Ga0075430_100024546 | |||
| 2478 | Ga0075430_100029281 | |||
| 2479 | Ga0075430_100082786 | |||
| 2480 | Ga0075430_100379413 | |||
| 2481 | Ga0075431_100042220 | |||
| 2482 | Ga0075431_100149921 | |||
| 2483 | Ga0075431_100309849 | |||
| 2484 | Ga0075431_100319133 | |||
| 2485 | Ga0075431_100421210 | |||
| 2486 | Ga0075431_100469761 | |||
| 2487 | Ga0075431_101087123 | |||
| 2488 | Ga0075433_10000416 | |||
| 2489 | Ga0075433_10018210 | |||
| 2490 | Ga0075433_10039332 | |||
| 2491 | Ga0075433_10068696 | |||
| 2492 | Ga0075433_10385585 | |||
| 2493 | Ga0075434_100036046 | |||
| 2494 | Ga0075434_100261264 | |||
| 2495 | Ga0075434_100501291 | |||
| 2496 | Ga0075434_101055760 | |||
| 2497 | Ga0075429_100030504 | |||
| 2498 | Ga0075429_100111063 | |||
| 2499 | Ga0075429_100607664 | |||
| 2500 | Ga0075429_100687375 | |||
| 2501 | Ga0075429_101140949 | |||
| 2502 | Ga0068865_100001717 | |||
| 2503 | Ga0068865_100108711 | |||
| 2504 | Ga0068865_101159881 | |||
| 2505 | Ga0075436_100016298 | |||
| 2506 | Ga0075436_100167361 | |||
| 2507 | Ga0075436_100334850 | |||
| 2508 | Ga0097620_100084191 | |||
| 2509 | Ga0075435_100001405 | |||
| 2510 | Ga0075435_100009412 | |||
| 2511 | Ga0075435_100010822 | |||
| 2512 | Ga0075435_100448879 | |||
| 2513 | Ga0075435_100806314 | |||
| 2514 | Ga0075435_100917241 | |||
| 2515 | Ga0099795_10176161 | |||
| 2516 | Ga0105251_10617811 | |||
| 2517 | Ga0105240_10103290 | |||
| 2518 | Ga0105240_10408271 | |||
| 2519 | Ga0105240_10614585 | |||
| 2520 | Ga0111539_10002945 | |||
| 2521 | Ga0111539_10009364 | |||
| 2522 | Ga0111539_10025490 | |||
| 2523 | Ga0111539_10066276 | |||
| 2524 | Ga0111539_10164231 | |||
| 2525 | Ga0111539_10182094 | |||
| 2526 | Ga0111539_10590617 | |||
| 2527 | Ga0111539_10794970 | |||
| 2528 | Ga0111539_11233969 | |||
| 2529 | Ga0111539_12212767 | |||
| 2530 | Ga0105245_10014118 | |||
| 2531 | Ga0105245_10047377 | |||
| 2532 | Ga0105245_10059580 | |||
| 2533 | Ga0105245_10120510 | |||
| 2534 | Ga0105245_10197889 | |||
| 2535 | Ga0105245_10456300 | |||
| 2536 | Ga0105245_11188105 | |||
| 2537 | Ga0105247_10015844 | |||
| 2538 | Ga0114129_10009215 | |||
| 2539 | Ga0114129_10024585 | |||
| 2540 | Ga0114129_10029269 | |||
| 2541 | Ga0114129_10054396 | |||
| 2542 | Ga0114129_10067941 | |||
| 2543 | Ga0114129_10174092 | |||
| 2544 | Ga0114129_10249592 | |||
| 2545 | Ga0114129_10265403 | |||
| 2546 | Ga0114129_10380756 | |||
| 2547 | Ga0114129_10522575 | |||
| 2548 | Ga0114129_10527363 | |||
| 2549 | Ga0114129_10758499 | |||
| 2550 | Ga0114129_11274256 | |||
| 2551 | Ga0114129_11766163 | |||
| 2552 | Ga0114129_12237483 | |||
| 2553 | Ga0114129_12259333 | |||
| 2554 | Ga0114129_13266333 | |||
| 2555 | Ga0105243_10037406 | |||
| 2556 | Ga0105243_10046688 | |||
| 2557 | Ga0105243_10083356 | |||
| 2558 | Ga0105243_10222749 | |||
| 2559 | Ga0105243_10414183 | |||
| 2560 | Ga0105243_10436640 | |||
| 2561 | Ga0105243_10464884 | |||
| 2562 | Ga0105243_11939858 | |||
| 2563 | Ga0105243_12148119 | |||
| 2564 | Ga0105241_10061345 | |||
| 2565 | Ga0105241_10097285 | |||
| 2566 | Ga0105241_10136441 | |||
| 2567 | Ga0105241_10287849 | |||
| 2568 | Ga0105242_10011104 | |||
| 2569 | Ga0105242_10064630 | |||
| 2570 | Ga0105242_10188035 | |||
| 2571 | Ga0105242_11397771 | |||
| 2572 | Ga0105248_10022371 | |||
| 2573 | Ga0105248_10052205 | |||
| 2574 | Ga0105248_12122382 | |||
| 2575 | Ga0105237_10010287 | |||
| 2576 | Ga0105237_10190688 | |||
| 2577 | Ga0105237_10268387 | |||
| 2578 | Ga0105237_11124701 | |||
| 2579 | Ga0105237_12226953 | |||
| 2580 | Ga0105238_10047776 | |||
| 2581 | Ga0105238_10077304 | |||
| 2582 | Ga0105238_10193214 | |||
| 2583 | Ga0105238_10552988 | |||
| 2584 | Ga0105238_10839901 | |||
| 2585 | Ga0105238_10945985 | |||
| 2586 | Ga0105238_12348458 | |||
| 2587 | Ga0105249_10003715 | |||
| 2588 | Ga0105249_10007144 | |||
| 2589 | Ga0105249_10131571 | |||
| 2590 | Ga0105249_10157599 | |||
| 2591 | Ga0105249_10867900 | |||
| 2592 | Ga0105249_10943147 | |||
| 2593 | Ga0105249_11924096 | |||
| 2594 | Ga0105147_103172 | |||
| 2595 | Ga0105239_10034604 | |||
| 2596 | Ga0105239_10112615 | |||
| 2597 | Ga0105239_10114295 | |||
| 2598 | Ga0105239_10189319 | |||
| 2599 | Ga0105239_10502493 | |||
| 2600 | Ga0105239_10677410 | |||
| 2601 | Ga0105239_10702156 | |||
| 2602 | Ga0105246_10022658 | |||
| 2603 | Ga0105246_10346568 | |||
| 2604 | Ga0105246_11663606 | |||
| 2605 | Ga0157313_1040048 | |||
| 2606 | Ga0157342_1044539 | |||
| 2607 | Ga0157342_1074475 | |||
| 2608 | Ga0157338_1013400 | |||
| 2609 | Ga0157373_10276093 | |||
| 2610 | Ga0157373_10311385 | |||
| 2611 | Ga0157373_10686661 | |||
| 2612 | Ga0157373_10723762 | |||
| 2613 | Ga0157371_10210115 | |||
| 2614 | Ga0157371_10272281 | |||
| 2615 | Ga0157370_10011051 | |||
| 2616 | Ga0157370_10019665 | |||
| 2617 | Ga0157370_10030644 | |||
| 2618 | Ga0157370_10037034 | |||
| 2619 | Ga0157370_10878363 | |||
| 2620 | Ga0157370_11083602 | |||
| 2621 | Ga0157369_10024611 | |||
| 2622 | Ga0157369_10047050 | |||
| 2623 | Ga0157369_10053177 | |||
| 2624 | Ga0157369_10245867 | |||
| 2625 | Ga0157369_11082034 | |||
| 2626 | Ga0157369_11653714 | |||
| 2627 | Ga0157369_11743822 | |||
| 2628 | Ga0157369_12612812 | |||
| 2629 | Ga0157374_10012764 | |||
| 2630 | Ga0157374_10332553 | |||
| 2631 | Ga0157374_10696813 | |||
| 2632 | Ga0157378_10010459 | |||
| 2633 | Ga0157378_10095408 | |||
| 2634 | Ga0157378_10395810 | |||
| 2635 | Ga0157378_11589632 | |||
| 2636 | Ga0163162_10078641 | |||
| 2637 | Ga0163162_10406019 | |||
| 2638 | Ga0157372_10147425 | |||
| 2639 | Ga0157372_10266290 | |||
| 2640 | Ga0157372_10267376 | |||
| 2641 | Ga0157372_10424512 | |||
| 2642 | Ga0157372_11167715 | |||
| 2643 | Ga0157372_11533469 | |||
| 2644 | Ga0157375_10014122 | |||
| 2645 | Ga0157375_10220067 | |||
| 2646 | Ga0163163_10219594 | |||
| 2647 | Ga0163163_10239174 | |||
| 2648 | Ga0163163_10437268 | |||
| 2649 | Ga0163163_10673326 | |||
| 2650 | Ga0157380_10300999 | |||
| 2651 | Ga0157380_10804976 | |||
| 2652 | Ga0157380_11030904 | |||
| 2653 | Ga0157380_11197476 | |||
| 2654 | Ga0182008_10008535 | |||
| 2655 | Ga0182008_10044913 | |||
| 2656 | Ga0182008_10087200 | |||
| 2657 | Ga0182008_10609632 | |||
| 2658 | Ga0157377_10004665 | |||
| 2659 | Ga0157377_10088989 | |||
| 2660 | Ga0157377_10562102 | |||
| 2661 | Ga0157377_10654558 | |||
| 2662 | Ga0157377_11415232 | |||
| 2663 | Ga0157379_10223074 | |||
| 2664 | Ga0157379_10919076 | |||
| 2665 | Ga0157379_10992169 | |||
| 2666 | Ga0157379_12559976 | |||
| 2667 | Ga0157376_10011995 | |||
| 2668 | Ga0157376_10763897 | |||
| 2669 | Ga0157376_11768721 | |||
| 2670 | Ga0157376_12910532 | |||
| 2671 | Ga0182006_1074535 | |||
| 2672 | Ga0163161_10080803 | |||
| 2673 | Ga0163161_10292636 | |||
| 2674 | Ga0197907_10186633 | |||
| 2675 | Ga0197907_10423566 | |||
| 2676 | Ga0197907_10438343 | |||
| 2677 | Ga0197907_10442485 | |||
| 2678 | Ga0197907_11417827 | |||
| 2679 | Ga0206356_10455236 | |||
| 2680 | Ga0206356_10720194 | |||
| 2681 | Ga0206356_10854187 | |||
| 2682 | Ga0206356_10908358 | |||
| 2683 | Ga0206356_11024134 | |||
| 2684 | Ga0206349_1050397 | |||
| 2685 | Ga0206349_1419654 | |||
| 2686 | Ga0206349_1946013 | |||
| 2687 | Ga0206355_1040879 | |||
| 2688 | Ga0206355_1342106 | |||
| 2689 | Ga0206355_1462533 | |||
| 2690 | Ga0206351_10253461 | |||
| 2691 | Ga0206351_10479706 | |||
| 2692 | Ga0206352_10253765 | |||
| 2693 | Ga0206352_11278387 | |||
| 2694 | Ga0206350_11385448 | |||
| 2695 | Ga0206350_11604752 | |||
| 2696 | Ga0206354_10277449 | |||
| 2697 | Ga0206354_10303994 | |||
| 2698 | Ga0206354_10999163 | |||
| 2699 | Ga0206354_11321052 | |||
| 2700 | Ga0206354_11379180 | |||
| 2701 | Ga0206354_11387473 | |||
| 2702 | Ga0206354_11556505 | |||
| 2703 | Ga0206354_11716844 | |||
| 2704 | Ga0206353_10552814 | |||
| 2705 | Ga0206353_10579291 | |||
| 2706 | Ga0206353_10646658 | |||
| 2707 | Ga0206353_10874027 | |||
| 2708 | Ga0206353_11253320 | |||
| 2709 | Ga0206353_11303834 | |||
| 2710 | Ga0206353_11310262 | |||
| 2711 | Ga0154015_1027422 | |||
| 2712 | Ga0154015_1072201 | |||
| 2713 | Ga0154015_1370897 | |||
| 2714 | Ga0154015_1538434 | |||
| 2715 | Ga0213873_10019821 | |||
| 2716 | Ga0213871_10016008 | |||
| 2717 | Ga0224712_10017878 | |||
| 2718 | Ga0224712_10034170 | |||
| 2719 | Ga0224712_10053447 | |||
| 2720 | Ga0224712_10068687 | |||
| 2721 | Ga0224712_10142606 | |||
| 2722 | Ga0224712_10259724 | |||
| 2723 | Ga0224712_10361840 | |||
| 2724 | Ga0207656_10208724 | |||
| 2725 | Ga0207653_10003662 | |||
| 2726 | Ga0207692_10032981 | |||
| 2727 | Ga0207692_10099533 | |||
| 2728 | Ga0207692_10184079 | |||
| 2729 | Ga0207692_10403944 | |||
| 2730 | Ga0207692_10914269 | |||
| 2731 | Ga0207642_10005110 | |||
| 2732 | Ga0207642_10291502 | |||
| 2733 | Ga0207710_10186080 | |||
| 2734 | Ga0207688_10014788 | |||
| 2735 | Ga0207688_10017110 | |||
| 2736 | Ga0207688_10062626 | |||
| 2737 | Ga0207688_10135839 | |||
| 2738 | Ga0207688_10310269 | |||
| 2739 | Ga0207688_10630944 | |||
| 2740 | Ga0207680_10308212 | |||
| 2741 | Ga0207647_10123939 | |||
| 2742 | Ga0207699_10035352 | |||
| 2743 | Ga0207699_10073251 | |||
| 2744 | Ga0207699_10114925 | |||
| 2745 | Ga0207699_10555330 | |||
| 2746 | Ga0207699_10650779 | |||
| 2747 | Ga0207645_10036606 | |||
| 2748 | Ga0207643_10066060 | |||
| 2749 | Ga0207705_10015535 | |||
| 2750 | Ga0207705_10020921 | |||
| 2751 | Ga0207705_10168095 | |||
| 2752 | Ga0207705_10299797 | |||
| 2753 | Ga0207705_10337868 | |||
| 2754 | Ga0207705_11312032 | |||
| 2755 | Ga0207684_10056939 | |||
| 2756 | Ga0207684_10137621 | |||
| 2757 | Ga0207684_10189604 | |||
| 2758 | Ga0207684_10268331 | |||
| 2759 | Ga0207684_10503909 | |||
| 2760 | Ga0207654_10045756 | |||
| 2761 | Ga0207654_10251041 | |||
| 2762 | Ga0207707_10016827 | |||
| 2763 | Ga0207707_10025557 | |||
| 2764 | Ga0207707_10047009 | |||
| 2765 | Ga0207707_10138497 | |||
| 2766 | Ga0207707_10372101 | |||
| 2767 | Ga0207707_10454853 | |||
| 2768 | Ga0207707_10677643 | |||
| 2769 | Ga0207695_10448284 | |||
| 2770 | Ga0207695_10778546 | |||
| 2771 | Ga0207671_10018528 | |||
| 2772 | Ga0207671_10120587 | |||
| 2773 | Ga0207693_10002934 | |||
| 2774 | Ga0207693_10005025 | |||
| 2775 | Ga0207693_10005819 | |||
| 2776 | Ga0207693_10199911 | |||
| 2777 | Ga0207693_10256109 | |||
| 2778 | Ga0207693_10296241 | |||
| 2779 | Ga0207693_10413753 | |||
| 2780 | Ga0207663_10017343 | |||
| 2781 | Ga0207663_10184610 | |||
| 2782 | Ga0207663_10206825 | |||
| 2783 | Ga0207663_10235829 | |||
| 2784 | Ga0207663_10247972 | |||
| 2785 | Ga0207663_10275826 | |||
| 2786 | Ga0207663_10335249 | |||
| 2787 | Ga0207663_11042351 | |||
| 2788 | Ga0207660_10008765 | |||
| 2789 | Ga0207660_10022435 | |||
| 2790 | Ga0207660_10074403 | |||
| 2791 | Ga0207660_10140050 | |||
| 2792 | Ga0207660_10249602 | |||
| 2793 | Ga0207660_10355376 | |||
| 2794 | Ga0207660_10437698 | |||
| 2795 | Ga0207662_10094944 | |||
| 2796 | Ga0207657_10002082 | |||
| 2797 | Ga0207657_10009553 | |||
| 2798 | Ga0207657_10017180 | |||
| 2799 | Ga0207657_10041276 | |||
| 2800 | Ga0207657_10192956 | |||
| 2801 | Ga0207657_10228365 | |||
| 2802 | Ga0207657_10229537 | |||
| 2803 | Ga0207657_10517293 | |||
| 2804 | Ga0207649_10162074 | |||
| 2805 | Ga0207649_10207943 | |||
| 2806 | Ga0207652_10004034 | |||
| 2807 | Ga0207652_10020742 | |||
| 2808 | Ga0207652_10037172 | |||
| 2809 | Ga0207652_10138697 | |||
| 2810 | Ga0207652_10163371 | |||
| 2811 | Ga0207652_10615930 | |||
| 2812 | Ga0207652_10820186 | |||
| 2813 | Ga0207652_10882985 | |||
| 2814 | Ga0207652_11588678 | |||
| 2815 | Ga0207646_10022194 | |||
| 2816 | Ga0207646_10028189 | |||
| 2817 | Ga0207646_10211746 | |||
| 2818 | Ga0207646_10761723 | |||
| 2819 | Ga0207646_11435495 | |||
| 2820 | Ga0207694_10102940 | |||
| 2821 | Ga0207694_10158477 | |||
| 2822 | Ga0207694_10686119 | |||
| 2823 | Ga0207694_10716419 | |||
| 2824 | Ga0207650_10296870 | |||
| 2825 | Ga0207659_10337487 | |||
| 2826 | Ga0207687_10014069 | |||
| 2827 | Ga0207687_10018648 | |||
| 2828 | Ga0207687_10047767 | |||
| 2829 | Ga0207687_10107887 | |||
| 2830 | Ga0207687_10226649 | |||
| 2831 | Ga0207687_10578401 | |||
| 2832 | Ga0207687_10591112 | |||
| 2833 | Ga0207687_10604366 | |||
| 2834 | Ga0207700_10000012 | |||
| 2835 | Ga0207700_10121115 | |||
| 2836 | Ga0207700_10160292 | |||
| 2837 | Ga0207700_10499687 | |||
| 2838 | Ga0207700_10552552 | |||
| 2839 | Ga0207664_10008169 | |||
| 2840 | Ga0207664_10029592 | |||
| 2841 | Ga0207664_10038172 | |||
| 2842 | Ga0207664_10066535 | |||
| 2843 | Ga0207664_10124229 | |||
| 2844 | Ga0207664_10235088 | |||
| 2845 | Ga0207664_10358454 | |||
| 2846 | Ga0207664_10359366 | |||
| 2847 | Ga0207664_10430807 | |||
| 2848 | Ga0207664_10572208 | |||
| 2849 | Ga0207644_10067637 | |||
| 2850 | Ga0207644_11122046 | |||
| 2851 | Ga0207690_10137920 | |||
| 2852 | Ga0207690_10168766 | |||
| 2853 | Ga0207690_10209471 | |||
| 2854 | Ga0207690_10288650 | |||
| 2855 | Ga0207690_10833374 | |||
| 2856 | Ga0207690_11218357 | |||
| 2857 | Ga0207706_10013086 | |||
| 2858 | Ga0207706_10041233 | |||
| 2859 | Ga0207706_10082059 | |||
| 2860 | Ga0207706_10149077 | |||
| 2861 | Ga0207706_10290123 | |||
| 2862 | Ga0207706_11599020 | |||
| 2863 | Ga0207686_10047247 | |||
| 2864 | Ga0207686_10207801 | |||
| 2865 | Ga0207686_10217756 | |||
| 2866 | Ga0207709_10001561 | |||
| 2867 | Ga0207709_10145348 | |||
| 2868 | Ga0207709_10215207 | |||
| 2869 | Ga0207709_10276779 | |||
| 2870 | Ga0207709_10380993 | |||
| 2871 | Ga0207709_10485945 | |||
| 2872 | Ga0207670_10005360 | |||
| 2873 | Ga0207670_10171627 | |||
| 2874 | Ga0207669_10048585 | |||
| 2875 | Ga0207669_10050432 | |||
| 2876 | Ga0207669_11723840 | |||
| 2877 | Ga0207704_10024454 | |||
| 2878 | Ga0207704_10924980 | |||
| 2879 | Ga0207704_10951941 | |||
| 2880 | Ga0207665_10006819 | |||
| 2881 | Ga0207665_10012875 | |||
| 2882 | Ga0207665_10017176 | |||
| 2883 | Ga0207665_10084679 | |||
| 2884 | Ga0207665_10180018 | |||
| 2885 | Ga0207691_10010135 | |||
| 2886 | Ga0207691_10104108 | |||
| 2887 | Ga0207691_10215480 | |||
| 2888 | Ga0207711_10329208 | |||
| 2889 | Ga0207711_10564105 | |||
| 2890 | Ga0207689_10031753 | |||
| 2891 | Ga0207689_10780856 | |||
| 2892 | Ga0207661_10003963 | |||
| 2893 | Ga0207661_10011805 | |||
| 2894 | Ga0207661_10019765 | |||
| 2895 | Ga0207661_10027168 | |||
| 2896 | Ga0207661_10038872 | |||
| 2897 | Ga0207661_10040511 | |||
| 2898 | Ga0207661_10100835 | |||
| 2899 | Ga0207661_10179958 | |||
| 2900 | Ga0207661_10236842 | |||
| 2901 | Ga0207661_10366861 | |||
| 2902 | Ga0207661_10738323 | |||
| 2903 | Ga0207661_11941638 | |||
| 2904 | Ga0207679_10016754 | |||
| 2905 | Ga0207679_10245014 | |||
| 2906 | Ga0207679_10463826 | |||
| 2907 | Ga0207679_10716665 | |||
| 2908 | Ga0207679_11390189 | |||
| 2909 | Ga0207679_11535219 | |||
| 2910 | Ga0207667_10237510 | |||
| 2911 | Ga0207667_10249078 | |||
| 2912 | Ga0207667_10324726 | |||
| 2913 | Ga0207667_10589060 | |||
| 2914 | Ga0207667_10878256 | |||
| 2915 | Ga0207667_10946304 | |||
| 2916 | Ga0207651_10065761 | |||
| 2917 | Ga0207651_10133669 | |||
| 2918 | Ga0207712_10005445 | |||
| 2919 | Ga0207712_10037558 | |||
| 2920 | Ga0207712_10245071 | |||
| 2921 | Ga0207712_10309915 | |||
| 2922 | Ga0207668_10007560 | |||
| 2923 | Ga0207668_10020001 | |||
| 2924 | Ga0207668_10149933 | |||
| 2925 | Ga0207640_10052679 | |||
| 2926 | Ga0207640_10313113 | |||
| 2927 | Ga0207640_10450141 | |||
| 2928 | Ga0207640_10472743 | |||
| 2929 | Ga0207640_10491890 | |||
| 2930 | Ga0207640_10603917 | |||
| 2931 | Ga0207677_10034065 | |||
| 2932 | Ga0207677_10192696 | |||
| 2933 | Ga0207677_11329910 | |||
| 2934 | Ga0207703_10118898 | |||
| 2935 | Ga0207703_10524292 | |||
| 2936 | Ga0207639_10189302 | |||
| 2937 | Ga0207639_10279679 | |||
| 2938 | Ga0207639_10850069 | |||
| 2939 | Ga0207678_10027358 | |||
| 2940 | Ga0207678_10066311 | |||
| 2941 | Ga0207678_10321182 | |||
| 2942 | Ga0207678_11323859 | |||
| 2943 | Ga0207678_11557216 | |||
| 2944 | Ga0207708_10007870 | |||
| 2945 | Ga0207708_10010026 | |||
| 2946 | Ga0207708_10106644 | |||
| 2947 | Ga0207708_10122822 | |||
| 2948 | Ga0207708_10153264 | |||
| 2949 | Ga0207702_10139865 | |||
| 2950 | Ga0207702_10155110 | |||
| 2951 | Ga0207702_10196554 | |||
| 2952 | Ga0207702_10297043 | |||
| 2953 | Ga0207702_10555934 | |||
| 2954 | Ga0207702_10657934 | |||
| 2955 | Ga0207702_10717250 | |||
| 2956 | Ga0207702_11612545 | |||
| 2957 | Ga0207641_11981367 | |||
| 2958 | Ga0207648_10003432 | |||
| 2959 | Ga0207648_10029730 | |||
| 2960 | Ga0207648_10057075 | |||
| 2961 | Ga0207648_11885600 | |||
| 2962 | Ga0207676_10267278 | |||
| 2963 | Ga0207676_10717984 | |||
| 2964 | Ga0207674_10012751 | |||
| 2965 | Ga0207674_10020476 | |||
| 2966 | Ga0207674_10021392 | |||
| 2967 | Ga0207674_10139131 | |||
| 2968 | Ga0207675_100000239 | |||
| 2969 | Ga0207675_100012469 | |||
| 2970 | Ga0207675_100050628 | |||
| 2971 | Ga0207675_100085447 | |||
| 2972 | Ga0207675_100876368 | |||
| 2973 | Ga0207683_10000262 | |||
| 2974 | Ga0207683_10013297 | |||
| 2975 | Ga0207683_10263460 | |||
| 2976 | Ga0207683_10351529 | |||
| 2977 | Ga0207698_10001968 | |||
| 2978 | Ga0207698_10097076 | |||
| 2979 | Ga0207698_10114632 | |||
| 2980 | Ga0207698_10410040 | |||
| 2981 | Ga0207698_10954397 | |||
| 2982 | Ga0210000_1021556 | |||
| 2983 | Ga0209999_1040985 | |||
| 2984 | Ga0209966_1032655 | |||
| 2985 | Ga0209974_10072189 | |||
| 2986 | Ga0207428_10005731 | |||
| 2987 | Ga0207428_10032631 | |||
| 2988 | Ga0207428_10037013 | |||
| 2989 | Ga0207428_10037899 | |||
| 2990 | Ga0207428_10092239 | |||
| 2991 | Ga0207428_10924218 | |||
| 2992 | Ga0207428_10942007 | |||
| 2993 | Ga0268266_10973573 | |||
| 2994 | Ga0268265_10098586 | |||
| 2995 | Ga0268265_10102332 | |||
| 2996 | Ga0268265_11281917 | |||
| 2997 | Ga0268264_10034340 | |||
| 2998 | Ga0268264_10640832 | |||
| 2999 | Ga0268264_11821089 | |||
| 3000 | Ga0265337_1016381 | |||
| 3001 | Ga0265334_10073204 | |||
| 3002 | Ga0265318_10036326 | |||
| 3003 | Ga0265322_10021376 | |||
| 3004 | Ga0265336_10058625 | |||
| 3005 | Ga0265338_10005668 | |||
| 3006 | Ga0265338_10057127 | |||
| 3007 | Ga0265338_10179186 | |||
| 3008 | Ga0265330_10053272 | |||
| 3009 | Ga0265330_10062461 | |||
| 3010 | Ga0265330_10184926 | |||
| 3011 | Ga0265332_10032013 | |||
| 3012 | Ga0265332_10147986 | |||
| 3013 | Ga0265328_10194135 | |||
| 3014 | Ga0265320_10111876 | |||
| 3015 | Ga0265325_10009148 | |||
| 3016 | Ga0265339_10003320 | |||
| 3017 | Ga0265339_10176991 | |||
| 3018 | Ga0265331_10054358 | |||
| 3019 | Ga0265331_10102625 | |||
| 3020 | Ga0265327_10034191 | |||
| 3021 | Ga0265316_10015468 | |||
| 3022 | Ga0265316_10261358 | |||
| 3023 | Ga0265316_10629822 | |||
| 3024 | Ga0307408_100100073 | |||
| 3025 | Ga0307408_100160718 | |||
| 3026 | Ga0307408_100436281 | |||
| 3027 | Ga0265313_10009855 | |||
| 3028 | Ga0265313_10027633 | |||
| 3029 | Ga0265314_10006982 | |||
| 3030 | Ga0265314_10017534 | |||
| 3031 | Ga0265314_10085399 | |||
| 3032 | Ga0265342_10016426 | |||
| 3033 | Ga0265342_10053971 | |||
| 3034 | Ga0265342_10569043 | |||
| 3035 | Ga0307405_10022450 | |||
| 3036 | Ga0307405_10133898 | |||
| 3037 | Ga0307405_10373568 | |||
| 3038 | Ga0307405_10380056 | |||
| 3039 | Ga0307413_10000972 | |||
| 3040 | Ga0307413_10016513 | |||
| 3041 | Ga0307413_10172755 | |||
| 3042 | Ga0307413_10538915 | |||
| 3043 | Ga0307410_10018807 | |||
| 3044 | Ga0307410_10041612 | |||
| 3045 | Ga0307410_10063946 | |||
| 3046 | Ga0307410_10134913 | |||
| 3047 | Ga0307410_10135610 | |||
| 3048 | Ga0307410_10175842 | |||
| 3049 | Ga0307410_10190172 | |||
| 3050 | Ga0307410_10502020 | |||
| 3051 | Ga0307406_10007190 | |||
| 3052 | Ga0307406_10008830 | |||
| 3053 | Ga0307406_10025643 | |||
| 3054 | Ga0307406_10050049 | |||
| 3055 | Ga0307406_10085293 | |||
| 3056 | Ga0307406_10892474 | |||
| 3057 | Ga0307406_12098580 | |||
| 3058 | Ga0307407_10031023 | |||
| 3059 | Ga0307407_10048193 | |||
| 3060 | Ga0307407_10135541 | |||
| 3061 | Ga0307407_10138958 | |||
| 3062 | Ga0307407_11198077 | |||
| 3063 | Ga0307412_10010513 | |||
| 3064 | Ga0307412_10034476 | |||
| 3065 | Ga0307412_10429330 | |||
| 3066 | Ga0307412_10448658 | |||
| 3067 | Ga0307412_10661016 | |||
| 3068 | Ga0307412_10867571 | |||
| 3069 | Ga0307412_10885263 | |||
| 3070 | Ga0307412_12183223 | |||
| 3071 | Ga0307409_100000515 | |||
| 3072 | Ga0307409_100005794 | |||
| 3073 | Ga0307409_100007378 | |||
| 3074 | Ga0307409_100061112 | |||
| 3075 | Ga0307409_100130596 | |||
| 3076 | Ga0307409_100376229 | |||
| 3077 | Ga0307409_100774858 | |||
| 3078 | Ga0307409_100933501 | |||
| 3079 | Ga0307409_101688527 | |||
| 3080 | Ga0307409_102021864 | |||
| 3081 | Ga0307416_100003349 | |||
| 3082 | Ga0307416_100047663 | |||
| 3083 | Ga0307416_100056638 | |||
| 3084 | Ga0307416_100131881 | |||
| 3085 | Ga0307416_100143210 | |||
| 3086 | Ga0307416_100157287 | |||
| 3087 | Ga0307416_100220086 | |||
| 3088 | Ga0307416_100252874 | |||
| 3089 | Ga0307416_100428015 | |||
| 3090 | Ga0307416_100458655 | |||
| 3091 | Ga0307416_100488169 | |||
| 3092 | Ga0307416_100504864 | |||
| 3093 | Ga0307416_100656230 | |||
| 3094 | Ga0307416_100659895 | |||
| 3095 | Ga0307414_10125501 | |||
| 3096 | Ga0307414_10195703 | |||
| 3097 | Ga0307414_10248874 | |||
| 3098 | Ga0307414_10808261 | |||
| 3099 | Ga0307414_11008742 | |||
| 3100 | Ga0307411_10003787 | |||
| 3101 | Ga0307411_10098304 | |||
| 3102 | Ga0307411_10154707 | |||
| 3103 | Ga0307415_100002034 | |||
| 3104 | Ga0307415_100043617 | |||
| 3105 | Ga0307415_100087272 | |||
| 3106 | Ga0307415_100089802 | |||
| 3107 | Ga0307415_100475460 | |||
| 3108 | Ga0307415_100598109 | |||
| 3109 | Ga0307415_100603999 | |||
| 3110 | Ga0307415_100604603 | |||
| 3111 | Ga0307415_100905648 | |||
| 3112 | Ga0307415_100939544 | |||
| 3113 | Ga0307415_102253963 | |||
| 3114 | Ga0373948_0015230 | |||
| 3115 | Ga0373950_0002713 | |||
| 3116 | Ga0373950_0050489 | |||
| 3117 | Ga0373958_0010043 | |||
| 3118 | Ga0373959_0063102 | |||
| 3119 | Ga0373959_0117209 | |||
| 3120 | Ga0373938_0016719 | |||
| 3121 | Ga0373938_0060805 | |||
| 3122 | Ga0373928_0019989 | |||
| 3123 | Ga0373928_0085099 | |||
| 3124 | Ga0373934_0501747 | |||
| 3125 | Ga0373940_0013500 | |||
| 3126 | Ga0373940_0044496 | |||
| 3127 | Ga0373944_0009829 | |||
| 3128 | Ga0373944_0049658 | |||
| 3129 | Ga0373949_0025859 | |||
| 3130 | Ga0373951_0011199 | |||
| 3131 | Ga0373952_0010857 | |||
| 3132 | Ga0373952_0093012 | |||
| 3133 | Ga0373932_0005667 | |||
| 3134 | Ga0373932_0219365 | |||
| 3135 | Ga0373936_0083095 | |||
| 3136 | Ga0373939_0002231 | |||
| 3137 | Ga0373939_0128922 | |||
| 3138 | Ga0373939_0444495 | |||
| 3139 | Ga0373941_0005966 | |||
| 3140 | Ga0373945_0004274 | |||
| 3141 | Ga0373956_0024412 | |||
| 3142 | Ga0373957_0092227 | |||
| 3143 | Ga0373960_0005256 | |||
| 3144 | Ga0373960_0005339 | |||
| 3145 | Ga0373960_0160788 | |||
| 3146 | Ga0373943_0000166 | |||
| 3147 | Ga0373946_0003727 | |||
| 3148 | Ga0373946_0112300 | |||
| 3149 | Ga0373946_0369179 | |||
| 3150 | Ga0373946_0630756 | |||
| 3151 | Ga0373955_0148327 | |||
| 3152 | Ga0373942_0012103 | |||
| 3153 | Ga0373961_0009860 | |||
| 3154 | Ga0373961_0038639 | |||
| 3155 | Ga0373962_0005913 | |||
| 3156 | Ga0373962_0013418 | |||
| 3157 | Ga0373924_0179222 | |||
| 3158 | Ga0373931_0007745 | |||
| 3159 | Ga0373931_0008823 | |||
| 3160 | Ga0373931_0511305 | |||
| 3161 | Ga0373931_0805474 | |||
| 3162 | Ga0373935_0005283 | |||
| 3163 | Ga0373935_0115654 | |||
| 3164 | Ga0373935_0364423 | |||
| 3165 | Ga0373927_0031467 | |||
| 3166 | Ga0373933_0020179 | |||
| 3167 | Ga0373947_0001188 | |||
| 3168 | Ga0373947_0205036 | |||
| 3169 | Ga0373947_0766688 | |||
| 3170 | Ga0373937_0140002 | |||
| 3171 | Ga0373937_0749899 | |||
| 3172 | Ga0373937_1020462 | |||
| 3173 | Ga0373925_0036662 | |||
| 3174 | Ga0373925_0194672 | |||
| 3175 | Ga0373925_0254123 | |||
| 3176 | Ga0373925_0684193 | |||
| 3177 | Ga0373925_1531577 | |||
| 3178 | Ga0395899_0006190 | |||
| 3179 | Ga0395899_0007255 | |||
| 3180 | Ga0395899_0037475 | |||
| 3181 | Ga0395899_0049009 | |||
| 3182 | Ga0395899_0068080 | |||
| 3183 | Ga0395899_0068251 | |||
| 3184 | Ga0395899_0081030 | |||
| 3185 | Ga0395899_0091511 | |||
| 3186 | Ga0395899_0096028 | |||
| 3187 | Ga0395899_0103361 | |||
| 3188 | Ga0395899_0174738 | |||
| 3189 | Ga0395899_0295251 | |||
| 3190 | Ga0395899_0567863 | |||
| 3191 | Ga0395899_0721112 | |||
| 3192 | Ga0395900_0002322 | |||
| 3193 | Ga0395900_0012562 | |||
| 3194 | Ga0395900_0012865 | |||
| 3195 | Ga0395900_0017394 | |||
| 3196 | Ga0395900_0021131 | |||
| 3197 | Ga0395900_0022975 | |||
| 3198 | Ga0395900_0023819 | |||
| 3199 | Ga0395900_0024767 | |||
| 3200 | Ga0395900_0030439 | |||
| 3201 | Ga0395900_0040123 | |||
| 3202 | Ga0395900_0054326 | |||
| 3203 | Ga0395900_0065750 | |||
| 3204 | Ga0395900_0077913 | |||
| 3205 | Ga0395900_0106261 | |||
| 3206 | Ga0395900_0172061 | |||
| 3207 | Ga0395900_0175214 | |||
| 3208 | Ga0395900_0185856 | |||
| 3209 | Ga0395900_0191093 | |||
| 3210 | Ga0395900_0223395 | |||
| 3211 | Ga0395900_0226148 | |||
| 3212 | Ga0395900_0286751 | |||
| 3213 | Ga0395900_0441917 | |||
| 3214 | Ga0395900_0526121 | |||
| 3215 | Ga0395900_0574468 | |||
| 3216 | Ga0395900_0667123 | |||
| 3217 | Ga0395900_1109429 | |||
| 3218 | Ga0395900_1252148 | |||
| 3219 | Ga0395898_0000795 | |||
| 3220 | Ga0395898_0002193 | |||
| 3221 | Ga0395898_0009079 | |||
| 3222 | Ga0395898_0013830 | |||
| 3223 | Ga0395898_0015806 | |||
| 3224 | Ga0395898_0016921 | |||
| 3225 | Ga0395898_0034133 | |||
| 3226 | Ga0395898_0043576 | |||
| 3227 | Ga0395898_0044296 | |||
| 3228 | Ga0395898_0063856 | |||
| 3229 | Ga0395898_0086424 | |||
| 3230 | Ga0395898_0088576 | |||
| 3231 | Ga0395898_0128762 | |||
| 3232 | Ga0395898_0146755 | |||
| 3233 | Ga0395898_0162608 | |||
| 3234 | Ga0395898_0164186 | |||
| 3235 | Ga0395898_0183502 | |||
| 3236 | Ga0395898_0404434 | |||
| 3237 | Ga0395898_0698304 | |||
| 3238 | Ga0395898_0707202 | |||
| 3239 | Ga0395898_0811683 | |||
| 3240 | Ga0395898_1525449 | |||
| 3241 | Ga0395905_0009609 | |||
| 3242 | Ga0395905_0014210 | |||
| 3243 | Ga0395905_0015516 | |||
| 3244 | Ga0395905_0027661 | |||
| 3245 | Ga0395905_0057969 | |||
| 3246 | Ga0395905_0065451 | |||
| 3247 | Ga0395905_0081208 | |||
| 3248 | Ga0395905_0083987 | |||
| 3249 | Ga0395905_0086678 | |||
| 3250 | Ga0395905_0131221 | |||
| 3251 | Ga0395905_0140628 | |||
| 3252 | Ga0395905_0189510 | |||
| 3253 | Ga0395905_0254187 | |||
| 3254 | Ga0395905_0254700 | |||
| 3255 | Ga0395905_0298389 | |||
| 3256 | Ga0395905_0413140 | |||
| 3257 | Ga0395905_0777745 | |||
| 3258 | Ga0395905_0798930 | |||
| 3259 | Ga0395905_0988605 | |||
| 3260 | Ga0395905_1176978 | |||
| 3261 | Ga0436364_1329343 | |||
| 3262 | Ga0395901_0003405 | |||
| 3263 | Ga0395901_0004473 | |||
| 3264 | Ga0395901_0004812 | |||
| 3265 | Ga0395901_0007531 | |||
| 3266 | Ga0395901_0010774 | |||
| 3267 | Ga0395901_0014837 | |||
| 3268 | Ga0395901_0016495 | |||
| 3269 | Ga0395901_0017704 | |||
| 3270 | Ga0395901_0019015 | |||
| 3271 | Ga0395901_0024354 | |||
| 3272 | Ga0395901_0034604 | |||
| 3273 | Ga0395901_0065946 | |||
| 3274 | Ga0395901_0082903 | |||
| 3275 | Ga0395901_0093359 | |||
| 3276 | Ga0395901_0125048 | |||
| 3277 | Ga0395901_0141706 | |||
| 3278 | Ga0395901_0147590 | |||
| 3279 | Ga0395901_0152361 | |||
| 3280 | Ga0395901_0191167 | |||
| 3281 | Ga0395901_0193217 | |||
| 3282 | Ga0395901_0254714 | |||
| 3283 | Ga0395901_0288023 | |||
| 3284 | Ga0395901_0370110 | |||
| 3285 | Ga0395901_0373080 | |||
| 3286 | Ga0395901_0408976 | |||
| 3287 | Ga0395901_0415890 | |||
| 3288 | Ga0395901_0604107 | |||
| 3289 | Ga0395901_0635354 | |||
| 3290 | Ga0395901_0734825 | |||
| 3291 | Ga0395901_1035763 | |||
| 3292 | Ga0395901_1419657 | |||
| 3293 | Ga0395901_1741222 | |||
| 3294 | Ga0395901_1756604 | |||
| 3295 | Ga0395901_1928031 | |||
| 3296 | Ga0242422_05981 | |||
| 3297 | Ga0242420_002041 | |||
| 3298 | Ga0436365_0025901 | |||
| 3299 | Ga0436365_0411377 | |||
| 3300 | Ga0436365_1892433 | |||
| 3301 | Ga0436360_1251922 | |||
| 3302 | Ga0436363_0196864 | |||
| 3303 | Ga0436362_0019340 | |||
| 3304 | Ga0436362_0245167 | |||
| 3305 | Ga0436362_0676185 | |||
| 3306 | Ga0451787_108320 | |||
| 3307 | Ga0451789_0065786 | |||
| 3308 | Ga0451791_1185374 | |||
| 3309 | Ga0451804_0246043 | |||
| 3310 | Ga0451807_0796071 | |||
| 3311 | Ga0451835_0664966 | |||
| 3312 | Ga0451841_0560786 | |||
| 3313 | Ga0451853_2814187 | |||
| 3314 | Ga0439448_0194482 | |||
| 3315 | Ga0439450_036733 | |||
| 3316 | Ga0439454_035206 | |||
| 3317 | Ga0439454_117523 | |||
| 3318 | Ga0439455_0139176 | |||
| 3319 | Ga0439463_074284 | |||
| 3320 | Ga0439463_199900 | |||
| 3321 | Ga0450898_137666 | |||
| 3322 | Ga0450902_036243 | |||
| 3323 | Ga0439446_0088901 | |||
| 3324 | Ga0439458_0030587 | |||
| 3325 | Ga0439434_0112315 | |||
| 3326 | Ga0439444_0016653 | |||
| 3327 | Ga0439460_0071371 | |||
| 3328 | Ga0439440_0128365 | |||
| 3329 | Ga0466969_0160233 | |||
| 3330 | Ga0466972_0204299 | |||
| 3331 | Ga0466972_0301592 | |||
| 3332 | Ga0466972_0336484 | |||
| 3333 | Ga0466965_0315027 | |||
| 3334 | Ga0466966_0006534 | |||
| 3335 | Ga0466966_0122730 | |||
| 3336 | Ga0466961_0053483 | |||
| 3337 | Ga0466961_0138741 | |||
| 3338 | Ga0466961_0152125 | |||
| 3339 | Ga0466961_0838177 | |||
| 3340 | Ga0466963_0011944 | |||
| 3341 | Ga0466963_0017025 | |||
| 3342 | Ga0466963_0035000 | |||
| 3343 | Ga0466963_0065726 | |||
| 3344 | Ga0466963_0959000 | |||
| 3345 | Ga0466964_0002888 | |||
| 3346 | Ga0466964_0003812 | |||
| 3347 | Ga0466964_0033123 | |||
| 3348 | Ga0466964_0220273 | |||
| 3349 | Ga0466964_0300220 | |||
| 3350 | Ga0466964_0736770 | |||
| 3351 | Ga0466971_0144114 | |||
| 3352 | Ga0466971_0224452 | |||
| 3353 | Ga0466968_0027489 | |||
| 3354 | Ga0466968_0046132 | |||
| 3355 | Ga0466968_0117146 | |||
| 3356 | Ga0466968_0142424 | |||
| 3357 | Ga0466970_0016182 | |||
| 3358 | Ga0466970_0242029 | |||
| 3359 | Ga0466957_0019251 | |||
| 3360 | Ga0466957_0075311 | |||
| 3361 | Ga0466957_0183008 | |||
| 3362 | Ga0466957_0183040 | |||
| 3363 | Ga0466957_0298889 | |||
| 3364 | Ga0466957_0317723 | |||
| 3365 | Ga0466957_0480830 | |||
| 3366 | Ga0466957_0664673 | |||
| 3367 | Ga0466957_0755974 | |||
| 3368 | Ga0466957_1119401 | |||
| 3369 | Ga0466960_0025586 | |||
| 3370 | Ga0466960_0054678 | |||
| 3371 | Ga0466960_0196058 | |||
| 3372 | Ga0466960_0394268 | |||
| 3373 | Ga0466959_0022989 | |||
| 3374 | Ga0466959_0185798 | |||
| 3375 | Ga0466959_1123970 | |||
| 3376 | Ga0451576_0144297 | |||
| 3377 | Ga0451576_1317862 | |||
| 3378 | Ga0451576_2642071 | |||
| 3379 | Ga0466958_0022336 | |||
| 3380 | Ga0466958_0079748 | |||
| 3381 | Ga0466958_0091737 | |||
| 3382 | Ga0466958_0091870 | |||
| 3383 | Ga0466958_0122391 | |||
| 3384 | Ga0466958_0156642 | |||
| 3385 | Ga0466958_0160033 | |||
| 3386 | Ga0466958_0696156 | |||
| 3387 | Ga0466958_0822189 | |||
| 3388 | Ga0466967_0000648 | |||
| 3389 | Ga0466967_0005057 | |||
| 3390 | Ga0466967_0022282 | |||
| 3391 | Ga0466967_0023072 | |||
| 3392 | Ga0466967_0024240 | |||
| 3393 | Ga0466967_0029014 | |||
| 3394 | Ga0466967_0066322 | |||
| 3395 | Ga0466967_0067554 | |||
| 3396 | Ga0466967_0076699 | |||
| 3397 | Ga0466967_0080031 | |||
| 3398 | Ga0466967_0085775 | |||
| 3399 | Ga0466967_0097688 | |||
| 3400 | Ga0466967_0100171 | |||
| 3401 | Ga0466967_0107193 | |||
| 3402 | Ga0466967_0114681 | |||
| 3403 | Ga0466967_0118295 | |||
| 3404 | Ga0466967_0168883 | |||
| 3405 | Ga0466967_0181871 | |||
| 3406 | Ga0466967_0196051 | |||
| 3407 | Ga0466967_0420525 | |||
| 3408 | Ga0466967_0856428 | |||
| 3409 | Ga0466967_1175874 | |||
| 3410 | Ga0466967_1238906 | |||
| 3411 | Ga0495617_232252 | |||
| 3412 | Ga0495592_0057703 | |||
| 3413 | Ga0495592_0096530 | |||
| 3414 | Ga0495592_0477112 | |||
| 3415 | Ga0495603_0027930 | |||
| 3416 | Ga0495590_0045844 | |||
| 3417 | Ga0495590_0390171 | |||
| 3418 | Ga0495591_117065 | |||
| 3419 | Ga0495629_0001534 | |||
| 3420 | Ga0495638_0606284 | |||
| 3421 | Ga0495641_0000634 | |||
| 3422 | Ga0495641_0038789 | |||
| 3423 | Ga0495651_0089649 | |||
| 3424 | Ga0495651_0092854 | |||
| 3425 | Ga0495651_0403143 | |||
| 3426 | Ga0495653_0033629 | |||
| 3427 | Ga0495653_0036126 | |||
| 3428 | Ga0495653_0082578 | |||
| 3429 | Ga0495653_0087276 | |||
| 3430 | Ga0495580_0252581 | |||
| 3431 | Ga0495580_0404221 | |||
| 3432 | Ga0495582_0000041 | |||
| 3433 | Ga0495582_0058402 | |||
| 3434 | Ga0495582_0612761 | |||
| 3435 | Ga0495605_0039779 | |||
| 3436 | Ga0495605_0218574 | |||
| 3437 | Ga0495639_0000616 | |||
| 3438 | Ga0495639_0098150 | |||
| 3439 | Ga0495662_0000805 | |||
| 3440 | Ga0495662_0106325 | |||
| 3441 | Ga0495664_0008900 | |||
| 3442 | Ga0495664_0187080 | |||
| 3443 | Ga0495664_0904364 | |||
| 3444 | Ga0495584_0084654 | |||
| 3445 | Ga0495584_0132728 | |||
| 3446 | Ga0495584_0244699 | |||
| 3447 | Ga0495584_0396172 | |||
| 3448 | Ga0495584_0624608 | |||
| 3449 | Ga0495585_0181927 | |||
| 3450 | Ga0495585_0363787 | |||
| 3451 | Ga0495594_0077100 | |||
| 3452 | Ga0495594_0386022 | |||
| 3453 | Ga0495596_0054557 | |||
| 3454 | Ga0495596_0107330 | |||
| 3455 | Ga0495596_0133404 | |||
| 3456 | Ga0495596_0332236 | |||
| 3457 | Ga0495596_0377000 | |||
| 3458 | Ga0495607_0210654 | |||
| 3459 | Ga0495608_0012187 | |||
| 3460 | Ga0495608_0055687 | |||
| 3461 | Ga0495608_0060546 | |||
| 3462 | Ga0495616_0130617 | |||
| 3463 | Ga0495618_0050411 | |||
| 3464 | Ga0495618_0067553 | |||
| 3465 | Ga0495620_0046531 | |||
| 3466 | Ga0495620_0069802 | |||
| 3467 | Ga0495628_0019330 | |||
| 3468 | Ga0495628_0082548 | |||
| 3469 | Ga0495628_1195090 | |||
| 3470 | Ga0495630_0009695 | |||
| 3471 | Ga0495630_0010811 | |||
| 3472 | Ga0495630_0033795 | |||
| 3473 | Ga0495630_0037580 | |||
| 3474 | Ga0495630_0052291 | |||
| 3475 | Ga0495630_0417912 | |||
| 3476 | Ga0495631_0043502 | |||
| 3477 | Ga0495631_0407507 | |||
| 3478 | Ga0495637_0008598 | |||
| 3479 | Ga0495637_0191837 | |||
| 3480 | Ga0495637_0215434 | |||
| 3481 | Ga0495643_0339422 | |||
| 3482 | Ga0495644_0076077 | |||
| 3483 | Ga0495644_0131625 | |||
| 3484 | Ga0495644_0156161 | |||
| 3485 | Ga0495644_0271456 | |||
| 3486 | Ga0495644_0377472 | |||
| 3487 | Ga0495663_0026751 | |||
| 3488 | Ga0495663_0223651 | |||
| 3489 | Ga0495666_0003576 | |||
| 3490 | Ga0495666_0145108 | |||
| 3491 | Ga0495642_0088262 | |||
| 3492 | Ga0495652_0075905 | |||
| 3493 | Ga0495652_0096763 | |||
| 3494 | Ga0495654_0135920 | |||
| 3495 | Ga0495665_0000948 | |||
| 3496 | Ga0495665_0311918 | |||
| 3497 | Ga0495640_0005396 | |||
| 3498 | Ga0495640_0013669 | |||
| 3499 | Ga0495640_0246708 | |||
| 3500 | Ga0495640_0410476 | |||
| 3501 | Ga0495587_0015391 | |||
| 3502 | Ga0495587_0043037 | |||
| 3503 | Ga0495598_0011663 | |||
| 3504 | Ga0495609_0061834 | |||
| 3505 | Ga0495609_0229633 | |||
| 3506 | Ga0495645_0100217 | |||
| 3507 | Ga0495645_0395528 | |||
| 3508 | Ga0495645_0422118 | |||
| 3509 | Ga0495633_0076235 | |||
| 3510 | Ga0495633_0526382 | |||
| 3511 | Ga0495667_0006769 | |||
| 3512 | Ga0495667_0006801 | |||
| 3513 | Ga0495667_0124818 | |||
| 3514 | Ga0495667_0136955 | |||
| 3515 | Ga0495667_0525170 | |||
| 3516 | Ga0495667_0603389 | |||
| 3517 | Ga0495656_0032966 | |||
| 3518 | Ga0495668_0103060 | |||
| 3519 | Ga0495634_0019887 | |||
| 3520 | Ga0495634_0047336 | |||
| 3521 | Ga0495611_0059244 | |||
| 3522 | Ga0495611_0419099 | |||
| 3523 | Ga0495635_0007608 | |||
| 3524 | Ga0495635_0010696 | |||
| 3525 | Ga0495635_0016610 | |||
| 3526 | Ga0495635_0054666 | |||
| 3527 | Ga0495659_0027100 | |||
| 3528 | Ga0495659_0030398 | |||
| 3529 | Ga0495588_0162295 | |||
| 3530 | Ga0495657_0354853 | |||
| 3531 | Ga0495657_0366400 | |||
| 3532 | Ga0495599_0026581 | |||
| 3533 | Ga0495599_0879388 | |||
| 3534 | Ga0495623_0243689 | |||
| 3535 | Ga0495646_0072746 | |||
| 3536 | Ga0495647_0015964 | |||
| 3537 | Ga0495647_0366852 | |||
| 3538 | Ga0495658_0000230 | |||
| 3539 | Ga0495658_0553228 | |||
| 3540 | Ga0495669_0167450 | |||
| 3541 | Ga0495669_0664237 | |||
| 3542 | Ga0495613_0002261 | |||
| 3543 | Ga0495613_0069279 | |||
| 3544 | Ga0495613_0097965 | |||
| 3545 | Ga0495613_0354532 | |||
| 3546 | Ga0495624_0034413 | |||
| 3547 | Ga0495624_0042480 | |||
| 3548 | Ga0495624_0071490 | |||
| 3549 | Ga0495624_0135871 | |||
| 3550 | Ga0495670_0061845 | |||
| 3551 | Ga0495670_0113978 | |||
| 3552 | Ga0495670_0130226 | |||
| 3553 | Ga0495670_0394356 | |||
| 3554 | Ga0495671_0207562 | |||
| 3555 | Ga0495589_0186510 | |||
| 3556 | Ga0495589_0216702 | |||
| 3557 | Ga0495589_0249759 | |||
| 3558 | Ga0495589_0271721 | |||
| 3559 | Ga0495589_0600744 | |||
| 3560 | Ga0495600_0009782 | |||
| 3561 | Ga0495600_0071819 | |||
| 3562 | Ga0495600_0328083 | |||
| 3563 | Ga0495660_0044290 | |||
| 3564 | Ga0495581_0001492 | |||
| 3565 | Ga0495581_0006215 | |||
| 3566 | Ga0495581_0631063 | |||
| 3567 | Ga0495604_0004934 | |||
| 3568 | Ga0495636_0028072 | |||
| 3569 | Ga0495636_0433675 | |||
| 3570 | Ga0495674_0003506 | |||
| 3571 | Ga0495674_0014037 | |||
| 3572 | Ga0495674_0025916 | |||
| 3573 | Ga0495674_0061536 | |||
| 3574 | Ga0495674_0257678 | |||
| 3575 | Ga0495674_0312471 | |||
| 3576 | Ga0495674_0404015 | |||
| 3577 | Ga0495672_0047592 | |||
| 3578 | Ga0495672_0097048 | |||
| 3579 | Ga0495672_0328172 | |||
| 3580 | Ga0495676_0003276 | |||
| 3581 | Ga0495676_0143321 | |||
| 3582 | Ga0495676_0160306 | |||
| 3583 | Ga0495680_0000521 | |||
| 3584 | Ga0495680_0011431 | |||
| 3585 | Ga0495680_0013248 | |||
| 3586 | Ga0495680_0028536 | |||
| 3587 | Ga0495680_0140083 | |||
| 3588 | Ga0495683_0146492 | |||
| 3589 | Ga0495675_0021501 | |||
| 3590 | Ga0495675_0232831 | |||
| 3591 | Ga0495677_0063993 | |||
| 3592 | Ga0495679_068998 | |||
| 3593 | Ga0495685_062706 | |||
| 3594 | Ga0495681_0184959 | |||
| 3595 | Ga0495684_0009608 | |||
| 3596 | Ga0495684_0020048 | |||
| 3597 | Ga0495684_0051883 | |||
| 3598 | Ga0495684_0092681 | |||
| 3599 | Ga0495684_0748774 | |||
| 3600 | Ga0495602_0065858 | |||
| 3601 | Ga0495602_0190273 | |||
| 3602 | Ga0495602_1115762 | |||
| 3603 | Ga0495614_0014438 | |||
| 3604 | Ga0495614_0058642 | |||
| 3605 | Ga0495615_0220489 | |||
| 3606 | Ga0495615_0308307 | |||
| 3607 | Ga0495626_0047440 | |||
| 3608 | Ga0496100_0002332 | |||
| 3609 | Ga0496100_0005021 | |||
| 3610 | Ga0496100_0013924 | |||
| 3611 | Ga0496100_0013955 | |||
| 3612 | Ga0496100_0106039 | |||
| 3613 | Ga0496100_0576515 | |||
| 3614 | Ga0496100_0882414 | |||
| 3615 | Ga0496100_1010670 | |||
| 3616 | Ga0496101_0010235 | |||
| 3617 | Ga0496101_0025266 | |||
| 3618 | Ga0496101_0031082 | |||
| 3619 | Ga0496101_0049497 | |||
| 3620 | Ga0496101_0057179 | |||
| 3621 | Ga0496101_0091160 | |||
| 3622 | Ga0496101_0163902 | |||
| 3623 | Ga0496101_0233618 | |||
| 3624 | Ga0496101_0267975 | |||
| 3625 | Ga0496101_0292547 | |||
| 3626 | Ga0496101_1190624 | |||
| 3627 | Ga0496102_0002937 | |||
| 3628 | Ga0496102_0033185 | |||
| 3629 | Ga0496102_0071007 | |||
| 3630 | Ga0496102_0077466 | |||
| 3631 | Ga0496102_0131858 | |||
| 3632 | Ga0496102_0380971 | |||
| 3633 | Ga0496102_0601603 | |||
| 3634 | Ga0496102_0698942 | |||
| 3635 | Ga0496103_0001614 | |||
| 3636 | Ga0496103_0014534 | |||
| 3637 | Ga0496103_0018880 | |||
| 3638 | Ga0496103_0052355 | |||
| 3639 | Ga0496103_0483712 | |||
| 3640 | Ga0496103_1013769 | |||
| 3641 | Ga0496104_0005516 | |||
| 3642 | Ga0496104_0014035 | |||
| 3643 | Ga0496104_0015209 | |||
| 3644 | Ga0496104_0034799 | |||
| 3645 | Ga0496104_0036463 | |||
| 3646 | Ga0496104_0055819 | |||
| 3647 | Ga0496104_0157455 | |||
| 3648 | Ga0496104_0421722 | |||
| 3649 | Ga0496104_0870183 | |||
| 3650 | Ga0496104_1272806 | |||
| 3651 | Ga0496104_1654741 | |||
| 3652 | Ga0496105_0010678 | |||
| 3653 | Ga0496105_0027980 | |||
| 3654 | Ga0496105_0070252 | |||
| 3655 | Ga0496105_0093354 | |||
| 3656 | Ga0496105_0110363 | |||
| 3657 | Ga0496105_0122950 | |||
| 3658 | Ga0496105_0304107 | |||
| 3659 | Ga0496105_0499602 | |||
| 3660 | Ga0496106_0009352 | |||
| 3661 | Ga0496106_0011541 | |||
| 3662 | Ga0496106_0186802 | |||
| 3663 | Ga0496106_0208317 | |||
| 3664 | Ga0496106_0209843 | |||
| 3665 | Ga0496106_0413942 | |||
| 3666 | Ga0496106_1125642 | |||
| 3667 | Ga0496107_0006841 | |||
| 3668 | Ga0496107_0009060 | |||
| 3669 | Ga0496107_0029576 | |||
| 3670 | Ga0496107_0074957 | |||
| 3671 | Ga0496107_0085174 | |||
| 3672 | Ga0496107_0477612 | |||
| 3673 | Ga0496107_0883198 | |||
| 3674 | Ga0496108_0000654 | |||
| 3675 | Ga0496108_0002430 | |||
| 3676 | Ga0496108_0047226 | |||
| 3677 | Ga0496108_0133994 | |||
| 3678 | Ga0496108_0137631 | |||
| 3679 | Ga0496108_0172223 | |||
| 3680 | Ga0496108_0293151 | |||
| 3681 | Ga0496108_0364719 | |||
| 3682 | Ga0496108_0518754 | |||
| 3683 | Ga0496109_0002798 | |||
| 3684 | Ga0496109_0012171 | |||
| 3685 | Ga0496109_0013542 | |||
| 3686 | Ga0496109_0016655 | |||
| 3687 | Ga0496109_0024106 | |||
| 3688 | Ga0496109_0030375 | |||
| 3689 | Ga0496109_0037518 | |||
| 3690 | Ga0496109_0038589 | |||
| 3691 | Ga0496109_0053942 | |||
| 3692 | Ga0496109_0113783 | |||
| 3693 | Ga0496109_0204500 | |||
| 3694 | Ga0496109_0259359 | |||
| 3695 | Ga0496109_0625409 | |||
| 3696 | Ga0496110_0001043 | |||
| 3697 | Ga0496110_0001883 | |||
| 3698 | Ga0496110_0003760 | |||
| 3699 | Ga0496110_0014925 | |||
| 3700 | Ga0496110_0024135 | |||
| 3701 | Ga0496110_0043790 | |||
| 3702 | Ga0496110_0247362 | |||
| 3703 | Ga0496110_0281435 | |||
| 3704 | Ga0496110_0361662 | |||
| 3705 | Ga0496110_0368488 | |||
| 3706 | Ga0496111_0000185 | |||
| 3707 | Ga0496111_0002354 | |||
| 3708 | Ga0496111_0007396 | |||
| 3709 | Ga0496111_0017850 | |||
| 3710 | Ga0496111_0027681 | |||
| 3711 | Ga0496111_0069515 | |||
| 3712 | Ga0496111_0105136 | |||
| 3713 | Ga0496111_0127162 | |||
| 3714 | Ga0496111_0145866 | |||
| 3715 | Ga0496111_0153237 | |||
| 3716 | Ga0496111_0282500 | |||
| 3717 | Ga0496111_0537980 | |||
| 3718 | Ga0496111_0707391 | |||
| 3719 | Ga0496112_0004986 | |||
| 3720 | Ga0496112_0010630 | |||
| 3721 | Ga0496112_0026171 | |||
| 3722 | Ga0496112_0027194 | |||
| 3723 | Ga0496112_0037845 | |||
| 3724 | Ga0496112_0087398 | |||
| 3725 | Ga0496112_0091755 | |||
| 3726 | Ga0496112_0092642 | |||
| 3727 | Ga0496112_0160098 | |||
| 3728 | Ga0496112_0163749 | |||
| 3729 | Ga0496112_0226499 | |||
| 3730 | Ga0496112_0360693 | |||
| 3731 | Ga0496112_0428372 | |||
| 3732 | Ga0496112_0782268 | |||
| 3733 | Ga0496112_1008376 | |||
| 3734 | Ga0496112_1166626 | |||
| 3735 | Ga0496113_0003813 | |||
| 3736 | Ga0496113_0010963 | |||
| 3737 | Ga0496113_0038773 | |||
| 3738 | Ga0496113_0074078 | |||
| 3739 | Ga0496113_0171295 | |||
| 3740 | Ga0496113_0460268 | |||
| 3741 | Ga0496114_0003803 | |||
| 3742 | Ga0496114_0010950 | |||
| 3743 | Ga0496114_0035029 | |||
| 3744 | Ga0496114_0073138 | |||
| 3745 | Ga0496114_0102340 | |||
| 3746 | Ga0496114_0108216 | |||
| 3747 | Ga0496114_0177986 | |||
| 3748 | Ga0496114_0471620 | |||
| 3749 | Ga0496114_0506190 | |||
| 3750 | Ga0496114_0663439 | |||
| 3751 | Ga0496114_0772276 | |||
| 3752 | Ga0496115_0009651 | |||
| 3753 | Ga0496115_0016074 | |||
| 3754 | Ga0496115_0025999 | |||
| 3755 | Ga0496115_0061248 | |||
| 3756 | Ga0501290_078862 | |||
| 3757 | Ga0501300_066172 | |||
| 3758 | Ga0501311_081133 | |||
| 3759 | Ga0501317_085225 | |||
| 3760 | Ga0501320_067986 | |||
| 3761 | Ga0501031_0151420 | |||
| 3762 | Ga0501031_0176762 | |||
| 3763 | Ga0501031_1036008 | |||
| 3764 | Ga0501033_0126656 | |||
| 3765 | Ga0501033_0423655 | |||
| 3766 | Ga0501034_0002607 | |||
| 3767 | Ga0501036_0338224 | |||
| 3768 | Ga0501036_0610949 | |||
| 3769 | Ga0501036_0851716 | |||
| 3770 | Ga0501037_0747106 | |||
| 3771 | Ga0501038_0325699 | |||
| 3772 | Ga0501038_0604176 | |||
| 3773 | Ga0501038_0669436 | |||
| 3774 | Ga0501039_0115489 | |||
| 3775 | Ga0501039_0460072 | |||
| 3776 | Ga0501039_0870216 | |||
| 3777 | Ga0501039_1329807 | |||
| 3778 | Ga0501040_0057771 | |||
| 3779 | Ga0501040_0827480 | |||
| 3780 | Ga0501040_1238986 | |||
| 3781 | Ga0501041_0034630 | |||
| 3782 | Ga0501042_0056258 | |||
| 3783 | Ga0501042_0100926 | |||
| 3784 | Ga0501042_0102890 | |||
| 3785 | Ga0501043_0275034 | |||
| 3786 | Ga0501043_0647683 | |||
| 3787 | Ga0501046_0086652 | |||
| 3788 | Ga0501046_0422391 | |||
| 3789 | Ga0501046_1216392 | |||
| 3790 | Ga0501047_0050286 | |||
| 3791 | Ga0501047_0153138 | |||
| 3792 | Ga0501047_0356905 | |||
| 3793 | Ga0501048_0045475 | |||
| 3794 | Ga0501048_0176566 | |||
| 3795 | Ga0501048_0180171 | |||
| 3796 | Ga0501067_0006414 | |||
| 3797 | Ga0501067_0119012 | |||
| 3798 | Ga0501067_0282324 | |||
| 3799 | Ga0501068_0029729 | |||
| 3800 | Ga0501069_0010802 | |||
| 3801 | Ga0501069_0081900 | |||
| 3802 | Ga0501069_0240130 | |||
| 3803 | Ga0501069_0262639 | |||
| 3804 | Ga0501069_0658110 | |||
| 3805 | Ga0501070_0024322 | |||
| 3806 | Ga0501070_0026259 | |||
| 3807 | Ga0501070_0069129 | |||
| 3808 | Ga0501070_0089569 | |||
| 3809 | Ga0501070_0203130 | |||
| 3810 | Ga0501070_0401587 | |||
| 3811 | Ga0501071_0198887 | |||
| 3812 | Ga0501071_0399987 | |||
| 3813 | Ga0501071_0552819 | |||
| 3814 | Ga0501071_0650799 | |||
| 3815 | Ga0501071_0901722 | |||
| 3816 | Ga0501072_0017987 | |||
| 3817 | Ga0501072_0060596 | |||
| 3818 | Ga0501072_0147858 | |||
| 3819 | Ga0501072_0180091 | |||
| 3820 | Ga0501072_0699099 | |||
| 3821 | Ga0501072_0926230 | |||
| 3822 | Ga0501073_0025031 | |||
| 3823 | Ga0501073_0095561 | |||
| 3824 | Ga0501074_0044931 | |||
| 3825 | Ga0501074_0074051 | |||
| 3826 | Ga0501074_0218039 | |||
| 3827 | Ga0501074_0344366 | |||
| 3828 | Ga0501074_0589765 | |||
| 3829 | Ga0501074_0612763 | |||
| 3830 | Ga0501074_0629608 | |||
| 3831 | Ga0501074_0645054 | |||
| 3832 | Ga0501075_0056530 | |||
| 3833 | Ga0501075_0060095 | |||
| 3834 | Ga0501075_0189699 | |||
| 3835 | Ga0501075_0417473 | |||
| 3836 | Ga0501075_0672457 | |||
| 3837 | Ga0501075_0906527 | |||
| 3838 | Ga0501075_1478257 | |||
| 3839 | Ga0501075_1497182 | |||
| 3840 | Ga0501076_0003024 | |||
| 3841 | Ga0501076_0331672 | |||
| 3842 | Ga0501076_0594169 | |||
| 3843 | Ga0501076_0758956 | |||
| 3844 | Ga0501077_0272084 | |||
| 3845 | Ga0501077_0349046 | |||
| 3846 | Ga0501077_0405042 | |||
| 3847 | Ga0501077_0918466 | |||
| 3848 | Ga0501206_104648 | |||
| 3849 | Ga0501214_070599 | |||
| 3850 | Ga0501217_163530 | |||
| 3851 | Ga0501253_132060 | |||
| 3852 | Ga0501260_046275 | |||
| 3853 | Ga0501221_036754 | |||
| 3854 | Ga0501245_040026 | |||
| 3855 | Ga0501079_0010185 | |||
| 3856 | Ga0501079_0203861 | |||
| 3857 | Ga0501079_0227271 | |||
| 3858 | Ga0501079_0751300 | |||
| 3859 | Ga0501079_1655581 | |||
| 3860 | Ga0501080_0001559 | |||
| 3861 | Ga0501080_0072319 | |||
| 3862 | Ga0501080_0077249 | |||
| 3863 | Ga0501080_0552552 | |||
| 3864 | Ga0501080_0564702 | |||
| 3865 | Ga0501080_1305676 | |||
| 3866 | Ga0501081_0070749 | |||
| 3867 | Ga0501081_0822816 | |||
| 3868 | Ga0501083_0009330 | |||
| 3869 | Ga0501271_015111 | |||
| 3870 | Ga0501275_011525 | |||
| 3871 | Ga0501275_029791 | |||
| 3872 | Ga0501035_0311358 | |||
| 3873 | Ga0501035_0561404 | |||
| 3874 | Ga0501035_0706317 | |||
| 3875 | Ga0501044_0235687 | |||
| 3876 | Ga0501044_1054356 | |||
| 3877 | Ga0501045_0055827 | |||
| 3878 | Ga0501045_0259140 | |||
| 3879 | Ga0501212_053227 | |||
| 3880 | nmdc:mga03n38_351972_c1 | |||
| 3881 | nmdc:mga00v17_387579_c1 | |||
| 3882 | nmdc:mga00v17_86460_c1 | |||
| 3883 | nmdc:mga0yw44_80537_c1 | |||
| 3884 | nmdc:mga06z11_56682_c1 | |||
| 3885 | nmdc:mga04h51_315900_c1 | |||
| 3886 | nmdc:mga05p37_1109532_c1 | |||
| 3887 | nmdc:mga05p37_1203841_c1 | |||
| 3888 | nmdc:mga05p37_1224257_c1 | |||
| 3889 | nmdc:mga05p37_1262237_c1 | |||
| 3890 | nmdc:mga05p37_149800_c1 | |||
| 3891 | nmdc:mga05p37_170716_c1 | |||
| 3892 | nmdc:mga05p37_1868039_c1 | |||
| 3893 | nmdc:mga05p37_246225_c1 | |||
| 3894 | nmdc:mga05p37_492557_c1 | |||
| 3895 | nmdc:mga05p37_4971_c1 | |||
| 3896 | nmdc:mga05p37_62009_c1 | |||
| 3897 | nmdc:mga05p37_7365_c1 | |||
| 3898 | nmdc:mga05p37_761181_c1 | |||
| 3899 | nmdc:mga05p37_77309_c1 | |||
| 3900 | nmdc:mga05p37_84532_c1 | |||
| 3901 | nmdc:mga09592_102699_c1 | |||
| 3902 | nmdc:mga09592_1162385_c1 | |||
| 3903 | nmdc:mga09592_232348_c1 | |||
| 3904 | nmdc:mga09592_72196_c1 | |||
| 3905 | nmdc:mga09592_916500_c1 | |||
| 3906 | nmdc:mga0qj67_127369_c1 | |||
| 3907 | nmdc:mga0qj67_1408402_c1 | |||
| 3908 | nmdc:mga0qj67_209527_c1 | |||
| 3909 | nmdc:mga0qj67_226189_c1 | |||
| 3910 | nmdc:mga0qj67_24466_c1 | |||
| 3911 | nmdc:mga0qj67_32683_c1 | |||
| 3912 | nmdc:mga0qj67_362303_c1 | |||
| 3913 | nmdc:mga0qj67_75256_c1 | |||
| 3914 | nmdc:mga06r32_1145465_c1 | |||
| 3915 | nmdc:mga06r32_121829_c1 | |||
| 3916 | nmdc:mga06r32_1437520_c1 | |||
| 3917 | nmdc:mga06r32_1556444_c1 | |||
| 3918 | nmdc:mga06r32_1789960_c1 | |||
| 3919 | nmdc:mga06r32_372967_c1 | |||
| 3920 | nmdc:mga06r32_466067_c1 | |||
| 3921 | nmdc:mga08y16_1257543_c1 | |||
| 3922 | nmdc:mga08y16_1262508_c1 | |||
| 3923 | nmdc:mga08y16_1809560_c1 | |||
| 3924 | nmdc:mga08y16_26832_c1 | |||
| 3925 | nmdc:mga08y16_44850_c1 | |||
| 3926 | nmdc:mga08y16_54775_c1 | |||
| 3927 | nmdc:mga08y16_690772_c1 | |||
| 3928 | nmdc:mga08y16_860011_c1 | |||
| 3929 | nmdc:mga0n895_121245_c1 | |||
| 3930 | nmdc:mga0n895_1681299_c1 | |||
| 3931 | nmdc:mga0n895_276020_c1 | |||
| 3932 | nmdc:mga0n895_87414_c1 | |||
| 3933 | nmdc:mga0rr50_1412660_c1 | |||
| 3934 | nmdc:mga0rr50_295337_c1 | |||
| 3935 | nmdc:mga0rr50_390262_c1 | |||
| 3936 | nmdc:mga0rr50_427873_c1 | |||
| 3937 | nmdc:mga0rr50_522876_c1 | |||
| 3938 | nmdc:mga0rr50_580693_c1 | |||
| 3939 | nmdc:mga0rr50_610029_c1 | |||
| 3940 | nmdc:mga08x19_225124_c1 | |||
| 3941 | nmdc:mga08x19_48942_c1 | |||
| 3942 | nmdc:mga08x19_8549_c1 | |||
| 3943 | nmdc:mga0a205_1198984_c1 | |||
| 3944 | nmdc:mga0a205_175073_c1 | |||
| 3945 | nmdc:mga0a205_182072_c1 | |||
| 3946 | nmdc:mga0a205_198097_c1 | |||
| 3947 | nmdc:mga0a205_290404_c1 | |||
| 3948 | nmdc:mga0a205_397506_c1 | |||
| 3949 | nmdc:mga0a205_5684_c1 | |||
| 3950 | nmdc:mga0a205_77948_c1 | |||
| 3951 | Ga0495601_0070860 | |||
| 3952 | Ga0495601_0338962 | |||
| 3953 | Ga0495655_0221643 | |||
| 3954 | Ga0495595_0002879 | |||
| 3955 | Ga0495595_0016698 | |||
| 3956 | Ga0495595_0085481 | |||
| 3957 | Ga0495619_0004699 | |||
| 3958 | Ga0495619_0005606 | |||
| 3959 | Ga0495619_0007224 | |||
| 3960 | Ga0495619_0054756 | |||
| 3961 | Ga0495619_0293361 | |||
| 3962 | Ga0501084_0051144 | |||
| 3963 | Ga0501084_0141913 | |||
| 3964 | Ga0501084_0169019 | |||
| 3965 | Ga0501084_0409516 | |||
| 3966 | Ga0501084_1346918 | |||
| 3967 | Ga0590075_045881 | |||
| 3968 | Ga0590077_035030 | |||
| 3969 | Ga0587084_040057 | |||
| 3970 | Ga0587084_051071 | |||
| 3971 | Ga0587084_102593 | |||
| 3972 | Ga0587084_138049 | |||
| 3973 | Ga0587066_108855 | |||
| 3974 | Ga0587066_217442 | |||
| 3975 | Ga0587070_101082 | |||
| 3976 | Ga0587070_214108 | |||
| 3977 | Ga0587073_0203116 | |||
| 3978 | Ga0587073_0292096 | |||
| 3979 | Ga0587077_095102 | |||
| 3980 | Ga0587077_212906 | |||
| 3981 | Ga0587080_061336 | |||
| 3982 | Ga0587080_101725 | |||
| 3983 | Ga0587080_141572 | |||
| 3984 | Ga0587080_146095 | |||
| 3985 | Ga0587082_161433 | |||
| 3986 | Ga0587085_074572 | |||
| 3987 | Ga0587085_172658 | |||
| 3988 | Ga0587088_151909 | |||
| 3989 | Ga0587090_009608 | |||
| 3990 | Ga0587090_119262 | |||
| 3991 | Ga0587091_048029 | |||
| 3992 | Ga0587091_067568 | |||
| 3993 | Ga0587091_079722 | |||
| 3994 | Ga0587092_146162 | |||
| 3995 | Ga0587092_160686 | |||
| 3996 | Ga0587094_117740 | |||
| 3997 | Ga0587106_053879 | |||
| 3998 | Ga0587106_083455 | |||
| 3999 | Ga0587125_039416 | |||
| 4000 | Ga0587101_153969 | |||
| 4001 | Ga0587109_213982 | |||
| 4002 | Ga0587113_031987 | |||
| 4003 | Ga0587115_048274 | |||
| 4004 | Ga0587115_077529 | |||
| 4005 | Ga0587128_077829 | |||
| 4006 | Ga0587128_101224 | |||
| 4007 | Ga0587130_025002 | |||
| 4008 | Ga0587067_023074 | |||
| 4009 | Ga0587067_065792 | |||
| 4010 | Ga0587067_099799 | |||
| 4011 | Ga0587067_112104 | |||
| 4012 | Ga0587068_113559 | |||
| 4013 | Ga0587072_203833 | |||
| 4014 | Ga0587072_207240 | |||
| 4015 | Ga0587075_133276 | |||
| 4016 | Ga0587076_137506 | |||
| 4017 | Ga0587076_198366 | |||
| 4018 | Ga0587078_045332 | |||
| 4019 | Ga0587078_066884 | |||
| 4020 | Ga0587078_074998 | |||
| 4021 | Ga0587079_114906 | |||
| 4022 | Ga0587079_169053 | |||
| 4023 | Ga0587079_189891 | |||
| 4024 | Ga0587079_221776 | |||
| 4025 | Ga0587102_013673 | |||
| 4026 | Ga0587102_053307 | |||
| 4027 | Ga0587104_024947 | |||
| 4028 | Ga0587107_098060 | |||
| 4029 | Ga0587114_055041 | |||
| 4030 | Ga0587114_076241 | |||
| 4031 | Ga0587114_120275 | |||
| 4032 | Ga0587119_084909 | |||
| 4033 | Ga0587119_086624 | |||
| 4034 | Ga0587071_046783 | |||
| 4035 | Ga0587071_115430 | |||
| 4036 | Ga0501082_0329920 | |||
| 4037 | Ga0501082_0639635 | |||
| 4038 | Ga0501082_0806157 | |||
| 4039 | Ga0501082_0996221 | |||
| 4040 | Ga0501082_1038173 | |||
| 4041 | Ga0466962_0011514 | |||
| 4042 | Ga0466962_0084132 | |||
| 4043 | Ga0466962_0109045 | |||
| 4044 | Ga0466962_0185163 | |||
| 4045 | Ga0466962_0246087 | |||
| 4046 | Ga0466962_0487076 | |||
| 4047 | Ga0530510_0035924 | |||
| 4048 | Ga0530510_0612454 | |||
| 4049 | Ga0530510_0710199 | |||
| 4050 | Ga0530510_0844244 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.9269 | 3 | 114 |
| 6m36-assembly1.cif.gz_F | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9118 | 2 | 100 |
| 6m36-assembly1.cif.gz_H | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.91 | 2 | 102 |
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9072 | 5 | 113 |
| 4qtp-assembly3.cif.gz_C | crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis | 0.9068 | 1 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9115 | 3 | 113 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9085 | 3 | 116 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9033 | 1 | 106 | 3.30.750.24 |
| af_O07728_25_138_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8881 | 2 | 110 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8876 | 1 | 106 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838I9W5-F1-model_v4 | Anti-sigma factor antagonist | 0.9742 | 1 | 86 |
GO:0043856
|
| AF-A0A1V5ILW0-F1-model_v4 | Anti-sigma factor antagonist | 0.9722 | 3 | 114 |
GO:0043856
|
| AF-A0A538KEL9-F1-model_v4 | Anti-sigma factor antagonist | 0.9681 | 2 | 114 |
GO:0043856
|
| AF-K4QXE7-F1-model_v4 | Anti-sigma factor antagonist | 0.9672 | 7 | 115 |
GO:0043856
|
| AF-A0A7V9GVD6-F1-model_v4 | Anti-sigma factor antagonist | 0.9664 | 1 | 116 |
GO:0043856
|