F496139
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1956 | 862 | 1527 | 450 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10000778|Ga0163163_100007787 |
| Length | 502 |
| Sequence | MRESANLLRNERRLYGSRLNRASNLNGFPPSCRLCAEFQYYYQPTTEALMAKRKTAFVCNECGAEFGKWLGQCTECNAWNSISEFRVPAEPRGSDRNIGYAGTAASEVKLLNEIELSALPRVSTGAEEFDRVLGGGLVPGSAILIGGNPGAGKSTLLLQTLCHLAKTMPALYVTGEESLQQVAMRAQRLQLPTDQLKLLAETDVHQLLDRVQKVAPRVLVVDSIQVLYDADMTSAPGSVAQVRDCAALLTRFAKQTGTVLFLVGHVTKDGSLAGPKVLEHMIDCSIMLEGSSDNRFRTLRGHKNRFGPVNELGVFAMTEQGMREVKNPSAIFLTRGMAPAAGSVVMVVWEGTRPLLVEIQALVDTSQLSNPRRLAVGVDQNRLAMLLAVLHRHGGLQVGDQDVFVNVVGGVKVLETSADLALLISIVSSFRDRVLPQDLVVFGEVGLAGEIRPVPSGQERLQEAAKHGFRRAIVPKGNRPKTAPEGMEVIGVATLAEALEAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 12 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 13 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 14 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 15 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 16 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 17 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 18 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 19 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 20 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 21 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 22 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 23 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 24 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 25 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 26 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 27 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 28 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 29 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 30 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 31 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 32 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 33 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 34 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 35 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 36 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 37 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 38 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 39 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 40 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 41 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 42 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 43 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 44 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 45 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 46 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 47 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 48 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 49 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 50 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 51 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 52 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 53 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 54 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 55 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 56 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 57 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 58 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 59 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 60 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 61 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 62 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 63 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 64 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 65 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 66 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 67 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 68 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 69 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 70 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 71 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 72 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 73 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 74 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 75 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 76 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 77 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 78 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 79 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 80 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 81 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 82 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 83 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 84 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 85 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 86 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 87 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 88 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 89 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 90 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 91 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 92 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 93 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 94 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 95 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 96 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 97 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 98 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 99 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 100 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 101 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 102 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 103 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 104 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 105 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 106 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 107 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 108 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 109 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 110 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 111 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 112 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 113 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 114 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 115 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 116 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 117 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 118 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 119 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 120 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 121 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 122 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 123 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 124 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 125 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 126 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 127 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 128 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 129 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 130 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 131 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 132 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 133 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 134 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 135 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 136 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 137 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 138 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 139 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 140 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 141 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 142 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 143 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 144 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 145 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 146 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 147 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 148 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 149 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 150 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 151 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 152 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 153 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 154 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 155 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 156 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 157 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 158 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 159 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 160 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 161 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 162 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 163 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 164 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 165 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 166 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 167 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 168 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 169 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 170 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 171 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 172 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 173 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 174 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 175 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 176 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 177 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 178 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 179 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 180 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 181 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 182 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 183 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 184 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 185 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 186 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 187 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 188 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 189 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 190 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 191 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 192 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 193 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 194 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 195 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 196 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 197 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 198 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 199 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 200 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 201 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 202 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 203 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 204 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 205 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 206 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 207 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 208 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 209 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 210 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 211 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 212 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 213 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 214 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 215 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 216 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 217 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 218 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 219 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 220 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 221 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 222 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 223 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 224 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 225 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 226 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 227 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 228 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 229 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 230 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 231 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 232 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 233 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 234 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 235 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 236 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 237 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 238 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 239 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 240 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 241 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 242 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 243 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 244 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 245 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 246 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 247 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 248 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 249 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 250 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 251 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 252 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 253 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 254 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 255 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 256 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 257 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 258 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 259 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 260 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 261 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 262 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 263 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 264 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 265 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 266 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 267 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 268 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 269 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 270 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 271 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 272 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 273 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 274 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 275 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 276 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 277 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 278 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 279 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 280 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 281 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 282 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 283 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 284 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 285 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 286 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 287 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 288 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 289 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 290 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 291 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 292 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 293 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 294 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 295 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 296 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 297 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 298 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 299 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 300 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 301 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 302 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 303 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 304 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 305 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 306 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 307 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 308 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 309 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 310 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 311 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 312 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 313 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 314 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 315 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 316 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 317 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 318 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 319 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 320 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 321 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 322 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 323 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 324 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 325 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 326 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 327 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 328 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 329 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 330 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 331 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 332 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 333 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 334 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 335 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 336 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 337 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 338 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 339 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 340 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 341 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 342 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 343 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 344 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 345 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 346 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 347 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 348 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 349 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 350 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 351 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 352 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 353 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 354 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 355 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 356 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 357 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 358 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 359 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 360 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 361 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 362 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 363 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 364 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 365 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 366 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 367 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 368 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 369 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 370 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 371 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 372 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 373 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 374 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 375 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 376 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 377 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 378 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 379 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 380 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 381 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 382 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 383 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 384 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 385 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 386 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 387 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 388 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 389 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 390 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 391 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 392 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 393 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 394 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 395 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 396 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 397 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 398 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 399 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 400 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 401 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 402 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 403 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 404 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 405 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 406 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 408 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 409 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 410 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 411 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 412 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 413 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 414 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 415 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 416 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 419 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 420 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 421 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 422 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 423 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 424 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 425 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 426 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 427 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 428 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 429 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 430 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 431 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 432 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 433 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 434 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 435 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 436 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 437 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 438 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 439 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 440 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 441 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 442 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 443 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 444 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 445 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 446 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 447 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 448 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 449 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 450 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 451 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 452 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 453 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 454 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 455 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 456 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 457 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 458 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 459 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 460 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 462 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 463 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 464 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 465 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 466 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 467 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 468 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 469 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 471 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 473 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 474 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 475 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 476 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 477 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 478 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 479 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 480 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 481 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 482 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 483 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 484 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 485 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 486 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 487 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 488 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 489 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 490 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 491 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 492 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 493 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 494 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 495 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 496 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 497 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 498 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 499 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 500 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 501 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 502 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 503 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 504 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 505 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 506 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 507 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 508 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 509 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 510 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 511 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 513 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 514 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 516 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 517 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 518 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 519 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 520 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 521 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 522 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 523 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 568 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 569 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 574 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 578 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 579 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 580 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 581 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 582 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 583 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 584 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 585 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 586 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 587 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 588 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 589 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 590 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 591 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 592 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 593 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 594 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 595 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 596 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 597 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 598 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 599 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 600 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 601 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 602 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 603 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 604 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 605 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 606 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 607 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 608 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 609 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 610 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 611 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 612 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 613 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 614 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 615 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 616 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 617 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 618 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 619 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 620 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 621 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 622 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 623 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 624 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 625 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 626 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 627 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 628 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 629 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 630 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 631 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 632 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 633 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 634 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 635 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 636 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 637 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 638 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 639 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 640 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 641 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 642 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 643 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 644 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 645 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 646 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 647 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 648 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 649 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 650 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 651 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 652 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 653 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 654 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 655 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 656 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 657 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 658 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 659 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 660 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 661 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 662 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 663 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 664 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 665 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 666 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 740 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 741 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 742 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 743 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 744 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 745 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 746 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 747 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 748 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 749 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 750 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 751 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 752 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 753 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 754 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 755 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 756 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 757 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 758 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 759 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 760 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 761 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 764 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 765 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 766 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 767 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 768 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 769 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 770 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 771 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 772 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 773 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 774 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 775 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 776 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 777 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 778 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 779 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 780 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 781 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 782 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 783 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 784 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 785 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 786 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 787 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 788 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 789 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 790 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 791 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 792 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 793 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 794 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 795 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 796 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 797 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 798 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 799 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 800 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 801 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 802 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 803 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 804 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 805 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 806 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 807 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 808 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 809 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 810 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 811 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 812 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 813 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 814 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 815 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 816 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 817 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 818 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 819 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 820 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 821 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 822 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 823 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 824 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 825 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 826 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 827 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 828 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 829 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 830 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 831 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 832 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 833 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 834 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 835 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 836 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 837 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 838 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 839 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 840 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 841 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 842 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 843 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 844 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 845 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 846 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 847 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 848 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 849 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 850 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 851 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 852 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 853 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 854 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 855 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 856 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 857 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 858 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 859 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 860 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 861 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 862 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.02 |
| Metatranscriptomes | 0.05 |
| Isolates | 21.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0.05 |
| Endosphere | 4.81 |
| Nodule | 2.4 |
| Rhizoplane | 7.11 |
| Rhizosphere | 69.99 |
| Stem | 0.05 |
| Stem Tuber | 0.31 |
| Unclassified | 14.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1736 | 2124908027 | Bacteria | 9454 |
| 2 | SwRhRL2b_contig_667648 | 2162886007 | Bacteria | 5581 |
| 3 | JGI24739J22299_10000026 | 3300001989 | Bacteria | 42613 |
| 4 | JGI25162J39368_1000332 | 3300002737 | Bacteria | 41272 |
| 5 | JGI25162J39368_1000502 | 3300002737 | Bacteria | 29548 |
| 6 | JGI25162J39368_1003143 | 3300002737 | Bacteria | 5196 |
| 7 | JGI25163J39215_1000001 | 3300002771 | Bacteria | 314282 |
| 8 | JGI25163J39215_1000713 | 3300002771 | Bacteria | 8641 |
| 9 | JGI25163J39215_1000964 | 3300002771 | Bacteria | 6434 |
| 10 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 11 | JGI25164J39214_1000244 | 3300002772 | Bacteria | 41272 |
| 12 | JGI25164J39214_1000340 | 3300002772 | Bacteria | 29548 |
| 13 | JGI25152J39213_1000281 | 3300002773 | Bacteria | 34001 |
| 14 | JGI25165J46597_1000391 | 3300003214 | Bacteria | 46730 |
| 15 | JGI25165J46597_1000452 | 3300003214 | Bacteria | 41272 |
| 16 | rootH2_10020955 | 3300003320 | Bacteria | 23433 |
| 17 | rootL2_10024534 | 3300003322 | Bacteria | 2627 |
| 18 | rootH1_10012389 | 3300003323 | Bacteria | 43420 |
| 19 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 20 | Ga0055538_1000065 | 3300003751 | Bacteria | 100831 |
| 21 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 22 | Ga0055539_1000099 | 3300003752 | Bacteria | 100831 |
| 23 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 24 | Ga0055533_1000109 | 3300003756 | Bacteria | 100831 |
| 25 | Ga0055532_1000094 | 3300003758 | Bacteria | 100832 |
| 26 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 27 | Ga0055525_1000143 | 3300003759 | Bacteria | 100831 |
| 28 | Ga0055536_1000059 | 3300003781 | Bacteria | 103307 |
| 29 | Ga0055536_1001145 | 3300003781 | Bacteria | 16599 |
| 30 | Ga0055536_1001219 | 3300003781 | Bacteria | 15941 |
| 31 | Ga0055530_10000036 | 3300003791 | Bacteria | 117493 |
| 32 | Ga0055530_10000096 | 3300003791 | Bacteria | 73950 |
| 33 | Ga0055530_10000874 | 3300003791 | Bacteria | 24782 |
| 34 | Ga0055540_1000072 | 3300003792 | Bacteria | 117493 |
| 35 | Ga0055540_1000084 | 3300003792 | Bacteria | 107482 |
| 36 | Ga0055540_1000648 | 3300003792 | Bacteria | 24458 |
| 37 | Ga0055531_10000266 | 3300003794 | Bacteria | 54559 |
| 38 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 39 | Ga0055541_1000066 | 3300003841 | Bacteria | 100831 |
| 40 | Ga0058692_1000154 | 3300003856 | Bacteria | 43640 |
| 41 | Ga0058692_1001642 | 3300003856 | Bacteria | 8023 |
| 42 | Ga0058692_1002000 | 3300003856 | Bacteria | 7082 |
| 43 | Ga0058692_1005897 | 3300003856 | Bacteria | 3426 |
| 44 | Ga0058692_1008168 | 3300003856 | Bacteria | 2710 |
| 45 | Ga0058692_1009390 | 3300003856 | Bacteria | 2468 |
| 46 | Ga0065714_10002683 | 3300005288 | Bacteria | 21091 |
| 47 | Ga0065714_10003206 | 3300005288 | Bacteria | 13249 |
| 48 | Ga0065714_10003555 | 3300005288 | Bacteria | 12389 |
| 49 | Ga0065714_10003704 | 3300005288 | Bacteria | 6542 |
| 50 | Ga0065714_10009694 | 3300005288 | Bacteria | 2468 |
| 51 | Ga0065714_10016908 | 3300005288 | Bacteria | 2565 |
| 52 | Ga0065714_10067601 | 3300005288 | Bacteria | 5350 |
| 53 | Ga0065714_10079000 | 3300005288 | Bacteria | 2546 |
| 54 | Ga0065704_10000047 | 3300005289 | Bacteria | 72432 |
| 55 | Ga0065704_10003505 | 3300005289 | Bacteria | 4007 |
| 56 | Ga0065704_10007587 | 3300005289 | Bacteria | 4213 |
| 57 | Ga0065704_10008178 | 3300005289 | Bacteria | 3916 |
| 58 | Ga0065704_10071220 | 3300005289 | Bacteria | 12398 |
| 59 | Ga0065704_10081710 | 3300005289 | Bacteria | 3714 |
| 60 | Ga0065704_10089844 | 3300005289 | Bacteria | 2806 |
| 61 | Ga0065712_10068190 | 3300005290 | Bacteria | 13325 |
| 62 | Ga0065712_10073244 | 3300005290 | Bacteria | 4453 |
| 63 | Ga0065707_10085062 | 3300005295 | Bacteria | 6497 |
| 64 | Ga0070676_10156944 | 3300005328 | Bacteria | 1461 |
| 65 | Ga0070690_100006908 | 3300005330 | Bacteria | 6460 |
| 66 | Ga0070690_100012283 | 3300005330 | Bacteria | 5038 |
| 67 | Ga0070670_100000134 | 3300005331 | Bacteria | 69571 |
| 68 | Ga0070670_100004209 | 3300005331 | Bacteria | 12047 |
| 69 | Ga0070670_100267978 | 3300005331 | Bacteria | 1490 |
| 70 | Ga0070677_10020243 | 3300005333 | Bacteria | 2421 |
| 71 | Ga0070677_10023212 | 3300005333 | Bacteria | 2294 |
| 72 | Ga0068869_100074554 | 3300005334 | Bacteria | 2518 |
| 73 | Ga0068869_100104039 | 3300005334 | Bacteria | 2152 |
| 74 | Ga0070666_10008719 | 3300005335 | Bacteria | 6303 |
| 75 | Ga0070666_10191832 | 3300005335 | Bacteria | 1436 |
| 76 | Ga0070680_100059561 | 3300005336 | Bacteria | 3125 |
| 77 | Ga0070682_100011000 | 3300005337 | Bacteria | 5158 |
| 78 | Ga0070689_100005286 | 3300005340 | Bacteria | 8798 |
| 79 | Ga0070689_100023090 | 3300005340 | Bacteria | 4652 |
| 80 | Ga0070687_100010245 | 3300005343 | Bacteria | 4045 |
| 81 | Ga0070661_100000208 | 3300005344 | Bacteria | 48588 |
| 82 | Ga0070661_100047460 | 3300005344 | Bacteria | 3143 |
| 83 | Ga0070668_100050241 | 3300005347 | Bacteria | 3210 |
| 84 | Ga0070668_100057066 | 3300005347 | Bacteria | 3017 |
| 85 | Ga0070669_100000089 | 3300005353 | Bacteria | 88172 |
| 86 | Ga0070669_100009888 | 3300005353 | Bacteria | 6795 |
| 87 | Ga0070675_100000334 | 3300005354 | Bacteria | 31880 |
| 88 | Ga0070675_100036052 | 3300005354 | Bacteria | 4023 |
| 89 | Ga0070671_100000279 | 3300005355 | Bacteria | 34599 |
| 90 | Ga0070671_100094508 | 3300005355 | Bacteria | 2506 |
| 91 | Ga0070674_100050836 | 3300005356 | Bacteria | 2854 |
| 92 | Ga0070673_100043702 | 3300005364 | Bacteria | 3464 |
| 93 | Ga0070673_100056427 | 3300005364 | Bacteria | 3099 |
| 94 | Ga0070688_100006244 | 3300005365 | Bacteria | 6351 |
| 95 | Ga0070688_100052647 | 3300005365 | Bacteria | 2543 |
| 96 | Ga0070659_100019863 | 3300005366 | Bacteria | 5099 |
| 97 | Ga0070667_100000060 | 3300005367 | Bacteria | 145801 |
| 98 | Ga0070667_100023897 | 3300005367 | Bacteria | 5075 |
| 99 | Ga0070667_100132022 | 3300005367 | Bacteria | 2180 |
| 100 | Ga0070700_100051436 | 3300005441 | Bacteria | 2564 |
| 101 | Ga0070700_100059921 | 3300005441 | Bacteria | 2398 |
| 102 | Ga0070678_100008328 | 3300005456 | Bacteria | 6209 |
| 103 | Ga0070678_100018584 | 3300005456 | Bacteria | 4507 |
| 104 | Ga0070662_100000419 | 3300005457 | Bacteria | 25188 |
| 105 | Ga0070662_100003827 | 3300005457 | Bacteria | 9421 |
| 106 | Ga0070662_100040573 | 3300005457 | Bacteria | 3315 |
| 107 | Ga0070681_10060863 | 3300005458 | Bacteria | 3752 |
| 108 | Ga0068867_100010572 | 3300005459 | Bacteria | 6510 |
| 109 | Ga0068867_100036345 | 3300005459 | Bacteria | 3575 |
| 110 | Ga0068867_100078602 | 3300005459 | Bacteria | 2481 |
| 111 | Ga0070685_10000063 | 3300005466 | Bacteria | 62658 |
| 112 | Ga0070684_100000467 | 3300005535 | Bacteria | 27593 |
| 113 | Ga0070672_100000694 | 3300005543 | Bacteria | 19915 |
| 114 | Ga0070672_100010076 | 3300005543 | Bacteria | 6543 |
| 115 | Ga0070672_100011621 | 3300005543 | Bacteria | 6144 |
| 116 | Ga0070686_100011149 | 3300005544 | Bacteria | 5093 |
| 117 | Ga0070686_100136407 | 3300005544 | Bacteria | 1703 |
| 118 | Ga0070695_100046114 | 3300005545 | Bacteria | 2781 |
| 119 | Ga0070695_100181028 | 3300005545 | Bacteria | 1493 |
| 120 | Ga0070693_100031492 | 3300005547 | Bacteria | 2907 |
| 121 | Ga0070665_100000140 | 3300005548 | Bacteria | 135833 |
| 122 | Ga0070665_100002747 | 3300005548 | Bacteria | 19072 |
| 123 | Ga0070665_100004186 | 3300005548 | Bacteria | 15177 |
| 124 | Ga0070665_100013832 | 3300005548 | Bacteria | 8117 |
| 125 | Ga0070665_100080276 | 3300005548 | Bacteria | 3267 |
| 126 | Ga0070664_100000145 | 3300005564 | Bacteria | 48588 |
| 127 | Ga0070664_100000660 | 3300005564 | Bacteria | 26358 |
| 128 | Ga0070664_100147485 | 3300005564 | Bacteria | 2076 |
| 129 | Ga0068857_100001114 | 3300005577 | Bacteria | 20896 |
| 130 | Ga0068854_100007740 | 3300005578 | Bacteria | 6868 |
| 131 | Ga0068859_100003407 | 3300005617 | Bacteria | 16173 |
| 132 | Ga0068859_100120445 | 3300005617 | Bacteria | 2691 |
| 133 | Ga0068864_100000143 | 3300005618 | Bacteria | 69296 |
| 134 | Ga0068864_100005551 | 3300005618 | Bacteria | 10343 |
| 135 | Ga0068861_100004021 | 3300005719 | Bacteria | 9846 |
| 136 | Ga0068861_100011305 | 3300005719 | Bacteria | 6199 |
| 137 | Ga0068861_100011531 | 3300005719 | Bacteria | 6149 |
| 138 | Ga0068861_100027143 | 3300005719 | Bacteria | 4168 |
| 139 | Ga0068861_100051048 | 3300005719 | Bacteria | 3138 |
| 140 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 141 | Ga0068851_10008159 | 3300005834 | Bacteria | 4834 |
| 142 | Ga0068870_10013630 | 3300005840 | Bacteria | 3825 |
| 143 | Ga0068863_100007009 | 3300005841 | Bacteria | 11048 |
| 144 | Ga0068863_100078440 | 3300005841 | Bacteria | 3127 |
| 145 | Ga0068863_100108942 | 3300005841 | Bacteria | 2636 |
| 146 | Ga0068860_100008811 | 3300005843 | Bacteria | 10051 |
| 147 | Ga0068862_100000759 | 3300005844 | Bacteria | 32206 |
| 148 | Ga0068862_100001479 | 3300005844 | Bacteria | 21529 |
| 149 | Ga0068862_100005445 | 3300005844 | Bacteria | 10636 |
| 150 | Ga0068862_100007755 | 3300005844 | Bacteria | 8875 |
| 151 | Ga0068862_100026414 | 3300005844 | Bacteria | 4880 |
| 152 | Ga0075365_10000697 | 3300006038 | Bacteria | 13508 |
| 153 | Ga0075364_10000460 | 3300006051 | Bacteria | 20583 |
| 154 | Ga0075364_10004905 | 3300006051 | Bacteria | 7753 |
| 155 | Ga0075364_10006790 | 3300006051 | Bacteria | 6749 |
| 156 | Ga0075364_10018721 | 3300006051 | Bacteria | 4340 |
| 157 | Ga0075364_10112847 | 3300006051 | Bacteria | 1815 |
| 158 | Ga0075432_10002882 | 3300006058 | Bacteria | 5779 |
| 159 | Ga0075432_10010919 | 3300006058 | Bacteria | 3084 |
| 160 | Ga0075432_10011333 | 3300006058 | Bacteria | 3029 |
| 161 | Ga0075432_10015049 | 3300006058 | Bacteria | 2636 |
| 162 | Ga0075432_10017909 | 3300006058 | Bacteria | 2415 |
| 163 | Ga0068871_100041659 | 3300006358 | Bacteria | 3683 |
| 164 | Ga0068871_100044425 | 3300006358 | Bacteria | 3574 |
| 165 | Ga0075428_100006399 | 3300006844 | Bacteria | 13110 |
| 166 | Ga0075428_100012456 | 3300006844 | Bacteria | 9456 |
| 167 | Ga0075428_100020740 | 3300006844 | Bacteria | 7275 |
| 168 | Ga0075428_100027992 | 3300006844 | Bacteria | 6235 |
| 169 | Ga0075428_100048459 | 3300006844 | Bacteria | 4664 |
| 170 | Ga0075430_100001404 | 3300006846 | Bacteria | 19583 |
| 171 | Ga0075430_100219202 | 3300006846 | Bacteria | 1579 |
| 172 | Ga0075431_100001340 | 3300006847 | Bacteria | 22525 |
| 173 | Ga0075431_100001947 | 3300006847 | Bacteria | 19704 |
| 174 | Ga0075431_100059794 | 3300006847 | Bacteria | 3932 |
| 175 | Ga0075431_100107249 | 3300006847 | Bacteria | 2882 |
| 176 | Ga0075433_10000312 | 3300006852 | Bacteria | 29496 |
| 177 | Ga0075434_100000027 | 3300006871 | Bacteria | 66092 |
| 178 | Ga0075429_100001396 | 3300006880 | Bacteria | 19727 |
| 179 | Ga0075429_100030769 | 3300006880 | Bacteria | 4664 |
| 180 | Ga0075429_100052454 | 3300006880 | Bacteria | 3548 |
| 181 | Ga0068865_100007521 | 3300006881 | Bacteria | 6702 |
| 182 | Ga0097620_100003407 | 3300006931 | Bacteria | 16173 |
| 183 | Ga0097620_100120447 | 3300006931 | Bacteria | 2691 |
| 184 | Ga0099823_1000188 | 3300006944 | Bacteria | 34181 |
| 185 | Ga0079104_1000046 | 3300006946 | Bacteria | 183396 |
| 186 | Ga0079104_1000116 | 3300006946 | Bacteria | 114868 |
| 187 | Ga0079104_1000283 | 3300006946 | Bacteria | 65007 |
| 188 | Ga0079104_1000403 | 3300006946 | Bacteria | 49953 |
| 189 | Ga0079104_1000629 | 3300006946 | Bacteria | 34402 |
| 190 | Ga0079104_1000656 | 3300006946 | Bacteria | 33068 |
| 191 | Ga0079104_1001144 | 3300006946 | Bacteria | 19309 |
| 192 | Ga0079104_1001357 | 3300006946 | Bacteria | 16691 |
| 193 | Ga0079104_1012495 | 3300006946 | Bacteria | 2663 |
| 194 | Ga0079104_1027493 | 3300006946 | Bacteria | 1458 |
| 195 | Ga0099826_10011531 | 3300006948 | Bacteria | 6650 |
| 196 | Ga0099795_10000201 | 3300007788 | Bacteria | 10157 |
| 197 | Ga0105251_10000114 | 3300009011 | Bacteria | 80239 |
| 198 | Ga0105251_10000214 | 3300009011 | Bacteria | 58941 |
| 199 | Ga0105251_10000710 | 3300009011 | Bacteria | 30647 |
| 200 | Ga0105251_10000897 | 3300009011 | Bacteria | 26672 |
| 201 | Ga0105251_10001329 | 3300009011 | Bacteria | 21340 |
| 202 | Ga0105251_10001720 | 3300009011 | Bacteria | 18316 |
| 203 | Ga0105251_10001996 | 3300009011 | Bacteria | 16583 |
| 204 | Ga0105251_10002384 | 3300009011 | Bacteria | 14861 |
| 205 | Ga0105251_10002717 | 3300009011 | Bacteria | 13563 |
| 206 | Ga0105251_10006362 | 3300009011 | Bacteria | 7539 |
| 207 | Ga0105251_10007766 | 3300009011 | Bacteria | 6540 |
| 208 | Ga0105251_10011861 | 3300009011 | Bacteria | 4951 |
| 209 | Ga0105251_10016507 | 3300009011 | Bacteria | 3987 |
| 210 | Ga0105251_10024082 | 3300009011 | Bacteria | 3130 |
| 211 | Ga0105251_10029578 | 3300009011 | Bacteria | 2758 |
| 212 | Ga0105251_10051492 | 3300009011 | Bacteria | 1963 |
| 213 | Ga0105251_10053665 | 3300009011 | Bacteria | 1915 |
| 214 | Ga0105244_10000023 | 3300009036 | Bacteria | 233110 |
| 215 | Ga0105244_10000097 | 3300009036 | Bacteria | 91426 |
| 216 | Ga0105244_10000211 | 3300009036 | Bacteria | 60009 |
| 217 | Ga0105244_10000247 | 3300009036 | Bacteria | 55392 |
| 218 | Ga0105244_10000312 | 3300009036 | Bacteria | 47271 |
| 219 | Ga0105244_10000615 | 3300009036 | Bacteria | 31587 |
| 220 | Ga0105244_10000949 | 3300009036 | Bacteria | 24335 |
| 221 | Ga0105244_10001031 | 3300009036 | Bacteria | 23382 |
| 222 | Ga0105244_10001840 | 3300009036 | Bacteria | 16580 |
| 223 | Ga0105244_10002310 | 3300009036 | Bacteria | 14494 |
| 224 | Ga0105244_10003287 | 3300009036 | Bacteria | 11639 |
| 225 | Ga0105244_10004900 | 3300009036 | Bacteria | 9072 |
| 226 | Ga0105244_10009602 | 3300009036 | Bacteria | 5930 |
| 227 | Ga0105244_10013675 | 3300009036 | Bacteria | 4729 |
| 228 | Ga0105244_10013866 | 3300009036 | Bacteria | 4685 |
| 229 | Ga0105244_10014073 | 3300009036 | Bacteria | 4643 |
| 230 | Ga0105244_10016843 | 3300009036 | Bacteria | 4150 |
| 231 | Ga0105244_10037531 | 3300009036 | Bacteria | 2533 |
| 232 | Ga0105244_10041906 | 3300009036 | Bacteria | 2370 |
| 233 | Ga0105244_10075119 | 3300009036 | Bacteria | 1680 |
| 234 | Ga0105250_10000045 | 3300009092 | Bacteria | 127333 |
| 235 | Ga0105250_10000194 | 3300009092 | Bacteria | 51648 |
| 236 | Ga0105250_10000223 | 3300009092 | Bacteria | 47350 |
| 237 | Ga0105250_10000389 | 3300009092 | Bacteria | 32748 |
| 238 | Ga0105250_10003873 | 3300009092 | Bacteria | 7011 |
| 239 | Ga0105250_10004784 | 3300009092 | Bacteria | 6171 |
| 240 | Ga0105250_10005679 | 3300009092 | Bacteria | 5570 |
| 241 | Ga0105250_10009365 | 3300009092 | Bacteria | 4129 |
| 242 | Ga0105250_10009699 | 3300009092 | Bacteria | 4046 |
| 243 | Ga0105250_10010116 | 3300009092 | Bacteria | 3938 |
| 244 | Ga0105250_10020758 | 3300009092 | Bacteria | 2653 |
| 245 | Ga0105250_10025394 | 3300009092 | Bacteria | 2387 |
| 246 | Ga0105250_10033413 | 3300009092 | Bacteria | 2066 |
| 247 | Ga0105240_10179548 | 3300009093 | Bacteria | 2499 |
| 248 | Ga0111539_10006906 | 3300009094 | Bacteria | 14577 |
| 249 | Ga0111539_10036780 | 3300009094 | Bacteria | 5916 |
| 250 | Ga0111539_10304522 | 3300009094 | Bacteria | 1854 |
| 251 | Ga0105247_10000387 | 3300009101 | Bacteria | 37452 |
| 252 | Ga0114129_10001665 | 3300009147 | Bacteria | 30256 |
| 253 | Ga0114129_10030611 | 3300009147 | Bacteria | 7614 |
| 254 | Ga0114129_10053237 | 3300009147 | Bacteria | 5677 |
| 255 | Ga0105243_10000115 | 3300009148 | Bacteria | 92572 |
| 256 | Ga0105243_10001544 | 3300009148 | Bacteria | 20122 |
| 257 | Ga0105243_10002556 | 3300009148 | Bacteria | 15207 |
| 258 | Ga0105243_10002639 | 3300009148 | Bacteria | 14899 |
| 259 | Ga0105243_10022674 | 3300009148 | Bacteria | 4774 |
| 260 | Ga0105243_10080361 | 3300009148 | Bacteria | 2659 |
| 261 | Ga0105243_10099694 | 3300009148 | Bacteria | 2409 |
| 262 | Ga0105241_10000008 | 3300009174 | Bacteria | 334281 |
| 263 | Ga0105242_10002635 | 3300009176 | Bacteria | 14068 |
| 264 | Ga0105242_10060366 | 3300009176 | Bacteria | 3115 |
| 265 | Ga0105248_10016471 | 3300009177 | Bacteria | 8136 |
| 266 | Ga0105237_10002302 | 3300009545 | Bacteria | 23744 |
| 267 | Ga0105249_10020809 | 3300009553 | Bacteria | 5866 |
| 268 | Ga0099796_10023572 | 3300010159 | Bacteria | 1923 |
| 269 | Ga0105239_10156813 | 3300010375 | Bacteria | 2542 |
| 270 | Ga0105246_10000647 | 3300011119 | Bacteria | 19469 |
| 271 | Ga0105246_10001153 | 3300011119 | Bacteria | 15334 |
| 272 | Ga0105246_10001531 | 3300011119 | Bacteria | 13705 |
| 273 | Ga0105246_10014132 | 3300011119 | Bacteria | 5017 |
| 274 | Ga0157345_1000111 | 3300012498 | Bacteria | 15860 |
| 275 | Ga0157373_10003379 | 3300013100 | Bacteria | 12074 |
| 276 | Ga0157373_10004054 | 3300013100 | Bacteria | 11037 |
| 277 | Ga0157373_10006686 | 3300013100 | Bacteria | 8585 |
| 278 | Ga0157373_10007386 | 3300013100 | Bacteria | 8177 |
| 279 | Ga0157373_10031656 | 3300013100 | Bacteria | 3807 |
| 280 | Ga0157373_10039956 | 3300013100 | Bacteria | 3357 |
| 281 | Ga0157373_10055285 | 3300013100 | Bacteria | 2819 |
| 282 | Ga0157373_10076973 | 3300013100 | Bacteria | 2353 |
| 283 | Ga0157373_10095209 | 3300013100 | Bacteria | 2096 |
| 284 | Ga0157373_10105067 | 3300013100 | Bacteria | 1986 |
| 285 | Ga0157371_10000020 | 3300013102 | Bacteria | 304987 |
| 286 | Ga0157371_10000185 | 3300013102 | Bacteria | 91305 |
| 287 | Ga0157371_10000267 | 3300013102 | Bacteria | 71120 |
| 288 | Ga0157371_10000589 | 3300013102 | Bacteria | 43110 |
| 289 | Ga0157371_10006243 | 3300013102 | Bacteria | 9877 |
| 290 | Ga0157371_10007229 | 3300013102 | Bacteria | 9018 |
| 291 | Ga0157371_10007305 | 3300013102 | Bacteria | 8971 |
| 292 | Ga0157371_10008791 | 3300013102 | Bacteria | 8006 |
| 293 | Ga0157371_10015292 | 3300013102 | Bacteria | 5762 |
| 294 | Ga0157370_10000477 | 3300013104 | Bacteria | 50079 |
| 295 | Ga0157370_10002280 | 3300013104 | Bacteria | 23274 |
| 296 | Ga0157370_10004274 | 3300013104 | Bacteria | 16451 |
| 297 | Ga0157370_10010499 | 3300013104 | Bacteria | 9754 |
| 298 | Ga0157370_10027483 | 3300013104 | Bacteria | 5610 |
| 299 | Ga0157370_10027915 | 3300013104 | Bacteria | 5560 |
| 300 | Ga0157370_10082220 | 3300013104 | Bacteria | 3029 |
| 301 | Ga0157370_10124411 | 3300013104 | Bacteria | 2408 |
| 302 | Ga0157370_10182400 | 3300013104 | Bacteria | 1950 |
| 303 | Ga0157369_10000183 | 3300013105 | Bacteria | 86986 |
| 304 | Ga0157369_10006118 | 3300013105 | Bacteria | 13968 |
| 305 | Ga0157369_10009210 | 3300013105 | Bacteria | 11297 |
| 306 | Ga0157369_10011125 | 3300013105 | Bacteria | 10231 |
| 307 | Ga0157369_10013043 | 3300013105 | Bacteria | 9413 |
| 308 | Ga0157369_10031904 | 3300013105 | Bacteria | 5796 |
| 309 | Ga0157378_10169333 | 3300013297 | Bacteria | 2047 |
| 310 | Ga0163162_10001780 | 3300013306 | Bacteria | 20197 |
| 311 | Ga0163162_10017327 | 3300013306 | Bacteria | 7048 |
| 312 | Ga0157372_10001322 | 3300013307 | Bacteria | 26834 |
| 313 | Ga0157372_10001394 | 3300013307 | Bacteria | 26034 |
| 314 | Ga0157372_10004623 | 3300013307 | Bacteria | 14635 |
| 315 | Ga0157375_10028882 | 3300013308 | Bacteria | 5207 |
| 316 | Ga0157375_10050753 | 3300013308 | Bacteria | 4070 |
| 317 | Ga0157375_10419875 | 3300013308 | Bacteria | 1503 |
| 318 | Ga0163163_10000778 | 3300014325 | Bacteria | 27094 |
| 319 | Ga0163163_10074241 | 3300014325 | Bacteria | 3392 |
| 320 | Ga0163163_10206140 | 3300014325 | Bacteria | 2014 |
| 321 | Ga0157380_10035371 | 3300014326 | Bacteria | 3858 |
| 322 | Ga0182008_10003156 | 3300014497 | Bacteria | 10082 |
| 323 | Ga0182008_10004049 | 3300014497 | Bacteria | 8649 |
| 324 | Ga0182008_10004887 | 3300014497 | Bacteria | 7731 |
| 325 | Ga0182008_10005764 | 3300014497 | Bacteria | 7009 |
| 326 | Ga0182008_10006730 | 3300014497 | Bacteria | 6399 |
| 327 | Ga0182008_10009700 | 3300014497 | Bacteria | 5186 |
| 328 | Ga0182008_10022877 | 3300014497 | Bacteria | 3198 |
| 329 | Ga0182008_10024587 | 3300014497 | Bacteria | 3065 |
| 330 | Ga0157377_10022910 | 3300014745 | Bacteria | 3303 |
| 331 | Ga0182006_1000025 | 3300015261 | Bacteria | 255969 |
| 332 | Ga0182006_1001424 | 3300015261 | Bacteria | 14481 |
| 333 | Ga0182006_1001865 | 3300015261 | Bacteria | 12062 |
| 334 | Ga0182006_1003013 | 3300015261 | Bacteria | 8863 |
| 335 | Ga0182006_1003118 | 3300015261 | Bacteria | 8678 |
| 336 | Ga0182007_10001412 | 3300015262 | Bacteria | 12924 |
| 337 | Ga0182007_10012776 | 3300015262 | Bacteria | 3223 |
| 338 | Ga0182005_1001087 | 3300015265 | Bacteria | 11394 |
| 339 | Ga0182005_1001509 | 3300015265 | Bacteria | 9280 |
| 340 | Ga0182005_1012616 | 3300015265 | Bacteria | 2383 |
| 341 | Ga0183366_1003 | 3300015679 | Bacteria | 453474 |
| 342 | Ga0183370_1003 | 3300015680 | Bacteria | 454044 |
| 343 | Ga0183369_1005 | 3300015685 | Bacteria | 453680 |
| 344 | Ga0183368_1006 | 3300015687 | Bacteria | 551576 |
| 345 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 346 | Ga0163161_10005144 | 3300017792 | Bacteria | 9096 |
| 347 | Ga0163161_10019126 | 3300017792 | Bacteria | 4802 |
| 348 | Ga0163161_10021250 | 3300017792 | Bacteria | 4562 |
| 349 | Ga0213874_10001232 | 3300021377 | Bacteria | 5268 |
| 350 | Ga0213876_10000132 | 3300021384 | Bacteria | 81285 |
| 351 | Ga0213875_10000063 | 3300021388 | Bacteria | 130631 |
| 352 | Ga0209435_102069 | 3300025206 | Bacteria | 2407 |
| 353 | Ga0209760_100009 | 3300025207 | Bacteria | 207878 |
| 354 | Ga0209760_100063 | 3300025207 | Bacteria | 92173 |
| 355 | Ga0209760_100157 | 3300025207 | Bacteria | 40911 |
| 356 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 357 | Ga0209784_100101 | 3300025224 | Bacteria | 100885 |
| 358 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 359 | Ga0209566_100123 | 3300025225 | Bacteria | 100885 |
| 360 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 361 | Ga0209674_100145 | 3300025226 | Bacteria | 100885 |
| 362 | Ga0209147_100151 | 3300025229 | Bacteria | 100885 |
| 363 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 364 | Ga0209563_100128 | 3300025230 | Bacteria | 100885 |
| 365 | Ga0209563_101750 | 3300025230 | Bacteria | 5463 |
| 366 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 367 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 368 | Ga0207427_100092 | 3300025231 | Bacteria | 128454 |
| 369 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 370 | Ga0209437_100046 | 3300025233 | Bacteria | 405293 |
| 371 | Ga0209437_100063 | 3300025233 | Bacteria | 335477 |
| 372 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 373 | Ga0209258_100241 | 3300025242 | Bacteria | 100872 |
| 374 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 375 | Ga0209677_100094 | 3300025253 | Bacteria | 100885 |
| 376 | Ga0209759_1005193 | 3300025256 | Bacteria | 4634 |
| 377 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 378 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 379 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 380 | Ga0209233_1003944 | 3300025261 | Bacteria | 5145 |
| 381 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 382 | Ga0209676_1000264 | 3300025292 | Bacteria | 110593 |
| 383 | Ga0209676_1000313 | 3300025292 | Bacteria | 94925 |
| 384 | Ga0209676_1000805 | 3300025292 | Bacteria | 41142 |
| 385 | Ga0209676_1001727 | 3300025292 | Bacteria | 18738 |
| 386 | Ga0209676_1017636 | 3300025292 | Bacteria | 2520 |
| 387 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 388 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 389 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 390 | Ga0209050_1001454 | 3300025298 | Bacteria | 25396 |
| 391 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 392 | Ga0209051_1000082 | 3300025303 | Bacteria | 193133 |
| 393 | Ga0209051_1000139 | 3300025303 | Bacteria | 136281 |
| 394 | Ga0209257_1000539 | 3300025304 | Bacteria | 64964 |
| 395 | Ga0209257_1012661 | 3300025304 | Bacteria | 3865 |
| 396 | Ga0207656_10000045 | 3300025321 | Bacteria | 47492 |
| 397 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 398 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 399 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 400 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 401 | Ga0207696_1000093 | 3300025711 | Bacteria | 184278 |
| 402 | Ga0207696_1000126 | 3300025711 | Bacteria | 136197 |
| 403 | Ga0207696_1000140 | 3300025711 | Bacteria | 127393 |
| 404 | Ga0207696_1000142 | 3300025711 | Bacteria | 123519 |
| 405 | Ga0207696_1000255 | 3300025711 | Bacteria | 69740 |
| 406 | Ga0207696_1000453 | 3300025711 | Bacteria | 35831 |
| 407 | Ga0207696_1001097 | 3300025711 | Bacteria | 15865 |
| 408 | Ga0207696_1002003 | 3300025711 | Bacteria | 10320 |
| 409 | Ga0207696_1002046 | 3300025711 | Bacteria | 10184 |
| 410 | Ga0207696_1002325 | 3300025711 | Bacteria | 9426 |
| 411 | Ga0207696_1002717 | 3300025711 | Bacteria | 8463 |
| 412 | Ga0207696_1003815 | 3300025711 | Bacteria | 6708 |
| 413 | Ga0207696_1006244 | 3300025711 | Bacteria | 4825 |
| 414 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 415 | Ga0207655_1000017 | 3300025728 | Bacteria | 544403 |
| 416 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 417 | Ga0207655_1000026 | 3300025728 | Bacteria | 445528 |
| 418 | Ga0207655_1000054 | 3300025728 | Bacteria | 281894 |
| 419 | Ga0207655_1000056 | 3300025728 | Bacteria | 279166 |
| 420 | Ga0207655_1000101 | 3300025728 | Bacteria | 185883 |
| 421 | Ga0207655_1000120 | 3300025728 | Bacteria | 157018 |
| 422 | Ga0207655_1000146 | 3300025728 | Bacteria | 132221 |
| 423 | Ga0207655_1000378 | 3300025728 | Bacteria | 62082 |
| 424 | Ga0207655_1000383 | 3300025728 | Bacteria | 61839 |
| 425 | Ga0207655_1000629 | 3300025728 | Bacteria | 42354 |
| 426 | Ga0207655_1001313 | 3300025728 | Bacteria | 23498 |
| 427 | Ga0207655_1001444 | 3300025728 | Bacteria | 22008 |
| 428 | Ga0207655_1003230 | 3300025728 | Bacteria | 12243 |
| 429 | Ga0207655_1003272 | 3300025728 | Bacteria | 12157 |
| 430 | Ga0207655_1003542 | 3300025728 | Bacteria | 11564 |
| 431 | Ga0207655_1005247 | 3300025728 | Bacteria | 8894 |
| 432 | Ga0207655_1007448 | 3300025728 | Bacteria | 7098 |
| 433 | Ga0207655_1007987 | 3300025728 | Bacteria | 6786 |
| 434 | Ga0207655_1007999 | 3300025728 | Bacteria | 6780 |
| 435 | Ga0207655_1008311 | 3300025728 | Bacteria | 6602 |
| 436 | Ga0207655_1008543 | 3300025728 | Bacteria | 6481 |
| 437 | Ga0207655_1008592 | 3300025728 | Bacteria | 6461 |
| 438 | Ga0207655_1008846 | 3300025728 | Bacteria | 6329 |
| 439 | Ga0207655_1009011 | 3300025728 | Bacteria | 6251 |
| 440 | Ga0207655_1014324 | 3300025728 | Bacteria | 4489 |
| 441 | Ga0207655_1014693 | 3300025728 | Bacteria | 4405 |
| 442 | Ga0207655_1029728 | 3300025728 | Bacteria | 2552 |
| 443 | Ga0207713_1000007 | 3300025735 | Bacteria | 564979 |
| 444 | Ga0207713_1000034 | 3300025735 | Bacteria | 266214 |
| 445 | Ga0207713_1000046 | 3300025735 | Bacteria | 232796 |
| 446 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 447 | Ga0207713_1000055 | 3300025735 | Bacteria | 221387 |
| 448 | Ga0207713_1000110 | 3300025735 | Bacteria | 135907 |
| 449 | Ga0207713_1000200 | 3300025735 | Bacteria | 82983 |
| 450 | Ga0207713_1000229 | 3300025735 | Bacteria | 75343 |
| 451 | Ga0207713_1000233 | 3300025735 | Bacteria | 74522 |
| 452 | Ga0207713_1000419 | 3300025735 | Bacteria | 45136 |
| 453 | Ga0207713_1000836 | 3300025735 | Bacteria | 28375 |
| 454 | Ga0207713_1001161 | 3300025735 | Bacteria | 22265 |
| 455 | Ga0207713_1001267 | 3300025735 | Bacteria | 20840 |
| 456 | Ga0207713_1001606 | 3300025735 | Bacteria | 17647 |
| 457 | Ga0207713_1002366 | 3300025735 | Bacteria | 13792 |
| 458 | Ga0207713_1003863 | 3300025735 | Bacteria | 9994 |
| 459 | Ga0207713_1004683 | 3300025735 | Bacteria | 8820 |
| 460 | Ga0207713_1006309 | 3300025735 | Bacteria | 7243 |
| 461 | Ga0207713_1007420 | 3300025735 | Bacteria | 6473 |
| 462 | Ga0207713_1008121 | 3300025735 | Bacteria | 6086 |
| 463 | Ga0207713_1010825 | 3300025735 | Bacteria | 5015 |
| 464 | Ga0207713_1014889 | 3300025735 | Bacteria | 4014 |
| 465 | Ga0207713_1020562 | 3300025735 | Bacteria | 3193 |
| 466 | Ga0207713_1060961 | 3300025735 | Bacteria | 1438 |
| 467 | Ga0207682_10003524 | 3300025893 | Bacteria | 6778 |
| 468 | Ga0207682_10013434 | 3300025893 | Bacteria | 3190 |
| 469 | Ga0207710_10000015 | 3300025900 | Bacteria | 393018 |
| 470 | Ga0207710_10043778 | 3300025900 | Bacteria | 1992 |
| 471 | Ga0207645_10000348 | 3300025907 | Bacteria | 38649 |
| 472 | Ga0207643_10003398 | 3300025908 | Bacteria | 8581 |
| 473 | Ga0207654_10000009 | 3300025911 | Bacteria | 334291 |
| 474 | Ga0207671_10000613 | 3300025914 | Bacteria | 47054 |
| 475 | Ga0207693_10029146 | 3300025915 | Bacteria | 4362 |
| 476 | Ga0207660_10006542 | 3300025917 | Bacteria | 7559 |
| 477 | Ga0207660_10020250 | 3300025917 | Bacteria | 4461 |
| 478 | Ga0207662_10000587 | 3300025918 | Bacteria | 16215 |
| 479 | Ga0207649_10000023 | 3300025920 | Bacteria | 188467 |
| 480 | Ga0207681_10000134 | 3300025923 | Bacteria | 60646 |
| 481 | Ga0207681_10007277 | 3300025923 | Bacteria | 6784 |
| 482 | Ga0207681_10102082 | 3300025923 | Bacteria | 2070 |
| 483 | Ga0207681_10144340 | 3300025923 | Bacteria | 1776 |
| 484 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 485 | Ga0207650_10000100 | 3300025925 | Bacteria | 112181 |
| 486 | Ga0207650_10000153 | 3300025925 | Bacteria | 82970 |
| 487 | Ga0207659_10019038 | 3300025926 | Bacteria | 4510 |
| 488 | Ga0207659_10072315 | 3300025926 | Bacteria | 2520 |
| 489 | Ga0207664_10013185 | 3300025929 | Bacteria | 5922 |
| 490 | Ga0207644_10000282 | 3300025931 | Bacteria | 33804 |
| 491 | Ga0207690_10020833 | 3300025932 | Bacteria | 4058 |
| 492 | Ga0207706_10000056 | 3300025933 | Bacteria | 113022 |
| 493 | Ga0207706_10002539 | 3300025933 | Bacteria | 17789 |
| 494 | Ga0207706_10003016 | 3300025933 | Bacteria | 16232 |
| 495 | Ga0207706_10020376 | 3300025933 | Bacteria | 5961 |
| 496 | Ga0207706_10071449 | 3300025933 | Bacteria | 3052 |
| 497 | Ga0207686_10001071 | 3300025934 | Bacteria | 16087 |
| 498 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 499 | Ga0207709_10000127 | 3300025935 | Bacteria | 112650 |
| 500 | Ga0207709_10002430 | 3300025935 | Bacteria | 11708 |
| 501 | Ga0207709_10019461 | 3300025935 | Bacteria | 3818 |
| 502 | Ga0207709_10085647 | 3300025935 | Bacteria | 2043 |
| 503 | Ga0207670_10029178 | 3300025936 | Bacteria | 3511 |
| 504 | Ga0207669_10017376 | 3300025937 | Bacteria | 3687 |
| 505 | Ga0207669_10041781 | 3300025937 | Bacteria | 2672 |
| 506 | Ga0207704_10021280 | 3300025938 | Bacteria | 3451 |
| 507 | Ga0207704_10023807 | 3300025938 | Bacteria | 3307 |
| 508 | Ga0207665_10074271 | 3300025939 | Bacteria | 2327 |
| 509 | Ga0207691_10011300 | 3300025940 | Bacteria | 8567 |
| 510 | Ga0207691_10012956 | 3300025940 | Bacteria | 7985 |
| 511 | Ga0207691_10041982 | 3300025940 | Bacteria | 4219 |
| 512 | Ga0207691_10078998 | 3300025940 | Bacteria | 2961 |
| 513 | Ga0207691_10083144 | 3300025940 | Bacteria | 2874 |
| 514 | Ga0207691_10140007 | 3300025940 | Bacteria | 2133 |
| 515 | Ga0207711_10002362 | 3300025941 | Bacteria | 16903 |
| 516 | Ga0207711_10148097 | 3300025941 | Bacteria | 2116 |
| 517 | Ga0207689_10055918 | 3300025942 | Bacteria | 3247 |
| 518 | Ga0207689_10069125 | 3300025942 | Bacteria | 2902 |
| 519 | Ga0207689_10072704 | 3300025942 | Bacteria | 2825 |
| 520 | Ga0207679_10000017 | 3300025945 | Bacteria | 253004 |
| 521 | Ga0207651_10008259 | 3300025960 | Bacteria | 5612 |
| 522 | Ga0207651_10084876 | 3300025960 | Bacteria | 2295 |
| 523 | Ga0207668_10028388 | 3300025972 | Bacteria | 3658 |
| 524 | Ga0207668_10046286 | 3300025972 | Bacteria | 2971 |
| 525 | Ga0207640_10178991 | 3300025981 | Bacteria | 1588 |
| 526 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 527 | Ga0207658_10139956 | 3300025986 | Bacteria | 1957 |
| 528 | Ga0207703_10003380 | 3300026035 | Bacteria | 13405 |
| 529 | Ga0207639_10005168 | 3300026041 | Bacteria | 8804 |
| 530 | Ga0207708_10009579 | 3300026075 | Bacteria | 7182 |
| 531 | Ga0207708_10010217 | 3300026075 | Bacteria | 6969 |
| 532 | Ga0207641_10033914 | 3300026088 | Bacteria | 4244 |
| 533 | Ga0207641_10126974 | 3300026088 | Bacteria | 2284 |
| 534 | Ga0207641_10189471 | 3300026088 | Bacteria | 1889 |
| 535 | Ga0207648_10005345 | 3300026089 | Bacteria | 12946 |
| 536 | Ga0207648_10014086 | 3300026089 | Bacteria | 7398 |
| 537 | Ga0207648_10042556 | 3300026089 | Bacteria | 3986 |
| 538 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 539 | Ga0207676_10004754 | 3300026095 | Bacteria | 9633 |
| 540 | Ga0207676_10076214 | 3300026095 | Bacteria | 2709 |
| 541 | Ga0207674_10002994 | 3300026116 | Bacteria | 20952 |
| 542 | Ga0207674_10008222 | 3300026116 | Bacteria | 12089 |
| 543 | Ga0207674_10030134 | 3300026116 | Bacteria | 5708 |
| 544 | Ga0207674_10083479 | 3300026116 | Bacteria | 3194 |
| 545 | Ga0207675_100001821 | 3300026118 | Bacteria | 21367 |
| 546 | Ga0207675_100002107 | 3300026118 | Bacteria | 19713 |
| 547 | Ga0207675_100004064 | 3300026118 | Bacteria | 14163 |
| 548 | Ga0207675_100072804 | 3300026118 | Bacteria | 3214 |
| 549 | Ga0207675_100172203 | 3300026118 | Bacteria | 2069 |
| 550 | Ga0207683_10012335 | 3300026121 | Bacteria | 7293 |
| 551 | Ga0207683_10033133 | 3300026121 | Bacteria | 4487 |
| 552 | Ga0207683_10048422 | 3300026121 | Bacteria | 3722 |
| 553 | Ga0207683_10146037 | 3300026121 | Bacteria | 2133 |
| 554 | Ga0209281_1000022 | 3300027111 | Bacteria | 522913 |
| 555 | Ga0209281_1000054 | 3300027111 | Bacteria | 309505 |
| 556 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 557 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 558 | Ga0209281_1000120 | 3300027111 | Bacteria | 206692 |
| 559 | Ga0209281_1000127 | 3300027111 | Bacteria | 200036 |
| 560 | Ga0209281_1000145 | 3300027111 | Bacteria | 170793 |
| 561 | Ga0209281_1000223 | 3300027111 | Bacteria | 121161 |
| 562 | Ga0209281_1000384 | 3300027111 | Bacteria | 70059 |
| 563 | Ga0209281_1000489 | 3300027111 | Bacteria | 54514 |
| 564 | Ga0209281_1000854 | 3300027111 | Bacteria | 26809 |
| 565 | Ga0209281_1001296 | 3300027111 | Bacteria | 16009 |
| 566 | Ga0209281_1001588 | 3300027111 | Bacteria | 12323 |
| 567 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 568 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 569 | Ga0209371_1000030 | 3300027312 | Bacteria | 423605 |
| 570 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 571 | Ga0209371_1000054 | 3300027312 | Bacteria | 259676 |
| 572 | Ga0209371_1000111 | 3300027312 | Bacteria | 140093 |
| 573 | Ga0209371_1000123 | 3300027312 | Bacteria | 131854 |
| 574 | Ga0209371_1000127 | 3300027312 | Bacteria | 127069 |
| 575 | Ga0209371_1000241 | 3300027312 | Bacteria | 68278 |
| 576 | Ga0209371_1000246 | 3300027312 | Bacteria | 67449 |
| 577 | Ga0209371_1000438 | 3300027312 | Bacteria | 42301 |
| 578 | Ga0209371_1001222 | 3300027312 | Bacteria | 18480 |
| 579 | Ga0209371_1001384 | 3300027312 | Bacteria | 16656 |
| 580 | Ga0209371_1001635 | 3300027312 | Bacteria | 14443 |
| 581 | Ga0209371_1001784 | 3300027312 | Bacteria | 13481 |
| 582 | Ga0209371_1010019 | 3300027312 | Bacteria | 2958 |
| 583 | Ga0209371_1017337 | 3300027312 | Bacteria | 1868 |
| 584 | Ga0209983_1000100 | 3300027665 | Bacteria | 14518 |
| 585 | Ga0209971_1001260 | 3300027682 | Bacteria | 6319 |
| 586 | Ga0209998_10001506 | 3300027717 | Bacteria | 5602 |
| 587 | Ga0207428_10003747 | 3300027907 | Bacteria | 14590 |
| 588 | Ga0207428_10008488 | 3300027907 | Bacteria | 9278 |
| 589 | Ga0207428_10022639 | 3300027907 | Bacteria | 5300 |
| 590 | Ga0207428_10037467 | 3300027907 | Bacteria | 3945 |
| 591 | Ga0207428_10091240 | 3300027907 | Bacteria | 2365 |
| 592 | Ga0268266_10000143 | 3300028379 | Bacteria | 135829 |
| 593 | Ga0268266_10005042 | 3300028379 | Bacteria | 12465 |
| 594 | Ga0268266_10006807 | 3300028379 | Bacteria | 10413 |
| 595 | Ga0268266_10043875 | 3300028379 | Bacteria | 3822 |
| 596 | Ga0268266_10071137 | 3300028379 | Bacteria | 3015 |
| 597 | Ga0268265_10000613 | 3300028380 | Bacteria | 35613 |
| 598 | Ga0268265_10002577 | 3300028380 | Bacteria | 13530 |
| 599 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 600 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 601 | Ga0307517_10068597 | 3300028786 | Bacteria | 3227 |
| 602 | Ga0265338_10034880 | 3300028800 | Bacteria | 4850 |
| 603 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 604 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 605 | Ga0268256_1000025 | 3300030500 | Bacteria | 484317 |
| 606 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 607 | Ga0268256_1000095 | 3300030500 | Bacteria | 139698 |
| 608 | Ga0268256_1000104 | 3300030500 | Bacteria | 127069 |
| 609 | Ga0268256_1000200 | 3300030500 | Bacteria | 68278 |
| 610 | Ga0268256_1000225 | 3300030500 | Bacteria | 61749 |
| 611 | Ga0268256_1001189 | 3300030500 | Bacteria | 16656 |
| 612 | Ga0268256_1001819 | 3300030500 | Bacteria | 11992 |
| 613 | Ga0268256_1002159 | 3300030500 | Bacteria | 10445 |
| 614 | Ga0268256_1002901 | 3300030500 | Bacteria | 8225 |
| 615 | Ga0268256_1002999 | 3300030500 | Bacteria | 7974 |
| 616 | Ga0268256_1005681 | 3300030500 | Bacteria | 4823 |
| 617 | Ga0268256_1007797 | 3300030500 | Bacteria | 3760 |
| 618 | Ga0307511_10077707 | 3300030521 | Bacteria | 2361 |
| 619 | Ga0314311_1116887 | 3300030733 | Bacteria | 1988 |
| 620 | Ga0316178_1150033 | 3300030735 | Bacteria | 4482 |
| 621 | Ga0316183_1017054 | 3300030742 | Bacteria | 2584 |
| 622 | Ga0265331_10014725 | 3300031250 | Bacteria | 4153 |
| 623 | Ga0265331_10019997 | 3300031250 | Bacteria | 3446 |
| 624 | Ga0265327_10000002 | 3300031251 | Bacteria | 856593 |
| 625 | Ga0265327_10000044 | 3300031251 | Bacteria | 284808 |
| 626 | Ga0265327_10001253 | 3300031251 | Bacteria | 33702 |
| 627 | Ga0265327_10002604 | 3300031251 | Bacteria | 18671 |
| 628 | Ga0265327_10058219 | 3300031251 | Bacteria | 1984 |
| 629 | Ga0265316_10000678 | 3300031344 | Bacteria | 37854 |
| 630 | Ga0307513_10013189 | 3300031456 | Bacteria | 10152 |
| 631 | Ga0307513_10014340 | 3300031456 | Bacteria | 9679 |
| 632 | Ga0307513_10059559 | 3300031456 | Bacteria | 4053 |
| 633 | Ga0307513_10128850 | 3300031456 | Bacteria | 2480 |
| 634 | Ga0307513_10137244 | 3300031456 | Bacteria | 2378 |
| 635 | Ga0307509_10024054 | 3300031507 | Bacteria | 6828 |
| 636 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 637 | Ga0307408_100000091 | 3300031548 | Bacteria | 99968 |
| 638 | Ga0307408_100000216 | 3300031548 | Bacteria | 61491 |
| 639 | Ga0307408_100008354 | 3300031548 | Bacteria | 6835 |
| 640 | Ga0307408_100016726 | 3300031548 | Bacteria | 4901 |
| 641 | Ga0307408_100019847 | 3300031548 | Bacteria | 4527 |
| 642 | Ga0307408_100041888 | 3300031548 | Bacteria | 3248 |
| 643 | Ga0307408_100053815 | 3300031548 | Bacteria | 2908 |
| 644 | Ga0307408_100069774 | 3300031548 | Bacteria | 2592 |
| 645 | Ga0265313_10000068 | 3300031595 | Bacteria | 100563 |
| 646 | Ga0265313_10010933 | 3300031595 | Bacteria | 5688 |
| 647 | Ga0316575_10000890 | 3300031665 | Bacteria | 9175 |
| 648 | Ga0316575_10002831 | 3300031665 | Bacteria | 5883 |
| 649 | Ga0316575_10057811 | 3300031665 | Bacteria | 1546 |
| 650 | Ga0316579_10033235 | 3300031691 | Bacteria | 2367 |
| 651 | Ga0316579_10062073 | 3300031691 | Bacteria | 1760 |
| 652 | Ga0316576_10000212 | 3300031727 | Bacteria | 24453 |
| 653 | Ga0316576_10000354 | 3300031727 | Bacteria | 20585 |
| 654 | Ga0316576_10002258 | 3300031727 | Bacteria | 10915 |
| 655 | Ga0316576_10023926 | 3300031727 | Bacteria | 4261 |
| 656 | Ga0316576_10054196 | 3300031727 | Bacteria | 2924 |
| 657 | Ga0316576_10063714 | 3300031727 | Bacteria | 2706 |
| 658 | Ga0316576_10065716 | 3300031727 | Bacteria | 2666 |
| 659 | Ga0316576_10109184 | 3300031727 | Bacteria | 2073 |
| 660 | Ga0316576_10165725 | 3300031727 | Bacteria | 1667 |
| 661 | Ga0316576_10186980 | 3300031727 | Bacteria | 1562 |
| 662 | Ga0316578_10001858 | 3300031728 | Bacteria | 8884 |
| 663 | Ga0316578_10002495 | 3300031728 | Bacteria | 8107 |
| 664 | Ga0316578_10011385 | 3300031728 | Bacteria | 4651 |
| 665 | Ga0316578_10011851 | 3300031728 | Bacteria | 4578 |
| 666 | Ga0316578_10017136 | 3300031728 | Bacteria | 3938 |
| 667 | Ga0316578_10027858 | 3300031728 | Bacteria | 3196 |
| 668 | Ga0316578_10097559 | 3300031728 | Bacteria | 1760 |
| 669 | Ga0307516_10000171 | 3300031730 | Bacteria | 82839 |
| 670 | Ga0307405_10000292 | 3300031731 | Bacteria | 18517 |
| 671 | Ga0307405_10007687 | 3300031731 | Bacteria | 5415 |
| 672 | Ga0307405_10017959 | 3300031731 | Bacteria | 3893 |
| 673 | Ga0316577_10022083 | 3300031733 | Bacteria | 3533 |
| 674 | Ga0316577_10045816 | 3300031733 | Bacteria | 2443 |
| 675 | Ga0307413_10003575 | 3300031824 | Bacteria | 6577 |
| 676 | Ga0307406_10075232 | 3300031901 | Bacteria | 2227 |
| 677 | Ga0307406_10120842 | 3300031901 | Bacteria | 1821 |
| 678 | Ga0307407_10010041 | 3300031903 | Bacteria | 4444 |
| 679 | Ga0307407_10036565 | 3300031903 | Bacteria | 2706 |
| 680 | Ga0307412_10001542 | 3300031911 | Bacteria | 12735 |
| 681 | Ga0307412_10002214 | 3300031911 | Bacteria | 10787 |
| 682 | Ga0307412_10002890 | 3300031911 | Bacteria | 9521 |
| 683 | Ga0307409_100010789 | 3300031995 | Bacteria | 5711 |
| 684 | Ga0307409_100139812 | 3300031995 | Bacteria | 2084 |
| 685 | Ga0307416_100005907 | 3300032002 | Bacteria | 7598 |
| 686 | Ga0307414_10032163 | 3300032004 | Bacteria | 3451 |
| 687 | Ga0307414_10142369 | 3300032004 | Bacteria | 1879 |
| 688 | Ga0307411_10003528 | 3300032005 | Bacteria | 7278 |
| 689 | Ga0307411_10016120 | 3300032005 | Bacteria | 4223 |
| 690 | Ga0307411_10054322 | 3300032005 | Bacteria | 2629 |
| 691 | Ga0307415_100013159 | 3300032126 | Bacteria | 4819 |
| 692 | Ga0307415_100040227 | 3300032126 | Bacteria | 3095 |
| 693 | Ga0316583_10004776 | 3300032133 | Bacteria | 4841 |
| 694 | Ga0316583_10024695 | 3300032133 | Bacteria | 2146 |
| 695 | Ga0316583_10038853 | 3300032133 | Bacteria | 1686 |
| 696 | Ga0316585_10000461 | 3300032137 | Bacteria | 9538 |
| 697 | Ga0316585_10020355 | 3300032137 | Bacteria | 2030 |
| 698 | Ga0316580_10000964 | 3300032139 | Bacteria | 7166 |
| 699 | Ga0316580_10001667 | 3300032139 | Bacteria | 5904 |
| 700 | Ga0316593_10010248 | 3300032168 | Bacteria | 2681 |
| 701 | Ga0307510_10011495 | 3300033180 | Bacteria | 10518 |
| 702 | Ga0307510_10072032 | 3300033180 | Bacteria | 3436 |
| 703 | Ga0373923_0034671 | 3300035111 | Bacteria | 2050 |
| 704 | Ga0316574_0000008 | 3300035398 | Bacteria | 48126 |
| 705 | Ga0316574_0002035 | 3300035398 | Bacteria | 9971 |
| 706 | Ga0316574_0002733 | 3300035398 | Bacteria | 8940 |
| 707 | Ga0316574_0002892 | 3300035398 | Bacteria | 8730 |
| 708 | Ga0316574_0030478 | 3300035398 | Bacteria | 3267 |
| 709 | Ga0373924_0019116 | 3300035410 | Bacteria | 2651 |
| 710 | Ga0373931_0033413 | 3300035691 | Bacteria | 2666 |
| 711 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 712 | Ga0316582_0002628 | 3300036647 | Bacteria | 8508 |
| 713 | Ga0316582_0027128 | 3300036647 | Bacteria | 3456 |
| 714 | Ga0316582_0054182 | 3300036647 | Bacteria | 2552 |
| 715 | Ga0316582_0073521 | 3300036647 | Bacteria | 2218 |
| 716 | Ga0316584_0003578 | 3300036712 | Bacteria | 10149 |
| 717 | Ga0316584_0007566 | 3300036712 | Bacteria | 7442 |
| 718 | Ga0316584_0039754 | 3300036712 | Bacteria | 3502 |
| 719 | Ga0316584_0057190 | 3300036712 | Bacteria | 2919 |
| 720 | Ga0316584_0123479 | 3300036712 | Bacteria | 1934 |
| 721 | Ga0316584_0124694 | 3300036712 | Bacteria | 1924 |
| 722 | Ga0373925_0108113 | 3300037068 | Bacteria | 2146 |
| 723 | Ga0316581_0001438 | 3300037588 | Bacteria | 5354 |
| 724 | Ga0316581_0007444 | 3300037588 | Bacteria | 2938 |
| 725 | Ga0436364_0036482 | 3300037853 | Bacteria | 193771 |
| 726 | Ga0436364_0939013 | 3300037853 | Bacteria | 3839 |
| 727 | Ga0400483_028483 | 3300039062 | Bacteria | 154566 |
| 728 | Ga0400483_066663 | 3300039062 | Bacteria | 16018 |
| 729 | Ga0400483_085989 | 3300039062 | Bacteria | 9005 |
| 730 | Ga0400483_196526 | 3300039062 | Bacteria | 30829 |
| 731 | Ga0400483_232168 | 3300039062 | Bacteria | 10074 |
| 732 | Ga0400483_246213 | 3300039062 | Bacteria | 42716 |
| 733 | Ga0436365_0084998 | 3300039437 | Bacteria | 507888 |
| 734 | Ga0436365_1036887 | 3300039437 | Bacteria | 3414 |
| 735 | Ga0436363_0467135 | 3300039450 | Bacteria | 9763 |
| 736 | Ga0439436_0024069 | 3300041404 | Bacteria | 1798 |
| 737 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 738 | Ga0439438_000530 | 3300041405 | Bacteria | 17352 |
| 739 | Ga0439438_001413 | 3300041405 | Bacteria | 10590 |
| 740 | Ga0439438_001885 | 3300041405 | Bacteria | 9179 |
| 741 | Ga0439438_002408 | 3300041405 | Bacteria | 7972 |
| 742 | Ga0439438_002819 | 3300041405 | Bacteria | 7257 |
| 743 | Ga0439438_004575 | 3300041405 | Bacteria | 5262 |
| 744 | Ga0439438_011200 | 3300041405 | Bacteria | 2802 |
| 745 | Ga0439438_011384 | 3300041405 | Bacteria | 2773 |
| 746 | Ga0439438_013745 | 3300041405 | Bacteria | 2431 |
| 747 | Ga0439447_000242 | 3300041407 | Bacteria | 19191 |
| 748 | Ga0439447_000963 | 3300041407 | Bacteria | 10486 |
| 749 | Ga0439447_001174 | 3300041407 | Bacteria | 9539 |
| 750 | Ga0439447_012776 | 3300041407 | Bacteria | 2401 |
| 751 | Ga0439453_0002138 | 3300041408 | Bacteria | 2678 |
| 752 | Ga0439466_0000002 | 3300041411 | Bacteria | 494198 |
| 753 | Ga0439466_0000779 | 3300041411 | Bacteria | 12084 |
| 754 | Ga0439466_0001260 | 3300041411 | Bacteria | 9845 |
| 755 | Ga0439466_0002857 | 3300041411 | Bacteria | 6755 |
| 756 | Ga0439466_0004859 | 3300041411 | Bacteria | 5165 |
| 757 | Ga0439466_0006077 | 3300041411 | Bacteria | 4597 |
| 758 | Ga0439466_0015831 | 3300041411 | Bacteria | 2735 |
| 759 | Ga0439466_0017299 | 3300041411 | Bacteria | 2598 |
| 760 | Ga0439466_0049030 | 3300041411 | Bacteria | 1388 |
| 761 | Ga0439465_0001154 | 3300041413 | Bacteria | 8481 |
| 762 | Ga0451802_0783281 | 3300041460 | Bacteria | 2223 |
| 763 | Ga0451802_1689586 | 3300041460 | Bacteria | 3250 |
| 764 | Ga0451833_1230775 | 3300041491 | Bacteria | 2090 |
| 765 | Ga0451837_1364909 | 3300041494 | Bacteria | 2355 |
| 766 | Ga0439448_0041561 | 3300042005 | Bacteria | 1488 |
| 767 | Ga0439432_000632 | 3300042006 | Bacteria | 13211 |
| 768 | Ga0439432_001436 | 3300042006 | Bacteria | 8954 |
| 769 | Ga0439432_003043 | 3300042006 | Bacteria | 6243 |
| 770 | Ga0439432_003594 | 3300042006 | Bacteria | 5741 |
| 771 | Ga0439432_008727 | 3300042006 | Bacteria | 3550 |
| 772 | Ga0439432_009742 | 3300042006 | Bacteria | 3342 |
| 773 | Ga0439432_014683 | 3300042006 | Bacteria | 2649 |
| 774 | Ga0439451_000947 | 3300042009 | Bacteria | 5598 |
| 775 | Ga0439451_001448 | 3300042009 | Bacteria | 4690 |
| 776 | Ga0439451_002411 | 3300042009 | Bacteria | 3789 |
| 777 | Ga0439451_010777 | 3300042009 | Bacteria | 1842 |
| 778 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 779 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 780 | Ga0439452_000007 | 3300042010 | Bacteria | 613625 |
| 781 | Ga0439452_000041 | 3300042010 | Bacteria | 142405 |
| 782 | Ga0439452_000085 | 3300042010 | Bacteria | 79496 |
| 783 | Ga0439452_000149 | 3300042010 | Bacteria | 51740 |
| 784 | Ga0439452_000306 | 3300042010 | Bacteria | 31584 |
| 785 | Ga0439452_000497 | 3300042010 | Bacteria | 21515 |
| 786 | Ga0439452_000581 | 3300042010 | Bacteria | 18965 |
| 787 | Ga0439452_001680 | 3300042010 | Bacteria | 8695 |
| 788 | Ga0439452_006146 | 3300042010 | Bacteria | 3788 |
| 789 | Ga0439456_000013 | 3300042013 | Bacteria | 72544 |
| 790 | Ga0439456_000723 | 3300042013 | Bacteria | 6781 |
| 791 | Ga0439456_004033 | 3300042013 | Bacteria | 2980 |
| 792 | Ga0439456_006156 | 3300042013 | Bacteria | 2443 |
| 793 | Ga0439463_006772 | 3300042016 | Bacteria | 2835 |
| 794 | Ga0450911_000006 | 3300042115 | Bacteria | 222143 |
| 795 | Ga0450911_000521 | 3300042115 | Bacteria | 12132 |
| 796 | Ga0450911_001091 | 3300042115 | Bacteria | 6821 |
| 797 | Ga0450919_000041 | 3300042121 | Bacteria | 10737 |
| 798 | Ga0450920_001489 | 3300042122 | Bacteria | 3879 |
| 799 | Ga0450922_000267 | 3300042124 | Bacteria | 5539 |
| 800 | Ga0450923_002475 | 3300042125 | Bacteria | 2657 |
| 801 | Ga0450891_001666 | 3300042129 | Bacteria | 2288 |
| 802 | Ga0450902_002640 | 3300042137 | Bacteria | 2549 |
| 803 | Ga0450903_002709 | 3300042138 | Bacteria | 3120 |
| 804 | Ga0450904_000693 | 3300042139 | Bacteria | 5973 |
| 805 | Ga0450906_001060 | 3300042145 | Bacteria | 6063 |
| 806 | Ga0450907_000025 | 3300042146 | Bacteria | 72853 |
| 807 | Ga0450907_000244 | 3300042146 | Bacteria | 18765 |
| 808 | Ga0450907_000937 | 3300042146 | Bacteria | 6933 |
| 809 | Ga0450907_006059 | 3300042146 | Bacteria | 2027 |
| 810 | Ga0439446_0000257 | 3300042156 | Bacteria | 9897 |
| 811 | Ga0439446_0001080 | 3300042156 | Bacteria | 6015 |
| 812 | Ga0439446_0009320 | 3300042156 | Bacteria | 2626 |
| 813 | Ga0450908_005394 | 3300042184 | Bacteria | 2453 |
| 814 | Ga0439435_0000641 | 3300042436 | Bacteria | 5746 |
| 815 | Ga0439459_0007172 | 3300042438 | Bacteria | 1876 |
| 816 | Ga0439464_0000526 | 3300042439 | Bacteria | 7895 |
| 817 | Ga0439464_0006608 | 3300042439 | Bacteria | 3026 |
| 818 | Ga0439464_0011656 | 3300042439 | Bacteria | 2330 |
| 819 | Ga0439460_0000989 | 3300042461 | Bacteria | 6546 |
| 820 | Ga0439460_0006429 | 3300042461 | Bacteria | 2913 |
| 821 | Ga0439460_0011233 | 3300042461 | Bacteria | 2307 |
| 822 | Ga0450918_007379 | 3300042531 | Bacteria | 1946 |
| 823 | Ga0450893_0000317 | 3300042532 | Bacteria | 6718 |
| 824 | Ga0450893_0001268 | 3300042532 | Bacteria | 3815 |
| 825 | Ga0451577_0001360 | 3300042876 | Bacteria | 32926 |
| 826 | Ga0451577_0016457 | 3300042876 | Bacteria | 6850 |
| 827 | Ga0451577_0200600 | 3300042876 | Bacteria | 1801 |
| 828 | Ga0439440_0003329 | 3300042993 | Bacteria | 3091 |
| 829 | Ga0466981_0000014 | 3300044669 | Bacteria | 109658 |
| 830 | Ga0453683_0004190 | 3300044673 | Bacteria | 10315 |
| 831 | Ga0453683_0005511 | 3300044673 | Bacteria | 8832 |
| 832 | Ga0453683_0014870 | 3300044673 | Bacteria | 5052 |
| 833 | Ga0453684_0000231 | 3300044712 | Bacteria | 241070 |
| 834 | Ga0453684_0001356 | 3300044712 | Bacteria | 71474 |
| 835 | Ga0453684_0003877 | 3300044712 | Bacteria | 32926 |
| 836 | Ga0453684_0020833 | 3300044712 | Bacteria | 9849 |
| 837 | Ga0453684_0047336 | 3300044712 | Bacteria | 5704 |
| 838 | Ga0453684_0122219 | 3300044712 | Bacteria | 3141 |
| 839 | Ga0453684_0162105 | 3300044712 | Bacteria | 2644 |
| 840 | Ga0451576_0025049 | 3300045051 | Bacteria | 6434 |
| 841 | Ga0451576_0172631 | 3300045051 | Bacteria | 2257 |
| 842 | Ga0451576_0366787 | 3300045051 | Bacteria | 1508 |
| 843 | Ga0495617_000479 | 3300046452 | Bacteria | 21276 |
| 844 | Ga0495617_001534 | 3300046452 | Bacteria | 10022 |
| 845 | Ga0495617_046660 | 3300046452 | Bacteria | 1443 |
| 846 | Ga0495627_000042 | 3300046453 | Bacteria | 189845 |
| 847 | Ga0495627_000104 | 3300046453 | Bacteria | 104176 |
| 848 | Ga0495627_000221 | 3300046453 | Bacteria | 61299 |
| 849 | Ga0495627_003091 | 3300046453 | Bacteria | 7555 |
| 850 | Ga0495627_004493 | 3300046453 | Bacteria | 5830 |
| 851 | Ga0495627_006719 | 3300046453 | Bacteria | 4477 |
| 852 | Ga0495627_006739 | 3300046453 | Bacteria | 4470 |
| 853 | Ga0495603_0003012 | 3300046455 | Bacteria | 9980 |
| 854 | Ga0495590_0001439 | 3300046457 | Bacteria | 10271 |
| 855 | Ga0495590_0002041 | 3300046457 | Bacteria | 8473 |
| 856 | Ga0495590_0005058 | 3300046457 | Bacteria | 5258 |
| 857 | Ga0495590_0008961 | 3300046457 | Bacteria | 3802 |
| 858 | Ga0495590_0013050 | 3300046457 | Bacteria | 3063 |
| 859 | Ga0495591_000087 | 3300046458 | Bacteria | 104654 |
| 860 | Ga0495591_000124 | 3300046458 | Bacteria | 84206 |
| 861 | Ga0495591_000165 | 3300046458 | Bacteria | 70496 |
| 862 | Ga0495591_000167 | 3300046458 | Bacteria | 70044 |
| 863 | Ga0495591_000231 | 3300046458 | Bacteria | 54648 |
| 864 | Ga0495591_001414 | 3300046458 | Bacteria | 14966 |
| 865 | Ga0495591_001515 | 3300046458 | Bacteria | 14301 |
| 866 | Ga0495591_002013 | 3300046458 | Bacteria | 11827 |
| 867 | Ga0495591_003333 | 3300046458 | Bacteria | 8359 |
| 868 | Ga0495591_009099 | 3300046458 | Bacteria | 3981 |
| 869 | Ga0495591_010920 | 3300046458 | Bacteria | 3474 |
| 870 | Ga0495591_011840 | 3300046458 | Bacteria | 3278 |
| 871 | Ga0495591_023217 | 3300046458 | Bacteria | 1992 |
| 872 | Ga0495591_025548 | 3300046458 | Bacteria | 1850 |
| 873 | Ga0495591_037934 | 3300046458 | Bacteria | 1391 |
| 874 | Ga0495629_0009493 | 3300046459 | Bacteria | 7113 |
| 875 | Ga0495638_0006800 | 3300046460 | Bacteria | 8259 |
| 876 | Ga0495638_0007763 | 3300046460 | Bacteria | 7659 |
| 877 | Ga0495638_0007985 | 3300046460 | Bacteria | 7545 |
| 878 | Ga0495638_0008999 | 3300046460 | Bacteria | 7038 |
| 879 | Ga0495638_0010092 | 3300046460 | Bacteria | 6582 |
| 880 | Ga0495638_0010448 | 3300046460 | Bacteria | 6443 |
| 881 | Ga0495638_0016034 | 3300046460 | Bacteria | 5022 |
| 882 | Ga0495638_0027275 | 3300046460 | Bacteria | 3698 |
| 883 | Ga0495638_0065307 | 3300046460 | Bacteria | 2240 |
| 884 | Ga0495641_0054034 | 3300046461 | Bacteria | 1826 |
| 885 | Ga0495653_0000332 | 3300046463 | Bacteria | 38593 |
| 886 | Ga0495653_0048055 | 3300046463 | Bacteria | 3296 |
| 887 | Ga0495653_0056873 | 3300046463 | Bacteria | 2980 |
| 888 | Ga0495653_0060706 | 3300046463 | Bacteria | 2863 |
| 889 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 890 | Ga0495650_0000028 | 3300046471 | Bacteria | 473012 |
| 891 | Ga0495650_0000113 | 3300046471 | Bacteria | 196536 |
| 892 | Ga0495650_0002361 | 3300046471 | Bacteria | 15508 |
| 893 | Ga0495650_0004045 | 3300046471 | Bacteria | 10273 |
| 894 | Ga0495650_0005255 | 3300046471 | Bacteria | 8481 |
| 895 | Ga0495650_0006583 | 3300046471 | Bacteria | 7219 |
| 896 | Ga0495650_0007026 | 3300046471 | Bacteria | 6858 |
| 897 | Ga0495650_0011231 | 3300046471 | Bacteria | 4923 |
| 898 | Ga0495582_0039235 | 3300046473 | Bacteria | 2607 |
| 899 | Ga0495605_0000033 | 3300046474 | Bacteria | 209203 |
| 900 | Ga0495605_0000140 | 3300046474 | Bacteria | 93059 |
| 901 | Ga0495605_0000167 | 3300046474 | Bacteria | 83036 |
| 902 | Ga0495605_0001345 | 3300046474 | Bacteria | 16276 |
| 903 | Ga0495605_0006673 | 3300046474 | Bacteria | 6608 |
| 904 | Ga0495605_0010585 | 3300046474 | Bacteria | 5158 |
| 905 | Ga0495605_0011091 | 3300046474 | Bacteria | 5033 |
| 906 | Ga0495605_0027836 | 3300046474 | Bacteria | 2923 |
| 907 | Ga0495605_0028766 | 3300046474 | Bacteria | 2866 |
| 908 | Ga0495639_0000732 | 3300046475 | Bacteria | 15017 |
| 909 | Ga0495584_0001949 | 3300046491 | Bacteria | 11875 |
| 910 | Ga0495584_0003603 | 3300046491 | Bacteria | 8448 |
| 911 | Ga0495584_0003616 | 3300046491 | Bacteria | 8431 |
| 912 | Ga0495584_0004904 | 3300046491 | Bacteria | 7142 |
| 913 | Ga0495584_0008253 | 3300046491 | Bacteria | 5397 |
| 914 | Ga0495584_0010064 | 3300046491 | Bacteria | 4855 |
| 915 | Ga0495585_0000937 | 3300046492 | Bacteria | 24621 |
| 916 | Ga0495585_0004782 | 3300046492 | Bacteria | 8713 |
| 917 | Ga0495585_0005409 | 3300046492 | Bacteria | 8053 |
| 918 | Ga0495585_0010129 | 3300046492 | Bacteria | 5631 |
| 919 | Ga0495596_0001631 | 3300046500 | Bacteria | 12744 |
| 920 | Ga0495596_0012106 | 3300046500 | Bacteria | 3703 |
| 921 | Ga0495607_0000340 | 3300046501 | Bacteria | 48340 |
| 922 | Ga0495607_0000703 | 3300046501 | Bacteria | 32246 |
| 923 | Ga0495607_0001371 | 3300046501 | Bacteria | 21663 |
| 924 | Ga0495607_0001606 | 3300046501 | Bacteria | 19634 |
| 925 | Ga0495607_0001890 | 3300046501 | Bacteria | 17769 |
| 926 | Ga0495607_0002265 | 3300046501 | Bacteria | 15867 |
| 927 | Ga0495607_0002471 | 3300046501 | Bacteria | 15006 |
| 928 | Ga0495607_0003408 | 3300046501 | Bacteria | 12183 |
| 929 | Ga0495607_0005373 | 3300046501 | Bacteria | 9194 |
| 930 | Ga0495607_0006396 | 3300046501 | Bacteria | 8295 |
| 931 | Ga0495607_0008982 | 3300046501 | Bacteria | 6800 |
| 932 | Ga0495607_0009021 | 3300046501 | Bacteria | 6780 |
| 933 | Ga0495607_0014641 | 3300046501 | Bacteria | 5099 |
| 934 | Ga0495607_0062998 | 3300046501 | Bacteria | 2099 |
| 935 | Ga0495607_0063840 | 3300046501 | Bacteria | 2081 |
| 936 | Ga0495583_0000031 | 3300046506 | Bacteria | 253982 |
| 937 | Ga0495583_0002043 | 3300046506 | Bacteria | 18367 |
| 938 | Ga0495583_0002145 | 3300046506 | Bacteria | 17616 |
| 939 | Ga0495583_0002689 | 3300046506 | Bacteria | 14779 |
| 940 | Ga0495583_0004670 | 3300046506 | Bacteria | 9658 |
| 941 | Ga0495583_0005160 | 3300046506 | Bacteria | 8992 |
| 942 | Ga0495583_0006720 | 3300046506 | Bacteria | 7447 |
| 943 | Ga0495583_0020275 | 3300046506 | Bacteria | 3449 |
| 944 | Ga0495606_0000217 | 3300046507 | Bacteria | 101671 |
| 945 | Ga0495606_0000313 | 3300046507 | Bacteria | 83765 |
| 946 | Ga0495606_0000364 | 3300046507 | Bacteria | 77490 |
| 947 | Ga0495606_0004876 | 3300046507 | Bacteria | 13148 |
| 948 | Ga0495606_0007491 | 3300046507 | Bacteria | 9749 |
| 949 | Ga0495606_0008233 | 3300046507 | Bacteria | 9107 |
| 950 | Ga0495606_0008338 | 3300046507 | Bacteria | 9027 |
| 951 | Ga0495606_0009331 | 3300046507 | Bacteria | 8316 |
| 952 | Ga0495606_0014787 | 3300046507 | Bacteria | 6062 |
| 953 | Ga0495606_0024715 | 3300046507 | Bacteria | 4322 |
| 954 | Ga0495606_0082560 | 3300046507 | Bacteria | 1994 |
| 955 | Ga0495610_0006115 | 3300046512 | Bacteria | 8394 |
| 956 | Ga0495610_0006148 | 3300046512 | Bacteria | 8353 |
| 957 | Ga0495610_0007886 | 3300046512 | Bacteria | 6996 |
| 958 | Ga0495610_0008702 | 3300046512 | Bacteria | 6531 |
| 959 | Ga0495610_0011833 | 3300046512 | Bacteria | 5301 |
| 960 | Ga0495610_0014670 | 3300046512 | Bacteria | 4593 |
| 961 | Ga0495610_0019602 | 3300046512 | Bacteria | 3778 |
| 962 | Ga0495610_0020628 | 3300046512 | Bacteria | 3654 |
| 963 | Ga0495610_0023269 | 3300046512 | Bacteria | 3372 |
| 964 | Ga0495616_0000964 | 3300046513 | Bacteria | 20644 |
| 965 | Ga0495616_0003956 | 3300046513 | Bacteria | 9437 |
| 966 | Ga0495616_0004838 | 3300046513 | Bacteria | 8436 |
| 967 | Ga0495616_0005311 | 3300046513 | Bacteria | 7940 |
| 968 | Ga0495616_0013706 | 3300046513 | Bacteria | 4563 |
| 969 | Ga0495616_0034514 | 3300046513 | Bacteria | 2627 |
| 970 | Ga0495616_0044994 | 3300046513 | Bacteria | 2236 |
| 971 | Ga0495616_0053072 | 3300046513 | Bacteria | 2016 |
| 972 | Ga0495616_0054048 | 3300046513 | Bacteria | 1993 |
| 973 | Ga0495620_0000052 | 3300046515 | Bacteria | 103693 |
| 974 | Ga0495620_0000099 | 3300046515 | Bacteria | 69356 |
| 975 | Ga0495620_0000482 | 3300046515 | Bacteria | 25941 |
| 976 | Ga0495620_0000811 | 3300046515 | Bacteria | 19225 |
| 977 | Ga0495620_0004878 | 3300046515 | Bacteria | 7531 |
| 978 | Ga0495620_0006041 | 3300046515 | Bacteria | 6702 |
| 979 | Ga0495620_0006387 | 3300046515 | Bacteria | 6482 |
| 980 | Ga0495620_0007738 | 3300046515 | Bacteria | 5804 |
| 981 | Ga0495620_0034874 | 3300046515 | Bacteria | 2269 |
| 982 | Ga0495630_0018059 | 3300046517 | Bacteria | 5177 |
| 983 | Ga0495630_0054199 | 3300046517 | Bacteria | 3004 |
| 984 | Ga0495630_0107201 | 3300046517 | Bacteria | 2116 |
| 985 | Ga0495631_0000953 | 3300046518 | Bacteria | 18020 |
| 986 | Ga0495631_0003543 | 3300046518 | Bacteria | 8533 |
| 987 | Ga0495631_0004428 | 3300046518 | Bacteria | 7482 |
| 988 | Ga0495632_0001542 | 3300046519 | Bacteria | 19038 |
| 989 | Ga0495632_0002560 | 3300046519 | Bacteria | 13770 |
| 990 | Ga0495632_0007683 | 3300046519 | Bacteria | 6733 |
| 991 | Ga0495632_0007887 | 3300046519 | Bacteria | 6615 |
| 992 | Ga0495632_0008623 | 3300046519 | Bacteria | 6225 |
| 993 | Ga0495632_0008850 | 3300046519 | Bacteria | 6122 |
| 994 | Ga0495632_0011595 | 3300046519 | Bacteria | 5133 |
| 995 | Ga0495632_0011700 | 3300046519 | Bacteria | 5107 |
| 996 | Ga0495632_0015018 | 3300046519 | Bacteria | 4357 |
| 997 | Ga0495632_0016104 | 3300046519 | Bacteria | 4168 |
| 998 | Ga0495632_0016723 | 3300046519 | Bacteria | 4069 |
| 999 | Ga0495632_0022037 | 3300046519 | Bacteria | 3422 |
| 1000 | Ga0495632_0027337 | 3300046519 | Bacteria | 2989 |
| 1001 | Ga0495632_0035855 | 3300046519 | Bacteria | 2527 |
| 1002 | Ga0495632_0049670 | 3300046519 | Bacteria | 2072 |
| 1003 | Ga0495637_0000059 | 3300046520 | Bacteria | 96238 |
| 1004 | Ga0495637_0000816 | 3300046520 | Bacteria | 20571 |
| 1005 | Ga0495637_0000931 | 3300046520 | Bacteria | 18727 |
| 1006 | Ga0495637_0003407 | 3300046520 | Bacteria | 8442 |
| 1007 | Ga0495637_0003519 | 3300046520 | Bacteria | 8303 |
| 1008 | Ga0495637_0004240 | 3300046520 | Bacteria | 7450 |
| 1009 | Ga0495637_0011919 | 3300046520 | Bacteria | 4166 |
| 1010 | Ga0495637_0016561 | 3300046520 | Bacteria | 3444 |
| 1011 | Ga0495637_0018178 | 3300046520 | Bacteria | 3265 |
| 1012 | Ga0495637_0028057 | 3300046520 | Bacteria | 2515 |
| 1013 | Ga0495637_0031181 | 3300046520 | Bacteria | 2359 |
| 1014 | Ga0495637_0048068 | 3300046520 | Bacteria | 1798 |
| 1015 | Ga0495637_0055229 | 3300046520 | Bacteria | 1647 |
| 1016 | Ga0495643_0000197 | 3300046522 | Bacteria | 95489 |
| 1017 | Ga0495643_0000404 | 3300046522 | Bacteria | 56411 |
| 1018 | Ga0495643_0011424 | 3300046522 | Bacteria | 5407 |
| 1019 | Ga0495643_0015062 | 3300046522 | Bacteria | 4581 |
| 1020 | Ga0495643_0031462 | 3300046522 | Bacteria | 2952 |
| 1021 | Ga0495643_0039746 | 3300046522 | Bacteria | 2572 |
| 1022 | Ga0495643_0081844 | 3300046522 | Bacteria | 1678 |
| 1023 | Ga0495644_0000942 | 3300046523 | Bacteria | 12035 |
| 1024 | Ga0495644_0001481 | 3300046523 | Bacteria | 9567 |
| 1025 | Ga0495644_0002056 | 3300046523 | Bacteria | 8108 |
| 1026 | Ga0495644_0004561 | 3300046523 | Bacteria | 5446 |
| 1027 | Ga0495648_0001828 | 3300046524 | Bacteria | 20470 |
| 1028 | Ga0495648_0002424 | 3300046524 | Bacteria | 17284 |
| 1029 | Ga0495648_0004782 | 3300046524 | Bacteria | 11454 |
| 1030 | Ga0495648_0006093 | 3300046524 | Bacteria | 9892 |
| 1031 | Ga0495648_0010250 | 3300046524 | Bacteria | 7157 |
| 1032 | Ga0495648_0011321 | 3300046524 | Bacteria | 6729 |
| 1033 | Ga0495648_0014386 | 3300046524 | Bacteria | 5796 |
| 1034 | Ga0495648_0018256 | 3300046524 | Bacteria | 4977 |
| 1035 | Ga0495648_0018618 | 3300046524 | Bacteria | 4908 |
| 1036 | Ga0495648_0032715 | 3300046524 | Bacteria | 3407 |
| 1037 | Ga0495648_0034269 | 3300046524 | Bacteria | 3305 |
| 1038 | Ga0495648_0075457 | 3300046524 | Bacteria | 1939 |
| 1039 | Ga0495666_0003871 | 3300046526 | Bacteria | 7571 |
| 1040 | Ga0495666_0017193 | 3300046526 | Bacteria | 3602 |
| 1041 | Ga0495666_0027594 | 3300046526 | Bacteria | 2794 |
| 1042 | Ga0495642_0000276 | 3300046528 | Bacteria | 29070 |
| 1043 | Ga0495642_0000490 | 3300046528 | Bacteria | 20281 |
| 1044 | Ga0495654_0000031 | 3300046530 | Bacteria | 206800 |
| 1045 | Ga0495654_0000342 | 3300046530 | Bacteria | 40679 |
| 1046 | Ga0495654_0001661 | 3300046530 | Bacteria | 15056 |
| 1047 | Ga0495654_0001908 | 3300046530 | Bacteria | 13842 |
| 1048 | Ga0495654_0002241 | 3300046530 | Bacteria | 12524 |
| 1049 | Ga0495654_0002255 | 3300046530 | Bacteria | 12478 |
| 1050 | Ga0495654_0004408 | 3300046530 | Bacteria | 8360 |
| 1051 | Ga0495654_0004885 | 3300046530 | Bacteria | 7890 |
| 1052 | Ga0495654_0005191 | 3300046530 | Bacteria | 7596 |
| 1053 | Ga0495654_0006155 | 3300046530 | Bacteria | 6860 |
| 1054 | Ga0495654_0010455 | 3300046530 | Bacteria | 5048 |
| 1055 | Ga0495654_0013393 | 3300046530 | Bacteria | 4389 |
| 1056 | Ga0495654_0028656 | 3300046530 | Bacteria | 2845 |
| 1057 | Ga0495654_0029367 | 3300046530 | Bacteria | 2804 |
| 1058 | Ga0495654_0035733 | 3300046530 | Bacteria | 2499 |
| 1059 | Ga0495654_0081484 | 3300046530 | Bacteria | 1516 |
| 1060 | Ga0495587_0019792 | 3300046536 | Bacteria | 4160 |
| 1061 | Ga0495609_0000018 | 3300046538 | Bacteria | 302609 |
| 1062 | Ga0495609_0000123 | 3300046538 | Bacteria | 86194 |
| 1063 | Ga0495609_0000194 | 3300046538 | Bacteria | 60772 |
| 1064 | Ga0495609_0003847 | 3300046538 | Bacteria | 8444 |
| 1065 | Ga0495609_0003853 | 3300046538 | Bacteria | 8432 |
| 1066 | Ga0495609_0008134 | 3300046538 | Bacteria | 5162 |
| 1067 | Ga0495597_0000066 | 3300046542 | Bacteria | 90474 |
| 1068 | Ga0495597_0001966 | 3300046542 | Bacteria | 13805 |
| 1069 | Ga0495597_0005872 | 3300046542 | Bacteria | 6416 |
| 1070 | Ga0495597_0006609 | 3300046542 | Bacteria | 5980 |
| 1071 | Ga0495597_0013577 | 3300046542 | Bacteria | 3897 |
| 1072 | Ga0495597_0023807 | 3300046542 | Bacteria | 2830 |
| 1073 | Ga0495597_0027194 | 3300046542 | Bacteria | 2623 |
| 1074 | Ga0495597_0033173 | 3300046542 | Bacteria | 2339 |
| 1075 | Ga0495597_0037170 | 3300046542 | Bacteria | 2187 |
| 1076 | Ga0495622_0001082 | 3300046557 | Bacteria | 14241 |
| 1077 | Ga0495622_0003665 | 3300046557 | Bacteria | 7205 |
| 1078 | Ga0495622_0025393 | 3300046557 | Bacteria | 2767 |
| 1079 | Ga0495633_0003764 | 3300046558 | Bacteria | 9970 |
| 1080 | Ga0495633_0004090 | 3300046558 | Bacteria | 9412 |
| 1081 | Ga0495656_0039517 | 3300046615 | Bacteria | 1960 |
| 1082 | Ga0495668_0003074 | 3300046616 | Bacteria | 12915 |
| 1083 | Ga0495668_0004765 | 3300046616 | Bacteria | 9485 |
| 1084 | Ga0495668_0005370 | 3300046616 | Bacteria | 8730 |
| 1085 | Ga0495668_0020614 | 3300046616 | Bacteria | 3789 |
| 1086 | Ga0495668_0051162 | 3300046616 | Bacteria | 2287 |
| 1087 | Ga0495634_0009812 | 3300046642 | Bacteria | 7044 |
| 1088 | Ga0495611_0001586 | 3300046648 | Bacteria | 11112 |
| 1089 | Ga0495611_0004574 | 3300046648 | Bacteria | 5957 |
| 1090 | Ga0495625_0000202 | 3300046660 | Bacteria | 94655 |
| 1091 | Ga0495625_0001706 | 3300046660 | Bacteria | 25551 |
| 1092 | Ga0495625_0005131 | 3300046660 | Bacteria | 12100 |
| 1093 | Ga0495625_0006971 | 3300046660 | Bacteria | 9965 |
| 1094 | Ga0495625_0007674 | 3300046660 | Bacteria | 9349 |
| 1095 | Ga0495625_0011941 | 3300046660 | Bacteria | 7051 |
| 1096 | Ga0495625_0024843 | 3300046660 | Bacteria | 4551 |
| 1097 | Ga0495625_0054711 | 3300046660 | Bacteria | 2849 |
| 1098 | Ga0495635_0007404 | 3300046663 | Bacteria | 7661 |
| 1099 | Ga0495635_0046477 | 3300046663 | Bacteria | 2994 |
| 1100 | Ga0495659_0000457 | 3300046664 | Bacteria | 15230 |
| 1101 | Ga0495659_0002039 | 3300046664 | Bacteria | 6616 |
| 1102 | Ga0495661_0000075 | 3300046665 | Bacteria | 119777 |
| 1103 | Ga0495661_0000133 | 3300046665 | Bacteria | 88428 |
| 1104 | Ga0495661_0000336 | 3300046665 | Bacteria | 51167 |
| 1105 | Ga0495661_0001986 | 3300046665 | Bacteria | 16171 |
| 1106 | Ga0495661_0003038 | 3300046665 | Bacteria | 12640 |
| 1107 | Ga0495661_0005482 | 3300046665 | Bacteria | 9001 |
| 1108 | Ga0495661_0010774 | 3300046665 | Bacteria | 6222 |
| 1109 | Ga0495661_0043538 | 3300046665 | Bacteria | 2758 |
| 1110 | Ga0495661_0073244 | 3300046665 | Bacteria | 1996 |
| 1111 | Ga0495588_0056997 | 3300046674 | Bacteria | 2017 |
| 1112 | Ga0495623_0010642 | 3300046679 | Bacteria | 5954 |
| 1113 | Ga0495646_0031588 | 3300046680 | Bacteria | 3298 |
| 1114 | Ga0495669_0051240 | 3300046684 | Bacteria | 1852 |
| 1115 | Ga0495613_0144945 | 3300046689 | Bacteria | 1695 |
| 1116 | Ga0495624_0001179 | 3300046690 | Bacteria | 20701 |
| 1117 | Ga0495670_0000715 | 3300046691 | Bacteria | 15822 |
| 1118 | Ga0495670_0002855 | 3300046691 | Bacteria | 8535 |
| 1119 | Ga0495670_0007109 | 3300046691 | Bacteria | 5512 |
| 1120 | Ga0495670_0007882 | 3300046691 | Bacteria | 5236 |
| 1121 | Ga0495670_0008345 | 3300046691 | Bacteria | 5091 |
| 1122 | Ga0495670_0009264 | 3300046691 | Bacteria | 4842 |
| 1123 | Ga0495671_0001378 | 3300046692 | Bacteria | 16494 |
| 1124 | Ga0495671_0001513 | 3300046692 | Bacteria | 15559 |
| 1125 | Ga0495671_0004814 | 3300046692 | Bacteria | 7977 |
| 1126 | Ga0495671_0004830 | 3300046692 | Bacteria | 7965 |
| 1127 | Ga0495671_0004870 | 3300046692 | Bacteria | 7942 |
| 1128 | Ga0495671_0005064 | 3300046692 | Bacteria | 7760 |
| 1129 | Ga0495671_0007843 | 3300046692 | Bacteria | 6040 |
| 1130 | Ga0495671_0009478 | 3300046692 | Bacteria | 5438 |
| 1131 | Ga0495671_0011691 | 3300046692 | Bacteria | 4814 |
| 1132 | Ga0495671_0012933 | 3300046692 | Bacteria | 4542 |
| 1133 | Ga0495671_0015819 | 3300046692 | Bacteria | 4037 |
| 1134 | Ga0495671_0018358 | 3300046692 | Bacteria | 3713 |
| 1135 | Ga0495671_0046150 | 3300046692 | Bacteria | 2179 |
| 1136 | Ga0495671_0066731 | 3300046692 | Bacteria | 1770 |
| 1137 | Ga0495649_0001000 | 3300046694 | Bacteria | 22223 |
| 1138 | Ga0495649_0001508 | 3300046694 | Bacteria | 17467 |
| 1139 | Ga0495649_0003489 | 3300046694 | Bacteria | 10593 |
| 1140 | Ga0495649_0004598 | 3300046694 | Bacteria | 8977 |
| 1141 | Ga0495649_0004606 | 3300046694 | Bacteria | 8969 |
| 1142 | Ga0495649_0005123 | 3300046694 | Bacteria | 8408 |
| 1143 | Ga0495649_0006097 | 3300046694 | Bacteria | 7537 |
| 1144 | Ga0495649_0006109 | 3300046694 | Bacteria | 7528 |
| 1145 | Ga0495649_0006258 | 3300046694 | Bacteria | 7413 |
| 1146 | Ga0495649_0009541 | 3300046694 | Bacteria | 5757 |
| 1147 | Ga0495649_0013854 | 3300046694 | Bacteria | 4638 |
| 1148 | Ga0495649_0016529 | 3300046694 | Bacteria | 4181 |
| 1149 | Ga0495649_0022237 | 3300046694 | Bacteria | 3548 |
| 1150 | Ga0495649_0029337 | 3300046694 | Bacteria | 3043 |
| 1151 | Ga0495649_0054306 | 3300046694 | Bacteria | 2166 |
| 1152 | Ga0495589_0000005 | 3300046794 | Bacteria | 405112 |
| 1153 | Ga0495589_0003312 | 3300046794 | Bacteria | 8739 |
| 1154 | Ga0495589_0004738 | 3300046794 | Bacteria | 7219 |
| 1155 | Ga0495589_0005996 | 3300046794 | Bacteria | 6418 |
| 1156 | Ga0495589_0009187 | 3300046794 | Bacteria | 5141 |
| 1157 | Ga0495589_0014113 | 3300046794 | Bacteria | 4118 |
| 1158 | Ga0495589_0017712 | 3300046794 | Bacteria | 3655 |
| 1159 | Ga0495600_0018264 | 3300046809 | Bacteria | 4465 |
| 1160 | Ga0495660_0000013 | 3300046810 | Bacteria | 350283 |
| 1161 | Ga0495660_0000034 | 3300046810 | Bacteria | 201261 |
| 1162 | Ga0495660_0001176 | 3300046810 | Bacteria | 18465 |
| 1163 | Ga0495660_0004652 | 3300046810 | Bacteria | 8275 |
| 1164 | Ga0495660_0006205 | 3300046810 | Bacteria | 7093 |
| 1165 | Ga0495660_0008586 | 3300046810 | Bacteria | 5978 |
| 1166 | Ga0495660_0008799 | 3300046810 | Bacteria | 5895 |
| 1167 | Ga0495660_0011032 | 3300046810 | Bacteria | 5246 |
| 1168 | Ga0495660_0021990 | 3300046810 | Bacteria | 3645 |
| 1169 | Ga0495660_0051365 | 3300046810 | Bacteria | 2243 |
| 1170 | Ga0495660_0079955 | 3300046810 | Bacteria | 1716 |
| 1171 | Ga0495581_0019114 | 3300047315 | Bacteria | 3977 |
| 1172 | Ga0495636_0010709 | 3300047318 | Bacteria | 3625 |
| 1173 | Ga0495674_0017039 | 3300047319 | Bacteria | 6771 |
| 1174 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 1175 | Ga0495672_0000051 | 3300047320 | Bacteria | 237883 |
| 1176 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 1177 | Ga0495672_0002280 | 3300047320 | Bacteria | 17814 |
| 1178 | Ga0495672_0008082 | 3300047320 | Bacteria | 7815 |
| 1179 | Ga0495672_0009270 | 3300047320 | Bacteria | 7151 |
| 1180 | Ga0495672_0011348 | 3300047320 | Bacteria | 6294 |
| 1181 | Ga0495672_0011640 | 3300047320 | Bacteria | 6194 |
| 1182 | Ga0495672_0011731 | 3300047320 | Bacteria | 6162 |
| 1183 | Ga0495672_0015303 | 3300047320 | Bacteria | 5214 |
| 1184 | Ga0495672_0028587 | 3300047320 | Bacteria | 3525 |
| 1185 | Ga0495672_0032984 | 3300047320 | Bacteria | 3213 |
| 1186 | Ga0495672_0059323 | 3300047320 | Bacteria | 2214 |
| 1187 | Ga0495672_0061030 | 3300047320 | Bacteria | 2174 |
| 1188 | Ga0495676_0000053 | 3300047321 | Bacteria | 95693 |
| 1189 | Ga0495676_0010218 | 3300047321 | Bacteria | 8522 |
| 1190 | Ga0495676_0013031 | 3300047321 | Bacteria | 7482 |
| 1191 | Ga0495680_0008378 | 3300047322 | Bacteria | 9400 |
| 1192 | Ga0495680_0011624 | 3300047322 | Bacteria | 7779 |
| 1193 | Ga0495680_0016108 | 3300047322 | Bacteria | 6427 |
| 1194 | Ga0495680_0158737 | 3300047322 | Bacteria | 1643 |
| 1195 | Ga0495683_0000043 | 3300047323 | Bacteria | 136876 |
| 1196 | Ga0495683_0000082 | 3300047323 | Bacteria | 94515 |
| 1197 | Ga0495683_0001174 | 3300047323 | Bacteria | 17901 |
| 1198 | Ga0495683_0001446 | 3300047323 | Bacteria | 15578 |
| 1199 | Ga0495683_0008158 | 3300047323 | Bacteria | 5618 |
| 1200 | Ga0495683_0032185 | 3300047323 | Bacteria | 2671 |
| 1201 | Ga0495683_0033568 | 3300047323 | Bacteria | 2610 |
| 1202 | Ga0495683_0037968 | 3300047323 | Bacteria | 2439 |
| 1203 | Ga0495687_002579 | 3300047443 | Bacteria | 14291 |
| 1204 | Ga0495687_010786 | 3300047443 | Bacteria | 4974 |
| 1205 | Ga0495687_012830 | 3300047443 | Bacteria | 4409 |
| 1206 | Ga0495675_0017433 | 3300047444 | Bacteria | 4550 |
| 1207 | Ga0495679_000014 | 3300047446 | Bacteria | 292767 |
| 1208 | Ga0495679_000305 | 3300047446 | Bacteria | 39514 |
| 1209 | Ga0495679_000401 | 3300047446 | Bacteria | 32512 |
| 1210 | Ga0495679_000923 | 3300047446 | Bacteria | 18335 |
| 1211 | Ga0495679_012962 | 3300047446 | Bacteria | 3149 |
| 1212 | Ga0495673_0000047 | 3300047469 | Bacteria | 266522 |
| 1213 | Ga0495673_0000517 | 3300047469 | Bacteria | 40822 |
| 1214 | Ga0495673_0001376 | 3300047469 | Bacteria | 19632 |
| 1215 | Ga0495673_0001555 | 3300047469 | Bacteria | 17984 |
| 1216 | Ga0495673_0001645 | 3300047469 | Bacteria | 17245 |
| 1217 | Ga0495673_0001654 | 3300047469 | Bacteria | 17196 |
| 1218 | Ga0495673_0002191 | 3300047469 | Bacteria | 14168 |
| 1219 | Ga0495673_0003703 | 3300047469 | Bacteria | 9945 |
| 1220 | Ga0495673_0004615 | 3300047469 | Bacteria | 8574 |
| 1221 | Ga0495673_0004624 | 3300047469 | Bacteria | 8567 |
| 1222 | Ga0495673_0006316 | 3300047469 | Bacteria | 6982 |
| 1223 | Ga0495673_0006785 | 3300047469 | Bacteria | 6686 |
| 1224 | Ga0495673_0008889 | 3300047469 | Bacteria | 5600 |
| 1225 | Ga0495673_0013301 | 3300047469 | Bacteria | 4327 |
| 1226 | Ga0495673_0027528 | 3300047469 | Bacteria | 2704 |
| 1227 | Ga0495673_0032490 | 3300047469 | Bacteria | 2431 |
| 1228 | Ga0495681_0001974 | 3300047470 | Bacteria | 14987 |
| 1229 | Ga0495681_0002070 | 3300047470 | Bacteria | 14573 |
| 1230 | Ga0495681_0002174 | 3300047470 | Bacteria | 14205 |
| 1231 | Ga0495681_0002684 | 3300047470 | Bacteria | 12604 |
| 1232 | Ga0495681_0006168 | 3300047470 | Bacteria | 7915 |
| 1233 | Ga0495681_0006631 | 3300047470 | Bacteria | 7565 |
| 1234 | Ga0495681_0018594 | 3300047470 | Bacteria | 3825 |
| 1235 | Ga0495681_0023460 | 3300047470 | Bacteria | 3276 |
| 1236 | Ga0495681_0045278 | 3300047470 | Bacteria | 2106 |
| 1237 | Ga0495681_0048968 | 3300047470 | Bacteria | 2000 |
| 1238 | Ga0495686_0008099 | 3300047472 | Bacteria | 7771 |
| 1239 | Ga0495686_0012478 | 3300047472 | Bacteria | 5941 |
| 1240 | Ga0495686_0025928 | 3300047472 | Bacteria | 3838 |
| 1241 | Ga0495593_0006443 | 3300047673 | Bacteria | 6880 |
| 1242 | Ga0495602_0009613 | 3300048088 | Bacteria | 10051 |
| 1243 | Ga0495626_0000261 | 3300048091 | Bacteria | 60058 |
| 1244 | Ga0495626_0001455 | 3300048091 | Bacteria | 18744 |
| 1245 | Ga0495626_0001872 | 3300048091 | Bacteria | 15768 |
| 1246 | Ga0495626_0002288 | 3300048091 | Bacteria | 13583 |
| 1247 | Ga0495626_0002548 | 3300048091 | Bacteria | 12504 |
| 1248 | Ga0495626_0004275 | 3300048091 | Bacteria | 8813 |
| 1249 | Ga0495626_0005048 | 3300048091 | Bacteria | 7873 |
| 1250 | Ga0495626_0005862 | 3300048091 | Bacteria | 7080 |
| 1251 | Ga0496100_0018550 | 3300048903 | Bacteria | 4129 |
| 1252 | Ga0496101_0000158 | 3300048904 | Bacteria | 57788 |
| 1253 | Ga0496102_0002699 | 3300048905 | Bacteria | 15088 |
| 1254 | Ga0496102_0058604 | 3300048905 | Bacteria | 3519 |
| 1255 | Ga0496103_0004499 | 3300048906 | Bacteria | 8446 |
| 1256 | Ga0496104_0000302 | 3300048907 | Bacteria | 43843 |
| 1257 | Ga0496104_0000668 | 3300048907 | Bacteria | 29410 |
| 1258 | Ga0496104_0003933 | 3300048907 | Bacteria | 12850 |
| 1259 | Ga0496105_0003806 | 3300048908 | Bacteria | 11251 |
| 1260 | Ga0496107_0076292 | 3300048910 | Bacteria | 2441 |
| 1261 | Ga0496108_0019313 | 3300048911 | Bacteria | 5596 |
| 1262 | Ga0496110_0110591 | 3300048913 | Bacteria | 2469 |
| 1263 | Ga0496112_0172793 | 3300048915 | Bacteria | 2126 |
| 1264 | Ga0496114_0005875 | 3300048917 | Bacteria | 9646 |
| 1265 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 1266 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 1267 | Ga0496116_0000107 | 3300048919 | Bacteria | 188067 |
| 1268 | Ga0496116_0000267 | 3300048919 | Bacteria | 91320 |
| 1269 | Ga0496116_0000835 | 3300048919 | Bacteria | 38885 |
| 1270 | Ga0496116_0000904 | 3300048919 | Bacteria | 36723 |
| 1271 | Ga0496116_0003287 | 3300048919 | Bacteria | 16068 |
| 1272 | Ga0496116_0007651 | 3300048919 | Bacteria | 9530 |
| 1273 | Ga0496116_0009027 | 3300048919 | Bacteria | 8563 |
| 1274 | Ga0496116_0009042 | 3300048919 | Bacteria | 8552 |
| 1275 | Ga0496116_0033570 | 3300048919 | Bacteria | 3640 |
| 1276 | Ga0496116_0044155 | 3300048919 | Bacteria | 3030 |
| 1277 | Ga0496116_0054828 | 3300048919 | Bacteria | 2623 |
| 1278 | Ga0496117_0000103 | 3300048920 | Bacteria | 189316 |
| 1279 | Ga0496117_0000183 | 3300048920 | Bacteria | 127679 |
| 1280 | Ga0496117_0000238 | 3300048920 | Bacteria | 104303 |
| 1281 | Ga0496117_0000345 | 3300048920 | Bacteria | 82051 |
| 1282 | Ga0496117_0001664 | 3300048920 | Bacteria | 31144 |
| 1283 | Ga0496117_0003235 | 3300048920 | Bacteria | 19188 |
| 1284 | Ga0496117_0004149 | 3300048920 | Bacteria | 16193 |
| 1285 | Ga0496117_0004534 | 3300048920 | Bacteria | 15234 |
| 1286 | Ga0496117_0004589 | 3300048920 | Bacteria | 15103 |
| 1287 | Ga0496117_0007472 | 3300048920 | Bacteria | 10661 |
| 1288 | Ga0496117_0007955 | 3300048920 | Bacteria | 10184 |
| 1289 | Ga0496117_0009147 | 3300048920 | Bacteria | 9286 |
| 1290 | Ga0496117_0017496 | 3300048920 | Bacteria | 5985 |
| 1291 | Ga0496117_0035949 | 3300048920 | Bacteria | 3712 |
| 1292 | Ga0496117_0035964 | 3300048920 | Bacteria | 3711 |
| 1293 | Ga0496117_0055595 | 3300048920 | Bacteria | 2765 |
| 1294 | Ga0496117_0057654 | 3300048920 | Bacteria | 2695 |
| 1295 | Ga0496118_0000046 | 3300048921 | Bacteria | 271783 |
| 1296 | Ga0496118_0001062 | 3300048921 | Bacteria | 42938 |
| 1297 | Ga0496118_0001278 | 3300048921 | Bacteria | 38517 |
| 1298 | Ga0496118_0002104 | 3300048921 | Bacteria | 27943 |
| 1299 | Ga0496118_0002946 | 3300048921 | Bacteria | 22116 |
| 1300 | Ga0496118_0003804 | 3300048921 | Bacteria | 18596 |
| 1301 | Ga0496118_0003831 | 3300048921 | Bacteria | 18510 |
| 1302 | Ga0496118_0009161 | 3300048921 | Bacteria | 10057 |
| 1303 | Ga0496118_0011289 | 3300048921 | Bacteria | 8737 |
| 1304 | Ga0496118_0022852 | 3300048921 | Bacteria | 5452 |
| 1305 | Ga0496118_0025190 | 3300048921 | Bacteria | 5110 |
| 1306 | Ga0496118_0052119 | 3300048921 | Bacteria | 3124 |
| 1307 | Ga0496118_0071085 | 3300048921 | Bacteria | 2507 |
| 1308 | Ga0496119_0000026 | 3300048922 | Bacteria | 254759 |
| 1309 | Ga0496119_0000031 | 3300048922 | Bacteria | 239685 |
| 1310 | Ga0496119_0000199 | 3300048922 | Bacteria | 84539 |
| 1311 | Ga0496119_0000374 | 3300048922 | Bacteria | 61884 |
| 1312 | Ga0496119_0000391 | 3300048922 | Bacteria | 60498 |
| 1313 | Ga0496119_0001418 | 3300048922 | Bacteria | 29010 |
| 1314 | Ga0496119_0002255 | 3300048922 | Bacteria | 21447 |
| 1315 | Ga0496119_0002834 | 3300048922 | Bacteria | 18539 |
| 1316 | Ga0496119_0002989 | 3300048922 | Bacteria | 17940 |
| 1317 | Ga0496119_0002994 | 3300048922 | Bacteria | 17918 |
| 1318 | Ga0496119_0005635 | 3300048922 | Bacteria | 11900 |
| 1319 | Ga0496119_0027444 | 3300048922 | Bacteria | 3911 |
| 1320 | Ga0496119_0048933 | 3300048922 | Bacteria | 2617 |
| 1321 | Ga0496120_0000017 | 3300048923 | Bacteria | 269222 |
| 1322 | Ga0496120_0000317 | 3300048923 | Bacteria | 79762 |
| 1323 | Ga0496120_0000491 | 3300048923 | Bacteria | 61896 |
| 1324 | Ga0496120_0000806 | 3300048923 | Bacteria | 45060 |
| 1325 | Ga0496120_0000840 | 3300048923 | Bacteria | 43691 |
| 1326 | Ga0496120_0001006 | 3300048923 | Bacteria | 37957 |
| 1327 | Ga0496120_0001012 | 3300048923 | Bacteria | 37715 |
| 1328 | Ga0496120_0001022 | 3300048923 | Bacteria | 37416 |
| 1329 | Ga0496120_0001442 | 3300048923 | Bacteria | 28529 |
| 1330 | Ga0496120_0002864 | 3300048923 | Bacteria | 16598 |
| 1331 | Ga0496120_0006711 | 3300048923 | Bacteria | 8756 |
| 1332 | Ga0496120_0013652 | 3300048923 | Bacteria | 5457 |
| 1333 | Ga0496120_0022993 | 3300048923 | Bacteria | 3908 |
| 1334 | Ga0496120_0026635 | 3300048923 | Bacteria | 3567 |
| 1335 | Ga0496121_0000366 | 3300048924 | Bacteria | 92773 |
| 1336 | Ga0496121_0001130 | 3300048924 | Bacteria | 46848 |
| 1337 | Ga0496121_0001160 | 3300048924 | Bacteria | 46200 |
| 1338 | Ga0496121_0004084 | 3300048924 | Bacteria | 20053 |
| 1339 | Ga0496121_0005503 | 3300048924 | Bacteria | 16197 |
| 1340 | Ga0496121_0005581 | 3300048924 | Bacteria | 16068 |
| 1341 | Ga0496121_0007929 | 3300048924 | Bacteria | 12693 |
| 1342 | Ga0496121_0013954 | 3300048924 | Bacteria | 8584 |
| 1343 | Ga0496121_0027349 | 3300048924 | Bacteria | 5338 |
| 1344 | Ga0496121_0030100 | 3300048924 | Bacteria | 4995 |
| 1345 | Ga0496121_0050458 | 3300048924 | Bacteria | 3515 |
| 1346 | Ga0496121_0052221 | 3300048924 | Bacteria | 3435 |
| 1347 | Ga0496121_0079971 | 3300048924 | Bacteria | 2593 |
| 1348 | Ga0496121_0086603 | 3300048924 | Bacteria | 2461 |
| 1349 | Ga0496122_0000075 | 3300048925 | Bacteria | 219099 |
| 1350 | Ga0496122_0000125 | 3300048925 | Bacteria | 179659 |
| 1351 | Ga0496122_0001095 | 3300048925 | Bacteria | 46975 |
| 1352 | Ga0496122_0001397 | 3300048925 | Bacteria | 39198 |
| 1353 | Ga0496122_0003298 | 3300048925 | Bacteria | 21357 |
| 1354 | Ga0496122_0011931 | 3300048925 | Bacteria | 8724 |
| 1355 | Ga0496122_0013632 | 3300048925 | Bacteria | 7934 |
| 1356 | Ga0496122_0014282 | 3300048925 | Bacteria | 7692 |
| 1357 | Ga0496122_0020330 | 3300048925 | Bacteria | 6005 |
| 1358 | Ga0496122_0037343 | 3300048925 | Bacteria | 3911 |
| 1359 | Ga0496122_0044849 | 3300048925 | Bacteria | 3445 |
| 1360 | Ga0496123_0000019 | 3300048926 | Bacteria | 400216 |
| 1361 | Ga0496123_0000092 | 3300048926 | Bacteria | 179551 |
| 1362 | Ga0496123_0000377 | 3300048926 | Bacteria | 83811 |
| 1363 | Ga0496123_0000432 | 3300048926 | Bacteria | 75431 |
| 1364 | Ga0496123_0012760 | 3300048926 | Bacteria | 7125 |
| 1365 | Ga0496123_0022407 | 3300048926 | Bacteria | 4869 |
| 1366 | Ga0496123_0025637 | 3300048926 | Bacteria | 4439 |
| 1367 | Ga0496123_0032442 | 3300048926 | Bacteria | 3781 |
| 1368 | Ga0496123_0035936 | 3300048926 | Bacteria | 3522 |
| 1369 | Ga0496123_0041327 | 3300048926 | Bacteria | 3199 |
| 1370 | Ga0496123_0049604 | 3300048926 | Bacteria | 2812 |
| 1371 | Ga0496123_0117516 | 3300048926 | Bacteria | 1503 |
| 1372 | Ga0496124_0000058 | 3300048927 | Bacteria | 242191 |
| 1373 | Ga0496124_0000238 | 3300048927 | Bacteria | 106881 |
| 1374 | Ga0496124_0000528 | 3300048927 | Bacteria | 65079 |
| 1375 | Ga0496124_0000965 | 3300048927 | Bacteria | 45797 |
| 1376 | Ga0496124_0002138 | 3300048927 | Bacteria | 26556 |
| 1377 | Ga0496124_0003076 | 3300048927 | Bacteria | 20781 |
| 1378 | Ga0496124_0006598 | 3300048927 | Bacteria | 12601 |
| 1379 | Ga0496124_0008102 | 3300048927 | Bacteria | 11041 |
| 1380 | Ga0496124_0011229 | 3300048927 | Bacteria | 8975 |
| 1381 | Ga0496124_0014414 | 3300048927 | Bacteria | 7643 |
| 1382 | Ga0496124_0021096 | 3300048927 | Bacteria | 6007 |
| 1383 | Ga0496124_0024965 | 3300048927 | Bacteria | 5421 |
| 1384 | Ga0496124_0025396 | 3300048927 | Bacteria | 5365 |
| 1385 | Ga0496124_0028318 | 3300048927 | Bacteria | 5013 |
| 1386 | Ga0496124_0087110 | 3300048927 | Bacteria | 2554 |
| 1387 | Ga0496124_0200625 | 3300048927 | Bacteria | 1517 |
| 1388 | Ga0496125_0000032 | 3300048928 | Bacteria | 354078 |
| 1389 | Ga0496125_0000240 | 3300048928 | Bacteria | 112092 |
| 1390 | Ga0496125_0000384 | 3300048928 | Bacteria | 82197 |
| 1391 | Ga0496125_0004777 | 3300048928 | Bacteria | 15428 |
| 1392 | Ga0496125_0006298 | 3300048928 | Bacteria | 12882 |
| 1393 | Ga0496125_0018484 | 3300048928 | Bacteria | 6619 |
| 1394 | Ga0496125_0018591 | 3300048928 | Bacteria | 6597 |
| 1395 | Ga0496125_0058859 | 3300048928 | Bacteria | 3100 |
| 1396 | Ga0496125_0076321 | 3300048928 | Bacteria | 2588 |
| 1397 | Ga0496126_0000109 | 3300048929 | Bacteria | 196717 |
| 1398 | Ga0496126_0003362 | 3300048929 | Bacteria | 20286 |
| 1399 | Ga0496126_0020625 | 3300048929 | Bacteria | 6455 |
| 1400 | Ga0496126_0024373 | 3300048929 | Bacteria | 5842 |
| 1401 | Ga0496126_0034211 | 3300048929 | Bacteria | 4774 |
| 1402 | Ga0496126_0046990 | 3300048929 | Bacteria | 3953 |
| 1403 | Ga0496126_0069814 | 3300048929 | Bacteria | 3132 |
| 1404 | Ga0495678_000021 | 3300049459 | Bacteria | 239150 |
| 1405 | Ga0495678_000243 | 3300049459 | Bacteria | 61378 |
| 1406 | Ga0495678_000994 | 3300049459 | Bacteria | 24294 |
| 1407 | Ga0495678_002086 | 3300049459 | Bacteria | 14214 |
| 1408 | Ga0495678_004020 | 3300049459 | Bacteria | 8760 |
| 1409 | Ga0495678_004657 | 3300049459 | Bacteria | 7869 |
| 1410 | Ga0495678_006521 | 3300049459 | Bacteria | 6198 |
| 1411 | Ga0495678_010033 | 3300049459 | Bacteria | 4627 |
| 1412 | Ga0495678_010394 | 3300049459 | Bacteria | 4527 |
| 1413 | Ga0495678_038350 | 3300049459 | Bacteria | 1939 |
| 1414 | Ga0495678_045975 | 3300049459 | Bacteria | 1718 |
| 1415 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 1416 | Ga0495682_0000118 | 3300049460 | Bacteria | 69167 |
| 1417 | Ga0495682_0000336 | 3300049460 | Bacteria | 34757 |
| 1418 | Ga0495682_0001977 | 3300049460 | Bacteria | 10140 |
| 1419 | Ga0501034_0000330 | 3300049571 | Bacteria | 82994 |
| 1420 | Ga0501034_0143928 | 3300049571 | Bacteria | 2362 |
| 1421 | Ga0501036_0012641 | 3300049572 | Bacteria | 7002 |
| 1422 | Ga0501036_0058143 | 3300049572 | Bacteria | 3276 |
| 1423 | Ga0501037_0026371 | 3300049573 | Bacteria | 4295 |
| 1424 | Ga0501037_0026991 | 3300049573 | Bacteria | 4243 |
| 1425 | Ga0501038_0015356 | 3300049574 | Bacteria | 6962 |
| 1426 | Ga0501038_0036714 | 3300049574 | Bacteria | 4300 |
| 1427 | Ga0501039_0007733 | 3300049575 | Bacteria | 8202 |
| 1428 | Ga0501039_0025995 | 3300049575 | Bacteria | 4500 |
| 1429 | Ga0501040_0002725 | 3300049576 | Bacteria | 11378 |
| 1430 | Ga0501041_0003883 | 3300049577 | Bacteria | 8607 |
| 1431 | Ga0501042_0007640 | 3300049578 | Bacteria | 7093 |
| 1432 | Ga0501042_0084310 | 3300049578 | Bacteria | 2278 |
| 1433 | Ga0501042_0135215 | 3300049578 | Bacteria | 1777 |
| 1434 | Ga0501043_0111543 | 3300049579 | Bacteria | 2147 |
| 1435 | Ga0501046_0070030 | 3300049580 | Bacteria | 2728 |
| 1436 | Ga0501046_0082069 | 3300049580 | Bacteria | 2490 |
| 1437 | Ga0501047_0032511 | 3300049581 | Bacteria | 5036 |
| 1438 | Ga0501048_0011880 | 3300049582 | Bacteria | 6493 |
| 1439 | Ga0501067_0012117 | 3300049583 | Bacteria | 4780 |
| 1440 | Ga0501068_0001066 | 3300049584 | Bacteria | 14479 |
| 1441 | Ga0501069_0046607 | 3300049585 | Bacteria | 2405 |
| 1442 | Ga0501069_0061910 | 3300049585 | Bacteria | 2090 |
| 1443 | Ga0501070_0021040 | 3300049586 | Bacteria | 5473 |
| 1444 | Ga0501070_0042822 | 3300049586 | Bacteria | 3770 |
| 1445 | Ga0501071_0002875 | 3300049587 | Bacteria | 10618 |
| 1446 | Ga0501071_0003941 | 3300049587 | Bacteria | 9361 |
| 1447 | Ga0501071_0012220 | 3300049587 | Bacteria | 5815 |
| 1448 | Ga0501071_0118236 | 3300049587 | Bacteria | 1963 |
| 1449 | Ga0501072_0002404 | 3300049588 | Bacteria | 14038 |
| 1450 | Ga0501072_0016067 | 3300049588 | Bacteria | 5740 |
| 1451 | Ga0501072_0040567 | 3300049588 | Bacteria | 3655 |
| 1452 | Ga0501072_0089139 | 3300049588 | Bacteria | 2448 |
| 1453 | Ga0501073_0002866 | 3300049589 | Bacteria | 12915 |
| 1454 | Ga0501073_0029739 | 3300049589 | Bacteria | 3904 |
| 1455 | Ga0501074_0000122 | 3300049590 | Bacteria | 39373 |
| 1456 | Ga0501074_0026163 | 3300049590 | Bacteria | 4231 |
| 1457 | Ga0501074_0053111 | 3300049590 | Bacteria | 2925 |
| 1458 | Ga0501075_0003232 | 3300049591 | Bacteria | 10902 |
| 1459 | Ga0501075_0039592 | 3300049591 | Bacteria | 3527 |
| 1460 | Ga0501075_0056314 | 3300049591 | Bacteria | 2960 |
| 1461 | Ga0501075_0071097 | 3300049591 | Bacteria | 2630 |
| 1462 | Ga0501076_0005334 | 3300049592 | Bacteria | 9232 |
| 1463 | Ga0501076_0006170 | 3300049592 | Bacteria | 8674 |
| 1464 | Ga0501076_0015408 | 3300049592 | Bacteria | 5776 |
| 1465 | Ga0501076_0017475 | 3300049592 | Bacteria | 5452 |
| 1466 | Ga0501077_0004666 | 3300049593 | Bacteria | 8329 |
| 1467 | Ga0501077_0007570 | 3300049593 | Bacteria | 6701 |
| 1468 | Ga0501079_0000691 | 3300049741 | Bacteria | 22700 |
| 1469 | Ga0501079_0001011 | 3300049741 | Bacteria | 19496 |
| 1470 | Ga0501079_0056664 | 3300049741 | Bacteria | 3024 |
| 1471 | Ga0501080_0003163 | 3300049742 | Bacteria | 14507 |
| 1472 | Ga0501080_0014035 | 3300049742 | Bacteria | 7374 |
| 1473 | Ga0501080_0117770 | 3300049742 | Bacteria | 2462 |
| 1474 | Ga0501080_0130113 | 3300049742 | Bacteria | 2330 |
| 1475 | Ga0501081_0006439 | 3300049743 | Bacteria | 7619 |
| 1476 | Ga0501081_0134086 | 3300049743 | Bacteria | 1771 |
| 1477 | Ga0501241_000456 | 3300049758 | Bacteria | 8889 |
| 1478 | Ga0501241_002164 | 3300049758 | Bacteria | 3841 |
| 1479 | Ga0501035_0024116 | 3300049822 | Bacteria | 5581 |
| 1480 | Ga0501035_0028332 | 3300049822 | Bacteria | 5114 |
| 1481 | Ga0501035_0068049 | 3300049822 | Bacteria | 3158 |
| 1482 | Ga0501044_0000065 | 3300049823 | Bacteria | 130072 |
| 1483 | Ga0501044_0010660 | 3300049823 | Bacteria | 9972 |
| 1484 | Ga0501044_0229725 | 3300049823 | Bacteria | 1803 |
| 1485 | Ga0501045_0003649 | 3300049824 | Bacteria | 10582 |
| 1486 | Ga0501045_0003730 | 3300049824 | Bacteria | 10476 |
| 1487 | Ga0501045_0035721 | 3300049824 | Bacteria | 3608 |
| 1488 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 1489 | nmdc:mga00v17_38473_c1 | 3300050491 | Bacteria | 2861 |
| 1490 | nmdc:mga00v17_570_c1 | 3300050491 | Bacteria | 20583 |
| 1491 | nmdc:mga0yw44_2366_c1 | 3300050492 | Bacteria | 8005 |
| 1492 | nmdc:mga0yw44_94477_c1 | 3300050492 | Bacteria | 1895 |
| 1493 | nmdc:mga05p37_19353_c1 | 3300050507 | Bacteria | 8235 |
| 1494 | nmdc:mga05p37_19948_c1 | 3300050507 | Bacteria | 8110 |
| 1495 | nmdc:mga05p37_274897_c1 | 3300050507 | Bacteria | 2011 |
| 1496 | nmdc:mga05p37_484_c1 | 3300050507 | Bacteria | 43547 |
| 1497 | nmdc:mga09592_28298_c1 | 3300050508 | Bacteria | 4656 |
| 1498 | nmdc:mga09592_31124_c1 | 3300050508 | Bacteria | 4444 |
| 1499 | nmdc:mga09592_567_c1 | 3300050508 | Bacteria | 28034 |
| 1500 | nmdc:mga0qj67_204369_c1 | 3300050509 | Bacteria | 1604 |
| 1501 | nmdc:mga0qj67_325_c1 | 3300050509 | Bacteria | 32921 |
| 1502 | nmdc:mga0qj67_6220_c1 | 3300050509 | Bacteria | 8765 |
| 1503 | nmdc:mga06r32_27264_c1 | 3300050510 | Bacteria | 5335 |
| 1504 | nmdc:mga06r32_3756_c1 | 3300050510 | Bacteria | 13584 |
| 1505 | nmdc:mga06r32_461_c1 | 3300050510 | Bacteria | 34790 |
| 1506 | nmdc:mga08y16_29965_c1 | 3300050511 | Bacteria | 5730 |
| 1507 | nmdc:mga08y16_32843_c1 | 3300050511 | Bacteria | 5456 |
| 1508 | nmdc:mga0n895_3290_c1 | 3300050512 | Bacteria | 12974 |
| 1509 | nmdc:mga0a205_87_c1 | 3300050515 | Bacteria | 51120 |
| 1510 | Ga0500650_0001226 | 3300053098 | Bacteria | 7551 |
| 1511 | Ga0500556_0000319 | 3300053104 | Bacteria | 36216 |
| 1512 | Ga0500572_001005 | 3300053111 | Bacteria | 8512 |
| 1513 | Ga0500621_000034 | 3300053126 | Bacteria | 27593 |
| 1514 | Ga0500573_0034852 | 3300053140 | Bacteria | 2903 |
| 1515 | Ga0500622_0004521 | 3300053156 | Bacteria | 8694 |
| 1516 | Ga0500622_0014825 | 3300053156 | Bacteria | 4178 |
| 1517 | Ga0500637_0003153 | 3300053178 | Bacteria | 7538 |
| 1518 | Ga0501084_0001911 | 3300054114 | Bacteria | 16622 |
| 1519 | Ga0501084_0019612 | 3300054114 | Bacteria | 5634 |
| 1520 | Ga0501084_0106069 | 3300054114 | Bacteria | 2360 |
| 1521 | Ga0501082_0012374 | 3300060353 | Bacteria | 7334 |
| 1522 | Ga0501082_0025185 | 3300060353 | Bacteria | 5126 |
| 1523 | Ga0501082_0103907 | 3300060353 | Bacteria | 2457 |
| 1524 | Ga0530510_0007950 | 3300061734 | Bacteria | 7400 |
| 1525 | Ga0530510_0032120 | 3300061734 | Bacteria | 3775 |
| 1526 | Ga0530510_0082637 | 3300061734 | Bacteria | 2339 |
| 1527 | Ga0530510_0086299 | 3300061734 | Bacteria | 2287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005543 | Ga0070672_100000694 | Ga0070672_10000069420 | 379 |
| 2 | 3300005844 | Ga0068862_100005445 | Ga0068862_1000054456 | 379 |
| 3 | 3300006881 | Ga0068865_100007521 | Ga0068865_1000075215 | 379 |
| 4 | 3300025907 | Ga0207645_10000348 | Ga0207645_1000034810 | 379 |
| 5 | 3300025917 | Ga0207660_10006542 | Ga0207660_100065424 | 379 |
| 6 | 3300025933 | Ga0207706_10002539 | Ga0207706_1000253910 | 379 |
| 7 | 3300025940 | Ga0207691_10011300 | Ga0207691_100113007 | 379 |
| 8 | 3300026075 | Ga0207708_10009579 | Ga0207708_100095792 | 379 |
| 9 | 3300026089 | Ga0207648_10005345 | Ga0207648_1000534511 | 379 |
| 10 | 3300026118 | Ga0207675_100002107 | Ga0207675_10000210714 | 379 |
| 11 | 3300027682 | Ga0209971_1001260 | Ga0209971_10012603 | 379 |
| 12 | 3300027717 | Ga0209998_10001506 | Ga0209998_100015063 | 379 |
| 13 | 3300046461 | Ga0495641_0054034 | Ga0495641_0054034_660_1799 | 379 |
| 14 | 3300060353 | Ga0501082_0103907 | Ga0501082_0103907_1169_2308 | 379 |
| 15 | 3300042125 | Ga0450923_002475 | Ga0450923_002475_247_1497 | 381 |
| 16 | 3300042005 | Ga0439448_0041561 | Ga0439448_0041561_189_1469 | 388 |
| 17 | 3300044673 | Ga0453683_0014870 | Ga0453683_0014870_3336_4517 | 393 |
| 18 | 3300044712 | Ga0453684_0020833 | Ga0453684_0020833_3886_5067 | 393 |
| 19 | 3300045051 | Ga0451576_0172631 | Ga0451576_0172631_686_1867 | 393 |
| 20 | 3300006844 | Ga0075428_100006399 | Ga0075428_1000063996 | 394 |
| 21 | 3300006847 | Ga0075431_100107249 | Ga0075431_1001072492 | 394 |
| 22 | 3300031727 | Ga0316576_10000212 | Ga0316576_100002124 | 400 |
| 23 | 3300032168 | Ga0316593_10010248 | Ga0316593_100102482 | 400 |
| 24 | 3300035398 | Ga0316574_0000008 | Ga0316574_0000008_22499_23740 | 400 |
| 25 | 3300027907 | Ga0207428_10037467 | Ga0207428_100374673 | 405 |
| 26 | 3300046694 | Ga0495649_0006258 | Ga0495649_0006258_51_1325 | 405 |
| 27 | 3300031727 | Ga0316576_10186980 | Ga0316576_101869802 | 407 |
| 28 | 3300049586 | Ga0501070_0042822 | Ga0501070_0042822_2391_3626 | 408 |
| 29 | 3300031727 | Ga0316576_10165725 | Ga0316576_101657251 | 409 |
| 30 | 3300037588 | Ga0316581_0007444 | Ga0316581_0007444_326_1696 | 409 |
| 31 | 3300049581 | Ga0501047_0032511 | Ga0501047_0032511_3636_4889 | 411 |
| 32 | 3300049590 | Ga0501074_0053111 | Ga0501074_0053111_771_2024 | 411 |
| 33 | 3300049742 | Ga0501080_0117770 | Ga0501080_0117770_962_2215 | 411 |
| 34 | 3300049822 | Ga0501035_0024116 | Ga0501035_0024116_920_2173 | 411 |
| 35 | 3300049823 | Ga0501044_0010660 | Ga0501044_0010660_2066_3319 | 411 |
| 36 | 3300005441 | Ga0070700_100059921 | Ga0070700_1000599211 | 412 |
| 37 | 3300035691 | Ga0373931_0033413 | Ga0373931_0033413_840_2195 | 412 |
| 38 | 3300005330 | Ga0070690_100012283 | Ga0070690_1000122834 | 415 |
| 39 | 3300005340 | Ga0070689_100023090 | Ga0070689_1000230904 | 415 |
| 40 | 3300005343 | Ga0070687_100010245 | Ga0070687_1000102453 | 415 |
| 41 | 3300005354 | Ga0070675_100000334 | Ga0070675_1000003342 | 415 |
| 42 | 3300005365 | Ga0070688_100006244 | Ga0070688_1000062442 | 415 |
| 43 | 3300005367 | Ga0070667_100023897 | Ga0070667_1000238973 | 415 |
| 44 | 3300005441 | Ga0070700_100051436 | Ga0070700_1000514362 | 415 |
| 45 | 3300005456 | Ga0070678_100008328 | Ga0070678_1000083284 | 415 |
| 46 | 3300005457 | Ga0070662_100040573 | Ga0070662_1000405733 | 415 |
| 47 | 3300005459 | Ga0068867_100036345 | Ga0068867_1000363452 | 415 |
| 48 | 3300005543 | Ga0070672_100011621 | Ga0070672_1000116214 | 415 |
| 49 | 3300005548 | Ga0070665_100013832 | Ga0070665_1000138325 | 415 |
| 50 | 3300005564 | Ga0070664_100000660 | Ga0070664_1000006604 | 415 |
| 51 | 3300005617 | Ga0068859_100003407 | Ga0068859_1000034079 | 415 |
| 52 | 3300005618 | Ga0068864_100005551 | Ga0068864_10000555110 | 415 |
| 53 | 3300005841 | Ga0068863_100007009 | Ga0068863_1000070093 | 415 |
| 54 | 3300005844 | Ga0068862_100007755 | Ga0068862_1000077559 | 415 |
| 55 | 3300006358 | Ga0068871_100041659 | Ga0068871_1000416594 | 415 |
| 56 | 3300006844 | Ga0075428_100027992 | Ga0075428_1000279926 | 415 |
| 57 | 3300006931 | Ga0097620_100003407 | Ga0097620_10000340710 | 415 |
| 58 | 3300009011 | Ga0105251_10024082 | Ga0105251_100240821 | 415 |
| 59 | 3300009092 | Ga0105250_10003873 | Ga0105250_100038733 | 415 |
| 60 | 3300009101 | Ga0105247_10000387 | Ga0105247_100003871 | 415 |
| 61 | 3300009177 | Ga0105248_10016471 | Ga0105248_100164719 | 415 |
| 62 | 3300010375 | Ga0105239_10156813 | Ga0105239_101568131 | 415 |
| 63 | 3300013297 | Ga0157378_10169333 | Ga0157378_101693332 | 415 |
| 64 | 3300013308 | Ga0157375_10050753 | Ga0157375_100507532 | 415 |
| 65 | 3300014326 | Ga0157380_10035371 | Ga0157380_100353713 | 415 |
| 66 | 3300017792 | Ga0163161_10000002 | Ga0163161_10000002150 | 415 |
| 67 | 3300025711 | Ga0207696_1000009 | Ga0207696_1000009223 | 415 |
| 68 | 3300025735 | Ga0207713_1000034 | Ga0207713_100003443 | 415 |
| 69 | 3300025900 | Ga0207710_10000015 | Ga0207710_10000015302 | 415 |
| 70 | 3300025918 | Ga0207662_10000587 | Ga0207662_100005872 | 415 |
| 71 | 3300025926 | Ga0207659_10019038 | Ga0207659_100190382 | 415 |
| 72 | 3300025933 | Ga0207706_10071449 | Ga0207706_100714492 | 415 |
| 73 | 3300025938 | Ga0207704_10021280 | Ga0207704_100212802 | 415 |
| 74 | 3300025938 | Ga0207704_10023807 | Ga0207704_100238071 | 415 |
| 75 | 3300025941 | Ga0207711_10148097 | Ga0207711_101480972 | 415 |
| 76 | 3300025960 | Ga0207651_10084876 | Ga0207651_100848762 | 415 |
| 77 | 3300026075 | Ga0207708_10010217 | Ga0207708_100102172 | 415 |
| 78 | 3300026089 | Ga0207648_10014086 | Ga0207648_100140863 | 415 |
| 79 | 3300026095 | Ga0207676_10004754 | Ga0207676_100047544 | 415 |
| 80 | 3300026121 | Ga0207683_10012335 | Ga0207683_100123352 | 415 |
| 81 | 3300036647 | Ga0316582_0073521 | Ga0316582_0073521_85_1347 | 415 |
| 82 | 3300045051 | Ga0451576_0025049 | Ga0451576_0025049_4138_5493 | 415 |
| 83 | 3300046453 | Ga0495627_000042 | Ga0495627_000042_50661_52046 | 415 |
| 84 | 3300048915 | Ga0496112_0172793 | Ga0496112_0172793_406_1761 | 415 |
| 85 | 3300048919 | Ga0496116_0000015 | Ga0496116_0000015_245998_247383 | 415 |
| 86 | 3300048920 | Ga0496117_0035964 | Ga0496117_0035964_2316_3701 | 415 |
| 87 | 3300048921 | Ga0496118_0025190 | Ga0496118_0025190_3187_4572 | 415 |
| 88 | 3300050507 | nmdc:mga05p37_274897_c1 | nmdc:mga05p37_274897_c1_118_1470 | 415 |
| 89 | 3300050508 | nmdc:mga09592_31124_c1 | nmdc:mga09592_31124_c1_1855_3207 | 415 |
| 90 | 3300050509 | nmdc:mga0qj67_6220_c1 | nmdc:mga0qj67_6220_c1_4428_5780 | 415 |
| 91 | 3300050510 | nmdc:mga06r32_27264_c1 | nmdc:mga06r32_27264_c1_2109_3461 | 415 |
| 92 | 3300006844 | Ga0075428_100012456 | Ga0075428_1000124562 | 417 |
| 93 | 3300006847 | Ga0075431_100001340 | Ga0075431_10000134020 | 417 |
| 94 | 3300006880 | Ga0075429_100030769 | Ga0075429_1000307692 | 417 |
| 95 | 3300006946 | Ga0079104_1001357 | Ga0079104_10013572 | 417 |
| 96 | 3300009011 | Ga0105251_10001329 | Ga0105251_1000132919 | 417 |
| 97 | 3300009147 | Ga0114129_10030611 | Ga0114129_100306112 | 417 |
| 98 | 3300009174 | Ga0105241_10000008 | Ga0105241_1000000899 | 417 |
| 99 | 3300013100 | Ga0157373_10003379 | Ga0157373_100033795 | 417 |
| 100 | 3300014497 | Ga0182008_10004887 | Ga0182008_100048875 | 417 |
| 101 | 3300025735 | Ga0207713_1000055 | Ga0207713_100005530 | 417 |
| 102 | 3300025911 | Ga0207654_10000009 | Ga0207654_1000000999 | 417 |
| 103 | 3300025937 | Ga0207669_10041781 | Ga0207669_100417811 | 417 |
| 104 | 3300027111 | Ga0209281_1000054 | Ga0209281_100005482 | 417 |
| 105 | 3300042006 | Ga0439432_001436 | Ga0439432_001436_3986_5371 | 417 |
| 106 | 3300046530 | Ga0495654_0000342 | Ga0495654_0000342_10276_11661 | 417 |
| 107 | 3300046794 | Ga0495589_0000005 | Ga0495589_0000005_348668_350053 | 417 |
| 108 | 3300050507 | nmdc:mga05p37_19353_c1 | nmdc:mga05p37_19353_c1_3371_4810 | 417 |
| 109 | 3300050508 | nmdc:mga09592_28298_c1 | nmdc:mga09592_28298_c1_841_2280 | 417 |
| 110 | 3300050510 | nmdc:mga06r32_3756_c1 | nmdc:mga06r32_3756_c1_9021_10460 | 417 |
| 111 | 3300005335 | Ga0070666_10191832 | Ga0070666_101918321 | 418 |
| 112 | 3300005336 | Ga0070680_100059561 | Ga0070680_1000595612 | 418 |
| 113 | 3300005344 | Ga0070661_100047460 | Ga0070661_1000474603 | 418 |
| 114 | 3300005347 | Ga0070668_100057066 | Ga0070668_1000570662 | 418 |
| 115 | 3300005355 | Ga0070671_100094508 | Ga0070671_1000945081 | 418 |
| 116 | 3300005458 | Ga0070681_10060863 | Ga0070681_100608632 | 418 |
| 117 | 3300005459 | Ga0068867_100010572 | Ga0068867_1000105724 | 418 |
| 118 | 3300005535 | Ga0070684_100000467 | Ga0070684_10000046713 | 418 |
| 119 | 3300005719 | Ga0068861_100004021 | Ga0068861_1000040219 | 418 |
| 120 | 3300005719 | Ga0068861_100011531 | Ga0068861_1000115312 | 418 |
| 121 | 3300005844 | Ga0068862_100001479 | Ga0068862_10000147915 | 418 |
| 122 | 3300006844 | Ga0075428_100048459 | Ga0075428_1000484593 | 418 |
| 123 | 3300006847 | Ga0075431_100059794 | Ga0075431_1000597942 | 418 |
| 124 | 3300006880 | Ga0075429_100052454 | Ga0075429_1000524544 | 418 |
| 125 | 3300009553 | Ga0105249_10020809 | Ga0105249_100208092 | 418 |
| 126 | 3300025917 | Ga0207660_10020250 | Ga0207660_100202503 | 418 |
| 127 | 3300025923 | Ga0207681_10144340 | Ga0207681_101443401 | 418 |
| 128 | 3300025972 | Ga0207668_10046286 | Ga0207668_100462862 | 418 |
| 129 | 3300025981 | Ga0207640_10178991 | Ga0207640_101789912 | 418 |
| 130 | 3300026116 | Ga0207674_10008222 | Ga0207674_1000822210 | 418 |
| 131 | 3300026116 | Ga0207674_10030134 | Ga0207674_100301344 | 418 |
| 132 | 3300026118 | Ga0207675_100001821 | Ga0207675_1000018212 | 418 |
| 133 | 3300028380 | Ga0268265_10002577 | Ga0268265_100025777 | 418 |
| 134 | 3300048911 | Ga0496108_0019313 | Ga0496108_0019313_1041_2396 | 418 |
| 135 | 3300014325 | Ga0163163_10074241 | Ga0163163_100742412 | 419 |
| 136 | 3300026116 | Ga0207674_10083479 | Ga0207674_100834793 | 419 |
| 137 | 3300031548 | Ga0307408_100053815 | Ga0307408_1000538151 | 419 |
| 138 | 3300031901 | Ga0307406_10120842 | Ga0307406_101208422 | 419 |
| 139 | 3300046458 | Ga0495591_037934 | Ga0495591_037934_54_1313 | 419 |
| 140 | 3300046507 | Ga0495606_0082560 | Ga0495606_0082560_66_1325 | 419 |
| 141 | 3300046515 | Ga0495620_0034874 | Ga0495620_0034874_35_1294 | 419 |
| 142 | 3300046665 | Ga0495661_0073244 | Ga0495661_0073244_662_1921 | 419 |
| 143 | 3300048924 | Ga0496121_0086603 | Ga0496121_0086603_55_1314 | 419 |
| 144 | 3300009147 | Ga0114129_10053237 | Ga0114129_100532372 | 420 |
| 145 | 3300027907 | Ga0207428_10003747 | Ga0207428_100037479 | 420 |
| 146 | 3300050507 | nmdc:mga05p37_19948_c1 | nmdc:mga05p37_19948_c1_1151_2506 | 420 |
| 147 | 3300050511 | nmdc:mga08y16_32843_c1 | nmdc:mga08y16_32843_c1_308_1663 | 420 |
| 148 | 3300006852 | Ga0075433_10000312 | Ga0075433_100003124 | 421 |
| 149 | 3300006871 | Ga0075434_100000027 | Ga0075434_1000000279 | 421 |
| 150 | 3300031824 | Ga0307413_10003575 | Ga0307413_100035756 | 421 |
| 151 | 3300031903 | Ga0307407_10010041 | Ga0307407_100100412 | 421 |
| 152 | 3300031995 | Ga0307409_100010789 | Ga0307409_1000107895 | 421 |
| 153 | 3300050512 | nmdc:mga0n895_3290_c1 | nmdc:mga0n895_3290_c1_323_1678 | 421 |
| 154 | 3300050515 | nmdc:mga0a205_87_c1 | nmdc:mga0a205_87_c1_2664_4019 | 421 |
| 155 | 3300006844 | Ga0075428_100020740 | Ga0075428_1000207402 | 422 |
| 156 | 3300006846 | Ga0075430_100001404 | Ga0075430_10000140414 | 422 |
| 157 | 3300006847 | Ga0075431_100001947 | Ga0075431_1000019472 | 422 |
| 158 | 3300006880 | Ga0075429_100001396 | Ga0075429_1000013962 | 422 |
| 159 | 3300009094 | Ga0111539_10036780 | Ga0111539_100367804 | 422 |
| 160 | 3300009147 | Ga0114129_10001665 | Ga0114129_100016652 | 422 |
| 161 | 3300050507 | nmdc:mga05p37_484_c1 | nmdc:mga05p37_484_c1_12293_13648 | 422 |
| 162 | 3300050508 | nmdc:mga09592_567_c1 | nmdc:mga09592_567_c1_4358_5713 | 422 |
| 163 | 3300050509 | nmdc:mga0qj67_325_c1 | nmdc:mga0qj67_325_c1_15106_16461 | 422 |
| 164 | 3300050510 | nmdc:mga06r32_461_c1 | nmdc:mga06r32_461_c1_15106_16461 | 422 |
| 165 | 3300042439 | Ga0439464_0011656 | Ga0439464_0011656_343_1614 | 423 |
| 166 | 3300046518 | Ga0495631_0000953 | Ga0495631_0000953_9188_10555 | 423 |
| 167 | 3300028800 | Ga0265338_10034880 | Ga0265338_100348804 | 424 |
| 168 | iso_pu_bacteria | 2547132416 | 2548650853 | 424 |
| 169 | 3300048923 | Ga0496120_0001006 | Ga0496120_0001006_17391_18731 | 426 |
| 170 | 3300048927 | Ga0496124_0000058 | Ga0496124_0000058_14485_15825 | 426 |
| 171 | 3300009094 | Ga0111539_10006906 | Ga0111539_1000690611 | 427 |
| 172 | 3300021377 | Ga0213874_10001232 | Ga0213874_100012323 | 427 |
| 173 | 3300039450 | Ga0436363_0467135 | Ga0436363_0467135_7374_8717 | 427 |
| 174 | 3300005330 | Ga0070690_100006908 | Ga0070690_1000069082 | 428 |
| 175 | 3300005334 | Ga0068869_100104039 | Ga0068869_1001040392 | 428 |
| 176 | 3300005340 | Ga0070689_100005286 | Ga0070689_1000052866 | 428 |
| 177 | 3300005544 | Ga0070686_100011149 | Ga0070686_1000111492 | 428 |
| 178 | 3300005545 | Ga0070695_100046114 | Ga0070695_1000461142 | 428 |
| 179 | 3300005719 | Ga0068861_100027143 | Ga0068861_1000271432 | 428 |
| 180 | 3300005841 | Ga0068863_100108942 | Ga0068863_1001089423 | 428 |
| 181 | 3300005844 | Ga0068862_100026414 | Ga0068862_1000264142 | 428 |
| 182 | 3300025936 | Ga0207670_10029178 | Ga0207670_100291784 | 428 |
| 183 | 3300025942 | Ga0207689_10072704 | Ga0207689_100727043 | 428 |
| 184 | 3300026095 | Ga0207676_10076214 | Ga0207676_100762142 | 428 |
| 185 | 3300031728 | Ga0316578_10002495 | Ga0316578_100024952 | 428 |
| 186 | 3300031733 | Ga0316577_10045816 | Ga0316577_100458161 | 428 |
| 187 | 3300032139 | Ga0316580_10001667 | Ga0316580_100016676 | 428 |
| 188 | 3300036647 | Ga0316582_0027128 | Ga0316582_0027128_830_2176 | 428 |
| 189 | 3300054114 | Ga0501084_0106069 | Ga0501084_0106069_706_2058 | 428 |
| 190 | 3300060353 | Ga0501082_0012374 | Ga0501082_0012374_4033_5385 | 428 |
| 191 | 3300005840 | Ga0068870_10013630 | Ga0068870_100136302 | 429 |
| 192 | 3300049572 | Ga0501036_0058143 | Ga0501036_0058143_1900_3252 | 429 |
| 193 | 3300049587 | Ga0501071_0118236 | Ga0501071_0118236_175_1524 | 429 |
| 194 | 3300049588 | Ga0501072_0016067 | Ga0501072_0016067_3037_4386 | 429 |
| 195 | 3300049591 | Ga0501075_0039592 | Ga0501075_0039592_1715_3064 | 429 |
| 196 | 3300049591 | Ga0501075_0056314 | Ga0501075_0056314_1097_2449 | 429 |
| 197 | 3300049824 | Ga0501045_0035721 | Ga0501045_0035721_1403_2752 | 429 |
| 198 | 3300061734 | Ga0530510_0032120 | Ga0530510_0032120_2121_3470 | 429 |
| 199 | 3300005289 | Ga0065704_10081710 | Ga0065704_100817104 | 430 |
| 200 | 3300009094 | Ga0111539_10304522 | Ga0111539_103045222 | 430 |
| 201 | 3300031251 | Ga0265327_10001253 | Ga0265327_1000125314 | 430 |
| 202 | 3300031344 | Ga0265316_10000678 | Ga0265316_1000067837 | 430 |
| 203 | 3300044712 | Ga0453684_0162105 | Ga0453684_0162105_703_2019 | 430 |
| 204 | 3300031691 | Ga0316579_10033235 | Ga0316579_100332351 | 432 |
| 205 | 3300037588 | Ga0316581_0001438 | Ga0316581_0001438_1336_2706 | 432 |
| 206 | 3300050511 | nmdc:mga08y16_29965_c1 | nmdc:mga08y16_29965_c1_2838_4184 | 432 |
| 207 | 3300005719 | Ga0068861_100011305 | Ga0068861_1000113054 | 433 |
| 208 | 3300026118 | Ga0207675_100004064 | Ga0207675_1000040644 | 433 |
| 209 | 3300006058 | Ga0075432_10015049 | Ga0075432_100150492 | 434 |
| 210 | 3300006358 | Ga0068871_100044425 | Ga0068871_1000444252 | 434 |
| 211 | 3300009011 | Ga0105251_10053665 | Ga0105251_100536652 | 434 |
| 212 | 3300009092 | Ga0105250_10020758 | Ga0105250_100207582 | 434 |
| 213 | 3300025711 | Ga0207696_1002003 | Ga0207696_100200311 | 434 |
| 214 | 3300025986 | Ga0207658_10139956 | Ga0207658_101399562 | 434 |
| 215 | 3300005543 | Ga0070672_100010076 | Ga0070672_1000100762 | 435 |
| 216 | 3300025940 | Ga0207691_10140007 | Ga0207691_101400072 | 435 |
| 217 | 3300026089 | Ga0207648_10042556 | Ga0207648_100425562 | 435 |
| 218 | 3300031548 | Ga0307408_100000020 | Ga0307408_100000020304 | 435 |
| 219 | 3300031727 | Ga0316576_10054196 | Ga0316576_100541962 | 435 |
| 220 | 3300039062 | Ga0400483_066663 | Ga0400483_066663_10176_11534 | 435 |
| 221 | 3300042439 | Ga0439464_0000526 | Ga0439464_0000526_705_2063 | 435 |
| 222 | 3300046524 | Ga0495648_0010250 | Ga0495648_0010250_4802_6151 | 435 |
| 223 | 3300005544 | Ga0070686_100136407 | Ga0070686_1001364072 | 436 |
| 224 | 3300031595 | Ga0265313_10010933 | Ga0265313_100109335 | 436 |
| 225 | 3300046519 | Ga0495632_0035855 | Ga0495632_0035855_419_1765 | 436 |
| 226 | 3300049571 | Ga0501034_0143928 | Ga0501034_0143928_885_2261 | 436 |
| 227 | 3300013308 | Ga0157375_10419875 | Ga0157375_104198752 | 438 |
| 228 | 3300013100 | Ga0157373_10076973 | Ga0157373_100769732 | 439 |
| 229 | 3300032137 | Ga0316585_10020355 | Ga0316585_100203552 | 439 |
| 230 | 3300035398 | Ga0316574_0002733 | Ga0316574_0002733_1536_2906 | 439 |
| 231 | 3300003320 | rootH2_10020955 | rootH2_1002095521 | 440 |
| 232 | 3300006051 | Ga0075364_10018721 | Ga0075364_100187213 | 440 |
| 233 | 3300006946 | Ga0079104_1000403 | Ga0079104_100040341 | 440 |
| 234 | 3300006946 | Ga0079104_1000629 | Ga0079104_100062917 | 440 |
| 235 | 3300009011 | Ga0105251_10000710 | Ga0105251_1000071011 | 440 |
| 236 | 3300009036 | Ga0105244_10000615 | Ga0105244_100006155 | 440 |
| 237 | 3300009036 | Ga0105244_10001840 | Ga0105244_100018403 | 440 |
| 238 | 3300009036 | Ga0105244_10004900 | Ga0105244_1000490010 | 440 |
| 239 | 3300009092 | Ga0105250_10004784 | Ga0105250_100047842 | 440 |
| 240 | 3300025711 | Ga0207696_1003815 | Ga0207696_10038156 | 440 |
| 241 | 3300025728 | Ga0207655_1000054 | Ga0207655_1000054207 | 440 |
| 242 | 3300025728 | Ga0207655_1008543 | Ga0207655_10085436 | 440 |
| 243 | 3300025735 | Ga0207713_1000836 | Ga0207713_10008369 | 440 |
| 244 | 3300027111 | Ga0209281_1000120 | Ga0209281_100012094 | 440 |
| 245 | 3300027111 | Ga0209281_1000854 | Ga0209281_100085422 | 440 |
| 246 | 3300027312 | Ga0209371_1000054 | Ga0209371_1000054111 | 440 |
| 247 | 3300027312 | Ga0209371_1017337 | Ga0209371_10173372 | 440 |
| 248 | 3300030500 | Ga0268256_1000012 | Ga0268256_1000012582 | 440 |
| 249 | 3300036647 | Ga0316582_0054182 | Ga0316582_0054182_227_1594 | 440 |
| 250 | 3300036712 | Ga0316584_0123479 | Ga0316584_0123479_182_1576 | 440 |
| 251 | 3300044669 | Ga0466981_0000014 | Ga0466981_0000014_68517_69902 | 440 |
| 252 | 3300046515 | Ga0495620_0004878 | Ga0495620_0004878_2063_3445 | 440 |
| 253 | 3300046515 | Ga0495620_0006041 | Ga0495620_0006041_3693_5015 | 440 |
| 254 | 3300046694 | Ga0495649_0005123 | Ga0495649_0005123_6873_8255 | 440 |
| 255 | 3300048922 | Ga0496119_0001418 | Ga0496119_0001418_26154_27539 | 440 |
| 256 | 3300048923 | Ga0496120_0001022 | Ga0496120_0001022_15324_16709 | 440 |
| 257 | 3300049592 | Ga0501076_0005334 | Ga0501076_0005334_2777_4126 | 440 |
| 258 | 3300060353 | Ga0501082_0025185 | Ga0501082_0025185_1481_2830 | 440 |
| 259 | iso_pu_bacteria | 2687453129 | 2687580761 | 440 |
| 260 | 3300005545 | Ga0070695_100181028 | Ga0070695_1001810281 | 441 |
| 261 | 3300006946 | Ga0079104_1000046 | Ga0079104_100004654 | 441 |
| 262 | 3300027111 | Ga0209281_1000022 | Ga0209281_100002256 | 441 |
| 263 | 3300027312 | Ga0209371_1000123 | Ga0209371_100012345 | 441 |
| 264 | 3300027312 | Ga0209371_1000246 | Ga0209371_100024661 | 441 |
| 265 | 3300030500 | Ga0268256_1000095 | Ga0268256_100009543 | 441 |
| 266 | 3300030500 | Ga0268256_1000225 | Ga0268256_10002256 | 441 |
| 267 | 3300031456 | Ga0307513_10013189 | Ga0307513_1001318910 | 441 |
| 268 | 3300039437 | Ga0436365_1036887 | Ga0436365_1036887_1419_2774 | 441 |
| 269 | 3300042010 | Ga0439452_000497 | Ga0439452_000497_17255_18637 | 441 |
| 270 | 3300046512 | Ga0495610_0007886 | Ga0495610_0007886_5418_6785 | 441 |
| 271 | 3300046513 | Ga0495616_0000964 | Ga0495616_0000964_1617_2966 | 441 |
| 272 | 3300046530 | Ga0495654_0006155 | Ga0495654_0006155_667_2034 | 441 |
| 273 | 3300046694 | Ga0495649_0009541 | Ga0495649_0009541_2972_4339 | 441 |
| 274 | 3300048091 | Ga0495626_0005862 | Ga0495626_0005862_212_1579 | 441 |
| 275 | 3300049459 | Ga0495678_045975 | Ga0495678_045975_140_1507 | 441 |
| 276 | 3300003856 | Ga0058692_1009390 | Ga0058692_10093902 | 442 |
| 277 | 3300005289 | Ga0065704_10003505 | Ga0065704_100035054 | 442 |
| 278 | 3300005337 | Ga0070682_100011000 | Ga0070682_1000110003 | 442 |
| 279 | 3300005366 | Ga0070659_100019863 | Ga0070659_1000198633 | 442 |
| 280 | 3300005459 | Ga0068867_100078602 | Ga0068867_1000786022 | 442 |
| 281 | 3300005548 | Ga0070665_100000140 | Ga0070665_10000014015 | 442 |
| 282 | 3300005577 | Ga0068857_100001114 | Ga0068857_1000011149 | 442 |
| 283 | 3300005834 | Ga0068851_10008159 | Ga0068851_100081592 | 442 |
| 284 | 3300006051 | Ga0075364_10006790 | Ga0075364_100067905 | 442 |
| 285 | 3300006946 | Ga0079104_1012495 | Ga0079104_10124952 | 442 |
| 286 | 3300009011 | Ga0105251_10006362 | Ga0105251_100063623 | 442 |
| 287 | 3300009011 | Ga0105251_10011861 | Ga0105251_100118612 | 442 |
| 288 | 3300009092 | Ga0105250_10009365 | Ga0105250_100093652 | 442 |
| 289 | 3300009093 | Ga0105240_10179548 | Ga0105240_101795482 | 442 |
| 290 | 3300009148 | Ga0105243_10099694 | Ga0105243_100996942 | 442 |
| 291 | 3300013104 | Ga0157370_10010499 | Ga0157370_100104996 | 442 |
| 292 | 3300015679 | Ga0183366_1003 | Ga0183366_1003200 | 442 |
| 293 | 3300015680 | Ga0183370_1003 | Ga0183370_1003220 | 442 |
| 294 | 3300015685 | Ga0183369_1005 | Ga0183369_1005220 | 442 |
| 295 | 3300015687 | Ga0183368_1006 | Ga0183368_1006199 | 442 |
| 296 | 3300025735 | Ga0207713_1000046 | Ga0207713_1000046107 | 442 |
| 297 | 3300025735 | Ga0207713_1008121 | Ga0207713_10081212 | 442 |
| 298 | 3300025735 | Ga0207713_1014889 | Ga0207713_10148891 | 442 |
| 299 | 3300025923 | Ga0207681_10102082 | Ga0207681_101020822 | 442 |
| 300 | 3300025932 | Ga0207690_10020833 | Ga0207690_100208333 | 442 |
| 301 | 3300025935 | Ga0207709_10085647 | Ga0207709_100856472 | 442 |
| 302 | 3300025942 | Ga0207689_10069125 | Ga0207689_100691252 | 442 |
| 303 | 3300026116 | Ga0207674_10002994 | Ga0207674_1000299413 | 442 |
| 304 | 3300027111 | Ga0209281_1000489 | Ga0209281_10004895 | 442 |
| 305 | 3300027312 | Ga0209371_1000030 | Ga0209371_1000030135 | 442 |
| 306 | 3300027312 | Ga0209371_1000111 | Ga0209371_100011162 | 442 |
| 307 | 3300027312 | Ga0209371_1001384 | Ga0209371_10013842 | 442 |
| 308 | 3300028379 | Ga0268266_10000143 | Ga0268266_10000143131 | 442 |
| 309 | 3300030500 | Ga0268256_1000025 | Ga0268256_1000025188 | 442 |
| 310 | 3300030500 | Ga0268256_1001189 | Ga0268256_10011892 | 442 |
| 311 | 3300030500 | Ga0268256_1002999 | Ga0268256_10029994 | 442 |
| 312 | 3300031507 | Ga0307509_10024054 | Ga0307509_100240541 | 442 |
| 313 | 3300031727 | Ga0316576_10023926 | Ga0316576_100239262 | 442 |
| 314 | 3300031903 | Ga0307407_10036565 | Ga0307407_100365652 | 442 |
| 315 | 3300031995 | Ga0307409_100139812 | Ga0307409_1001398122 | 442 |
| 316 | 3300032005 | Ga0307411_10003528 | Ga0307411_100035281 | 442 |
| 317 | 3300032133 | Ga0316583_10038853 | Ga0316583_100388531 | 442 |
| 318 | 3300042010 | Ga0439452_000306 | Ga0439452_000306_25096_26481 | 442 |
| 319 | 3300046460 | Ga0495638_0016034 | Ga0495638_0016034_1360_2706 | 442 |
| 320 | 3300046471 | Ga0495650_0000028 | Ga0495650_0000028_199443_200828 | 442 |
| 321 | 3300046692 | Ga0495671_0046150 | Ga0495671_0046150_741_2084 | 442 |
| 322 | 3300048907 | Ga0496104_0000302 | Ga0496104_0000302_26053_27438 | 442 |
| 323 | 3300048919 | Ga0496116_0033570 | Ga0496116_0033570_704_2089 | 442 |
| 324 | 3300048919 | Ga0496116_0054828 | Ga0496116_0054828_1219_2604 | 442 |
| 325 | 3300048920 | Ga0496117_0000183 | Ga0496117_0000183_14629_16014 | 442 |
| 326 | 3300048921 | Ga0496118_0003804 | Ga0496118_0003804_3467_4852 | 442 |
| 327 | 3300048922 | Ga0496119_0002989 | Ga0496119_0002989_8435_9820 | 442 |
| 328 | 3300048922 | Ga0496119_0002994 | Ga0496119_0002994_4682_6067 | 442 |
| 329 | 3300048923 | Ga0496120_0006711 | Ga0496120_0006711_4056_5441 | 442 |
| 330 | 3300048924 | Ga0496121_0004084 | Ga0496121_0004084_9652_11037 | 442 |
| 331 | 3300048924 | Ga0496121_0030100 | Ga0496121_0030100_377_1762 | 442 |
| 332 | 3300048925 | Ga0496122_0001095 | Ga0496122_0001095_28841_30226 | 442 |
| 333 | 3300048925 | Ga0496122_0020330 | Ga0496122_0020330_512_1897 | 442 |
| 334 | 3300048926 | Ga0496123_0000377 | Ga0496123_0000377_15970_17355 | 442 |
| 335 | 3300048926 | Ga0496123_0117516 | Ga0496123_0117516_98_1483 | 442 |
| 336 | 3300048927 | Ga0496124_0025396 | Ga0496124_0025396_3604_4989 | 442 |
| 337 | 3300048927 | Ga0496124_0028318 | Ga0496124_0028318_380_1765 | 442 |
| 338 | 3300048929 | Ga0496126_0003362 | Ga0496126_0003362_14917_16302 | 442 |
| 339 | 3300048929 | Ga0496126_0046990 | Ga0496126_0046990_45_1430 | 442 |
| 340 | 3300050491 | nmdc:mga00v17_38473_c1 | nmdc:mga00v17_38473_c1_1247_2632 | 442 |
| 341 | iso_pu_bacteria | 8016728285 | 8016732341 | 442 |
| 342 | 3300003322 | rootL2_10024534 | rootL2_100245342 | 443 |
| 343 | 3300005331 | Ga0070670_100267978 | Ga0070670_1002679781 | 443 |
| 344 | 3300005333 | Ga0070677_10020243 | Ga0070677_100202432 | 443 |
| 345 | 3300005333 | Ga0070677_10023212 | Ga0070677_100232121 | 443 |
| 346 | 3300005334 | Ga0068869_100074554 | Ga0068869_1000745542 | 443 |
| 347 | 3300005354 | Ga0070675_100036052 | Ga0070675_1000360522 | 443 |
| 348 | 3300005356 | Ga0070674_100050836 | Ga0070674_1000508361 | 443 |
| 349 | 3300005364 | Ga0070673_100043702 | Ga0070673_1000437022 | 443 |
| 350 | 3300005364 | Ga0070673_100056427 | Ga0070673_1000564272 | 443 |
| 351 | 3300005365 | Ga0070688_100052647 | Ga0070688_1000526471 | 443 |
| 352 | 3300005367 | Ga0070667_100132022 | Ga0070667_1001320221 | 443 |
| 353 | 3300005456 | Ga0070678_100018584 | Ga0070678_1000185841 | 443 |
| 354 | 3300005548 | Ga0070665_100002747 | Ga0070665_1000027477 | 443 |
| 355 | 3300005719 | Ga0068861_100051048 | Ga0068861_1000510482 | 443 |
| 356 | 3300005841 | Ga0068863_100078440 | Ga0068863_1000784402 | 443 |
| 357 | 3300006051 | Ga0075364_10004905 | Ga0075364_100049053 | 443 |
| 358 | 3300006946 | Ga0079104_1001144 | Ga0079104_10011442 | 443 |
| 359 | 3300009036 | Ga0105244_10000097 | Ga0105244_1000009776 | 443 |
| 360 | 3300014325 | Ga0163163_10206140 | Ga0163163_102061401 | 443 |
| 361 | 3300025711 | Ga0207696_1002325 | Ga0207696_10023255 | 443 |
| 362 | 3300025728 | Ga0207655_1000017 | Ga0207655_1000017302 | 443 |
| 363 | 3300025728 | Ga0207655_1000146 | Ga0207655_100014677 | 443 |
| 364 | 3300025893 | Ga0207682_10003524 | Ga0207682_100035242 | 443 |
| 365 | 3300025893 | Ga0207682_10013434 | Ga0207682_100134341 | 443 |
| 366 | 3300025908 | Ga0207643_10003398 | Ga0207643_100033982 | 443 |
| 367 | 3300025937 | Ga0207669_10017376 | Ga0207669_100173763 | 443 |
| 368 | 3300025940 | Ga0207691_10012956 | Ga0207691_100129568 | 443 |
| 369 | 3300025940 | Ga0207691_10041982 | Ga0207691_100419822 | 443 |
| 370 | 3300025940 | Ga0207691_10083144 | Ga0207691_100831442 | 443 |
| 371 | 3300025942 | Ga0207689_10055918 | Ga0207689_100559183 | 443 |
| 372 | 3300025960 | Ga0207651_10008259 | Ga0207651_100082596 | 443 |
| 373 | 3300026088 | Ga0207641_10033914 | Ga0207641_100339142 | 443 |
| 374 | 3300026118 | Ga0207675_100072804 | Ga0207675_1000728042 | 443 |
| 375 | 3300026118 | Ga0207675_100172203 | Ga0207675_1001722032 | 443 |
| 376 | 3300026121 | Ga0207683_10033133 | Ga0207683_100331331 | 443 |
| 377 | 3300026121 | Ga0207683_10048422 | Ga0207683_100484223 | 443 |
| 378 | 3300027111 | Ga0209281_1000223 | Ga0209281_100022335 | 443 |
| 379 | 3300031456 | Ga0307513_10014340 | Ga0307513_100143406 | 443 |
| 380 | 3300031456 | Ga0307513_10059559 | Ga0307513_100595593 | 443 |
| 381 | 3300031665 | Ga0316575_10000890 | Ga0316575_100008902 | 443 |
| 382 | 3300041460 | Ga0451802_0783281 | Ga0451802_0783281_385_1731 | 443 |
| 383 | 3300041460 | Ga0451802_1689586 | Ga0451802_1689586_638_1987 | 443 |
| 384 | 3300041491 | Ga0451833_1230775 | Ga0451833_1230775_139_1485 | 443 |
| 385 | 3300041494 | Ga0451837_1364909 | Ga0451837_1364909_682_2028 | 443 |
| 386 | 3300044673 | Ga0453683_0005511 | Ga0453683_0005511_4055_5407 | 443 |
| 387 | 3300046458 | Ga0495591_000231 | Ga0495591_000231_4486_5868 | 443 |
| 388 | 3300048921 | Ga0496118_0022852 | Ga0496118_0022852_3315_4697 | 443 |
| 389 | 3300048924 | Ga0496121_0007929 | Ga0496121_0007929_1480_2862 | 443 |
| 390 | 3300048925 | Ga0496122_0000075 | Ga0496122_0000075_38567_39949 | 443 |
| 391 | 3300048926 | Ga0496123_0000019 | Ga0496123_0000019_131586_132968 | 443 |
| 392 | 3300048928 | Ga0496125_0018591 | Ga0496125_0018591_1004_2386 | 443 |
| 393 | 3300049583 | Ga0501067_0012117 | Ga0501067_0012117_2798_4144 | 443 |
| 394 | 3300049584 | Ga0501068_0001066 | Ga0501068_0001066_2757_4103 | 443 |
| 395 | 3300049585 | Ga0501069_0046607 | Ga0501069_0046607_136_1482 | 443 |
| 396 | 3300049586 | Ga0501070_0021040 | Ga0501070_0021040_3121_4467 | 443 |
| 397 | 3300049587 | Ga0501071_0012220 | Ga0501071_0012220_2798_4144 | 443 |
| 398 | 3300049589 | Ga0501073_0002866 | Ga0501073_0002866_6131_7477 | 443 |
| 399 | 3300049590 | Ga0501074_0000122 | Ga0501074_0000122_14831_16177 | 443 |
| 400 | 3300049592 | Ga0501076_0017475 | Ga0501076_0017475_1377_2723 | 443 |
| 401 | 3300049593 | Ga0501077_0007570 | Ga0501077_0007570_4302_5648 | 443 |
| 402 | 3300049741 | Ga0501079_0001011 | Ga0501079_0001011_8190_9536 | 443 |
| 403 | 3300049742 | Ga0501080_0003163 | Ga0501080_0003163_3373_4719 | 443 |
| 404 | 3300053104 | Ga0500556_0000319 | Ga0500556_0000319_12588_13970 | 443 |
| 405 | 3300054114 | Ga0501084_0019612 | Ga0501084_0019612_1558_2904 | 443 |
| 406 | 3300061734 | Ga0530510_0082637 | Ga0530510_0082637_73_1419 | 443 |
| 407 | 3300001989 | JGI24739J22299_10000026 | JGI24739J22299_1000002614 | 444 |
| 408 | 3300002737 | JGI25162J39368_1003143 | JGI25162J39368_10031435 | 444 |
| 409 | 3300002773 | JGI25152J39213_1000281 | JGI25152J39213_100028137 | 444 |
| 410 | 3300003856 | Ga0058692_1001642 | Ga0058692_10016425 | 444 |
| 411 | 3300003856 | Ga0058692_1002000 | Ga0058692_10020003 | 444 |
| 412 | 3300003856 | Ga0058692_1005897 | Ga0058692_10058973 | 444 |
| 413 | 3300005328 | Ga0070676_10156944 | Ga0070676_101569441 | 444 |
| 414 | 3300005347 | Ga0070668_100050241 | Ga0070668_1000502412 | 444 |
| 415 | 3300005457 | Ga0070662_100003827 | Ga0070662_1000038278 | 444 |
| 416 | 3300007788 | Ga0099795_10000201 | Ga0099795_100002011 | 444 |
| 417 | 3300009011 | Ga0105251_10001996 | Ga0105251_100019963 | 444 |
| 418 | 3300009036 | Ga0105244_10002310 | Ga0105244_100023109 | 444 |
| 419 | 3300010159 | Ga0099796_10023572 | Ga0099796_100235721 | 444 |
| 420 | 3300013102 | Ga0157371_10007305 | Ga0157371_100073057 | 444 |
| 421 | 3300013104 | Ga0157370_10004274 | Ga0157370_1000427412 | 444 |
| 422 | 3300013105 | Ga0157369_10000183 | Ga0157369_1000018352 | 444 |
| 423 | 3300013306 | Ga0163162_10017327 | Ga0163162_100173272 | 444 |
| 424 | 3300013307 | Ga0157372_10001322 | Ga0157372_1000132220 | 444 |
| 425 | 3300025233 | Ga0209437_100063 | Ga0209437_100063116 | 444 |
| 426 | 3300025258 | Ga0209129_1000008 | Ga0209129_1000008392 | 444 |
| 427 | 3300025711 | Ga0207696_1006244 | Ga0207696_10062443 | 444 |
| 428 | 3300025728 | Ga0207655_1003272 | Ga0207655_10032724 | 444 |
| 429 | 3300025735 | Ga0207713_1000007 | Ga0207713_1000007193 | 444 |
| 430 | 3300025735 | Ga0207713_1003863 | Ga0207713_10038637 | 444 |
| 431 | 3300025933 | Ga0207706_10020376 | Ga0207706_100203764 | 444 |
| 432 | 3300025939 | Ga0207665_10074271 | Ga0207665_100742712 | 444 |
| 433 | 3300025972 | Ga0207668_10028388 | Ga0207668_100283882 | 444 |
| 434 | 3300027312 | Ga0209371_1000014 | Ga0209371_1000014188 | 444 |
| 435 | 3300027312 | Ga0209371_1000241 | Ga0209371_10002415 | 444 |
| 436 | 3300027312 | Ga0209371_1001635 | Ga0209371_100163512 | 444 |
| 437 | 3300027312 | Ga0209371_1010019 | Ga0209371_10100192 | 444 |
| 438 | 3300028379 | Ga0268266_10071137 | Ga0268266_100711372 | 444 |
| 439 | 3300030500 | Ga0268256_1000021 | Ga0268256_1000021182 | 444 |
| 440 | 3300030500 | Ga0268256_1000200 | Ga0268256_10002005 | 444 |
| 441 | 3300030500 | Ga0268256_1002901 | Ga0268256_10029017 | 444 |
| 442 | 3300030500 | Ga0268256_1007797 | Ga0268256_10077972 | 444 |
| 443 | 3300031730 | Ga0307516_10000171 | Ga0307516_100001714 | 444 |
| 444 | 3300035111 | Ga0373923_0034671 | Ga0373923_0034671_604_1959 | 444 |
| 445 | 3300035410 | Ga0373924_0019116 | Ga0373924_0019116_1284_2639 | 444 |
| 446 | 3300037068 | Ga0373925_0108113 | Ga0373925_0108113_197_1552 | 444 |
| 447 | 3300041411 | Ga0439466_0000002 | Ga0439466_0000002_343803_345185 | 444 |
| 448 | 3300042006 | Ga0439432_003043 | Ga0439432_003043_1156_2538 | 444 |
| 449 | 3300042010 | Ga0439452_000004 | Ga0439452_000004_515836_517218 | 444 |
| 450 | 3300042010 | Ga0439452_000005 | Ga0439452_000005_215434_216822 | 444 |
| 451 | 3300042010 | Ga0439452_000041 | Ga0439452_000041_5076_6461 | 444 |
| 452 | 3300042016 | Ga0439463_006772 | Ga0439463_006772_733_2115 | 444 |
| 453 | 3300042146 | Ga0450907_000244 | Ga0450907_000244_1905_3287 | 444 |
| 454 | 3300042439 | Ga0439464_0006608 | Ga0439464_0006608_444_1826 | 444 |
| 455 | 3300042876 | Ga0451577_0001360 | Ga0451577_0001360_27767_29125 | 444 |
| 456 | 3300044712 | Ga0453684_0003877 | Ga0453684_0003877_3802_5160 | 444 |
| 457 | 3300047320 | Ga0495672_0000054 | Ga0495672_0000054_1955_3337 | 444 |
| 458 | 3300047446 | Ga0495679_000923 | Ga0495679_000923_8937_10319 | 444 |
| 459 | 3300047469 | Ga0495673_0032490 | Ga0495673_0032490_11_1360 | 444 |
| 460 | 3300048903 | Ga0496100_0018550 | Ga0496100_0018550_1036_2418 | 444 |
| 461 | 3300048905 | Ga0496102_0058604 | Ga0496102_0058604_808_2190 | 444 |
| 462 | 3300048907 | Ga0496104_0003933 | Ga0496104_0003933_10746_12101 | 444 |
| 463 | 3300048908 | Ga0496105_0003806 | Ga0496105_0003806_5958_7313 | 444 |
| 464 | 3300048910 | Ga0496107_0076292 | Ga0496107_0076292_536_1891 | 444 |
| 465 | 3300048917 | Ga0496114_0005875 | Ga0496114_0005875_7396_8751 | 444 |
| 466 | 3300048919 | Ga0496116_0000904 | Ga0496116_0000904_3735_5117 | 444 |
| 467 | 3300048920 | Ga0496117_0000103 | Ga0496117_0000103_52690_54072 | 444 |
| 468 | 3300048920 | Ga0496117_0000238 | Ga0496117_0000238_88701_90083 | 444 |
| 469 | 3300048920 | Ga0496117_0001664 | Ga0496117_0001664_24429_25781 | 444 |
| 470 | 3300048920 | Ga0496117_0003235 | Ga0496117_0003235_4835_6217 | 444 |
| 471 | 3300048920 | Ga0496117_0004149 | Ga0496117_0004149_9526_10914 | 444 |
| 472 | 3300048921 | Ga0496118_0000046 | Ga0496118_0000046_135157_136539 | 444 |
| 473 | 3300048921 | Ga0496118_0001062 | Ga0496118_0001062_39587_40969 | 444 |
| 474 | 3300048921 | Ga0496118_0002946 | Ga0496118_0002946_5280_6668 | 444 |
| 475 | 3300048921 | Ga0496118_0003831 | Ga0496118_0003831_13984_15366 | 444 |
| 476 | 3300048922 | Ga0496119_0000026 | Ga0496119_0000026_124655_126043 | 444 |
| 477 | 3300048922 | Ga0496119_0000374 | Ga0496119_0000374_34233_35615 | 444 |
| 478 | 3300048922 | Ga0496119_0002255 | Ga0496119_0002255_140_1522 | 444 |
| 479 | 3300048923 | Ga0496120_0000491 | Ga0496120_0000491_34245_35627 | 444 |
| 480 | 3300048923 | Ga0496120_0000806 | Ga0496120_0000806_27080_28462 | 444 |
| 481 | 3300048923 | Ga0496120_0002864 | Ga0496120_0002864_13164_14552 | 444 |
| 482 | 3300048924 | Ga0496121_0001130 | Ga0496121_0001130_43478_44860 | 444 |
| 483 | 3300048926 | Ga0496123_0035936 | Ga0496123_0035936_1239_2627 | 444 |
| 484 | 3300048927 | Ga0496124_0000965 | Ga0496124_0000965_2017_3399 | 444 |
| 485 | 3300048927 | Ga0496124_0014414 | Ga0496124_0014414_1850_3238 | 444 |
| 486 | 3300048928 | Ga0496125_0018484 | Ga0496125_0018484_273_1661 | 444 |
| 487 | 3300048929 | Ga0496126_0034211 | Ga0496126_0034211_2364_3752 | 444 |
| 488 | iso_pu_bacteria | 2919497567 | 2919498247 | 444 |
| 489 | iso_pu_bacteria | 2919688452 | 2919689977 | 444 |
| 490 | 3300006946 | Ga0079104_1027493 | Ga0079104_10274931 | 445 |
| 491 | 3300009011 | Ga0105251_10002717 | Ga0105251_1000271710 | 445 |
| 492 | 3300009011 | Ga0105251_10051492 | Ga0105251_100514922 | 445 |
| 493 | 3300009036 | Ga0105244_10009602 | Ga0105244_100096024 | 445 |
| 494 | 3300009092 | Ga0105250_10000389 | Ga0105250_1000038922 | 445 |
| 495 | 3300009092 | Ga0105250_10025394 | Ga0105250_100253942 | 445 |
| 496 | 3300021388 | Ga0213875_10000063 | Ga0213875_1000006347 | 445 |
| 497 | 3300025711 | Ga0207696_1000142 | Ga0207696_100014286 | 445 |
| 498 | 3300025728 | Ga0207655_1000026 | Ga0207655_1000026294 | 445 |
| 499 | 3300025728 | Ga0207655_1009011 | Ga0207655_10090112 | 445 |
| 500 | 3300025735 | Ga0207713_1007420 | Ga0207713_10074203 | 445 |
| 501 | 3300026121 | Ga0207683_10146037 | Ga0207683_101460371 | 445 |
| 502 | 3300027111 | Ga0209281_1000384 | Ga0209281_100038460 | 445 |
| 503 | 3300027111 | Ga0209281_1001588 | Ga0209281_10015885 | 445 |
| 504 | 3300031456 | Ga0307513_10137244 | Ga0307513_101372442 | 445 |
| 505 | 3300036712 | Ga0316584_0003578 | Ga0316584_0003578_6771_8141 | 445 |
| 506 | 3300037853 | Ga0436364_0036482 | Ga0436364_0036482_141686_143389 | 445 |
| 507 | 3300044673 | Ga0453683_0004190 | Ga0453683_0004190_3332_4699 | 445 |
| 508 | 3300044712 | Ga0453684_0000231 | Ga0453684_0000231_43828_45201 | 445 |
| 509 | 3300046530 | Ga0495654_0081484 | Ga0495654_0081484_32_1414 | 445 |
| 510 | 3300046660 | Ga0495625_0024843 | Ga0495625_0024843_213_1595 | 445 |
| 511 | 3300047320 | Ga0495672_0000051 | Ga0495672_0000051_181125_182516 | 445 |
| 512 | 3300047446 | Ga0495679_000014 | Ga0495679_000014_102207_103589 | 445 |
| 513 | 3300048928 | Ga0496125_0000032 | Ga0496125_0000032_234502_235884 | 445 |
| 514 | 3300049573 | Ga0501037_0026371 | Ga0501037_0026371_1644_2996 | 445 |
| 515 | 3300049574 | Ga0501038_0015356 | Ga0501038_0015356_4803_6155 | 445 |
| 516 | 3300049575 | Ga0501039_0007733 | Ga0501039_0007733_5631_6983 | 445 |
| 517 | 3300049576 | Ga0501040_0002725 | Ga0501040_0002725_3531_4883 | 445 |
| 518 | 3300049577 | Ga0501041_0003883 | Ga0501041_0003883_3502_4854 | 445 |
| 519 | 3300049578 | Ga0501042_0007640 | Ga0501042_0007640_3618_4970 | 445 |
| 520 | 3300049582 | Ga0501048_0011880 | Ga0501048_0011880_3199_4551 | 445 |
| 521 | 3300049587 | Ga0501071_0002875 | Ga0501071_0002875_3665_5017 | 445 |
| 522 | 3300049588 | Ga0501072_0002404 | Ga0501072_0002404_9067_10419 | 445 |
| 523 | 3300049590 | Ga0501074_0026163 | Ga0501074_0026163_995_2347 | 445 |
| 524 | 3300049591 | Ga0501075_0003232 | Ga0501075_0003232_9174_10526 | 445 |
| 525 | 3300049592 | Ga0501076_0006170 | Ga0501076_0006170_3982_5334 | 445 |
| 526 | 3300049593 | Ga0501077_0004666 | Ga0501077_0004666_1914_3266 | 445 |
| 527 | 3300049741 | Ga0501079_0000691 | Ga0501079_0000691_2114_3466 | 445 |
| 528 | 3300049742 | Ga0501080_0014035 | Ga0501080_0014035_683_2035 | 445 |
| 529 | 3300049743 | Ga0501081_0006439 | Ga0501081_0006439_3387_4739 | 445 |
| 530 | 3300049822 | Ga0501035_0068049 | Ga0501035_0068049_1657_3009 | 445 |
| 531 | 3300049824 | Ga0501045_0003649 | Ga0501045_0003649_9087_10439 | 445 |
| 532 | 3300054114 | Ga0501084_0001911 | Ga0501084_0001911_4846_6198 | 445 |
| 533 | 3300061734 | Ga0530510_0007950 | Ga0530510_0007950_3401_4753 | 445 |
| 534 | iso_pu_bacteria | 2690315857 | 2691331615 | 445 |
| 535 | iso_pu_bacteria | 2881714928 | 2881716625 | 445 |
| 536 | iso_pu_bacteria | 2887630918 | 2887632296 | 445 |
| 537 | iso_pu_bacteria | 2919493220 | 2919496718 | 445 |
| 538 | iso_pu_bacteria | 2919534386 | 2919536877 | 445 |
| 539 | iso_pu_bacteria | 2919543075 | 2919545294 | 445 |
| 540 | iso_pu_bacteria | 2923525760 | 2923526961 | 445 |
| 541 | iso_pu_bacteria | 2952252522 | 2952255917 | 445 |
| 542 | iso_pu_bacteria | 8054357960 | 8054360714 | 445 |
| 543 | 3300006946 | Ga0079104_1000656 | Ga0079104_100065620 | 446 |
| 544 | 3300027111 | Ga0209281_1000145 | Ga0209281_1000145142 | 446 |
| 545 | 3300031250 | Ga0265331_10019997 | Ga0265331_100199972 | 446 |
| 546 | 3300031251 | Ga0265327_10000044 | Ga0265327_10000044195 | 446 |
| 547 | 3300031548 | Ga0307408_100000091 | Ga0307408_10000009176 | 446 |
| 548 | 3300031727 | Ga0316576_10063714 | Ga0316576_100637143 | 446 |
| 549 | 3300036712 | Ga0316584_0124694 | Ga0316584_0124694_504_1889 | 446 |
| 550 | 3300042156 | Ga0439446_0009320 | Ga0439446_0009320_778_2145 | 446 |
| 551 | 3300048920 | Ga0496117_0007955 | Ga0496117_0007955_4578_5963 | 446 |
| 552 | 3300048924 | Ga0496121_0005503 | Ga0496121_0005503_575_1960 | 446 |
| 553 | iso_pu_bacteria | 2554235132 | 2554817587 | 446 |
| 554 | iso_pu_bacteria | 2606217733 | 2608382744 | 446 |
| 555 | iso_pu_bacteria | 8057160832 | 8057163537 | 446 |
| 556 | 3300025915 | Ga0207693_10029146 | Ga0207693_100291462 | 447 |
| 557 | 3300025929 | Ga0207664_10013185 | Ga0207664_100131853 | 447 |
| 558 | 3300028573 | Ga0265334_10000010 | Ga0265334_1000001079 | 447 |
| 559 | 3300031595 | Ga0265313_10000068 | Ga0265313_100000682 | 447 |
| 560 | 3300031728 | Ga0316578_10011385 | Ga0316578_100113851 | 447 |
| 561 | 3300035695 | Ga0373927_0000002 | Ga0373927_0000002_860704_862059 | 447 |
| 562 | 3300036712 | Ga0316584_0007566 | Ga0316584_0007566_1179_2666 | 447 |
| 563 | 3300049588 | Ga0501072_0040567 | Ga0501072_0040567_1621_2970 | 447 |
| 564 | 3300061734 | Ga0530510_0086299 | Ga0530510_0086299_667_2016 | 447 |
| 565 | 3300005288 | Ga0065714_10067601 | Ga0065714_100676014 | 448 |
| 566 | 3300005331 | Ga0070670_100000134 | Ga0070670_10000013447 | 448 |
| 567 | 3300005335 | Ga0070666_10008719 | Ga0070666_100087196 | 448 |
| 568 | 3300005353 | Ga0070669_100009888 | Ga0070669_1000098886 | 448 |
| 569 | 3300005355 | Ga0070671_100000279 | Ga0070671_10000027922 | 448 |
| 570 | 3300005367 | Ga0070667_100000060 | Ga0070667_100000060135 | 448 |
| 571 | 3300005466 | Ga0070685_10000063 | Ga0070685_1000006333 | 448 |
| 572 | 3300005617 | Ga0068859_100120445 | Ga0068859_1001204452 | 448 |
| 573 | 3300005618 | Ga0068864_100000143 | Ga0068864_10000014346 | 448 |
| 574 | 3300005843 | Ga0068860_100008811 | Ga0068860_1000088111 | 448 |
| 575 | 3300005844 | Ga0068862_100000759 | Ga0068862_1000007596 | 448 |
| 576 | 3300006931 | Ga0097620_100120447 | Ga0097620_1001204472 | 448 |
| 577 | 3300014325 | Ga0163163_10000778 | Ga0163163_100007787 | 448 |
| 578 | 3300014745 | Ga0157377_10022910 | Ga0157377_100229102 | 448 |
| 579 | 3300025735 | Ga0207713_1000419 | Ga0207713_100041918 | 448 |
| 580 | 3300025900 | Ga0207710_10043778 | Ga0207710_100437782 | 448 |
| 581 | 3300025923 | Ga0207681_10007277 | Ga0207681_100072776 | 448 |
| 582 | 3300025925 | Ga0207650_10000013 | Ga0207650_1000001323 | 448 |
| 583 | 3300025926 | Ga0207659_10072315 | Ga0207659_100723152 | 448 |
| 584 | 3300025931 | Ga0207644_10000282 | Ga0207644_1000028222 | 448 |
| 585 | 3300025940 | Ga0207691_10078998 | Ga0207691_100789982 | 448 |
| 586 | 3300025941 | Ga0207711_10002362 | Ga0207711_100023623 | 448 |
| 587 | 3300025986 | Ga0207658_10000005 | Ga0207658_1000000524 | 448 |
| 588 | 3300026035 | Ga0207703_10003380 | Ga0207703_1000338010 | 448 |
| 589 | 3300026088 | Ga0207641_10126974 | Ga0207641_101269742 | 448 |
| 590 | 3300026088 | Ga0207641_10189471 | Ga0207641_101894712 | 448 |
| 591 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010121 | 448 |
| 592 | 3300027312 | Ga0209371_1000438 | Ga0209371_100043828 | 448 |
| 593 | 3300028379 | Ga0268266_10005042 | Ga0268266_100050429 | 448 |
| 594 | 3300028380 | Ga0268265_10000613 | Ga0268265_1000061311 | 448 |
| 595 | 3300028381 | Ga0268264_10000016 | Ga0268264_10000016128 | 448 |
| 596 | 3300030500 | Ga0268256_1005681 | Ga0268256_10056813 | 448 |
| 597 | 3300031250 | Ga0265331_10014725 | Ga0265331_100147252 | 448 |
| 598 | 3300031251 | Ga0265327_10058219 | Ga0265327_100582192 | 448 |
| 599 | 3300031728 | Ga0316578_10097559 | Ga0316578_100975592 | 448 |
| 600 | 3300032002 | Ga0307416_100005907 | Ga0307416_1000059072 | 448 |
| 601 | 3300032004 | Ga0307414_10142369 | Ga0307414_101423691 | 448 |
| 602 | 3300032126 | Ga0307415_100040227 | Ga0307415_1000402272 | 448 |
| 603 | 3300032133 | Ga0316583_10004776 | Ga0316583_100047764 | 448 |
| 604 | 3300041408 | Ga0439453_0002138 | Ga0439453_0002138_1209_2561 | 448 |
| 605 | 3300042156 | Ga0439446_0000257 | Ga0439446_0000257_2419_3771 | 448 |
| 606 | 3300042184 | Ga0450908_005394 | Ga0450908_005394_565_2013 | 448 |
| 607 | 3300042436 | Ga0439435_0000641 | Ga0439435_0000641_1913_3265 | 448 |
| 608 | 3300042461 | Ga0439460_0011233 | Ga0439460_0011233_932_2284 | 448 |
| 609 | 3300042531 | Ga0450918_007379 | Ga0450918_007379_295_1743 | 448 |
| 610 | 3300048919 | Ga0496116_0000835 | Ga0496116_0000835_26028_27410 | 448 |
| 611 | 3300048922 | Ga0496119_0000391 | Ga0496119_0000391_53571_54953 | 448 |
| 612 | 3300048923 | Ga0496120_0000317 | Ga0496120_0000317_24708_26090 | 448 |
| 613 | 3300048927 | Ga0496124_0024965 | Ga0496124_0024965_1983_3344 | 448 |
| 614 | 3300048928 | Ga0496125_0076321 | Ga0496125_0076321_204_1565 | 448 |
| 615 | 3300049572 | Ga0501036_0012641 | Ga0501036_0012641_4579_5931 | 448 |
| 616 | 3300049573 | Ga0501037_0026991 | Ga0501037_0026991_971_2323 | 448 |
| 617 | 3300049574 | Ga0501038_0036714 | Ga0501038_0036714_2463_3815 | 448 |
| 618 | 3300049575 | Ga0501039_0025995 | Ga0501039_0025995_2141_3493 | 448 |
| 619 | 3300049578 | Ga0501042_0084310 | Ga0501042_0084310_663_2015 | 448 |
| 620 | 3300049578 | Ga0501042_0135215 | Ga0501042_0135215_249_1601 | 448 |
| 621 | 3300049579 | Ga0501043_0111543 | Ga0501043_0111543_265_1647 | 448 |
| 622 | 3300049580 | Ga0501046_0070030 | Ga0501046_0070030_1240_2622 | 448 |
| 623 | 3300049580 | Ga0501046_0082069 | Ga0501046_0082069_729_2081 | 448 |
| 624 | 3300049585 | Ga0501069_0061910 | Ga0501069_0061910_407_1759 | 448 |
| 625 | 3300049587 | Ga0501071_0003941 | Ga0501071_0003941_3878_5230 | 448 |
| 626 | 3300049588 | Ga0501072_0089139 | Ga0501072_0089139_931_2283 | 448 |
| 627 | 3300049589 | Ga0501073_0029739 | Ga0501073_0029739_1713_3095 | 448 |
| 628 | 3300049591 | Ga0501075_0071097 | Ga0501075_0071097_906_2258 | 448 |
| 629 | 3300049592 | Ga0501076_0015408 | Ga0501076_0015408_3719_5071 | 448 |
| 630 | 3300049741 | Ga0501079_0056664 | Ga0501079_0056664_1359_2711 | 448 |
| 631 | 3300049742 | Ga0501080_0130113 | Ga0501080_0130113_805_2157 | 448 |
| 632 | 3300049743 | Ga0501081_0134086 | Ga0501081_0134086_243_1595 | 448 |
| 633 | 3300049822 | Ga0501035_0028332 | Ga0501035_0028332_1701_3053 | 448 |
| 634 | 3300049823 | Ga0501044_0229725 | Ga0501044_0229725_403_1785 | 448 |
| 635 | 3300049824 | Ga0501045_0003730 | Ga0501045_0003730_4752_6104 | 448 |
| 636 | 3300053098 | Ga0500650_0001226 | Ga0500650_0001226_4399_5760 | 448 |
| 637 | iso_pu_bacteria | 2600254954 | 2600443672 | 448 |
| 638 | iso_pu_bacteria | 2600255389 | 2602008871 | 448 |
| 639 | iso_pu_bacteria | 2738541276 | 2738715384 | 448 |
| 640 | iso_pu_bacteria | 2823421272 | 2823425244 | 448 |
| 641 | iso_pu_bacteria | 2919501602 | 2919501989 | 448 |
| 642 | iso_pu_bacteria | 2926063275 | 2926063662 | 448 |
| 643 | iso_pu_bacteria | 8002745576 | 8002748048 | 448 |
| 644 | iso_pu_bacteria | 8034962539 | 8034963240 | 448 |
| 645 | 3300003751 | Ga0055538_1000065 | Ga0055538_100006538 | 449 |
| 646 | 3300003752 | Ga0055539_1000099 | Ga0055539_100009938 | 449 |
| 647 | 3300003756 | Ga0055533_1000109 | Ga0055533_100010938 | 449 |
| 648 | 3300003758 | Ga0055532_1000094 | Ga0055532_100009438 | 449 |
| 649 | 3300003759 | Ga0055525_1000143 | Ga0055525_100014338 | 449 |
| 650 | 3300003794 | Ga0055531_10000266 | Ga0055531_1000026610 | 449 |
| 651 | 3300003841 | Ga0055541_1000066 | Ga0055541_100006653 | 449 |
| 652 | 3300005288 | Ga0065714_10016908 | Ga0065714_100169083 | 449 |
| 653 | 3300005288 | Ga0065714_10079000 | Ga0065714_100790002 | 449 |
| 654 | 3300005344 | Ga0070661_100000208 | Ga0070661_10000020839 | 449 |
| 655 | 3300005353 | Ga0070669_100000089 | Ga0070669_1000000897 | 449 |
| 656 | 3300005457 | Ga0070662_100000419 | Ga0070662_1000004192 | 449 |
| 657 | 3300005548 | Ga0070665_100080276 | Ga0070665_1000802761 | 449 |
| 658 | 3300005564 | Ga0070664_100000145 | Ga0070664_10000014538 | 449 |
| 659 | 3300005564 | Ga0070664_100147485 | Ga0070664_1001474852 | 449 |
| 660 | 3300005578 | Ga0068854_100007740 | Ga0068854_1000077405 | 449 |
| 661 | 3300005834 | Ga0068851_10000002 | Ga0068851_10000002197 | 449 |
| 662 | 3300006051 | Ga0075364_10112847 | Ga0075364_101128471 | 449 |
| 663 | 3300009011 | Ga0105251_10029578 | Ga0105251_100295783 | 449 |
| 664 | 3300009036 | Ga0105244_10000211 | Ga0105244_1000021156 | 449 |
| 665 | 3300009036 | Ga0105244_10000312 | Ga0105244_1000031238 | 449 |
| 666 | 3300009036 | Ga0105244_10001031 | Ga0105244_1000103116 | 449 |
| 667 | 3300009092 | Ga0105250_10000194 | Ga0105250_100001949 | 449 |
| 668 | 3300009092 | Ga0105250_10005679 | Ga0105250_100056793 | 449 |
| 669 | 3300009148 | Ga0105243_10022674 | Ga0105243_100226743 | 449 |
| 670 | 3300009176 | Ga0105242_10002635 | Ga0105242_1000263510 | 449 |
| 671 | 3300009545 | Ga0105237_10002302 | Ga0105237_100023026 | 449 |
| 672 | 3300011119 | Ga0105246_10001531 | Ga0105246_100015317 | 449 |
| 673 | 3300013100 | Ga0157373_10055285 | Ga0157373_100552853 | 449 |
| 674 | 3300013100 | Ga0157373_10095209 | Ga0157373_100952093 | 449 |
| 675 | 3300013100 | Ga0157373_10105067 | Ga0157373_101050671 | 449 |
| 676 | 3300013102 | Ga0157371_10000185 | Ga0157371_1000018544 | 449 |
| 677 | 3300013104 | Ga0157370_10182400 | Ga0157370_101824002 | 449 |
| 678 | 3300013105 | Ga0157369_10009210 | Ga0157369_1000921010 | 449 |
| 679 | 3300013105 | Ga0157369_10011125 | Ga0157369_100111254 | 449 |
| 680 | 3300013308 | Ga0157375_10028882 | Ga0157375_100288823 | 449 |
| 681 | 3300014497 | Ga0182008_10009700 | Ga0182008_100097003 | 449 |
| 682 | 3300025206 | Ga0209435_102069 | Ga0209435_1020691 | 449 |
| 683 | 3300025224 | Ga0209784_100101 | Ga0209784_10010153 | 449 |
| 684 | 3300025225 | Ga0209566_100123 | Ga0209566_10012353 | 449 |
| 685 | 3300025226 | Ga0209674_100145 | Ga0209674_10014553 | 449 |
| 686 | 3300025229 | Ga0209147_100151 | Ga0209147_10015153 | 449 |
| 687 | 3300025230 | Ga0209563_100128 | Ga0209563_10012853 | 449 |
| 688 | 3300025242 | Ga0209258_100241 | Ga0209258_10024153 | 449 |
| 689 | 3300025253 | Ga0209677_100094 | Ga0209677_10009453 | 449 |
| 690 | 3300025256 | Ga0209759_1005193 | Ga0209759_10051933 | 449 |
| 691 | 3300025321 | Ga0207656_10000045 | Ga0207656_1000004532 | 449 |
| 692 | 3300025711 | Ga0207696_1000126 | Ga0207696_1000126119 | 449 |
| 693 | 3300025728 | Ga0207655_1000120 | Ga0207655_10001206 | 449 |
| 694 | 3300025728 | Ga0207655_1000378 | Ga0207655_100037847 | 449 |
| 695 | 3300025728 | Ga0207655_1003230 | Ga0207655_10032302 | 449 |
| 696 | 3300025728 | Ga0207655_1007999 | Ga0207655_10079992 | 449 |
| 697 | 3300025735 | Ga0207713_1000229 | Ga0207713_100022939 | 449 |
| 698 | 3300025735 | Ga0207713_1000233 | Ga0207713_100023324 | 449 |
| 699 | 3300025735 | Ga0207713_1001606 | Ga0207713_10016063 | 449 |
| 700 | 3300025914 | Ga0207671_10000613 | Ga0207671_1000061340 | 449 |
| 701 | 3300025920 | Ga0207649_10000023 | Ga0207649_10000023116 | 449 |
| 702 | 3300025923 | Ga0207681_10000134 | Ga0207681_1000013454 | 449 |
| 703 | 3300025925 | Ga0207650_10000100 | Ga0207650_1000010066 | 449 |
| 704 | 3300025933 | Ga0207706_10000056 | Ga0207706_1000005643 | 449 |
| 705 | 3300025934 | Ga0207686_10001071 | Ga0207686_100010716 | 449 |
| 706 | 3300025945 | Ga0207679_10000017 | Ga0207679_10000017116 | 449 |
| 707 | 3300026041 | Ga0207639_10005168 | Ga0207639_100051685 | 449 |
| 708 | 3300028379 | Ga0268266_10043875 | Ga0268266_100438753 | 449 |
| 709 | 3300031251 | Ga0265327_10002604 | Ga0265327_1000260414 | 449 |
| 710 | 3300031731 | Ga0307405_10007687 | Ga0307405_100076874 | 449 |
| 711 | 3300032133 | Ga0316583_10024695 | Ga0316583_100246952 | 449 |
| 712 | 3300037853 | Ga0436364_0939013 | Ga0436364_0939013_562_1953 | 449 |
| 713 | 3300039062 | Ga0400483_028483 | Ga0400483_028483_20717_22081 | 449 |
| 714 | 3300039062 | Ga0400483_196526 | Ga0400483_196526_21884_23248 | 449 |
| 715 | 3300039062 | Ga0400483_246213 | Ga0400483_246213_16347_17711 | 449 |
| 716 | 3300044712 | Ga0453684_0122219 | Ga0453684_0122219_1754_3121 | 449 |
| 717 | 3300045051 | Ga0451576_0366787 | Ga0451576_0366787_83_1450 | 449 |
| 718 | 3300046453 | Ga0495627_000104 | Ga0495627_000104_80004_81371 | 449 |
| 719 | 3300046453 | Ga0495627_004493 | Ga0495627_004493_2396_3763 | 449 |
| 720 | 3300046458 | Ga0495591_000087 | Ga0495591_000087_80667_82034 | 449 |
| 721 | 3300046458 | Ga0495591_011840 | Ga0495591_011840_1898_3265 | 449 |
| 722 | 3300046458 | Ga0495591_025548 | Ga0495591_025548_288_1655 | 449 |
| 723 | 3300046471 | Ga0495650_0002361 | Ga0495650_0002361_13122_14489 | 449 |
| 724 | 3300046474 | Ga0495605_0000033 | Ga0495605_0000033_1361_2728 | 449 |
| 725 | 3300046474 | Ga0495605_0000140 | Ga0495605_0000140_58663_60030 | 449 |
| 726 | 3300046474 | Ga0495605_0006673 | Ga0495605_0006673_4072_5439 | 449 |
| 727 | 3300046501 | Ga0495607_0000340 | Ga0495607_0000340_46936_48303 | 449 |
| 728 | 3300046501 | Ga0495607_0001890 | Ga0495607_0001890_240_1607 | 449 |
| 729 | 3300046506 | Ga0495583_0000031 | Ga0495583_0000031_251729_253096 | 449 |
| 730 | 3300046506 | Ga0495583_0002043 | Ga0495583_0002043_1232_2599 | 449 |
| 731 | 3300046506 | Ga0495583_0020275 | Ga0495583_0020275_1376_2743 | 449 |
| 732 | 3300046507 | Ga0495606_0007491 | Ga0495606_0007491_6469_7836 | 449 |
| 733 | 3300046512 | Ga0495610_0019602 | Ga0495610_0019602_887_2254 | 449 |
| 734 | 3300046515 | Ga0495620_0000099 | Ga0495620_0000099_1007_2374 | 449 |
| 735 | 3300046519 | Ga0495632_0008850 | Ga0495632_0008850_1020_2387 | 449 |
| 736 | 3300046524 | Ga0495648_0011321 | Ga0495648_0011321_885_2252 | 449 |
| 737 | 3300046530 | Ga0495654_0004408 | Ga0495654_0004408_709_2076 | 449 |
| 738 | 3300046538 | Ga0495609_0000018 | Ga0495609_0000018_101101_102468 | 449 |
| 739 | 3300046538 | Ga0495609_0000194 | Ga0495609_0000194_24813_26180 | 449 |
| 740 | 3300046542 | Ga0495597_0000066 | Ga0495597_0000066_66487_67854 | 449 |
| 741 | 3300046665 | Ga0495661_0000336 | Ga0495661_0000336_36105_37472 | 449 |
| 742 | 3300046665 | Ga0495661_0001986 | Ga0495661_0001986_13918_15285 | 449 |
| 743 | 3300046665 | Ga0495661_0003038 | Ga0495661_0003038_9354_10721 | 449 |
| 744 | 3300046691 | Ga0495670_0007882 | Ga0495670_0007882_2812_4179 | 449 |
| 745 | 3300046794 | Ga0495589_0005996 | Ga0495589_0005996_4135_5502 | 449 |
| 746 | 3300046794 | Ga0495589_0014113 | Ga0495589_0014113_1830_3197 | 449 |
| 747 | 3300046810 | Ga0495660_0001176 | Ga0495660_0001176_15743_17197 | 449 |
| 748 | 3300046810 | Ga0495660_0008799 | Ga0495660_0008799_1124_2491 | 449 |
| 749 | 3300047320 | Ga0495672_0032984 | Ga0495672_0032984_1806_3173 | 449 |
| 750 | 3300047323 | Ga0495683_0000082 | Ga0495683_0000082_92142_93509 | 449 |
| 751 | 3300047446 | Ga0495679_000305 | Ga0495679_000305_1172_2539 | 449 |
| 752 | 3300048091 | Ga0495626_0005048 | Ga0495626_0005048_6510_7859 | 449 |
| 753 | 3300048920 | Ga0496117_0004589 | Ga0496117_0004589_5068_6435 | 449 |
| 754 | 3300048920 | Ga0496117_0035949 | Ga0496117_0035949_726_2093 | 449 |
| 755 | 3300048920 | Ga0496117_0057654 | Ga0496117_0057654_151_1518 | 449 |
| 756 | 3300048921 | Ga0496118_0071085 | Ga0496118_0071085_1007_2374 | 449 |
| 757 | 3300048923 | Ga0496120_0022993 | Ga0496120_0022993_1263_2630 | 449 |
| 758 | 3300048923 | Ga0496120_0026635 | Ga0496120_0026635_999_2366 | 449 |
| 759 | 3300048924 | Ga0496121_0052221 | Ga0496121_0052221_1057_2424 | 449 |
| 760 | 3300048925 | Ga0496122_0037343 | Ga0496122_0037343_738_2105 | 449 |
| 761 | 3300048925 | Ga0496122_0044849 | Ga0496122_0044849_1807_3174 | 449 |
| 762 | 3300048926 | Ga0496123_0049604 | Ga0496123_0049604_639_2006 | 449 |
| 763 | 3300048927 | Ga0496124_0011229 | Ga0496124_0011229_1247_2614 | 449 |
| 764 | 3300048927 | Ga0496124_0087110 | Ga0496124_0087110_805_2172 | 449 |
| 765 | 3300048928 | Ga0496125_0004777 | Ga0496125_0004777_8751_10118 | 449 |
| 766 | 3300048928 | Ga0496125_0058859 | Ga0496125_0058859_1287_2654 | 449 |
| 767 | 3300048929 | Ga0496126_0020625 | Ga0496126_0020625_1295_2662 | 449 |
| 768 | 3300049459 | Ga0495678_000021 | Ga0495678_000021_998_2365 | 449 |
| 769 | 3300049823 | Ga0501044_0000065 | Ga0501044_0000065_1818_3212 | 449 |
| 770 | 3300053140 | Ga0500573_0034852 | Ga0500573_0034852_213_1580 | 449 |
| 771 | iso_pu_bacteria | 2510065053 | 2510284763 | 449 |
| 772 | iso_pu_bacteria | 2510065055 | 2510295076 | 449 |
| 773 | iso_pu_bacteria | 2510065058 | 2510312141 | 449 |
| 774 | iso_pu_bacteria | 2537561728 | 2538426098 | 449 |
| 775 | iso_pu_bacteria | 2565956521 | 2566035509 | 449 |
| 776 | iso_pu_bacteria | 2648501241 | 2649121488 | 449 |
| 777 | iso_pu_bacteria | 2651869818 | 2652974394 | 449 |
| 778 | iso_pu_bacteria | 2728369097 | 2729144970 | 449 |
| 779 | iso_pu_bacteria | 2773857672 | 2774131388 | 449 |
| 780 | iso_pu_bacteria | 2846540461 | 2846541001 | 449 |
| 781 | iso_pu_bacteria | 2855195626 | 2855197650 | 449 |
| 782 | iso_pu_bacteria | 2858466076 | 2858466355 | 449 |
| 783 | iso_pu_bacteria | 2871272651 | 2871276532 | 449 |
| 784 | iso_pu_bacteria | 2871282230 | 2871283863 | 449 |
| 785 | iso_pu_bacteria | 2900051742 | 2900056093 | 449 |
| 786 | iso_pu_bacteria | 2917832318 | 2917834252 | 449 |
| 787 | iso_pu_bacteria | 2919125081 | 2919127807 | 449 |
| 788 | iso_pu_bacteria | 2974298342 | 2974298593 | 449 |
| 789 | iso_pu_bacteria | 2984504281 | 2984505718 | 449 |
| 790 | iso_pu_bacteria | 640427133 | 640486901 | 449 |
| 791 | iso_pu_bacteria | 651053060 | 651174774 | 449 |
| 792 | 3300005295 | Ga0065707_10085062 | Ga0065707_100850622 | 450 |
| 793 | 3300006038 | Ga0075365_10000697 | Ga0075365_1000069714 | 450 |
| 794 | 3300030742 | Ga0316183_1017054 | Ga0316183_10170541 | 450 |
| 795 | 3300031665 | Ga0316575_10057811 | Ga0316575_100578111 | 450 |
| 796 | 3300031727 | Ga0316576_10002258 | Ga0316576_100022583 | 450 |
| 797 | 3300031727 | Ga0316576_10065716 | Ga0316576_100657162 | 450 |
| 798 | 3300031727 | Ga0316576_10109184 | Ga0316576_101091841 | 450 |
| 799 | 3300031728 | Ga0316578_10011851 | Ga0316578_100118512 | 450 |
| 800 | 3300031728 | Ga0316578_10027858 | Ga0316578_100278582 | 450 |
| 801 | 3300031733 | Ga0316577_10022083 | Ga0316577_100220832 | 450 |
| 802 | 3300035398 | Ga0316574_0002035 | Ga0316574_0002035_5859_7217 | 450 |
| 803 | 3300035398 | Ga0316574_0030478 | Ga0316574_0030478_1171_2529 | 450 |
| 804 | 3300046460 | Ga0495638_0006800 | Ga0495638_0006800_4140_5492 | 450 |
| 805 | 3300046660 | Ga0495625_0001706 | Ga0495625_0001706_17143_18495 | 450 |
| 806 | 3300048919 | Ga0496116_0000107 | Ga0496116_0000107_27596_28960 | 450 |
| 807 | 3300048924 | Ga0496121_0001160 | Ga0496121_0001160_27154_28518 | 450 |
| 808 | 3300050492 | nmdc:mga0yw44_2366_c1 | nmdc:mga0yw44_2366_c1_1519_2907 | 450 |
| 809 | iso_pu_bacteria | 2506520007 | 2506576642 | 450 |
| 810 | iso_pu_bacteria | 2506520008 | 2506581780 | 450 |
| 811 | iso_pu_bacteria | 2508501071 | 2508850585 | 450 |
| 812 | iso_pu_bacteria | 2511231025 | 2511378341 | 450 |
| 813 | iso_pu_bacteria | 2511231035 | 2511433816 | 450 |
| 814 | iso_pu_bacteria | 2547132181 | 2547696531 | 450 |
| 815 | iso_pu_bacteria | 2554235234 | 2555262012 | 450 |
| 816 | iso_pu_bacteria | 2561511199 | 2562465899 | 450 |
| 817 | iso_pu_bacteria | 2585427591 | 2585826215 | 450 |
| 818 | iso_pu_bacteria | 2585427592 | 2585830755 | 450 |
| 819 | iso_pu_bacteria | 2599185169 | 2599412888 | 450 |
| 820 | iso_pu_bacteria | 2599185299 | 2599928107 | 450 |
| 821 | iso_pu_bacteria | 2600255254 | 2601525641 | 450 |
| 822 | iso_pu_bacteria | 2600255255 | 2601530750 | 450 |
| 823 | iso_pu_bacteria | 2600255256 | 2601533942 | 450 |
| 824 | iso_pu_bacteria | 2600255257 | 2601540110 | 450 |
| 825 | iso_pu_bacteria | 2600255280 | 2601617761 | 450 |
| 826 | iso_pu_bacteria | 2600255281 | 2601622796 | 450 |
| 827 | iso_pu_bacteria | 2600255287 | 2601644659 | 450 |
| 828 | iso_pu_bacteria | 2600255288 | 2601651069 | 450 |
| 829 | iso_pu_bacteria | 2600255289 | 2601656118 | 450 |
| 830 | iso_pu_bacteria | 2600255290 | 2601661042 | 450 |
| 831 | iso_pu_bacteria | 2600255291 | 2601664824 | 450 |
| 832 | iso_pu_bacteria | 2600255298 | 2601697308 | 450 |
| 833 | iso_pu_bacteria | 2600255299 | 2601702696 | 450 |
| 834 | iso_pu_bacteria | 2600255300 | 2601708884 | 450 |
| 835 | iso_pu_bacteria | 2600255301 | 2601713922 | 450 |
| 836 | iso_pu_bacteria | 2600255302 | 2601718967 | 450 |
| 837 | iso_pu_bacteria | 2600255303 | 2601722645 | 450 |
| 838 | iso_pu_bacteria | 2600255304 | 2601728912 | 450 |
| 839 | iso_pu_bacteria | 2600255305 | 2601733913 | 450 |
| 840 | iso_pu_bacteria | 2600255306 | 2601738889 | 450 |
| 841 | iso_pu_bacteria | 2600255307 | 2601743303 | 450 |
| 842 | iso_pu_bacteria | 2600255309 | 2601754429 | 450 |
| 843 | iso_pu_bacteria | 2600255310 | 2601758907 | 450 |
| 844 | iso_pu_bacteria | 2600255311 | 2601762743 | 450 |
| 845 | iso_pu_bacteria | 2600255392 | 2602021370 | 450 |
| 846 | iso_pu_bacteria | 2602042046 | 2603640595 | 450 |
| 847 | iso_pu_bacteria | 2602042047 | 2603644623 | 450 |
| 848 | iso_pu_bacteria | 2602042052 | 2603662859 | 450 |
| 849 | iso_pu_bacteria | 2602042053 | 2603667756 | 450 |
| 850 | iso_pu_bacteria | 2602042066 | 2603700475 | 450 |
| 851 | iso_pu_bacteria | 2602042067 | 2603705915 | 450 |
| 852 | iso_pu_bacteria | 2602042103 | 2603841438 | 450 |
| 853 | iso_pu_bacteria | 2602042104 | 2603846433 | 450 |
| 854 | iso_pu_bacteria | 2602042105 | 2603851508 | 450 |
| 855 | iso_pu_bacteria | 2602042106 | 2603856651 | 450 |
| 856 | iso_pu_bacteria | 2602042109 | 2603868503 | 450 |
| 857 | iso_pu_bacteria | 2602042110 | 2603874155 | 450 |
| 858 | iso_pu_bacteria | 2602042111 | 2603878565 | 450 |
| 859 | iso_pu_bacteria | 2603880178 | 2606051410 | 450 |
| 860 | iso_pu_bacteria | 2603880184 | 2606072313 | 450 |
| 861 | iso_pu_bacteria | 2603880202 | 2606149096 | 450 |
| 862 | iso_pu_bacteria | 2603880211 | 2606179226 | 450 |
| 863 | iso_pu_bacteria | 2609459761 | 2609912002 | 450 |
| 864 | iso_pu_bacteria | 2636415599 | 2637227185 | 450 |
| 865 | iso_pu_bacteria | 2648501693 | 2650900237 | 450 |
| 866 | iso_pu_bacteria | 2654587920 | 2656276461 | 450 |
| 867 | iso_pu_bacteria | 2667528172 | 2671103731 | 450 |
| 868 | iso_pu_bacteria | 2667528173 | 2671106524 | 450 |
| 869 | iso_pu_bacteria | 2671180115 | 2671586837 | 450 |
| 870 | iso_pu_bacteria | 2675903046 | 2676409850 | 450 |
| 871 | iso_pu_bacteria | 2681812866 | 2681996824 | 450 |
| 872 | iso_pu_bacteria | 2681812869 | 2682008605 | 450 |
| 873 | iso_pu_bacteria | 2684622997 | 2686354476 | 450 |
| 874 | iso_pu_bacteria | 2687453601 | 2689443020 | 450 |
| 875 | iso_pu_bacteria | 2706794495 | 2707101255 | 450 |
| 876 | iso_pu_bacteria | 2711768156 | 2712472386 | 450 |
| 877 | iso_pu_bacteria | 2751185917 | 2753854543 | 450 |
| 878 | iso_pu_bacteria | 2765235842 | 2765587402 | 450 |
| 879 | iso_pu_bacteria | 2772190666 | 2772437173 | 450 |
| 880 | iso_pu_bacteria | 2775506706 | 2775540790 | 450 |
| 881 | iso_pu_bacteria | 2775507074 | 2777021583 | 450 |
| 882 | iso_pu_bacteria | 2791354903 | 2791924230 | 450 |
| 883 | iso_pu_bacteria | 2791355010 | 2792313306 | 450 |
| 884 | iso_pu_bacteria | 2791355275 | 2793406944 | 450 |
| 885 | iso_pu_bacteria | 2806310673 | 2807177931 | 450 |
| 886 | iso_pu_bacteria | 2808606379 | 2808942456 | 450 |
| 887 | iso_pu_bacteria | 2808606414 | 2809124236 | 450 |
| 888 | iso_pu_bacteria | 2811995292 | 2813730644 | 450 |
| 889 | iso_pu_bacteria | 2814123068 | 2814698251 | 450 |
| 890 | iso_pu_bacteria | 2821118458 | 2821121406 | 450 |
| 891 | iso_pu_bacteria | 2823373977 | 2823377479 | 450 |
| 892 | iso_pu_bacteria | 2844425489 | 2844426096 | 450 |
| 893 | iso_pu_bacteria | 2844528606 | 2844532622 | 450 |
| 894 | iso_pu_bacteria | 2847085930 | 2847089144 | 450 |
| 895 | iso_pu_bacteria | 2847797336 | 2847801330 | 450 |
| 896 | iso_pu_bacteria | 2852103415 | 2852106154 | 450 |
| 897 | iso_pu_bacteria | 2854601825 | 2854605141 | 450 |
| 898 | iso_pu_bacteria | 2865014394 | 2865018628 | 450 |
| 899 | iso_pu_bacteria | 2869551831 | 2869552424 | 450 |
| 900 | iso_pu_bacteria | 2876601092 | 2876605763 | 450 |
| 901 | iso_pu_bacteria | 2881609920 | 2881611773 | 450 |
| 902 | iso_pu_bacteria | 2884086401 | 2884090558 | 450 |
| 903 | iso_pu_bacteria | 2888366609 | 2888367225 | 450 |
| 904 | iso_pu_bacteria | 2891670763 | 2891672287 | 450 |
| 905 | iso_pu_bacteria | 2904474040 | 2904474328 | 450 |
| 906 | iso_pu_bacteria | 2904504865 | 2904507084 | 450 |
| 907 | iso_pu_bacteria | 2904513164 | 2904516092 | 450 |
| 908 | iso_pu_bacteria | 2908669403 | 2908673086 | 450 |
| 909 | iso_pu_bacteria | 2919108558 | 2919112807 | 450 |
| 910 | iso_pu_bacteria | 2919150387 | 2919150675 | 450 |
| 911 | iso_pu_bacteria | 2923634449 | 2923637932 | 450 |
| 912 | iso_pu_bacteria | 2927143783 | 2927145548 | 450 |
| 913 | iso_pu_bacteria | 2927833300 | 2927835629 | 450 |
| 914 | iso_pu_bacteria | 2932406140 | 2932406525 | 450 |
| 915 | iso_pu_bacteria | 2935625433 | 2935627897 | 450 |
| 916 | iso_pu_bacteria | 2937539931 | 2937540061 | 450 |
| 917 | iso_pu_bacteria | 2937967321 | 2937970780 | 450 |
| 918 | iso_pu_bacteria | 2939568625 | 2939571613 | 450 |
| 919 | iso_pu_bacteria | 2939573065 | 2939576001 | 450 |
| 920 | iso_pu_bacteria | 2939577877 | 2939578053 | 450 |
| 921 | iso_pu_bacteria | 2939602548 | 2939606612 | 450 |
| 922 | iso_pu_bacteria | 2939607340 | 2939609520 | 450 |
| 923 | iso_pu_bacteria | 2939617950 | 2939619683 | 450 |
| 924 | iso_pu_bacteria | 2939642701 | 2939645980 | 450 |
| 925 | iso_pu_bacteria | 2939651529 | 2939651985 | 450 |
| 926 | iso_pu_bacteria | 2945874760 | 2945879827 | 450 |
| 927 | iso_pu_bacteria | 2945951305 | 2945954355 | 450 |
| 928 | iso_pu_bacteria | 2969079654 | 2969084199 | 450 |
| 929 | iso_pu_bacteria | 2971820967 | 2971825706 | 450 |
| 930 | iso_pu_bacteria | 2974310843 | 2974313667 | 450 |
| 931 | iso_pu_bacteria | 2974435778 | 2974436925 | 450 |
| 932 | iso_pu_bacteria | 2984494565 | 2984498161 | 450 |
| 933 | iso_pu_bacteria | 2984559226 | 2984561279 | 450 |
| 934 | iso_pu_bacteria | 2984595703 | 2984599349 | 450 |
| 935 | iso_pu_bacteria | 2990196909 | 2990198091 | 450 |
| 936 | iso_pu_bacteria | 2990261002 | 2990265141 | 450 |
| 937 | iso_pu_bacteria | 3000376612 | 3000380561 | 450 |
| 938 | iso_pu_bacteria | 3007252601 | 3007255496 | 450 |
| 939 | iso_pu_bacteria | 640753048 | 640936178 | 450 |
| 940 | iso_pu_bacteria | 8004592986 | 8004597875 | 450 |
| 941 | iso_pu_bacteria | 8015394850 | 8015396103 | 450 |
| 942 | iso_pu_bacteria | 8016733728 | 8016737293 | 450 |
| 943 | iso_pu_bacteria | 8018221730 | 8018224969 | 450 |
| 944 | iso_pu_bacteria | 8018405270 | 8018409990 | 450 |
| 945 | iso_pu_bacteria | 8019499862 | 8019502493 | 450 |
| 946 | iso_pu_bacteria | 8019504834 | 8019506795 | 450 |
| 947 | iso_pu_bacteria | 8054844752 | 8054848626 | 450 |
| 948 | iso_pu_bacteria | 8054849141 | 8054850072 | 450 |
| 949 | iso_pu_bacteria | 8055087960 | 8055091491 | 450 |
| 950 | iso_pu_bacteria | 8055092621 | 8055092807 | 450 |
| 951 | iso_pu_bacteria | 8055097453 | 8055100707 | 450 |
| 952 | iso_pu_bacteria | 8055693939 | 8055697638 | 450 |
| 953 | iso_pu_bacteria | 8057304971 | 8057307382 | 450 |
| 954 | 3300003323 | rootH1_10012389 | rootH1_1001238939 | 451 |
| 955 | 3300005547 | Ga0070693_100031492 | Ga0070693_1000314922 | 451 |
| 956 | 3300006846 | Ga0075430_100219202 | Ga0075430_1002192021 | 451 |
| 957 | 3300031548 | Ga0307408_100000216 | Ga0307408_1000002163 | 451 |
| 958 | 3300031665 | Ga0316575_10002831 | Ga0316575_100028313 | 451 |
| 959 | 3300031691 | Ga0316579_10062073 | Ga0316579_100620731 | 451 |
| 960 | 3300031727 | Ga0316576_10000354 | Ga0316576_100003543 | 451 |
| 961 | 3300031728 | Ga0316578_10001858 | Ga0316578_100018581 | 451 |
| 962 | 3300031728 | Ga0316578_10017136 | Ga0316578_100171362 | 451 |
| 963 | 3300031901 | Ga0307406_10075232 | Ga0307406_100752322 | 451 |
| 964 | 3300032137 | Ga0316585_10000461 | Ga0316585_100004612 | 451 |
| 965 | 3300032139 | Ga0316580_10000964 | Ga0316580_100009643 | 451 |
| 966 | 3300035398 | Ga0316574_0002892 | Ga0316574_0002892_4927_6306 | 451 |
| 967 | 3300036647 | Ga0316582_0002628 | Ga0316582_0002628_6900_8279 | 451 |
| 968 | 3300036712 | Ga0316584_0039754 | Ga0316584_0039754_528_1955 | 451 |
| 969 | 3300036712 | Ga0316584_0057190 | Ga0316584_0057190_90_1469 | 451 |
| 970 | 3300042129 | Ga0450891_001666 | Ga0450891_001666_205_1575 | 451 |
| 971 | 3300049758 | Ga0501241_002164 | Ga0501241_002164_804_2174 | 451 |
| 972 | 3300050509 | nmdc:mga0qj67_204369_c1 | nmdc:mga0qj67_204369_c1_72_1427 | 451 |
| 973 | 3300053156 | Ga0500622_0004521 | Ga0500622_0004521_4245_5606 | 451 |
| 974 | 3300053156 | Ga0500622_0014825 | Ga0500622_0014825_2689_4050 | 451 |
| 975 | 3300053178 | Ga0500637_0003153 | Ga0500637_0003153_35_1399 | 451 |
| 976 | iso_pu_bacteria | 2511231004 | 2511252922 | 451 |
| 977 | iso_pu_bacteria | 2511231006 | 2511267762 | 451 |
| 978 | iso_pu_bacteria | 2511231007 | 2511271359 | 451 |
| 979 | iso_pu_bacteria | 2511231008 | 2511278493 | 451 |
| 980 | iso_pu_bacteria | 2511231010 | 2511287772 | 451 |
| 981 | iso_pu_bacteria | 2511231011 | 2511295280 | 451 |
| 982 | iso_pu_bacteria | 2511231012 | 2511304978 | 451 |
| 983 | iso_pu_bacteria | 2511231014 | 2511315860 | 451 |
| 984 | iso_pu_bacteria | 2511231015 | 2511323218 | 451 |
| 985 | iso_pu_bacteria | 2511231016 | 2511326842 | 451 |
| 986 | iso_pu_bacteria | 2511231017 | 2511335026 | 451 |
| 987 | iso_pu_bacteria | 2511231018 | 2511338322 | 451 |
| 988 | iso_pu_bacteria | 2511231019 | 2511344547 | 451 |
| 989 | iso_pu_bacteria | 2511231020 | 2511350933 | 451 |
| 990 | iso_pu_bacteria | 2511231021 | 2511359911 | 451 |
| 991 | iso_pu_bacteria | 2511231022 | 2511362053 | 451 |
| 992 | iso_pu_bacteria | 2511231023 | 2511370636 | 451 |
| 993 | iso_pu_bacteria | 2511231024 | 2511375148 | 451 |
| 994 | iso_pu_bacteria | 2511231031 | 2511411447 | 451 |
| 995 | iso_pu_bacteria | 2511231156 | 2511827069 | 451 |
| 996 | iso_pu_bacteria | 2512047018 | 2512324681 | 451 |
| 997 | iso_pu_bacteria | 2554235231 | 2555245658 | 451 |
| 998 | iso_pu_bacteria | 2554235341 | 2555672273 | 451 |
| 999 | iso_pu_bacteria | 2582580891 | 2583794760 | 451 |
| 1000 | iso_pu_bacteria | 2597489887 | 2597860352 | 451 |
| 1001 | iso_pu_bacteria | 2597489888 | 2597866087 | 451 |
| 1002 | iso_pu_bacteria | 2597489889 | 2597871916 | 451 |
| 1003 | iso_pu_bacteria | 2599185155 | 2599329471 | 451 |
| 1004 | iso_pu_bacteria | 2599185160 | 2599358291 | 451 |
| 1005 | iso_pu_bacteria | 2599185161 | 2599364640 | 451 |
| 1006 | iso_pu_bacteria | 2599185162 | 2599370824 | 451 |
| 1007 | iso_pu_bacteria | 2599185163 | 2599376846 | 451 |
| 1008 | iso_pu_bacteria | 2599185164 | 2599383456 | 451 |
| 1009 | iso_pu_bacteria | 2599185165 | 2599389903 | 451 |
| 1010 | iso_pu_bacteria | 2599185166 | 2599396186 | 451 |
| 1011 | iso_pu_bacteria | 2599185167 | 2599401450 | 451 |
| 1012 | iso_pu_bacteria | 2599185168 | 2599408026 | 451 |
| 1013 | iso_pu_bacteria | 2599185179 | 2599453137 | 451 |
| 1014 | iso_pu_bacteria | 2599185181 | 2599465106 | 451 |
| 1015 | iso_pu_bacteria | 2599185182 | 2599471415 | 451 |
| 1016 | iso_pu_bacteria | 2599185185 | 2599486806 | 451 |
| 1017 | iso_pu_bacteria | 2599185186 | 2599493979 | 451 |
| 1018 | iso_pu_bacteria | 2599185188 | 2599505207 | 451 |
| 1019 | iso_pu_bacteria | 2599185189 | 2599509885 | 451 |
| 1020 | iso_pu_bacteria | 2599185190 | 2599515140 | 451 |
| 1021 | iso_pu_bacteria | 2599185191 | 2599520305 | 451 |
| 1022 | iso_pu_bacteria | 2599185212 | 2599616894 | 451 |
| 1023 | iso_pu_bacteria | 2599185248 | 2599772862 | 451 |
| 1024 | iso_pu_bacteria | 2599185257 | 2599807070 | 451 |
| 1025 | iso_pu_bacteria | 2599185288 | 2599881742 | 451 |
| 1026 | iso_pu_bacteria | 2599185289 | 2599888176 | 451 |
| 1027 | iso_pu_bacteria | 2599185290 | 2599894520 | 451 |
| 1028 | iso_pu_bacteria | 2599185291 | 2599901042 | 451 |
| 1029 | iso_pu_bacteria | 2599185300 | 2599934525 | 451 |
| 1030 | iso_pu_bacteria | 2599185302 | 2599945104 | 451 |
| 1031 | iso_pu_bacteria | 2599185303 | 2599949367 | 451 |
| 1032 | iso_pu_bacteria | 2599185304 | 2599955167 | 451 |
| 1033 | iso_pu_bacteria | 2599185305 | 2599962772 | 451 |
| 1034 | iso_pu_bacteria | 2599185306 | 2599969278 | 451 |
| 1035 | iso_pu_bacteria | 2599185307 | 2599974515 | 451 |
| 1036 | iso_pu_bacteria | 2599185308 | 2599980651 | 451 |
| 1037 | iso_pu_bacteria | 2599185309 | 2599983900 | 451 |
| 1038 | iso_pu_bacteria | 2599185310 | 2599990382 | 451 |
| 1039 | iso_pu_bacteria | 2599185311 | 2599997382 | 451 |
| 1040 | iso_pu_bacteria | 2599185312 | 2600001676 | 451 |
| 1041 | iso_pu_bacteria | 2599185313 | 2600008417 | 451 |
| 1042 | iso_pu_bacteria | 2599185314 | 2600014257 | 451 |
| 1043 | iso_pu_bacteria | 2599185315 | 2600020834 | 451 |
| 1044 | iso_pu_bacteria | 2599185316 | 2600026284 | 451 |
| 1045 | iso_pu_bacteria | 2599185317 | 2600031790 | 451 |
| 1046 | iso_pu_bacteria | 2599185318 | 2600038631 | 451 |
| 1047 | iso_pu_bacteria | 2599185319 | 2600044079 | 451 |
| 1048 | iso_pu_bacteria | 2599185320 | 2600048916 | 451 |
| 1049 | iso_pu_bacteria | 2599185321 | 2600056100 | 451 |
| 1050 | iso_pu_bacteria | 2599185322 | 2600062770 | 451 |
| 1051 | iso_pu_bacteria | 2599185323 | 2600067767 | 451 |
| 1052 | iso_pu_bacteria | 2599185324 | 2600073823 | 451 |
| 1053 | iso_pu_bacteria | 2599185325 | 2600079508 | 451 |
| 1054 | iso_pu_bacteria | 2599185356 | 2600217840 | 451 |
| 1055 | iso_pu_bacteria | 2600254930 | 2600360316 | 451 |
| 1056 | iso_pu_bacteria | 2600254931 | 2600367134 | 451 |
| 1057 | iso_pu_bacteria | 2600255283 | 2601623443 | 451 |
| 1058 | iso_pu_bacteria | 2600255296 | 2601693976 | 451 |
| 1059 | iso_pu_bacteria | 2600255313 | 2601778007 | 451 |
| 1060 | iso_pu_bacteria | 2600255318 | 2601800449 | 451 |
| 1061 | iso_pu_bacteria | 2603880185 | 2606078743 | 451 |
| 1062 | iso_pu_bacteria | 2603880199 | 2606125597 | 451 |
| 1063 | iso_pu_bacteria | 2619619299 | 2621297377 | 451 |
| 1064 | iso_pu_bacteria | 2623620443 | 2624482864 | 451 |
| 1065 | iso_pu_bacteria | 2623620446 | 2624494405 | 451 |
| 1066 | iso_pu_bacteria | 2643221565 | 2643844783 | 451 |
| 1067 | iso_pu_bacteria | 2643221571 | 2643869677 | 451 |
| 1068 | iso_pu_bacteria | 2643221589 | 2643957552 | 451 |
| 1069 | iso_pu_bacteria | 2643221602 | 2644025666 | 451 |
| 1070 | iso_pu_bacteria | 2643221633 | 2644189083 | 451 |
| 1071 | iso_pu_bacteria | 2643221650 | 2644286008 | 451 |
| 1072 | iso_pu_bacteria | 2643221713 | 2644625363 | 451 |
| 1073 | iso_pu_bacteria | 2667528170 | 2671093936 | 451 |
| 1074 | iso_pu_bacteria | 2667528171 | 2671100812 | 451 |
| 1075 | iso_pu_bacteria | 2667528176 | 2671130436 | 451 |
| 1076 | iso_pu_bacteria | 2671180172 | 2671773372 | 451 |
| 1077 | iso_pu_bacteria | 2675903420 | 2677895801 | 451 |
| 1078 | iso_pu_bacteria | 2675903515 | 2678265577 | 451 |
| 1079 | iso_pu_bacteria | 2713897148 | 2715752300 | 451 |
| 1080 | iso_pu_bacteria | 2713897149 | 2715759039 | 451 |
| 1081 | iso_pu_bacteria | 2718217725 | 2718636078 | 451 |
| 1082 | iso_pu_bacteria | 2721755607 | 2723250825 | 451 |
| 1083 | iso_pu_bacteria | 2738541265 | 2738672898 | 451 |
| 1084 | iso_pu_bacteria | 2738541271 | 2738687177 | 451 |
| 1085 | iso_pu_bacteria | 2738541282 | 2738751291 | 451 |
| 1086 | iso_pu_bacteria | 2738541294 | 2738810294 | 451 |
| 1087 | iso_pu_bacteria | 2738541303 | 2738860332 | 451 |
| 1088 | iso_pu_bacteria | 2738541309 | 2738897654 | 451 |
| 1089 | iso_pu_bacteria | 2738543004 | 2739198196 | 451 |
| 1090 | iso_pu_bacteria | 2738543015 | 2739260960 | 451 |
| 1091 | iso_pu_bacteria | 2738543016 | 2739262798 | 451 |
| 1092 | iso_pu_bacteria | 2738543020 | 2739289359 | 451 |
| 1093 | iso_pu_bacteria | 2738543021 | 2739294671 | 451 |
| 1094 | iso_pu_bacteria | 2738543025 | 2739316597 | 451 |
| 1095 | iso_pu_bacteria | 2740892503 | 2743739894 | 451 |
| 1096 | iso_pu_bacteria | 2744054620 | 2745006814 | 451 |
| 1097 | iso_pu_bacteria | 2765235841 | 2765585975 | 451 |
| 1098 | iso_pu_bacteria | 2773857670 | 2774121776 | 451 |
| 1099 | iso_pu_bacteria | 2773857673 | 2774137019 | 451 |
| 1100 | iso_pu_bacteria | 2784132063 | 2784262356 | 451 |
| 1101 | iso_pu_bacteria | 2784132072 | 2784314439 | 451 |
| 1102 | iso_pu_bacteria | 2791355520 | 2794598431 | 451 |
| 1103 | iso_pu_bacteria | 2806310737 | 2807410289 | 451 |
| 1104 | iso_pu_bacteria | 2806310745 | 2807458637 | 451 |
| 1105 | iso_pu_bacteria | 2808606361 | 2808858154 | 451 |
| 1106 | iso_pu_bacteria | 2808606373 | 2808906625 | 451 |
| 1107 | iso_pu_bacteria | 2808606376 | 2808926776 | 451 |
| 1108 | iso_pu_bacteria | 2808606377 | 2808930830 | 451 |
| 1109 | iso_pu_bacteria | 2808606378 | 2808938369 | 451 |
| 1110 | iso_pu_bacteria | 2808606380 | 2808948891 | 451 |
| 1111 | iso_pu_bacteria | 2808606381 | 2808952952 | 451 |
| 1112 | iso_pu_bacteria | 2808606382 | 2808959282 | 451 |
| 1113 | iso_pu_bacteria | 2808606383 | 2808966639 | 451 |
| 1114 | iso_pu_bacteria | 2808606385 | 2808977655 | 451 |
| 1115 | iso_pu_bacteria | 2808606388 | 2808992687 | 451 |
| 1116 | iso_pu_bacteria | 2808606389 | 2809001469 | 451 |
| 1117 | iso_pu_bacteria | 2808606445 | 2809219313 | 451 |
| 1118 | iso_pu_bacteria | 2811994881 | 2812368758 | 451 |
| 1119 | iso_pu_bacteria | 2816332298 | 2817493516 | 451 |
| 1120 | iso_pu_bacteria | 2818991456 | 2819659156 | 451 |
| 1121 | iso_pu_bacteria | 2818991464 | 2819706480 | 451 |
| 1122 | iso_pu_bacteria | 2825651385 | 2825655664 | 451 |
| 1123 | iso_pu_bacteria | 2826581358 | 2826586429 | 451 |
| 1124 | iso_pu_bacteria | 2834028612 | 2834033282 | 451 |
| 1125 | iso_pu_bacteria | 2842805378 | 2842808095 | 451 |
| 1126 | iso_pu_bacteria | 2842815866 | 2842818377 | 451 |
| 1127 | iso_pu_bacteria | 2842826826 | 2842831568 | 451 |
| 1128 | iso_pu_bacteria | 2842832357 | 2842837002 | 451 |
| 1129 | iso_pu_bacteria | 2842837860 | 2842840391 | 451 |
| 1130 | iso_pu_bacteria | 2842843487 | 2842847741 | 451 |
| 1131 | iso_pu_bacteria | 2842849001 | 2842853713 | 451 |
| 1132 | iso_pu_bacteria | 2842854478 | 2842859693 | 451 |
| 1133 | iso_pu_bacteria | 2844665904 | 2844666444 | 451 |
| 1134 | iso_pu_bacteria | 2852612431 | 2852618192 | 451 |
| 1135 | iso_pu_bacteria | 2852657418 | 2852660989 | 451 |
| 1136 | iso_pu_bacteria | 2852667396 | 2852673250 | 451 |
| 1137 | iso_pu_bacteria | 2860339153 | 2860343849 | 451 |
| 1138 | iso_pu_bacteria | 2860867994 | 2860872507 | 451 |
| 1139 | iso_pu_bacteria | 2878029506 | 2878034797 | 451 |
| 1140 | iso_pu_bacteria | 2880230671 | 2880235446 | 451 |
| 1141 | iso_pu_bacteria | 2904518522 | 2904522988 | 451 |
| 1142 | iso_pu_bacteria | 2904550169 | 2904555898 | 451 |
| 1143 | iso_pu_bacteria | 2908446538 | 2908452023 | 451 |
| 1144 | iso_pu_bacteria | 2912963787 | 2912964476 | 451 |
| 1145 | iso_pu_bacteria | 2913036834 | 2913041990 | 451 |
| 1146 | iso_pu_bacteria | 2917070673 | 2917076154 | 451 |
| 1147 | iso_pu_bacteria | 2919063839 | 2919067821 | 451 |
| 1148 | iso_pu_bacteria | 2919155634 | 2919156523 | 451 |
| 1149 | iso_pu_bacteria | 2919385768 | 2919390709 | 451 |
| 1150 | iso_pu_bacteria | 2919456309 | 2919461781 | 451 |
| 1151 | iso_pu_bacteria | 2919481497 | 2919485829 | 451 |
| 1152 | iso_pu_bacteria | 2919487758 | 2919490988 | 451 |
| 1153 | iso_pu_bacteria | 2919697872 | 2919701494 | 451 |
| 1154 | iso_pu_bacteria | 2923153595 | 2923158984 | 451 |
| 1155 | iso_pu_bacteria | 2923519811 | 2923522823 | 451 |
| 1156 | iso_pu_bacteria | 2923586266 | 2923590949 | 451 |
| 1157 | iso_pu_bacteria | 2929144301 | 2929149369 | 451 |
| 1158 | iso_pu_bacteria | 2929189879 | 2929194614 | 451 |
| 1159 | iso_pu_bacteria | 2931369376 | 2931373214 | 451 |
| 1160 | iso_pu_bacteria | 2931390751 | 2931395890 | 451 |
| 1161 | iso_pu_bacteria | 2931396565 | 2931397519 | 451 |
| 1162 | iso_pu_bacteria | 2935353572 | 2935359578 | 451 |
| 1163 | iso_pu_bacteria | 2939636861 | 2939641789 | 451 |
| 1164 | iso_pu_bacteria | 2945928738 | 2945931435 | 451 |
| 1165 | iso_pu_bacteria | 2946006987 | 2946007496 | 451 |
| 1166 | iso_pu_bacteria | 2946027586 | 2946033108 | 451 |
| 1167 | iso_pu_bacteria | 2947233263 | 2947233870 | 451 |
| 1168 | iso_pu_bacteria | 2969304461 | 2969309615 | 451 |
| 1169 | iso_pu_bacteria | 2974289157 | 2974294652 | 451 |
| 1170 | iso_pu_bacteria | 2984286254 | 2984287184 | 451 |
| 1171 | iso_pu_bacteria | 2988728565 | 2988730914 | 451 |
| 1172 | iso_pu_bacteria | 2998139840 | 2998144866 | 451 |
| 1173 | iso_pu_bacteria | 3007315729 | 3007320410 | 451 |
| 1174 | iso_pu_bacteria | 3007395558 | 3007398607 | 451 |
| 1175 | iso_pu_bacteria | 3007419365 | 3007420394 | 451 |
| 1176 | iso_pu_bacteria | 3007511990 | 3007516652 | 451 |
| 1177 | iso_pu_bacteria | 3007614139 | 3007615230 | 451 |
| 1178 | iso_pu_bacteria | 3007619802 | 3007621079 | 451 |
| 1179 | iso_pu_bacteria | 3007718800 | 3007722255 | 451 |
| 1180 | iso_pu_bacteria | 3007803356 | 3007803535 | 451 |
| 1181 | iso_pu_bacteria | 3007855910 | 3007860073 | 451 |
| 1182 | iso_pu_bacteria | 3007866637 | 3007870977 | 451 |
| 1183 | iso_pu_bacteria | 3007872151 | 3007876189 | 451 |
| 1184 | iso_pu_bacteria | 637000220 | 637322691 | 451 |
| 1185 | iso_pu_bacteria | 8011350971 | 8011352916 | 451 |
| 1186 | iso_pu_bacteria | 8015687852 | 8015693070 | 451 |
| 1187 | iso_pu_bacteria | 8019769354 | 8019771394 | 451 |
| 1188 | iso_pu_bacteria | 8019775933 | 8019781889 | 451 |
| 1189 | iso_pu_bacteria | 8029995093 | 8029996029 | 451 |
| 1190 | iso_pu_bacteria | 8052494512 | 8052495456 | 451 |
| 1191 | iso_pu_bacteria | 8054285046 | 8054288876 | 451 |
| 1192 | iso_pu_bacteria | 8054347763 | 8054353052 | 451 |
| 1193 | iso_pu_bacteria | 8054503363 | 8054508395 | 451 |
| 1194 | iso_pu_bacteria | 8054929484 | 8054932967 | 451 |
| 1195 | iso_pu_bacteria | 8055770955 | 8055776317 | 451 |
| 1196 | iso_pu_bacteria | 8055817908 | 8055823348 | 451 |
| 1197 | iso_pu_bacteria | 8055878733 | 8055882617 | 451 |
| 1198 | iso_pu_bacteria | 8056115690 | 8056120637 | 451 |
| 1199 | iso_pu_bacteria | 8056120720 | 8056121539 | 451 |
| 1200 | iso_pu_bacteria | 8056125926 | 8056131079 | 451 |
| 1201 | iso_pu_bacteria | 8056131705 | 8056136753 | 451 |
| 1202 | iso_pu_bacteria | 8056137416 | 8056142280 | 451 |
| 1203 | iso_pu_bacteria | 8056143049 | 8056148196 | 451 |
| 1204 | iso_pu_bacteria | 8056148874 | 8056150279 | 451 |
| 1205 | iso_pu_bacteria | 8056155041 | 8056156277 | 451 |
| 1206 | iso_pu_bacteria | 8056161164 | 8056163068 | 451 |
| 1207 | iso_pu_bacteria | 8056166840 | 8056171702 | 451 |
| 1208 | iso_pu_bacteria | 8056172158 | 8056172381 | 451 |
| 1209 | iso_pu_bacteria | 8056177738 | 8056179143 | 451 |
| 1210 | iso_pu_bacteria | 8056569372 | 8056571897 | 451 |
| 1211 | iso_pu_bacteria | 8057798959 | 8057805156 | 451 |
| 1212 | 3300031251 | Ga0265327_10000002 | Ga0265327_10000002425 | 452 |
| 1213 | 3300031456 | Ga0307513_10128850 | Ga0307513_101288502 | 452 |
| 1214 | 3300042876 | Ga0451577_0016457 | Ga0451577_0016457_1976_3358 | 452 |
| 1215 | 3300042876 | Ga0451577_0200600 | Ga0451577_0200600_259_1629 | 452 |
| 1216 | 3300044712 | Ga0453684_0001356 | Ga0453684_0001356_49568_50938 | 452 |
| 1217 | 3300044712 | Ga0453684_0047336 | Ga0453684_0047336_2729_4111 | 452 |
| 1218 | 2162886007 | SwRhRL2b_contig_667648 | SwRhRL2b_0985.00003210 | 453 |
| 1219 | 3300002771 | JGI25163J39215_1000001 | JGI25163J39215_1000001262 | 453 |
| 1220 | 3300002772 | JGI25164J39214_1000001 | JGI25164J39214_1000001167 | 453 |
| 1221 | 3300003751 | Ga0055538_1000004 | Ga0055538_1000004297 | 453 |
| 1222 | 3300003752 | Ga0055539_1000004 | Ga0055539_1000004262 | 453 |
| 1223 | 3300003756 | Ga0055533_1000007 | Ga0055533_1000007297 | 453 |
| 1224 | 3300003759 | Ga0055525_1000007 | Ga0055525_1000007297 | 453 |
| 1225 | 3300003841 | Ga0055541_1000004 | Ga0055541_1000004297 | 453 |
| 1226 | 3300003856 | Ga0058692_1000154 | Ga0058692_10001546 | 453 |
| 1227 | 3300005289 | Ga0065704_10000047 | Ga0065704_1000004742 | 453 |
| 1228 | 3300006051 | Ga0075364_10000460 | Ga0075364_1000046022 | 453 |
| 1229 | 3300009011 | Ga0105251_10000897 | Ga0105251_1000089710 | 453 |
| 1230 | 3300009036 | Ga0105244_10000023 | Ga0105244_1000002344 | 453 |
| 1231 | 3300009036 | Ga0105244_10000247 | Ga0105244_1000024718 | 453 |
| 1232 | 3300009036 | Ga0105244_10013866 | Ga0105244_100138663 | 453 |
| 1233 | 3300009036 | Ga0105244_10016843 | Ga0105244_100168435 | 453 |
| 1234 | 3300009036 | Ga0105244_10075119 | Ga0105244_100751191 | 453 |
| 1235 | 3300009092 | Ga0105250_10000045 | Ga0105250_10000045111 | 453 |
| 1236 | 3300009092 | Ga0105250_10000223 | Ga0105250_1000022318 | 453 |
| 1237 | 3300009092 | Ga0105250_10009699 | Ga0105250_100096992 | 453 |
| 1238 | 3300009092 | Ga0105250_10033413 | Ga0105250_100334132 | 453 |
| 1239 | 3300009148 | Ga0105243_10002639 | Ga0105243_1000263910 | 453 |
| 1240 | 3300013100 | Ga0157373_10007386 | Ga0157373_100073863 | 453 |
| 1241 | 3300013102 | Ga0157371_10000020 | Ga0157371_10000020110 | 453 |
| 1242 | 3300013102 | Ga0157371_10000267 | Ga0157371_1000026746 | 453 |
| 1243 | 3300013102 | Ga0157371_10000589 | Ga0157371_1000058925 | 453 |
| 1244 | 3300013102 | Ga0157371_10006243 | Ga0157371_100062436 | 453 |
| 1245 | 3300013104 | Ga0157370_10002280 | Ga0157370_1000228014 | 453 |
| 1246 | 3300015261 | Ga0182006_1000025 | Ga0182006_1000025163 | 453 |
| 1247 | 3300021384 | Ga0213876_10000132 | Ga0213876_1000013214 | 453 |
| 1248 | 3300025207 | Ga0209760_100063 | Ga0209760_10006364 | 453 |
| 1249 | 3300025224 | Ga0209784_100001 | Ga0209784_100001291 | 453 |
| 1250 | 3300025225 | Ga0209566_100001 | Ga0209566_100001291 | 453 |
| 1251 | 3300025226 | Ga0209674_100002 | Ga0209674_100002291 | 453 |
| 1252 | 3300025230 | Ga0209563_100008 | Ga0209563_100008294 | 453 |
| 1253 | 3300025231 | Ga0207427_100002 | Ga0207427_100002986 | 453 |
| 1254 | 3300025233 | Ga0209437_100046 | Ga0209437_10004696 | 453 |
| 1255 | 3300025253 | Ga0209677_100004 | Ga0209677_100004294 | 453 |
| 1256 | 3300025261 | Ga0209233_1003944 | Ga0209233_10039442 | 453 |
| 1257 | 3300025711 | Ga0207696_1000027 | Ga0207696_1000027213 | 453 |
| 1258 | 3300025711 | Ga0207696_1000093 | Ga0207696_100009329 | 453 |
| 1259 | 3300025711 | Ga0207696_1000140 | Ga0207696_1000140111 | 453 |
| 1260 | 3300025711 | Ga0207696_1000453 | Ga0207696_100045324 | 453 |
| 1261 | 3300025711 | Ga0207696_1002046 | Ga0207696_10020466 | 453 |
| 1262 | 3300025728 | Ga0207655_1000024 | Ga0207655_1000024161 | 453 |
| 1263 | 3300025728 | Ga0207655_1000056 | Ga0207655_1000056155 | 453 |
| 1264 | 3300025728 | Ga0207655_1000101 | Ga0207655_100010134 | 453 |
| 1265 | 3300025728 | Ga0207655_1000629 | Ga0207655_10006297 | 453 |
| 1266 | 3300025728 | Ga0207655_1008592 | Ga0207655_10085922 | 453 |
| 1267 | 3300025728 | Ga0207655_1014693 | Ga0207655_10146932 | 453 |
| 1268 | 3300025735 | Ga0207713_1000110 | Ga0207713_100011023 | 453 |
| 1269 | 3300025935 | Ga0207709_10002430 | Ga0207709_1000243010 | 453 |
| 1270 | 3300027111 | Ga0209281_1000060 | Ga0209281_1000060155 | 453 |
| 1271 | 3300027111 | Ga0209281_1001296 | Ga0209281_10012969 | 453 |
| 1272 | 3300027312 | Ga0209371_1000053 | Ga0209371_1000053171 | 453 |
| 1273 | 3300027312 | Ga0209371_1001222 | Ga0209371_10012228 | 453 |
| 1274 | 3300027665 | Ga0209983_1000100 | Ga0209983_100010015 | 453 |
| 1275 | 3300030500 | Ga0268256_1000053 | Ga0268256_100005363 | 453 |
| 1276 | 3300030500 | Ga0268256_1001819 | Ga0268256_10018195 | 453 |
| 1277 | 3300032126 | Ga0307415_100013159 | Ga0307415_1000131591 | 453 |
| 1278 | 3300039062 | Ga0400483_085989 | Ga0400483_085989_6661_8043 | 453 |
| 1279 | 3300039062 | Ga0400483_232168 | Ga0400483_232168_4019_5401 | 453 |
| 1280 | 3300039437 | Ga0436365_0084998 | Ga0436365_0084998_246437_247819 | 453 |
| 1281 | 3300041405 | Ga0439438_000003 | Ga0439438_000003_220479_221861 | 453 |
| 1282 | 3300041405 | Ga0439438_013745 | Ga0439438_013745_982_2364 | 453 |
| 1283 | 3300042010 | Ga0439452_000007 | Ga0439452_000007_273971_275353 | 453 |
| 1284 | 3300042532 | Ga0450893_0001268 | Ga0450893_0001268_1462_2844 | 453 |
| 1285 | 3300046458 | Ga0495591_000124 | Ga0495591_000124_25859_27244 | 453 |
| 1286 | 3300046471 | Ga0495650_0000004 | Ga0495650_0000004_323237_324619 | 453 |
| 1287 | 3300046471 | Ga0495650_0000113 | Ga0495650_0000113_18069_19451 | 453 |
| 1288 | 3300046507 | Ga0495606_0000217 | Ga0495606_0000217_78615_79997 | 453 |
| 1289 | 3300046523 | Ga0495644_0004561 | Ga0495644_0004561_936_2318 | 453 |
| 1290 | 3300046524 | Ga0495648_0018618 | Ga0495648_0018618_2847_4229 | 453 |
| 1291 | 3300046530 | Ga0495654_0000031 | Ga0495654_0000031_79500_80885 | 453 |
| 1292 | 3300046692 | Ga0495671_0004830 | Ga0495671_0004830_3625_5007 | 453 |
| 1293 | 3300046694 | Ga0495649_0003489 | Ga0495649_0003489_8825_10207 | 453 |
| 1294 | 3300046794 | Ga0495589_0009187 | Ga0495589_0009187_1811_3193 | 453 |
| 1295 | 3300046810 | Ga0495660_0000013 | Ga0495660_0000013_295546_296928 | 453 |
| 1296 | 3300046810 | Ga0495660_0000034 | Ga0495660_0000034_136239_137621 | 453 |
| 1297 | 3300047320 | Ga0495672_0000029 | Ga0495672_0000029_27419_28801 | 453 |
| 1298 | 3300047469 | Ga0495673_0000047 | Ga0495673_0000047_32309_33691 | 453 |
| 1299 | 3300047469 | Ga0495673_0000517 | Ga0495673_0000517_24478_25860 | 453 |
| 1300 | 3300048904 | Ga0496101_0000158 | Ga0496101_0000158_13747_15132 | 453 |
| 1301 | 3300048907 | Ga0496104_0000668 | Ga0496104_0000668_25582_26964 | 453 |
| 1302 | 3300048919 | Ga0496116_0000016 | Ga0496116_0000016_194315_195697 | 453 |
| 1303 | 3300048919 | Ga0496116_0044155 | Ga0496116_0044155_593_1975 | 453 |
| 1304 | 3300048920 | Ga0496117_0007472 | Ga0496117_0007472_2918_4300 | 453 |
| 1305 | 3300048921 | Ga0496118_0002104 | Ga0496118_0002104_3355_4845 | 453 |
| 1306 | 3300048921 | Ga0496118_0009161 | Ga0496118_0009161_299_1681 | 453 |
| 1307 | 3300048922 | Ga0496119_0000031 | Ga0496119_0000031_146993_148375 | 453 |
| 1308 | 3300048922 | Ga0496119_0002834 | Ga0496119_0002834_11233_12615 | 453 |
| 1309 | 3300048922 | Ga0496119_0005635 | Ga0496119_0005635_2997_4379 | 453 |
| 1310 | 3300048922 | Ga0496119_0048933 | Ga0496119_0048933_593_1978 | 453 |
| 1311 | 3300048923 | Ga0496120_0000017 | Ga0496120_0000017_251362_252744 | 453 |
| 1312 | 3300048923 | Ga0496120_0001012 | Ga0496120_0001012_35256_36638 | 453 |
| 1313 | 3300048923 | Ga0496120_0001442 | Ga0496120_0001442_26067_27452 | 453 |
| 1314 | 3300048923 | Ga0496120_0013652 | Ga0496120_0013652_3609_4991 | 453 |
| 1315 | 3300048925 | Ga0496122_0000125 | Ga0496122_0000125_55090_56472 | 453 |
| 1316 | 3300048925 | Ga0496122_0003298 | Ga0496122_0003298_3510_4895 | 453 |
| 1317 | 3300048925 | Ga0496122_0013632 | Ga0496122_0013632_1931_3313 | 453 |
| 1318 | 3300048926 | Ga0496123_0000092 | Ga0496123_0000092_123197_124579 | 453 |
| 1319 | 3300048926 | Ga0496123_0012760 | Ga0496123_0012760_4808_6193 | 453 |
| 1320 | 3300048926 | Ga0496123_0025637 | Ga0496123_0025637_1953_3335 | 453 |
| 1321 | 3300048926 | Ga0496123_0041327 | Ga0496123_0041327_1009_2391 | 453 |
| 1322 | 3300048927 | Ga0496124_0000238 | Ga0496124_0000238_45009_46391 | 453 |
| 1323 | 3300048927 | Ga0496124_0000528 | Ga0496124_0000528_44762_46144 | 453 |
| 1324 | 3300048927 | Ga0496124_0008102 | Ga0496124_0008102_1069_2451 | 453 |
| 1325 | 3300048927 | Ga0496124_0021096 | Ga0496124_0021096_86_1471 | 453 |
| 1326 | 3300048928 | Ga0496125_0000384 | Ga0496125_0000384_27250_28632 | 453 |
| 1327 | 3300048929 | Ga0496126_0000109 | Ga0496126_0000109_37615_38997 | 453 |
| 1328 | 3300048929 | Ga0496126_0024373 | Ga0496126_0024373_1966_3348 | 453 |
| 1329 | 3300048929 | Ga0496126_0069814 | Ga0496126_0069814_364_1749 | 453 |
| 1330 | 3300049459 | Ga0495678_000994 | Ga0495678_000994_10237_11619 | 453 |
| 1331 | 3300049460 | Ga0495682_0000003 | Ga0495682_0000003_266311_267693 | 453 |
| 1332 | 3300050491 | nmdc:mga00v17_570_c1 | nmdc:mga00v17_570_c1_18045_19439 | 453 |
| 1333 | 3300050492 | nmdc:mga0yw44_94477_c1 | nmdc:mga0yw44_94477_c1_246_1640 | 453 |
| 1334 | 3300053126 | Ga0500621_000034 | Ga0500621_000034_4369_5751 | 453 |
| 1335 | iso_pu_bacteria | 2984499530 | 2984500835 | 453 |
| 1336 | 3300041404 | Ga0439436_0024069 | Ga0439436_0024069_167_1531 | 454 |
| 1337 | 3300041411 | Ga0439466_0004859 | Ga0439466_0004859_3752_5116 | 454 |
| 1338 | 2124908027 | MRS2a_Contig_1736 | MRS2a_00593500 | 455 |
| 1339 | 3300002737 | JGI25162J39368_1000332 | JGI25162J39368_100033240 | 455 |
| 1340 | 3300002737 | JGI25162J39368_1000502 | JGI25162J39368_100050212 | 455 |
| 1341 | 3300002771 | JGI25163J39215_1000713 | JGI25163J39215_10007138 | 455 |
| 1342 | 3300002771 | JGI25163J39215_1000964 | JGI25163J39215_10009645 | 455 |
| 1343 | 3300002772 | JGI25164J39214_1000244 | JGI25164J39214_10002443 | 455 |
| 1344 | 3300002772 | JGI25164J39214_1000340 | JGI25164J39214_100034017 | 455 |
| 1345 | 3300003214 | JGI25165J46597_1000391 | JGI25165J46597_100039117 | 455 |
| 1346 | 3300003214 | JGI25165J46597_1000452 | JGI25165J46597_100045240 | 455 |
| 1347 | 3300003781 | Ga0055536_1000059 | Ga0055536_100005971 | 455 |
| 1348 | 3300003781 | Ga0055536_1001145 | Ga0055536_100114516 | 455 |
| 1349 | 3300003781 | Ga0055536_1001219 | Ga0055536_100121915 | 455 |
| 1350 | 3300003791 | Ga0055530_10000036 | Ga0055530_100000363 | 455 |
| 1351 | 3300003791 | Ga0055530_10000096 | Ga0055530_1000009660 | 455 |
| 1352 | 3300003791 | Ga0055530_10000874 | Ga0055530_1000087415 | 455 |
| 1353 | 3300003792 | Ga0055540_1000072 | Ga0055540_10000723 | 455 |
| 1354 | 3300003792 | Ga0055540_1000084 | Ga0055540_100008425 | 455 |
| 1355 | 3300003792 | Ga0055540_1000648 | Ga0055540_10006489 | 455 |
| 1356 | 3300003856 | Ga0058692_1008168 | Ga0058692_10081682 | 455 |
| 1357 | 3300005288 | Ga0065714_10002683 | Ga0065714_100026833 | 455 |
| 1358 | 3300005288 | Ga0065714_10003206 | Ga0065714_1000320613 | 455 |
| 1359 | 3300005288 | Ga0065714_10003555 | Ga0065714_1000355513 | 455 |
| 1360 | 3300005288 | Ga0065714_10003704 | Ga0065714_100037043 | 455 |
| 1361 | 3300005288 | Ga0065714_10009694 | Ga0065714_100096943 | 455 |
| 1362 | 3300005289 | Ga0065704_10007587 | Ga0065704_100075875 | 455 |
| 1363 | 3300005289 | Ga0065704_10008178 | Ga0065704_100081781 | 455 |
| 1364 | 3300005289 | Ga0065704_10071220 | Ga0065704_100712206 | 455 |
| 1365 | 3300005289 | Ga0065704_10089844 | Ga0065704_100898442 | 455 |
| 1366 | 3300005290 | Ga0065712_10068190 | Ga0065712_100681905 | 455 |
| 1367 | 3300005290 | Ga0065712_10073244 | Ga0065712_100732443 | 455 |
| 1368 | 3300005331 | Ga0070670_100004209 | Ga0070670_1000042094 | 455 |
| 1369 | 3300005548 | Ga0070665_100004186 | Ga0070665_1000041868 | 455 |
| 1370 | 3300006058 | Ga0075432_10002882 | Ga0075432_100028825 | 455 |
| 1371 | 3300006058 | Ga0075432_10010919 | Ga0075432_100109193 | 455 |
| 1372 | 3300006058 | Ga0075432_10011333 | Ga0075432_100113332 | 455 |
| 1373 | 3300006058 | Ga0075432_10017909 | Ga0075432_100179093 | 455 |
| 1374 | 3300006944 | Ga0099823_1000188 | Ga0099823_100018810 | 455 |
| 1375 | 3300006946 | Ga0079104_1000116 | Ga0079104_10001163 | 455 |
| 1376 | 3300006946 | Ga0079104_1000283 | Ga0079104_100028358 | 455 |
| 1377 | 3300006948 | Ga0099826_10011531 | Ga0099826_100115312 | 455 |
| 1378 | 3300009011 | Ga0105251_10000114 | Ga0105251_100001149 | 455 |
| 1379 | 3300009011 | Ga0105251_10000214 | Ga0105251_1000021446 | 455 |
| 1380 | 3300009011 | Ga0105251_10001720 | Ga0105251_100017209 | 455 |
| 1381 | 3300009011 | Ga0105251_10002384 | Ga0105251_1000238413 | 455 |
| 1382 | 3300009011 | Ga0105251_10007766 | Ga0105251_100077667 | 455 |
| 1383 | 3300009011 | Ga0105251_10016507 | Ga0105251_100165072 | 455 |
| 1384 | 3300009036 | Ga0105244_10000949 | Ga0105244_100009498 | 455 |
| 1385 | 3300009036 | Ga0105244_10003287 | Ga0105244_100032873 | 455 |
| 1386 | 3300009036 | Ga0105244_10013675 | Ga0105244_100136751 | 455 |
| 1387 | 3300009036 | Ga0105244_10014073 | Ga0105244_100140733 | 455 |
| 1388 | 3300009036 | Ga0105244_10037531 | Ga0105244_100375313 | 455 |
| 1389 | 3300009036 | Ga0105244_10041906 | Ga0105244_100419062 | 455 |
| 1390 | 3300009092 | Ga0105250_10010116 | Ga0105250_100101163 | 455 |
| 1391 | 3300009148 | Ga0105243_10000115 | Ga0105243_1000011578 | 455 |
| 1392 | 3300009148 | Ga0105243_10001544 | Ga0105243_1000154411 | 455 |
| 1393 | 3300009148 | Ga0105243_10002556 | Ga0105243_1000255610 | 455 |
| 1394 | 3300009148 | Ga0105243_10080361 | Ga0105243_100803612 | 455 |
| 1395 | 3300009176 | Ga0105242_10060366 | Ga0105242_100603663 | 455 |
| 1396 | 3300011119 | Ga0105246_10000647 | Ga0105246_100006477 | 455 |
| 1397 | 3300011119 | Ga0105246_10001153 | Ga0105246_100011539 | 455 |
| 1398 | 3300011119 | Ga0105246_10014132 | Ga0105246_100141324 | 455 |
| 1399 | 3300012498 | Ga0157345_1000111 | Ga0157345_10001113 | 455 |
| 1400 | 3300013100 | Ga0157373_10004054 | Ga0157373_1000405410 | 455 |
| 1401 | 3300013100 | Ga0157373_10006686 | Ga0157373_100066863 | 455 |
| 1402 | 3300013100 | Ga0157373_10031656 | Ga0157373_100316562 | 455 |
| 1403 | 3300013100 | Ga0157373_10039956 | Ga0157373_100399563 | 455 |
| 1404 | 3300013102 | Ga0157371_10007229 | Ga0157371_100072299 | 455 |
| 1405 | 3300013102 | Ga0157371_10008791 | Ga0157371_100087913 | 455 |
| 1406 | 3300013102 | Ga0157371_10015292 | Ga0157371_100152921 | 455 |
| 1407 | 3300013104 | Ga0157370_10000477 | Ga0157370_1000047714 | 455 |
| 1408 | 3300013104 | Ga0157370_10027483 | Ga0157370_100274834 | 455 |
| 1409 | 3300013104 | Ga0157370_10027915 | Ga0157370_100279153 | 455 |
| 1410 | 3300013104 | Ga0157370_10082220 | Ga0157370_100822202 | 455 |
| 1411 | 3300013104 | Ga0157370_10124411 | Ga0157370_101244113 | 455 |
| 1412 | 3300013105 | Ga0157369_10006118 | Ga0157369_100061183 | 455 |
| 1413 | 3300013105 | Ga0157369_10013043 | Ga0157369_100130439 | 455 |
| 1414 | 3300013105 | Ga0157369_10031904 | Ga0157369_100319043 | 455 |
| 1415 | 3300013306 | Ga0163162_10001780 | Ga0163162_100017809 | 455 |
| 1416 | 3300013307 | Ga0157372_10001394 | Ga0157372_1000139418 | 455 |
| 1417 | 3300013307 | Ga0157372_10004623 | Ga0157372_1000462315 | 455 |
| 1418 | 3300014497 | Ga0182008_10003156 | Ga0182008_100031564 | 455 |
| 1419 | 3300014497 | Ga0182008_10004049 | Ga0182008_1000404910 | 455 |
| 1420 | 3300014497 | Ga0182008_10005764 | Ga0182008_100057647 | 455 |
| 1421 | 3300014497 | Ga0182008_10006730 | Ga0182008_100067305 | 455 |
| 1422 | 3300014497 | Ga0182008_10022877 | Ga0182008_100228771 | 455 |
| 1423 | 3300014497 | Ga0182008_10024587 | Ga0182008_100245872 | 455 |
| 1424 | 3300015261 | Ga0182006_1001424 | Ga0182006_10014243 | 455 |
| 1425 | 3300015261 | Ga0182006_1001865 | Ga0182006_10018654 | 455 |
| 1426 | 3300015261 | Ga0182006_1003013 | Ga0182006_10030132 | 455 |
| 1427 | 3300015261 | Ga0182006_1003118 | Ga0182006_10031183 | 455 |
| 1428 | 3300015262 | Ga0182007_10001412 | Ga0182007_100014125 | 455 |
| 1429 | 3300015262 | Ga0182007_10012776 | Ga0182007_100127763 | 455 |
| 1430 | 3300015265 | Ga0182005_1001087 | Ga0182005_10010871 | 455 |
| 1431 | 3300015265 | Ga0182005_1001509 | Ga0182005_10015093 | 455 |
| 1432 | 3300015265 | Ga0182005_1012616 | Ga0182005_10126162 | 455 |
| 1433 | 3300017792 | Ga0163161_10005144 | Ga0163161_100051447 | 455 |
| 1434 | 3300017792 | Ga0163161_10019126 | Ga0163161_100191265 | 455 |
| 1435 | 3300017792 | Ga0163161_10021250 | Ga0163161_100212504 | 455 |
| 1436 | 3300025207 | Ga0209760_100009 | Ga0209760_10000978 | 455 |
| 1437 | 3300025207 | Ga0209760_100157 | Ga0209760_10015717 | 455 |
| 1438 | 3300025230 | Ga0209563_101750 | Ga0209563_1017504 | 455 |
| 1439 | 3300025231 | Ga0207427_100016 | Ga0207427_100016429 | 455 |
| 1440 | 3300025231 | Ga0207427_100092 | Ga0207427_100092110 | 455 |
| 1441 | 3300025233 | Ga0209437_100011 | Ga0209437_100011618 | 455 |
| 1442 | 3300025233 | Ga0209437_100065 | Ga0209437_100065199 | 455 |
| 1443 | 3300025261 | Ga0209233_1000019 | Ga0209233_1000019618 | 455 |
| 1444 | 3300025261 | Ga0209233_1000085 | Ga0209233_1000085199 | 455 |
| 1445 | 3300025292 | Ga0209676_1000076 | Ga0209676_1000076108 | 455 |
| 1446 | 3300025292 | Ga0209676_1000264 | Ga0209676_100026425 | 455 |
| 1447 | 3300025292 | Ga0209676_1000313 | Ga0209676_100031359 | 455 |
| 1448 | 3300025292 | Ga0209676_1000805 | Ga0209676_100080517 | 455 |
| 1449 | 3300025292 | Ga0209676_1001727 | Ga0209676_10017273 | 455 |
| 1450 | 3300025292 | Ga0209676_1017636 | Ga0209676_10176362 | 455 |
| 1451 | 3300025298 | Ga0209050_1000063 | Ga0209050_1000063210 | 455 |
| 1452 | 3300025298 | Ga0209050_1000080 | Ga0209050_1000080244 | 455 |
| 1453 | 3300025298 | Ga0209050_1000106 | Ga0209050_1000106183 | 455 |
| 1454 | 3300025298 | Ga0209050_1001454 | Ga0209050_100145425 | 455 |
| 1455 | 3300025303 | Ga0209051_1000045 | Ga0209051_1000045183 | 455 |
| 1456 | 3300025303 | Ga0209051_1000082 | Ga0209051_1000082175 | 455 |
| 1457 | 3300025303 | Ga0209051_1000139 | Ga0209051_1000139100 | 455 |
| 1458 | 3300025304 | Ga0209257_1000539 | Ga0209257_100053926 | 455 |
| 1459 | 3300025304 | Ga0209257_1012661 | Ga0209257_10126612 | 455 |
| 1460 | 3300025711 | Ga0207696_1000022 | Ga0207696_1000022350 | 455 |
| 1461 | 3300025711 | Ga0207696_1000047 | Ga0207696_1000047103 | 455 |
| 1462 | 3300025711 | Ga0207696_1000255 | Ga0207696_10002556 | 455 |
| 1463 | 3300025711 | Ga0207696_1001097 | Ga0207696_10010973 | 455 |
| 1464 | 3300025711 | Ga0207696_1002717 | Ga0207696_100271710 | 455 |
| 1465 | 3300025728 | Ga0207655_1000015 | Ga0207655_100001549 | 455 |
| 1466 | 3300025728 | Ga0207655_1000383 | Ga0207655_100038337 | 455 |
| 1467 | 3300025728 | Ga0207655_1001313 | Ga0207655_10013133 | 455 |
| 1468 | 3300025728 | Ga0207655_1001444 | Ga0207655_100144416 | 455 |
| 1469 | 3300025728 | Ga0207655_1003542 | Ga0207655_10035422 | 455 |
| 1470 | 3300025728 | Ga0207655_1005247 | Ga0207655_10052478 | 455 |
| 1471 | 3300025728 | Ga0207655_1007448 | Ga0207655_10074488 | 455 |
| 1472 | 3300025728 | Ga0207655_1007987 | Ga0207655_10079873 | 455 |
| 1473 | 3300025728 | Ga0207655_1008311 | Ga0207655_10083112 | 455 |
| 1474 | 3300025728 | Ga0207655_1008846 | Ga0207655_10088467 | 455 |
| 1475 | 3300025728 | Ga0207655_1014324 | Ga0207655_10143243 | 455 |
| 1476 | 3300025728 | Ga0207655_1029728 | Ga0207655_10297283 | 455 |
| 1477 | 3300025735 | Ga0207713_1000049 | Ga0207713_100004941 | 455 |
| 1478 | 3300025735 | Ga0207713_1000200 | Ga0207713_100020064 | 455 |
| 1479 | 3300025735 | Ga0207713_1001161 | Ga0207713_100116111 | 455 |
| 1480 | 3300025735 | Ga0207713_1001267 | Ga0207713_100126713 | 455 |
| 1481 | 3300025735 | Ga0207713_1002366 | Ga0207713_10023665 | 455 |
| 1482 | 3300025735 | Ga0207713_1004683 | Ga0207713_10046832 | 455 |
| 1483 | 3300025735 | Ga0207713_1006309 | Ga0207713_10063094 | 455 |
| 1484 | 3300025735 | Ga0207713_1010825 | Ga0207713_10108253 | 455 |
| 1485 | 3300025735 | Ga0207713_1020562 | Ga0207713_10205622 | 455 |
| 1486 | 3300025735 | Ga0207713_1060961 | Ga0207713_10609611 | 455 |
| 1487 | 3300025925 | Ga0207650_10000153 | Ga0207650_100001536 | 455 |
| 1488 | 3300025933 | Ga0207706_10003016 | Ga0207706_1000301612 | 455 |
| 1489 | 3300025935 | Ga0207709_10000030 | Ga0207709_10000030211 | 455 |
| 1490 | 3300025935 | Ga0207709_10000127 | Ga0207709_1000012727 | 455 |
| 1491 | 3300025935 | Ga0207709_10019461 | Ga0207709_100194612 | 455 |
| 1492 | 3300027111 | Ga0209281_1000070 | Ga0209281_1000070160 | 455 |
| 1493 | 3300027111 | Ga0209281_1000127 | Ga0209281_1000127184 | 455 |
| 1494 | 3300027296 | Ga0209389_1000002 | Ga0209389_100000235 | 455 |
| 1495 | 3300027312 | Ga0209371_1000127 | Ga0209371_100012735 | 455 |
| 1496 | 3300027312 | Ga0209371_1001784 | Ga0209371_100178411 | 455 |
| 1497 | 3300027907 | Ga0207428_10008488 | Ga0207428_100084888 | 455 |
| 1498 | 3300027907 | Ga0207428_10022639 | Ga0207428_100226394 | 455 |
| 1499 | 3300027907 | Ga0207428_10091240 | Ga0207428_100912402 | 455 |
| 1500 | 3300028379 | Ga0268266_10006807 | Ga0268266_100068073 | 455 |
| 1501 | 3300028786 | Ga0307517_10068597 | Ga0307517_100685972 | 455 |
| 1502 | 3300030500 | Ga0268256_1000104 | Ga0268256_100010435 | 455 |
| 1503 | 3300030500 | Ga0268256_1002159 | Ga0268256_10021594 | 455 |
| 1504 | 3300030521 | Ga0307511_10077707 | Ga0307511_100777071 | 455 |
| 1505 | 3300030733 | Ga0314311_1116887 | Ga0314311_11168872 | 455 |
| 1506 | 3300030735 | Ga0316178_1150033 | Ga0316178_11500333 | 455 |
| 1507 | 3300031548 | Ga0307408_100008354 | Ga0307408_1000083543 | 455 |
| 1508 | 3300031548 | Ga0307408_100016726 | Ga0307408_1000167264 | 455 |
| 1509 | 3300031548 | Ga0307408_100019847 | Ga0307408_1000198473 | 455 |
| 1510 | 3300031548 | Ga0307408_100041888 | Ga0307408_1000418883 | 455 |
| 1511 | 3300031548 | Ga0307408_100069774 | Ga0307408_1000697743 | 455 |
| 1512 | 3300031731 | Ga0307405_10000292 | Ga0307405_100002923 | 455 |
| 1513 | 3300031731 | Ga0307405_10017959 | Ga0307405_100179593 | 455 |
| 1514 | 3300031911 | Ga0307412_10001542 | Ga0307412_1000154212 | 455 |
| 1515 | 3300031911 | Ga0307412_10002214 | Ga0307412_1000221410 | 455 |
| 1516 | 3300031911 | Ga0307412_10002890 | Ga0307412_100028903 | 455 |
| 1517 | 3300032004 | Ga0307414_10032163 | Ga0307414_100321633 | 455 |
| 1518 | 3300032005 | Ga0307411_10016120 | Ga0307411_100161203 | 455 |
| 1519 | 3300032005 | Ga0307411_10054322 | Ga0307411_100543223 | 455 |
| 1520 | 3300033180 | Ga0307510_10011495 | Ga0307510_100114953 | 455 |
| 1521 | 3300033180 | Ga0307510_10072032 | Ga0307510_100720322 | 455 |
| 1522 | 3300041405 | Ga0439438_000530 | Ga0439438_000530_15239_16606 | 455 |
| 1523 | 3300041405 | Ga0439438_001413 | Ga0439438_001413_8737_10104 | 455 |
| 1524 | 3300041405 | Ga0439438_001885 | Ga0439438_001885_6389_7756 | 455 |
| 1525 | 3300041405 | Ga0439438_002408 | Ga0439438_002408_1062_2429 | 455 |
| 1526 | 3300041405 | Ga0439438_002819 | Ga0439438_002819_4782_6149 | 455 |
| 1527 | 3300041405 | Ga0439438_004575 | Ga0439438_004575_771_2198 | 455 |
| 1528 | 3300041405 | Ga0439438_011200 | Ga0439438_011200_726_2093 | 455 |
| 1529 | 3300041405 | Ga0439438_011384 | Ga0439438_011384_681_2048 | 455 |
| 1530 | 3300041407 | Ga0439447_000242 | Ga0439447_000242_16439_17806 | 455 |
| 1531 | 3300041407 | Ga0439447_000963 | Ga0439447_000963_7193_8560 | 455 |
| 1532 | 3300041407 | Ga0439447_001174 | Ga0439447_001174_1253_2620 | 455 |
| 1533 | 3300041407 | Ga0439447_012776 | Ga0439447_012776_847_2274 | 455 |
| 1534 | 3300041411 | Ga0439466_0000779 | Ga0439466_0000779_1422_2849 | 455 |
| 1535 | 3300041411 | Ga0439466_0001260 | Ga0439466_0001260_6044_7411 | 455 |
| 1536 | 3300041411 | Ga0439466_0002857 | Ga0439466_0002857_1013_2380 | 455 |
| 1537 | 3300041411 | Ga0439466_0006077 | Ga0439466_0006077_55_1422 | 455 |
| 1538 | 3300041411 | Ga0439466_0015831 | Ga0439466_0015831_306_1673 | 455 |
| 1539 | 3300041411 | Ga0439466_0017299 | Ga0439466_0017299_761_2128 | 455 |
| 1540 | 3300041411 | Ga0439466_0049030 | Ga0439466_0049030_11_1378 | 455 |
| 1541 | 3300041413 | Ga0439465_0001154 | Ga0439465_0001154_6416_7783 | 455 |
| 1542 | 3300042006 | Ga0439432_000632 | Ga0439432_000632_434_1801 | 455 |
| 1543 | 3300042006 | Ga0439432_003594 | Ga0439432_003594_1877_3244 | 455 |
| 1544 | 3300042006 | Ga0439432_008727 | Ga0439432_008727_763_2130 | 455 |
| 1545 | 3300042006 | Ga0439432_009742 | Ga0439432_009742_726_2093 | 455 |
| 1546 | 3300042006 | Ga0439432_014683 | Ga0439432_014683_707_2074 | 455 |
| 1547 | 3300042009 | Ga0439451_000947 | Ga0439451_000947_2338_3705 | 455 |
| 1548 | 3300042009 | Ga0439451_001448 | Ga0439451_001448_3275_4642 | 455 |
| 1549 | 3300042009 | Ga0439451_002411 | Ga0439451_002411_681_2048 | 455 |
| 1550 | 3300042009 | Ga0439451_010777 | Ga0439451_010777_146_1513 | 455 |
| 1551 | 3300042010 | Ga0439452_000085 | Ga0439452_000085_73493_74920 | 455 |
| 1552 | 3300042010 | Ga0439452_000149 | Ga0439452_000149_49561_50928 | 455 |
| 1553 | 3300042010 | Ga0439452_000581 | Ga0439452_000581_10233_11600 | 455 |
| 1554 | 3300042010 | Ga0439452_001680 | Ga0439452_001680_2162_3529 | 455 |
| 1555 | 3300042010 | Ga0439452_006146 | Ga0439452_006146_682_2049 | 455 |
| 1556 | 3300042013 | Ga0439456_000013 | Ga0439456_000013_56805_58172 | 455 |
| 1557 | 3300042013 | Ga0439456_000723 | Ga0439456_000723_4477_5844 | 455 |
| 1558 | 3300042013 | Ga0439456_004033 | Ga0439456_004033_1188_2555 | 455 |
| 1559 | 3300042013 | Ga0439456_006156 | Ga0439456_006156_649_2016 | 455 |
| 1560 | 3300042115 | Ga0450911_000006 | Ga0450911_000006_49942_51309 | 455 |
| 1561 | 3300042115 | Ga0450911_000521 | Ga0450911_000521_2665_4032 | 455 |
| 1562 | 3300042115 | Ga0450911_001091 | Ga0450911_001091_4861_6228 | 455 |
| 1563 | 3300042121 | Ga0450919_000041 | Ga0450919_000041_7804_9171 | 455 |
| 1564 | 3300042122 | Ga0450920_001489 | Ga0450920_001489_1181_2548 | 455 |
| 1565 | 3300042124 | Ga0450922_000267 | Ga0450922_000267_1076_2443 | 455 |
| 1566 | 3300042137 | Ga0450902_002640 | Ga0450902_002640_460_1827 | 455 |
| 1567 | 3300042138 | Ga0450903_002709 | Ga0450903_002709_909_2276 | 455 |
| 1568 | 3300042139 | Ga0450904_000693 | Ga0450904_000693_680_2047 | 455 |
| 1569 | 3300042145 | Ga0450906_001060 | Ga0450906_001060_1073_2440 | 455 |
| 1570 | 3300042146 | Ga0450907_000025 | Ga0450907_000025_62194_63561 | 455 |
| 1571 | 3300042146 | Ga0450907_000937 | Ga0450907_000937_4488_5855 | 455 |
| 1572 | 3300042146 | Ga0450907_006059 | Ga0450907_006059_567_1934 | 455 |
| 1573 | 3300042156 | Ga0439446_0001080 | Ga0439446_0001080_3820_5187 | 455 |
| 1574 | 3300042438 | Ga0439459_0007172 | Ga0439459_0007172_499_1866 | 455 |
| 1575 | 3300042461 | Ga0439460_0000989 | Ga0439460_0000989_817_2184 | 455 |
| 1576 | 3300042461 | Ga0439460_0006429 | Ga0439460_0006429_1121_2488 | 455 |
| 1577 | 3300042532 | Ga0450893_0000317 | Ga0450893_0000317_2032_3399 | 455 |
| 1578 | 3300042993 | Ga0439440_0003329 | Ga0439440_0003329_973_2340 | 455 |
| 1579 | 3300046452 | Ga0495617_000479 | Ga0495617_000479_7409_8776 | 455 |
| 1580 | 3300046452 | Ga0495617_001534 | Ga0495617_001534_6471_7838 | 455 |
| 1581 | 3300046452 | Ga0495617_046660 | Ga0495617_046660_44_1411 | 455 |
| 1582 | 3300046453 | Ga0495627_000221 | Ga0495627_000221_2417_3817 | 455 |
| 1583 | 3300046453 | Ga0495627_003091 | Ga0495627_003091_707_2074 | 455 |
| 1584 | 3300046453 | Ga0495627_006719 | Ga0495627_006719_616_1983 | 455 |
| 1585 | 3300046453 | Ga0495627_006739 | Ga0495627_006739_2495_3862 | 455 |
| 1586 | 3300046455 | Ga0495603_0003012 | Ga0495603_0003012_6082_7449 | 455 |
| 1587 | 3300046457 | Ga0495590_0001439 | Ga0495590_0001439_7818_9185 | 455 |
| 1588 | 3300046457 | Ga0495590_0002041 | Ga0495590_0002041_6492_7859 | 455 |
| 1589 | 3300046457 | Ga0495590_0005058 | Ga0495590_0005058_3224_4591 | 455 |
| 1590 | 3300046457 | Ga0495590_0008961 | Ga0495590_0008961_2100_3467 | 455 |
| 1591 | 3300046457 | Ga0495590_0013050 | Ga0495590_0013050_701_2068 | 455 |
| 1592 | 3300046458 | Ga0495591_000165 | Ga0495591_000165_8172_9539 | 455 |
| 1593 | 3300046458 | Ga0495591_000167 | Ga0495591_000167_15034_16404 | 455 |
| 1594 | 3300046458 | Ga0495591_001414 | Ga0495591_001414_12587_13954 | 455 |
| 1595 | 3300046458 | Ga0495591_001515 | Ga0495591_001515_12385_13752 | 455 |
| 1596 | 3300046458 | Ga0495591_002013 | Ga0495591_002013_3606_4973 | 455 |
| 1597 | 3300046458 | Ga0495591_003333 | Ga0495591_003333_543_1910 | 455 |
| 1598 | 3300046458 | Ga0495591_009099 | Ga0495591_009099_112_1479 | 455 |
| 1599 | 3300046458 | Ga0495591_010920 | Ga0495591_010920_1342_2712 | 455 |
| 1600 | 3300046458 | Ga0495591_023217 | Ga0495591_023217_541_1908 | 455 |
| 1601 | 3300046459 | Ga0495629_0009493 | Ga0495629_0009493_4739_6106 | 455 |
| 1602 | 3300046460 | Ga0495638_0007763 | Ga0495638_0007763_1019_2386 | 455 |
| 1603 | 3300046460 | Ga0495638_0007985 | Ga0495638_0007985_692_2119 | 455 |
| 1604 | 3300046460 | Ga0495638_0008999 | Ga0495638_0008999_4643_6010 | 455 |
| 1605 | 3300046460 | Ga0495638_0010092 | Ga0495638_0010092_4097_5464 | 455 |
| 1606 | 3300046460 | Ga0495638_0010448 | Ga0495638_0010448_5064_6431 | 455 |
| 1607 | 3300046460 | Ga0495638_0027275 | Ga0495638_0027275_582_1949 | 455 |
| 1608 | 3300046460 | Ga0495638_0065307 | Ga0495638_0065307_199_1566 | 455 |
| 1609 | 3300046463 | Ga0495653_0000332 | Ga0495653_0000332_1669_3036 | 455 |
| 1610 | 3300046463 | Ga0495653_0048055 | Ga0495653_0048055_1008_2375 | 455 |
| 1611 | 3300046463 | Ga0495653_0056873 | Ga0495653_0056873_372_1739 | 455 |
| 1612 | 3300046463 | Ga0495653_0060706 | Ga0495653_0060706_825_2192 | 455 |
| 1613 | 3300046471 | Ga0495650_0004045 | Ga0495650_0004045_4633_6003 | 455 |
| 1614 | 3300046471 | Ga0495650_0005255 | Ga0495650_0005255_6475_7842 | 455 |
| 1615 | 3300046471 | Ga0495650_0006583 | Ga0495650_0006583_3224_4591 | 455 |
| 1616 | 3300046471 | Ga0495650_0007026 | Ga0495650_0007026_4886_6253 | 455 |
| 1617 | 3300046471 | Ga0495650_0011231 | Ga0495650_0011231_78_1445 | 455 |
| 1618 | 3300046473 | Ga0495582_0039235 | Ga0495582_0039235_891_2258 | 455 |
| 1619 | 3300046474 | Ga0495605_0000167 | Ga0495605_0000167_77508_78878 | 455 |
| 1620 | 3300046474 | Ga0495605_0001345 | Ga0495605_0001345_10237_11604 | 455 |
| 1621 | 3300046474 | Ga0495605_0010585 | Ga0495605_0010585_3123_4490 | 455 |
| 1622 | 3300046474 | Ga0495605_0011091 | Ga0495605_0011091_2713_4080 | 455 |
| 1623 | 3300046474 | Ga0495605_0027836 | Ga0495605_0027836_1540_2907 | 455 |
| 1624 | 3300046474 | Ga0495605_0028766 | Ga0495605_0028766_369_1736 | 455 |
| 1625 | 3300046475 | Ga0495639_0000732 | Ga0495639_0000732_12463_13830 | 455 |
| 1626 | 3300046491 | Ga0495584_0001949 | Ga0495584_0001949_4391_5758 | 455 |
| 1627 | 3300046491 | Ga0495584_0003603 | Ga0495584_0003603_7052_8419 | 455 |
| 1628 | 3300046491 | Ga0495584_0003616 | Ga0495584_0003616_601_1968 | 455 |
| 1629 | 3300046491 | Ga0495584_0004904 | Ga0495584_0004904_5091_6458 | 455 |
| 1630 | 3300046491 | Ga0495584_0008253 | Ga0495584_0008253_1000_2367 | 455 |
| 1631 | 3300046491 | Ga0495584_0010064 | Ga0495584_0010064_3352_4719 | 455 |
| 1632 | 3300046492 | Ga0495585_0000937 | Ga0495585_0000937_22527_23894 | 455 |
| 1633 | 3300046492 | Ga0495585_0004782 | Ga0495585_0004782_6766_8133 | 455 |
| 1634 | 3300046492 | Ga0495585_0005409 | Ga0495585_0005409_5551_6918 | 455 |
| 1635 | 3300046492 | Ga0495585_0010129 | Ga0495585_0010129_1534_2901 | 455 |
| 1636 | 3300046500 | Ga0495596_0001631 | Ga0495596_0001631_1049_2416 | 455 |
| 1637 | 3300046500 | Ga0495596_0012106 | Ga0495596_0012106_973_2343 | 455 |
| 1638 | 3300046501 | Ga0495607_0000703 | Ga0495607_0000703_20521_21891 | 455 |
| 1639 | 3300046501 | Ga0495607_0001371 | Ga0495607_0001371_8457_9824 | 455 |
| 1640 | 3300046501 | Ga0495607_0001606 | Ga0495607_0001606_3074_4444 | 455 |
| 1641 | 3300046501 | Ga0495607_0002265 | Ga0495607_0002265_10561_11931 | 455 |
| 1642 | 3300046501 | Ga0495607_0002471 | Ga0495607_0002471_641_2008 | 455 |
| 1643 | 3300046501 | Ga0495607_0003408 | Ga0495607_0003408_3088_4455 | 455 |
| 1644 | 3300046501 | Ga0495607_0005373 | Ga0495607_0005373_7181_8548 | 455 |
| 1645 | 3300046501 | Ga0495607_0006396 | Ga0495607_0006396_581_1948 | 455 |
| 1646 | 3300046501 | Ga0495607_0008982 | Ga0495607_0008982_448_1818 | 455 |
| 1647 | 3300046501 | Ga0495607_0009021 | Ga0495607_0009021_5175_6542 | 455 |
| 1648 | 3300046501 | Ga0495607_0014641 | Ga0495607_0014641_785_2152 | 455 |
| 1649 | 3300046501 | Ga0495607_0062998 | Ga0495607_0062998_17_1384 | 455 |
| 1650 | 3300046501 | Ga0495607_0063840 | Ga0495607_0063840_612_1979 | 455 |
| 1651 | 3300046506 | Ga0495583_0002145 | Ga0495583_0002145_1822_3189 | 455 |
| 1652 | 3300046506 | Ga0495583_0002689 | Ga0495583_0002689_286_1653 | 455 |
| 1653 | 3300046506 | Ga0495583_0004670 | Ga0495583_0004670_4062_5432 | 455 |
| 1654 | 3300046506 | Ga0495583_0005160 | Ga0495583_0005160_1256_2623 | 455 |
| 1655 | 3300046506 | Ga0495583_0006720 | Ga0495583_0006720_4682_6052 | 455 |
| 1656 | 3300046507 | Ga0495606_0000313 | Ga0495606_0000313_77839_79209 | 455 |
| 1657 | 3300046507 | Ga0495606_0000364 | Ga0495606_0000364_66062_67429 | 455 |
| 1658 | 3300046507 | Ga0495606_0004876 | Ga0495606_0004876_10393_11760 | 455 |
| 1659 | 3300046507 | Ga0495606_0008233 | Ga0495606_0008233_543_1910 | 455 |
| 1660 | 3300046507 | Ga0495606_0008338 | Ga0495606_0008338_7470_8837 | 455 |
| 1661 | 3300046507 | Ga0495606_0009331 | Ga0495606_0009331_1543_2913 | 455 |
| 1662 | 3300046507 | Ga0495606_0014787 | Ga0495606_0014787_4601_5968 | 455 |
| 1663 | 3300046507 | Ga0495606_0024715 | Ga0495606_0024715_669_2036 | 455 |
| 1664 | 3300046512 | Ga0495610_0006115 | Ga0495610_0006115_6438_7805 | 455 |
| 1665 | 3300046512 | Ga0495610_0006148 | Ga0495610_0006148_616_1983 | 455 |
| 1666 | 3300046512 | Ga0495610_0008702 | Ga0495610_0008702_1116_2483 | 455 |
| 1667 | 3300046512 | Ga0495610_0011833 | Ga0495610_0011833_575_1942 | 455 |
| 1668 | 3300046512 | Ga0495610_0014670 | Ga0495610_0014670_2067_3434 | 455 |
| 1669 | 3300046512 | Ga0495610_0020628 | Ga0495610_0020628_1096_2463 | 455 |
| 1670 | 3300046512 | Ga0495610_0023269 | Ga0495610_0023269_260_1627 | 455 |
| 1671 | 3300046513 | Ga0495616_0003956 | Ga0495616_0003956_7387_8754 | 455 |
| 1672 | 3300046513 | Ga0495616_0004838 | Ga0495616_0004838_629_1996 | 455 |
| 1673 | 3300046513 | Ga0495616_0005311 | Ga0495616_0005311_426_1793 | 455 |
| 1674 | 3300046513 | Ga0495616_0013706 | Ga0495616_0013706_702_2069 | 455 |
| 1675 | 3300046513 | Ga0495616_0034514 | Ga0495616_0034514_1139_2506 | 455 |
| 1676 | 3300046513 | Ga0495616_0044994 | Ga0495616_0044994_157_1527 | 455 |
| 1677 | 3300046513 | Ga0495616_0053072 | Ga0495616_0053072_583_1950 | 455 |
| 1678 | 3300046513 | Ga0495616_0054048 | Ga0495616_0054048_387_1754 | 455 |
| 1679 | 3300046515 | Ga0495620_0000052 | Ga0495620_0000052_44315_45685 | 455 |
| 1680 | 3300046515 | Ga0495620_0000482 | Ga0495620_0000482_14026_15396 | 455 |
| 1681 | 3300046515 | Ga0495620_0000811 | Ga0495620_0000811_5661_7028 | 455 |
| 1682 | 3300046515 | Ga0495620_0006387 | Ga0495620_0006387_3348_4715 | 455 |
| 1683 | 3300046515 | Ga0495620_0007738 | Ga0495620_0007738_3421_4818 | 455 |
| 1684 | 3300046517 | Ga0495630_0018059 | Ga0495630_0018059_1153_2520 | 455 |
| 1685 | 3300046517 | Ga0495630_0054199 | Ga0495630_0054199_234_1601 | 455 |
| 1686 | 3300046517 | Ga0495630_0107201 | Ga0495630_0107201_263_1630 | 455 |
| 1687 | 3300046518 | Ga0495631_0003543 | Ga0495631_0003543_695_2062 | 455 |
| 1688 | 3300046518 | Ga0495631_0004428 | Ga0495631_0004428_3826_5226 | 455 |
| 1689 | 3300046519 | Ga0495632_0001542 | Ga0495632_0001542_7499_8866 | 455 |
| 1690 | 3300046519 | Ga0495632_0002560 | Ga0495632_0002560_6567_7934 | 455 |
| 1691 | 3300046519 | Ga0495632_0007683 | Ga0495632_0007683_4647_6014 | 455 |
| 1692 | 3300046519 | Ga0495632_0007887 | Ga0495632_0007887_623_1993 | 455 |
| 1693 | 3300046519 | Ga0495632_0008623 | Ga0495632_0008623_4401_5768 | 455 |
| 1694 | 3300046519 | Ga0495632_0011595 | Ga0495632_0011595_1272_2639 | 455 |
| 1695 | 3300046519 | Ga0495632_0011700 | Ga0495632_0011700_3637_5037 | 455 |
| 1696 | 3300046519 | Ga0495632_0015018 | Ga0495632_0015018_1557_2927 | 455 |
| 1697 | 3300046519 | Ga0495632_0016104 | Ga0495632_0016104_2400_3800 | 455 |
| 1698 | 3300046519 | Ga0495632_0016723 | Ga0495632_0016723_2495_3862 | 455 |
| 1699 | 3300046519 | Ga0495632_0022037 | Ga0495632_0022037_1522_2892 | 455 |
| 1700 | 3300046519 | Ga0495632_0027337 | Ga0495632_0027337_438_1805 | 455 |
| 1701 | 3300046519 | Ga0495632_0049670 | Ga0495632_0049670_670_2037 | 455 |
| 1702 | 3300046520 | Ga0495637_0000059 | Ga0495637_0000059_11220_12590 | 455 |
| 1703 | 3300046520 | Ga0495637_0000816 | Ga0495637_0000816_7759_9129 | 455 |
| 1704 | 3300046520 | Ga0495637_0000931 | Ga0495637_0000931_7476_8843 | 455 |
| 1705 | 3300046520 | Ga0495637_0003407 | Ga0495637_0003407_6460_7827 | 455 |
| 1706 | 3300046520 | Ga0495637_0003519 | Ga0495637_0003519_6416_7783 | 455 |
| 1707 | 3300046520 | Ga0495637_0004240 | Ga0495637_0004240_1393_2760 | 455 |
| 1708 | 3300046520 | Ga0495637_0011919 | Ga0495637_0011919_1943_3310 | 455 |
| 1709 | 3300046520 | Ga0495637_0016561 | Ga0495637_0016561_851_2218 | 455 |
| 1710 | 3300046520 | Ga0495637_0018178 | Ga0495637_0018178_1218_2585 | 455 |
| 1711 | 3300046520 | Ga0495637_0028057 | Ga0495637_0028057_885_2252 | 455 |
| 1712 | 3300046520 | Ga0495637_0031181 | Ga0495637_0031181_222_1589 | 455 |
| 1713 | 3300046520 | Ga0495637_0048068 | Ga0495637_0048068_408_1775 | 455 |
| 1714 | 3300046520 | Ga0495637_0055229 | Ga0495637_0055229_237_1604 | 455 |
| 1715 | 3300046522 | Ga0495643_0000197 | Ga0495643_0000197_2149_3519 | 455 |
| 1716 | 3300046522 | Ga0495643_0000404 | Ga0495643_0000404_38211_39578 | 455 |
| 1717 | 3300046522 | Ga0495643_0011424 | Ga0495643_0011424_660_2027 | 455 |
| 1718 | 3300046522 | Ga0495643_0015062 | Ga0495643_0015062_2349_3716 | 455 |
| 1719 | 3300046522 | Ga0495643_0031462 | Ga0495643_0031462_713_2080 | 455 |
| 1720 | 3300046522 | Ga0495643_0039746 | Ga0495643_0039746_1046_2413 | 455 |
| 1721 | 3300046522 | Ga0495643_0081844 | Ga0495643_0081844_241_1611 | 455 |
| 1722 | 3300046523 | Ga0495644_0000942 | Ga0495644_0000942_9943_11310 | 455 |
| 1723 | 3300046523 | Ga0495644_0001481 | Ga0495644_0001481_5413_6780 | 455 |
| 1724 | 3300046523 | Ga0495644_0002056 | Ga0495644_0002056_1979_3346 | 455 |
| 1725 | 3300046524 | Ga0495648_0001828 | Ga0495648_0001828_8833_10200 | 455 |
| 1726 | 3300046524 | Ga0495648_0002424 | Ga0495648_0002424_4347_5714 | 455 |
| 1727 | 3300046524 | Ga0495648_0004782 | Ga0495648_0004782_4033_5403 | 455 |
| 1728 | 3300046524 | Ga0495648_0006093 | Ga0495648_0006093_676_2043 | 455 |
| 1729 | 3300046524 | Ga0495648_0014386 | Ga0495648_0014386_4196_5566 | 455 |
| 1730 | 3300046524 | Ga0495648_0018256 | Ga0495648_0018256_1429_2796 | 455 |
| 1731 | 3300046524 | Ga0495648_0032715 | Ga0495648_0032715_1521_2888 | 455 |
| 1732 | 3300046524 | Ga0495648_0034269 | Ga0495648_0034269_1144_2511 | 455 |
| 1733 | 3300046524 | Ga0495648_0075457 | Ga0495648_0075457_454_1821 | 455 |
| 1734 | 3300046526 | Ga0495666_0003871 | Ga0495666_0003871_5615_6982 | 455 |
| 1735 | 3300046526 | Ga0495666_0017193 | Ga0495666_0017193_1005_2372 | 455 |
| 1736 | 3300046526 | Ga0495666_0027594 | Ga0495666_0027594_435_1802 | 455 |
| 1737 | 3300046528 | Ga0495642_0000276 | Ga0495642_0000276_14455_15822 | 455 |
| 1738 | 3300046528 | Ga0495642_0000490 | Ga0495642_0000490_710_2077 | 455 |
| 1739 | 3300046530 | Ga0495654_0001661 | Ga0495654_0001661_12525_13892 | 455 |
| 1740 | 3300046530 | Ga0495654_0001908 | Ga0495654_0001908_687_2054 | 455 |
| 1741 | 3300046530 | Ga0495654_0002241 | Ga0495654_0002241_2420_3820 | 455 |
| 1742 | 3300046530 | Ga0495654_0002255 | Ga0495654_0002255_1332_2699 | 455 |
| 1743 | 3300046530 | Ga0495654_0004885 | Ga0495654_0004885_3863_5230 | 455 |
| 1744 | 3300046530 | Ga0495654_0005191 | Ga0495654_0005191_5936_7306 | 455 |
| 1745 | 3300046530 | Ga0495654_0010455 | Ga0495654_0010455_1257_2624 | 455 |
| 1746 | 3300046530 | Ga0495654_0013393 | Ga0495654_0013393_587_1954 | 455 |
| 1747 | 3300046530 | Ga0495654_0028656 | Ga0495654_0028656_573_1940 | 455 |
| 1748 | 3300046530 | Ga0495654_0029367 | Ga0495654_0029367_796_2163 | 455 |
| 1749 | 3300046530 | Ga0495654_0035733 | Ga0495654_0035733_380_1747 | 455 |
| 1750 | 3300046536 | Ga0495587_0019792 | Ga0495587_0019792_1786_3153 | 455 |
| 1751 | 3300046538 | Ga0495609_0000123 | Ga0495609_0000123_80616_81986 | 455 |
| 1752 | 3300046538 | Ga0495609_0003847 | Ga0495609_0003847_609_1976 | 455 |
| 1753 | 3300046538 | Ga0495609_0003853 | Ga0495609_0003853_616_1983 | 455 |
| 1754 | 3300046538 | Ga0495609_0008134 | Ga0495609_0008134_1233_2600 | 455 |
| 1755 | 3300046542 | Ga0495597_0001966 | Ga0495597_0001966_11748_13115 | 455 |
| 1756 | 3300046542 | Ga0495597_0005872 | Ga0495597_0005872_4329_5696 | 455 |
| 1757 | 3300046542 | Ga0495597_0006609 | Ga0495597_0006609_4534_5901 | 455 |
| 1758 | 3300046542 | Ga0495597_0013577 | Ga0495597_0013577_1660_3027 | 455 |
| 1759 | 3300046542 | Ga0495597_0023807 | Ga0495597_0023807_642_2009 | 455 |
| 1760 | 3300046542 | Ga0495597_0027194 | Ga0495597_0027194_33_1400 | 455 |
| 1761 | 3300046542 | Ga0495597_0033173 | Ga0495597_0033173_519_1886 | 455 |
| 1762 | 3300046542 | Ga0495597_0037170 | Ga0495597_0037170_788_2155 | 455 |
| 1763 | 3300046557 | Ga0495622_0001082 | Ga0495622_0001082_699_2066 | 455 |
| 1764 | 3300046557 | Ga0495622_0003665 | Ga0495622_0003665_2199_3566 | 455 |
| 1765 | 3300046557 | Ga0495622_0025393 | Ga0495622_0025393_1148_2515 | 455 |
| 1766 | 3300046558 | Ga0495633_0003764 | Ga0495633_0003764_693_2060 | 455 |
| 1767 | 3300046558 | Ga0495633_0004090 | Ga0495633_0004090_1971_3338 | 455 |
| 1768 | 3300046615 | Ga0495656_0039517 | Ga0495656_0039517_313_1680 | 455 |
| 1769 | 3300046616 | Ga0495668_0003074 | Ga0495668_0003074_5630_6997 | 455 |
| 1770 | 3300046616 | Ga0495668_0004765 | Ga0495668_0004765_2238_3605 | 455 |
| 1771 | 3300046616 | Ga0495668_0005370 | Ga0495668_0005370_6675_8162 | 455 |
| 1772 | 3300046616 | Ga0495668_0020614 | Ga0495668_0020614_341_1711 | 455 |
| 1773 | 3300046616 | Ga0495668_0051162 | Ga0495668_0051162_577_1944 | 455 |
| 1774 | 3300046642 | Ga0495634_0009812 | Ga0495634_0009812_4510_5877 | 455 |
| 1775 | 3300046648 | Ga0495611_0001586 | Ga0495611_0001586_2730_4097 | 455 |
| 1776 | 3300046648 | Ga0495611_0004574 | Ga0495611_0004574_4350_5720 | 455 |
| 1777 | 3300046660 | Ga0495625_0000202 | Ga0495625_0000202_82086_83456 | 455 |
| 1778 | 3300046660 | Ga0495625_0005131 | Ga0495625_0005131_8930_10297 | 455 |
| 1779 | 3300046660 | Ga0495625_0006971 | Ga0495625_0006971_5961_7328 | 455 |
| 1780 | 3300046660 | Ga0495625_0007674 | Ga0495625_0007674_799_2166 | 455 |
| 1781 | 3300046660 | Ga0495625_0011941 | Ga0495625_0011941_681_2048 | 455 |
| 1782 | 3300046660 | Ga0495625_0054711 | Ga0495625_0054711_643_2010 | 455 |
| 1783 | 3300046663 | Ga0495635_0007404 | Ga0495635_0007404_5208_6575 | 455 |
| 1784 | 3300046663 | Ga0495635_0046477 | Ga0495635_0046477_629_1996 | 455 |
| 1785 | 3300046664 | Ga0495659_0000457 | Ga0495659_0000457_6854_8221 | 455 |
| 1786 | 3300046664 | Ga0495659_0002039 | Ga0495659_0002039_4941_6308 | 455 |
| 1787 | 3300046665 | Ga0495661_0000075 | Ga0495661_0000075_86611_87978 | 455 |
| 1788 | 3300046665 | Ga0495661_0000133 | Ga0495661_0000133_82725_84095 | 455 |
| 1789 | 3300046665 | Ga0495661_0005482 | Ga0495661_0005482_263_1630 | 455 |
| 1790 | 3300046665 | Ga0495661_0010774 | Ga0495661_0010774_520_1887 | 455 |
| 1791 | 3300046665 | Ga0495661_0043538 | Ga0495661_0043538_1025_2392 | 455 |
| 1792 | 3300046674 | Ga0495588_0056997 | Ga0495588_0056997_526_1893 | 455 |
| 1793 | 3300046679 | Ga0495623_0010642 | Ga0495623_0010642_1023_2390 | 455 |
| 1794 | 3300046680 | Ga0495646_0031588 | Ga0495646_0031588_922_2289 | 455 |
| 1795 | 3300046684 | Ga0495669_0051240 | Ga0495669_0051240_32_1399 | 455 |
| 1796 | 3300046689 | Ga0495613_0144945 | Ga0495613_0144945_252_1619 | 455 |
| 1797 | 3300046690 | Ga0495624_0001179 | Ga0495624_0001179_6007_7374 | 455 |
| 1798 | 3300046691 | Ga0495670_0000715 | Ga0495670_0000715_2166_3533 | 455 |
| 1799 | 3300046691 | Ga0495670_0002855 | Ga0495670_0002855_6468_7835 | 455 |
| 1800 | 3300046691 | Ga0495670_0007109 | Ga0495670_0007109_1244_2611 | 455 |
| 1801 | 3300046691 | Ga0495670_0008345 | Ga0495670_0008345_105_1472 | 455 |
| 1802 | 3300046691 | Ga0495670_0009264 | Ga0495670_0009264_1127_2494 | 455 |
| 1803 | 3300046692 | Ga0495671_0001378 | Ga0495671_0001378_14451_15818 | 455 |
| 1804 | 3300046692 | Ga0495671_0001513 | Ga0495671_0001513_1406_2773 | 455 |
| 1805 | 3300046692 | Ga0495671_0004814 | Ga0495671_0004814_5859_7226 | 455 |
| 1806 | 3300046692 | Ga0495671_0004870 | Ga0495671_0004870_3830_5200 | 455 |
| 1807 | 3300046692 | Ga0495671_0005064 | Ga0495671_0005064_2261_3628 | 455 |
| 1808 | 3300046692 | Ga0495671_0007843 | Ga0495671_0007843_754_2121 | 455 |
| 1809 | 3300046692 | Ga0495671_0009478 | Ga0495671_0009478_706_2073 | 455 |
| 1810 | 3300046692 | Ga0495671_0011691 | Ga0495671_0011691_700_2100 | 455 |
| 1811 | 3300046692 | Ga0495671_0012933 | Ga0495671_0012933_2489_3856 | 455 |
| 1812 | 3300046692 | Ga0495671_0015819 | Ga0495671_0015819_1079_2446 | 455 |
| 1813 | 3300046692 | Ga0495671_0018358 | Ga0495671_0018358_609_1976 | 455 |
| 1814 | 3300046692 | Ga0495671_0066731 | Ga0495671_0066731_248_1615 | 455 |
| 1815 | 3300046694 | Ga0495649_0001000 | Ga0495649_0001000_8242_9609 | 455 |
| 1816 | 3300046694 | Ga0495649_0001508 | Ga0495649_0001508_14951_16318 | 455 |
| 1817 | 3300046694 | Ga0495649_0004598 | Ga0495649_0004598_664_2031 | 455 |
| 1818 | 3300046694 | Ga0495649_0004606 | Ga0495649_0004606_2290_3657 | 455 |
| 1819 | 3300046694 | Ga0495649_0006097 | Ga0495649_0006097_848_2215 | 455 |
| 1820 | 3300046694 | Ga0495649_0006109 | Ga0495649_0006109_5382_6749 | 455 |
| 1821 | 3300046694 | Ga0495649_0013854 | Ga0495649_0013854_698_2065 | 455 |
| 1822 | 3300046694 | Ga0495649_0016529 | Ga0495649_0016529_1155_2522 | 455 |
| 1823 | 3300046694 | Ga0495649_0022237 | Ga0495649_0022237_2047_3417 | 455 |
| 1824 | 3300046694 | Ga0495649_0029337 | Ga0495649_0029337_376_1803 | 455 |
| 1825 | 3300046694 | Ga0495649_0054306 | Ga0495649_0054306_688_2055 | 455 |
| 1826 | 3300046794 | Ga0495589_0003312 | Ga0495589_0003312_6490_7857 | 455 |
| 1827 | 3300046794 | Ga0495589_0004738 | Ga0495589_0004738_675_2042 | 455 |
| 1828 | 3300046794 | Ga0495589_0017712 | Ga0495589_0017712_594_1961 | 455 |
| 1829 | 3300046809 | Ga0495600_0018264 | Ga0495600_0018264_813_2180 | 455 |
| 1830 | 3300046810 | Ga0495660_0004652 | Ga0495660_0004652_6334_7701 | 455 |
| 1831 | 3300046810 | Ga0495660_0006205 | Ga0495660_0006205_712_2079 | 455 |
| 1832 | 3300046810 | Ga0495660_0008586 | Ga0495660_0008586_4014_5381 | 455 |
| 1833 | 3300046810 | Ga0495660_0011032 | Ga0495660_0011032_475_1842 | 455 |
| 1834 | 3300046810 | Ga0495660_0021990 | Ga0495660_0021990_1700_3067 | 455 |
| 1835 | 3300046810 | Ga0495660_0051365 | Ga0495660_0051365_33_1400 | 455 |
| 1836 | 3300046810 | Ga0495660_0079955 | Ga0495660_0079955_270_1640 | 455 |
| 1837 | 3300047315 | Ga0495581_0019114 | Ga0495581_0019114_1605_2972 | 455 |
| 1838 | 3300047318 | Ga0495636_0010709 | Ga0495636_0010709_1017_2384 | 455 |
| 1839 | 3300047319 | Ga0495674_0017039 | Ga0495674_0017039_5393_6760 | 455 |
| 1840 | 3300047320 | Ga0495672_0002280 | Ga0495672_0002280_5858_7225 | 455 |
| 1841 | 3300047320 | Ga0495672_0008082 | Ga0495672_0008082_1124_2491 | 455 |
| 1842 | 3300047320 | Ga0495672_0009270 | Ga0495672_0009270_2866_4233 | 455 |
| 1843 | 3300047320 | Ga0495672_0011348 | Ga0495672_0011348_4005_5372 | 455 |
| 1844 | 3300047320 | Ga0495672_0011640 | Ga0495672_0011640_1056_2423 | 455 |
| 1845 | 3300047320 | Ga0495672_0011731 | Ga0495672_0011731_1022_2389 | 455 |
| 1846 | 3300047320 | Ga0495672_0015303 | Ga0495672_0015303_1407_2807 | 455 |
| 1847 | 3300047320 | Ga0495672_0028587 | Ga0495672_0028587_940_2307 | 455 |
| 1848 | 3300047320 | Ga0495672_0059323 | Ga0495672_0059323_167_1534 | 455 |
| 1849 | 3300047320 | Ga0495672_0061030 | Ga0495672_0061030_212_1579 | 455 |
| 1850 | 3300047321 | Ga0495676_0000053 | Ga0495676_0000053_83089_84459 | 455 |
| 1851 | 3300047321 | Ga0495676_0010218 | Ga0495676_0010218_6470_7837 | 455 |
| 1852 | 3300047321 | Ga0495676_0013031 | Ga0495676_0013031_5820_7187 | 455 |
| 1853 | 3300047322 | Ga0495680_0008378 | Ga0495680_0008378_7260_8627 | 455 |
| 1854 | 3300047322 | Ga0495680_0011624 | Ga0495680_0011624_1821_3188 | 455 |
| 1855 | 3300047322 | Ga0495680_0016108 | Ga0495680_0016108_1029_2396 | 455 |
| 1856 | 3300047322 | Ga0495680_0158737 | Ga0495680_0158737_215_1582 | 455 |
| 1857 | 3300047323 | Ga0495683_0000043 | Ga0495683_0000043_112719_114086 | 455 |
| 1858 | 3300047323 | Ga0495683_0001174 | Ga0495683_0001174_7344_8711 | 455 |
| 1859 | 3300047323 | Ga0495683_0001446 | Ga0495683_0001446_7069_8436 | 455 |
| 1860 | 3300047323 | Ga0495683_0008158 | Ga0495683_0008158_3099_4466 | 455 |
| 1861 | 3300047323 | Ga0495683_0032185 | Ga0495683_0032185_239_1606 | 455 |
| 1862 | 3300047323 | Ga0495683_0033568 | Ga0495683_0033568_844_2211 | 455 |
| 1863 | 3300047323 | Ga0495683_0037968 | Ga0495683_0037968_1041_2408 | 455 |
| 1864 | 3300047443 | Ga0495687_002579 | Ga0495687_002579_5864_7231 | 455 |
| 1865 | 3300047443 | Ga0495687_010786 | Ga0495687_010786_762_2129 | 455 |
| 1866 | 3300047443 | Ga0495687_012830 | Ga0495687_012830_2292_3659 | 455 |
| 1867 | 3300047444 | Ga0495675_0017433 | Ga0495675_0017433_898_2265 | 455 |
| 1868 | 3300047446 | Ga0495679_000401 | Ga0495679_000401_20082_21452 | 455 |
| 1869 | 3300047446 | Ga0495679_012962 | Ga0495679_012962_1058_2425 | 455 |
| 1870 | 3300047469 | Ga0495673_0001376 | Ga0495673_0001376_6969_8336 | 455 |
| 1871 | 3300047469 | Ga0495673_0001555 | Ga0495673_0001555_9173_10540 | 455 |
| 1872 | 3300047469 | Ga0495673_0001645 | Ga0495673_0001645_9897_11264 | 455 |
| 1873 | 3300047469 | Ga0495673_0001654 | Ga0495673_0001654_5479_6846 | 455 |
| 1874 | 3300047469 | Ga0495673_0002191 | Ga0495673_0002191_5087_6457 | 455 |
| 1875 | 3300047469 | Ga0495673_0003703 | Ga0495673_0003703_7871_9238 | 455 |
| 1876 | 3300047469 | Ga0495673_0004615 | Ga0495673_0004615_3224_4591 | 455 |
| 1877 | 3300047469 | Ga0495673_0004624 | Ga0495673_0004624_688_2055 | 455 |
| 1878 | 3300047469 | Ga0495673_0006316 | Ga0495673_0006316_454_1821 | 455 |
| 1879 | 3300047469 | Ga0495673_0006785 | Ga0495673_0006785_4652_6019 | 455 |
| 1880 | 3300047469 | Ga0495673_0008889 | Ga0495673_0008889_3350_4720 | 455 |
| 1881 | 3300047469 | Ga0495673_0013301 | Ga0495673_0013301_2729_4099 | 455 |
| 1882 | 3300047469 | Ga0495673_0027528 | Ga0495673_0027528_750_2117 | 455 |
| 1883 | 3300047470 | Ga0495681_0001974 | Ga0495681_0001974_640_2007 | 455 |
| 1884 | 3300047470 | Ga0495681_0002070 | Ga0495681_0002070_6490_7857 | 455 |
| 1885 | 3300047470 | Ga0495681_0002174 | Ga0495681_0002174_10750_12117 | 455 |
| 1886 | 3300047470 | Ga0495681_0002684 | Ga0495681_0002684_1458_2825 | 455 |
| 1887 | 3300047470 | Ga0495681_0006168 | Ga0495681_0006168_1167_2534 | 455 |
| 1888 | 3300047470 | Ga0495681_0006631 | Ga0495681_0006631_5249_6616 | 455 |
| 1889 | 3300047470 | Ga0495681_0018594 | Ga0495681_0018594_422_1789 | 455 |
| 1890 | 3300047470 | Ga0495681_0023460 | Ga0495681_0023460_653_2020 | 455 |
| 1891 | 3300047470 | Ga0495681_0045278 | Ga0495681_0045278_55_1422 | 455 |
| 1892 | 3300047470 | Ga0495681_0048968 | Ga0495681_0048968_223_1590 | 455 |
| 1893 | 3300047472 | Ga0495686_0008099 | Ga0495686_0008099_4707_6074 | 455 |
| 1894 | 3300047472 | Ga0495686_0012478 | Ga0495686_0012478_1044_2411 | 455 |
| 1895 | 3300047472 | Ga0495686_0025928 | Ga0495686_0025928_723_2090 | 455 |
| 1896 | 3300047673 | Ga0495593_0006443 | Ga0495593_0006443_4769_6136 | 455 |
| 1897 | 3300048088 | Ga0495602_0009613 | Ga0495602_0009613_884_2251 | 455 |
| 1898 | 3300048091 | Ga0495626_0000261 | Ga0495626_0000261_5602_6972 | 455 |
| 1899 | 3300048091 | Ga0495626_0001455 | Ga0495626_0001455_5509_6876 | 455 |
| 1900 | 3300048091 | Ga0495626_0001872 | Ga0495626_0001872_5451_6818 | 455 |
| 1901 | 3300048091 | Ga0495626_0002288 | Ga0495626_0002288_6591_7958 | 455 |
| 1902 | 3300048091 | Ga0495626_0002548 | Ga0495626_0002548_10090_11457 | 455 |
| 1903 | 3300048091 | Ga0495626_0004275 | Ga0495626_0004275_682_2049 | 455 |
| 1904 | 3300048905 | Ga0496102_0002699 | Ga0496102_0002699_8440_9807 | 455 |
| 1905 | 3300048906 | Ga0496103_0004499 | Ga0496103_0004499_5508_6875 | 455 |
| 1906 | 3300048913 | Ga0496110_0110591 | Ga0496110_0110591_486_1853 | 455 |
| 1907 | 3300048919 | Ga0496116_0000267 | Ga0496116_0000267_9613_10980 | 455 |
| 1908 | 3300048919 | Ga0496116_0003287 | Ga0496116_0003287_2246_3613 | 455 |
| 1909 | 3300048919 | Ga0496116_0007651 | Ga0496116_0007651_684_2051 | 455 |
| 1910 | 3300048919 | Ga0496116_0009027 | Ga0496116_0009027_694_2061 | 455 |
| 1911 | 3300048919 | Ga0496116_0009042 | Ga0496116_0009042_690_2057 | 455 |
| 1912 | 3300048920 | Ga0496117_0000345 | Ga0496117_0000345_80319_81686 | 455 |
| 1913 | 3300048920 | Ga0496117_0004534 | Ga0496117_0004534_4543_5913 | 455 |
| 1914 | 3300048920 | Ga0496117_0009147 | Ga0496117_0009147_5221_6588 | 455 |
| 1915 | 3300048920 | Ga0496117_0017496 | Ga0496117_0017496_969_2339 | 455 |
| 1916 | 3300048920 | Ga0496117_0055595 | Ga0496117_0055595_147_1517 | 455 |
| 1917 | 3300048921 | Ga0496118_0001278 | Ga0496118_0001278_28173_29543 | 455 |
| 1918 | 3300048921 | Ga0496118_0011289 | Ga0496118_0011289_861_2228 | 455 |
| 1919 | 3300048921 | Ga0496118_0052119 | Ga0496118_0052119_1652_3019 | 455 |
| 1920 | 3300048922 | Ga0496119_0000199 | Ga0496119_0000199_37421_38791 | 455 |
| 1921 | 3300048922 | Ga0496119_0027444 | Ga0496119_0027444_1863_3230 | 455 |
| 1922 | 3300048923 | Ga0496120_0000840 | Ga0496120_0000840_18308_19678 | 455 |
| 1923 | 3300048924 | Ga0496121_0000366 | Ga0496121_0000366_9627_10994 | 455 |
| 1924 | 3300048924 | Ga0496121_0005581 | Ga0496121_0005581_10484_11854 | 455 |
| 1925 | 3300048924 | Ga0496121_0013954 | Ga0496121_0013954_6362_7846 | 455 |
| 1926 | 3300048924 | Ga0496121_0027349 | Ga0496121_0027349_2073_3440 | 455 |
| 1927 | 3300048924 | Ga0496121_0050458 | Ga0496121_0050458_897_2267 | 455 |
| 1928 | 3300048924 | Ga0496121_0079971 | Ga0496121_0079971_440_1807 | 455 |
| 1929 | 3300048925 | Ga0496122_0001397 | Ga0496122_0001397_10565_11935 | 455 |
| 1930 | 3300048925 | Ga0496122_0011931 | Ga0496122_0011931_6698_8065 | 455 |
| 1931 | 3300048925 | Ga0496122_0014282 | Ga0496122_0014282_4010_5377 | 455 |
| 1932 | 3300048926 | Ga0496123_0000432 | Ga0496123_0000432_10563_11933 | 455 |
| 1933 | 3300048926 | Ga0496123_0022407 | Ga0496123_0022407_1118_2485 | 455 |
| 1934 | 3300048926 | Ga0496123_0032442 | Ga0496123_0032442_1087_2454 | 455 |
| 1935 | 3300048927 | Ga0496124_0002138 | Ga0496124_0002138_325_1692 | 455 |
| 1936 | 3300048927 | Ga0496124_0003076 | Ga0496124_0003076_15233_16600 | 455 |
| 1937 | 3300048927 | Ga0496124_0006598 | Ga0496124_0006598_934_2301 | 455 |
| 1938 | 3300048927 | Ga0496124_0200625 | Ga0496124_0200625_65_1435 | 455 |
| 1939 | 3300048928 | Ga0496125_0000240 | Ga0496125_0000240_66513_67883 | 455 |
| 1940 | 3300048928 | Ga0496125_0006298 | Ga0496125_0006298_2965_4332 | 455 |
| 1941 | 3300049459 | Ga0495678_000243 | Ga0495678_000243_25743_27113 | 455 |
| 1942 | 3300049459 | Ga0495678_002086 | Ga0495678_002086_6431_7798 | 455 |
| 1943 | 3300049459 | Ga0495678_004020 | Ga0495678_004020_6120_7490 | 455 |
| 1944 | 3300049459 | Ga0495678_004657 | Ga0495678_004657_5454_6821 | 455 |
| 1945 | 3300049459 | Ga0495678_006521 | Ga0495678_006521_84_1451 | 455 |
| 1946 | 3300049459 | Ga0495678_010033 | Ga0495678_010033_2260_3627 | 455 |
| 1947 | 3300049459 | Ga0495678_010394 | Ga0495678_010394_688_2055 | 455 |
| 1948 | 3300049459 | Ga0495678_038350 | Ga0495678_038350_51_1478 | 455 |
| 1949 | 3300049460 | Ga0495682_0000118 | Ga0495682_0000118_5691_7058 | 455 |
| 1950 | 3300049460 | Ga0495682_0000336 | Ga0495682_0000336_1175_2545 | 455 |
| 1951 | 3300049460 | Ga0495682_0001977 | Ga0495682_0001977_675_2042 | 455 |
| 1952 | 3300049571 | Ga0501034_0000330 | Ga0501034_0000330_44459_45829 | 455 |
| 1953 | 3300049758 | Ga0501241_000456 | Ga0501241_000456_6813_8180 | 455 |
| 1954 | 3300049853 | Ga0501226_000004 | Ga0501226_000004_112515_113882 | 455 |
| 1955 | 3300053111 | Ga0500572_001005 | Ga0500572_001005_690_2057 | 455 |
| 1956 | iso_pu_bacteria | 3007861166 | 3007866323 | 455 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lkq-assembly1.cif.gz_B | protease domain of rada | 0.9454 | 280 | 454 |
| 5h45-assembly1.cif.gz_B | crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms | 0.9358 | 290 | 455 |
| 5lkq-assembly1.cif.gz_B | protease domain of rada | 0.93 | 280 | 454 |
| 5h45-assembly1.cif.gz_B | crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms | 0.9014 | 290 | 455 |
| 8dvh-assembly1.cif.gz_B | crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) | 0.8922 | 289 | 452 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24554_314_459_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9983 | 311 | 455 | 3.30.230.10 |
| af_P24554_64_278_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9881 | 60 | 274 | 3.40.50.300 |
| af_F4K8X8_240_443_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.985 | 80 | 276 | 3.40.50.300 |
| af_P24554_314_459_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9848 | 311 | 455 | 3.30.230.10 |
| af_P24554_64_278_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9836 | 60 | 274 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258B630-F1-model_v4 | DNA repair protein RadA | 0.9977 | 321 | 454 |
GO:0000725
GO:0004176 GO:0004252 GO:0005829 GO:0006508 |
| AF-G5N717-F1-model_v4 | DNA repair protein RadA | 0.9957 | 297 | 454 |
GO:0000725
GO:0005829 |
| AF-W1XIA3-F1-model_v4 | DNA repair protein RadA | 0.9939 | 296 | 404 |
GO:0000725
GO:0005829 |
| AF-A0A5U8SVP6-F1-model_v4 | DNA repair protein RadA | 0.993 | 386 | 454 |
|
| AF-A0A143HYP2-F1-model_v4 | deleted | 0.9912 | 84 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar