F496139

General Info

Members Datasets Scaffolds Average Seq Length
1956 862 1527 450

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000778|Ga0163163_100007787
Length 502
Sequence MRESANLLRNERRLYGSRLNRASNLNGFPPSCRLCAEFQYYYQPTTEALMAKRKTAFVCNECGAEFGKWLGQCTECNAWNSISEFRVPAEPRGSDRNIGYAGTAASEVKLLNEIELSALPRVSTGAEEFDRVLGGGLVPGSAILIGGNPGAGKSTLLLQTLCHLAKTMPALYVTGEESLQQVAMRAQRLQLPTDQLKLLAETDVHQLLDRVQKVAPRVLVVDSIQVLYDADMTSAPGSVAQVRDCAALLTRFAKQTGTVLFLVGHVTKDGSLAGPKVLEHMIDCSIMLEGSSDNRFRTLRGHKNRFGPVNELGVFAMTEQGMREVKNPSAIFLTRGMAPAAGSVVMVVWEGTRPLLVEIQALVDTSQLSNPRRLAVGVDQNRLAMLLAVLHRHGGLQVGDQDVFVNVVGGVKVLETSADLALLISIVSSFRDRVLPQDLVVFGEVGLAGEIRPVPSGQERLQEAAKHGFRRAIVPKGNRPKTAPEGMEVIGVATLAEALEAV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2511231004 Pseudomonas sp. GM102 Isolate Nodule
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231007 Pseudomonas sp. GM18 Isolate Nodule
12 2511231008 Pseudomonas sp. GM21 Isolate Nodule
13 2511231010 Pseudomonas sp. GM25 Isolate Nodule
14 2511231011 Pseudomonas sp. GM30 Isolate Nodule
15 2511231012 Pseudomonas sp. GM33 Isolate Nodule
16 2511231014 Pseudomonas sp. GM48 Isolate Nodule
17 2511231015 Pseudomonas sp. GM49 Isolate Nodule
18 2511231016 Pseudomonas sp. GM50 Isolate Nodule
19 2511231017 Pseudomonas sp. GM55 Isolate Nodule
20 2511231018 Pseudomonas sp. GM60 Isolate Nodule
21 2511231019 Pseudomonas sp. GM67 Isolate Nodule
22 2511231020 Pseudomonas sp. GM74 Isolate Nodule
23 2511231021 Pseudomonas sp. GM78 Isolate Nodule
24 2511231022 Pseudomonas sp. GM79 Isolate Nodule
25 2511231023 Pseudomonas sp. GM80 Isolate Nodule
26 2511231024 Pseudomonas sp. GM84 Isolate Nodule
27 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
28 2511231031 Pseudomonas sp. GM16 Isolate Nodule
29 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
33 2547132181 Kosakonia sacchari SP1 Isolate Stem
34 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
35 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
36 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
37 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
38 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
39 2561511199 Enterobacter sp. R4-368 Isolate Nodule
40 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
41 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
42 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
43 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
44 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
45 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
46 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
47 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
48 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
49 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
50 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
51 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
52 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
53 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
54 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
55 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
56 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
57 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
58 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
59 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
60 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
61 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
62 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
63 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
64 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
65 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
66 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
67 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
68 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
69 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
70 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
71 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
72 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
73 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
74 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
75 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
76 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
77 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
78 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
79 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
80 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
81 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
82 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
83 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
84 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
85 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
86 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
87 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
88 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
89 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
90 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
91 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
92 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
93 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
94 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
95 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
96 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
97 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
98 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
99 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
100 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
101 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
102 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
103 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
104 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
105 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
106 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
107 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
108 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
109 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
110 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
111 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
112 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
113 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
114 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
115 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
116 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
117 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
118 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
119 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
120 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
121 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
122 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
123 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
124 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
125 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
126 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
127 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
128 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
129 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
130 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
131 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
132 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
133 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
134 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
135 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
136 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
137 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
138 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
139 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
140 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
141 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
142 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
143 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
144 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
145 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
146 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
147 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
148 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
149 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
150 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
151 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
152 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
153 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
154 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
155 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
156 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
157 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
158 2636415599 Klebsiella variicola DX120E Isolate Unclassified
159 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
160 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
161 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
162 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
163 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
164 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
165 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
166 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
167 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
168 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
169 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
170 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
171 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
172 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
173 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
174 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
175 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
176 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
177 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
178 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
179 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
180 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
181 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
182 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
183 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
184 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
185 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
186 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
187 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
188 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
189 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
190 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
191 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
192 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
193 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
194 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
195 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
196 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
197 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
198 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
199 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
200 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
201 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
202 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
203 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
204 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
205 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
206 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
207 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
208 2751185917 Enterobacter sp. HK169 Isolate Unclassified
209 2765235841 Pseudomonas putida AA7 Isolate Unclassified
210 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
211 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
212 2773857670 Pseudomonas sp. 478 Isolate Unclassified
213 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
214 2773857673 Pseudomonas sp. 443 Isolate Unclassified
215 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
216 2775507074 Klebsiella sp. D5A Isolate Unclassified
217 2784132063 Pseudomonas sp. 424 Isolate Unclassified
218 2784132072 Pseudomonas sp. 460 Isolate Unclassified
219 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
220 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
221 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
222 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
223 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
224 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
225 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
226 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
227 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
228 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
229 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
230 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
231 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
232 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
233 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
234 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
235 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
236 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
237 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
238 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
239 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
240 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
241 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
242 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
243 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
244 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
245 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
246 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
247 2821118458 Enterobacter asburiae 609 Isolate Unclassified
248 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
249 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
250 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
251 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
252 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
253 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
254 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
255 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
256 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
257 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
258 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
259 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
260 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
261 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
262 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
263 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
264 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
265 2847085930 Erwinia persicina B64 Isolate Bulb
266 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
267 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
268 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
269 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
270 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
271 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
272 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
273 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
274 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
275 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
276 2865014394 Pantoea sp. R-71966 Isolate Unclassified
277 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
278 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
279 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
280 2876601092 Pantoea endophytica 596 Isolate Unclassified
281 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
282 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
283 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
284 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
285 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
286 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
287 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
288 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
289 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
290 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
291 2904504865 Serratia marcescens 1822 Isolate Unclassified
292 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
293 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
294 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
295 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
296 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
297 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
298 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
299 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
300 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
301 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
302 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
303 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
304 2919150387 Rahnella aceris 1817 Isolate Unclassified
305 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
306 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
307 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
308 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
309 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
310 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
311 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
312 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
313 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
314 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
315 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
316 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
317 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
318 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
319 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
320 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
321 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
322 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
323 2927143783 Rahnella sp. 2050 Isolate Unclassified
324 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
325 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
326 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
327 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
328 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
329 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
330 2932406140 Serratia sp. 2723 Isolate Rhizosphere
331 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
332 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
333 2937539931 Pantoea sp. LS15 Isolate Unclassified
334 2937967321 Serratia sp. YC16 Isolate Unclassified
335 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
336 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
337 2939577877 Serratia sp. 509 Isolate Rhizosphere
338 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
339 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
340 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
341 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
342 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
343 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
344 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
345 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
346 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
347 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
348 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
349 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
350 2952252522 Salinicola sp. DM10 Isolate Unclassified
351 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
352 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
353 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
354 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
355 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
356 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
357 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
358 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
359 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
360 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
361 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
362 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
363 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
364 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
365 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
366 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
367 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
368 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
369 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
370 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
371 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
372 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
373 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
374 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
375 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
376 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
377 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
378 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
379 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
380 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
381 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
382 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
383 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
384 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
385 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
386 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
387 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
388 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
389 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
390 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
391 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
392 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
393 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
394 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
395 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
396 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
397 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
398 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
399 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
400 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
401 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
402 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
403 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
404 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
405 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
406 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
407 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
408 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
409 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
410 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
411 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
412 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
413 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
414 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
415 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
416 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
417 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
418 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
419 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
420 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
421 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
422 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
423 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
424 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
425 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
426 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
427 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
428 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
429 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
430 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
431 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
432 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
433 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
434 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
435 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
436 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
437 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
438 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
439 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
440 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
441 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
442 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
443 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
444 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
445 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
446 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
447 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
448 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
449 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
450 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
451 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
452 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
453 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
454 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
455 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
456 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
457 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
458 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
459 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
460 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
461 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
462 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
463 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
464 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
465 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
466 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
467 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
468 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
469 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
470 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
471 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
472 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
473 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
474 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
475 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
476 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
477 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
478 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
479 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
480 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
481 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
482 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
483 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
484 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
485 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
486 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
487 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
488 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
489 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
490 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
491 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
492 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
493 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
494 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
495 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
496 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
497 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
498 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
499 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
500 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
501 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
502 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
503 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
504 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
505 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
506 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
507 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
509 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
510 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
511 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
513 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
514 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
517 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
518 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
519 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
520 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
521 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
522 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
523 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
559 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
560 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
563 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
568 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
569 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
570 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
571 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
572 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
573 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
574 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
578 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
579 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
580 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
581 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
582 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
583 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
584 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
585 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
586 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
587 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
588 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
589 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
590 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
591 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
592 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
593 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
594 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
595 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
596 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
597 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
598 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
599 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
600 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
601 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
602 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
603 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
604 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
605 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
606 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
607 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
608 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
609 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
610 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
611 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
613 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
614 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
615 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
616 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
617 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
618 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
619 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
620 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
621 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
622 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
623 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
624 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
625 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
626 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
627 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
628 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
629 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
630 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
631 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
632 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
633 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
634 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
635 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
636 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
637 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
638 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
639 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
640 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
641 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
642 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
643 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
644 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
645 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
646 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
647 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
648 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
649 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
650 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
651 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
652 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
653 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
654 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
655 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
656 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
657 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
658 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
659 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
660 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
661 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
662 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
663 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
664 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
665 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
666 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
667 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
668 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
669 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
670 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
671 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
672 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
673 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
674 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
675 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
676 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
677 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
678 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
679 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
680 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
681 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
682 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
683 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
684 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
685 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
686 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
687 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
688 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
689 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
690 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
691 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
692 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
693 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
694 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
695 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
696 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
697 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
698 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
699 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
700 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
701 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
702 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
703 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
704 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
705 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
706 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
707 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
708 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
709 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
710 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
711 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
712 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
713 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
714 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
715 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
716 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
717 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
718 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
719 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
720 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
721 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
722 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
723 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
724 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
725 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
726 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
727 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
728 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
729 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
730 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
731 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
732 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
733 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
734 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
735 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
736 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
737 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
738 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
739 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
740 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
741 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
742 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
743 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
744 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
745 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
746 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
747 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
748 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
749 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
750 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
751 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
752 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
753 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
754 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
755 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
756 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
757 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
758 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
759 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
760 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
761 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
762 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
763 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
764 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
765 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
766 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
767 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
768 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
769 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
770 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
771 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
772 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
773 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
774 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
775 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
776 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
777 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
778 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
779 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
780 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
781 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
782 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
783 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
784 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
785 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
786 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
787 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
788 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
789 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
790 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
791 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
792 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
793 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
794 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
795 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
796 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
797 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
798 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
799 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
800 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
801 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
802 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
803 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
804 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
805 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
806 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
807 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
808 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
809 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
810 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
811 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
812 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
813 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
814 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
815 640753048 Serratia proteamaculans 568 Isolate Endosphere
816 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
817 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
818 8004592986 Serratia sp. S119 Isolate Unclassified
819 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
820 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
821 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
822 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
823 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
824 8018221730 Enterobacter sp. CM29 Isolate Unclassified
825 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
826 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
827 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
828 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
829 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
830 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
831 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
832 8052494512 Pseudomonas putida LD6 Isolate Unclassified
833 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
834 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
835 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
836 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
837 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
838 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
839 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
840 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
841 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
842 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
843 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
844 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
845 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
846 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
847 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
848 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
849 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
850 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
851 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
852 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
853 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
854 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
855 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
856 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
857 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
858 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
859 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
860 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
861 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
862 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.02
Metatranscriptomes 0.05
Isolates 21.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0.05
Endosphere 4.81
Nodule 2.4
Rhizoplane 7.11
Rhizosphere 69.99
Stem 0.05
Stem Tuber 0.31
Unclassified 14.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1736 2124908027 Bacteria 9454
2 SwRhRL2b_contig_667648 2162886007 Bacteria 5581
3 JGI24739J22299_10000026 3300001989 Bacteria 42613
4 JGI25162J39368_1000332 3300002737 Bacteria 41272
5 JGI25162J39368_1000502 3300002737 Bacteria 29548
6 JGI25162J39368_1003143 3300002737 Bacteria 5196
7 JGI25163J39215_1000001 3300002771 Bacteria 314282
8 JGI25163J39215_1000713 3300002771 Bacteria 8641
9 JGI25163J39215_1000964 3300002771 Bacteria 6434
10 JGI25164J39214_1000001 3300002772 Bacteria 477015
11 JGI25164J39214_1000244 3300002772 Bacteria 41272
12 JGI25164J39214_1000340 3300002772 Bacteria 29548
13 JGI25152J39213_1000281 3300002773 Bacteria 34001
14 JGI25165J46597_1000391 3300003214 Bacteria 46730
15 JGI25165J46597_1000452 3300003214 Bacteria 41272
16 rootH2_10020955 3300003320 Bacteria 23433
17 rootL2_10024534 3300003322 Bacteria 2627
18 rootH1_10012389 3300003323 Bacteria 43420
19 Ga0055538_1000004 3300003751 Bacteria 615646
20 Ga0055538_1000065 3300003751 Bacteria 100831
21 Ga0055539_1000004 3300003752 Bacteria 615646
22 Ga0055539_1000099 3300003752 Bacteria 100831
23 Ga0055533_1000007 3300003756 Bacteria 615646
24 Ga0055533_1000109 3300003756 Bacteria 100831
25 Ga0055532_1000094 3300003758 Bacteria 100832
26 Ga0055525_1000007 3300003759 Bacteria 615646
27 Ga0055525_1000143 3300003759 Bacteria 100831
28 Ga0055536_1000059 3300003781 Bacteria 103307
29 Ga0055536_1001145 3300003781 Bacteria 16599
30 Ga0055536_1001219 3300003781 Bacteria 15941
31 Ga0055530_10000036 3300003791 Bacteria 117493
32 Ga0055530_10000096 3300003791 Bacteria 73950
33 Ga0055530_10000874 3300003791 Bacteria 24782
34 Ga0055540_1000072 3300003792 Bacteria 117493
35 Ga0055540_1000084 3300003792 Bacteria 107482
36 Ga0055540_1000648 3300003792 Bacteria 24458
37 Ga0055531_10000266 3300003794 Bacteria 54559
38 Ga0055541_1000004 3300003841 Bacteria 615646
39 Ga0055541_1000066 3300003841 Bacteria 100831
40 Ga0058692_1000154 3300003856 Bacteria 43640
41 Ga0058692_1001642 3300003856 Bacteria 8023
42 Ga0058692_1002000 3300003856 Bacteria 7082
43 Ga0058692_1005897 3300003856 Bacteria 3426
44 Ga0058692_1008168 3300003856 Bacteria 2710
45 Ga0058692_1009390 3300003856 Bacteria 2468
46 Ga0065714_10002683 3300005288 Bacteria 21091
47 Ga0065714_10003206 3300005288 Bacteria 13249
48 Ga0065714_10003555 3300005288 Bacteria 12389
49 Ga0065714_10003704 3300005288 Bacteria 6542
50 Ga0065714_10009694 3300005288 Bacteria 2468
51 Ga0065714_10016908 3300005288 Bacteria 2565
52 Ga0065714_10067601 3300005288 Bacteria 5350
53 Ga0065714_10079000 3300005288 Bacteria 2546
54 Ga0065704_10000047 3300005289 Bacteria 72432
55 Ga0065704_10003505 3300005289 Bacteria 4007
56 Ga0065704_10007587 3300005289 Bacteria 4213
57 Ga0065704_10008178 3300005289 Bacteria 3916
58 Ga0065704_10071220 3300005289 Bacteria 12398
59 Ga0065704_10081710 3300005289 Bacteria 3714
60 Ga0065704_10089844 3300005289 Bacteria 2806
61 Ga0065712_10068190 3300005290 Bacteria 13325
62 Ga0065712_10073244 3300005290 Bacteria 4453
63 Ga0065707_10085062 3300005295 Bacteria 6497
64 Ga0070676_10156944 3300005328 Bacteria 1461
65 Ga0070690_100006908 3300005330 Bacteria 6460
66 Ga0070690_100012283 3300005330 Bacteria 5038
67 Ga0070670_100000134 3300005331 Bacteria 69571
68 Ga0070670_100004209 3300005331 Bacteria 12047
69 Ga0070670_100267978 3300005331 Bacteria 1490
70 Ga0070677_10020243 3300005333 Bacteria 2421
71 Ga0070677_10023212 3300005333 Bacteria 2294
72 Ga0068869_100074554 3300005334 Bacteria 2518
73 Ga0068869_100104039 3300005334 Bacteria 2152
74 Ga0070666_10008719 3300005335 Bacteria 6303
75 Ga0070666_10191832 3300005335 Bacteria 1436
76 Ga0070680_100059561 3300005336 Bacteria 3125
77 Ga0070682_100011000 3300005337 Bacteria 5158
78 Ga0070689_100005286 3300005340 Bacteria 8798
79 Ga0070689_100023090 3300005340 Bacteria 4652
80 Ga0070687_100010245 3300005343 Bacteria 4045
81 Ga0070661_100000208 3300005344 Bacteria 48588
82 Ga0070661_100047460 3300005344 Bacteria 3143
83 Ga0070668_100050241 3300005347 Bacteria 3210
84 Ga0070668_100057066 3300005347 Bacteria 3017
85 Ga0070669_100000089 3300005353 Bacteria 88172
86 Ga0070669_100009888 3300005353 Bacteria 6795
87 Ga0070675_100000334 3300005354 Bacteria 31880
88 Ga0070675_100036052 3300005354 Bacteria 4023
89 Ga0070671_100000279 3300005355 Bacteria 34599
90 Ga0070671_100094508 3300005355 Bacteria 2506
91 Ga0070674_100050836 3300005356 Bacteria 2854
92 Ga0070673_100043702 3300005364 Bacteria 3464
93 Ga0070673_100056427 3300005364 Bacteria 3099
94 Ga0070688_100006244 3300005365 Bacteria 6351
95 Ga0070688_100052647 3300005365 Bacteria 2543
96 Ga0070659_100019863 3300005366 Bacteria 5099
97 Ga0070667_100000060 3300005367 Bacteria 145801
98 Ga0070667_100023897 3300005367 Bacteria 5075
99 Ga0070667_100132022 3300005367 Bacteria 2180
100 Ga0070700_100051436 3300005441 Bacteria 2564
101 Ga0070700_100059921 3300005441 Bacteria 2398
102 Ga0070678_100008328 3300005456 Bacteria 6209
103 Ga0070678_100018584 3300005456 Bacteria 4507
104 Ga0070662_100000419 3300005457 Bacteria 25188
105 Ga0070662_100003827 3300005457 Bacteria 9421
106 Ga0070662_100040573 3300005457 Bacteria 3315
107 Ga0070681_10060863 3300005458 Bacteria 3752
108 Ga0068867_100010572 3300005459 Bacteria 6510
109 Ga0068867_100036345 3300005459 Bacteria 3575
110 Ga0068867_100078602 3300005459 Bacteria 2481
111 Ga0070685_10000063 3300005466 Bacteria 62658
112 Ga0070684_100000467 3300005535 Bacteria 27593
113 Ga0070672_100000694 3300005543 Bacteria 19915
114 Ga0070672_100010076 3300005543 Bacteria 6543
115 Ga0070672_100011621 3300005543 Bacteria 6144
116 Ga0070686_100011149 3300005544 Bacteria 5093
117 Ga0070686_100136407 3300005544 Bacteria 1703
118 Ga0070695_100046114 3300005545 Bacteria 2781
119 Ga0070695_100181028 3300005545 Bacteria 1493
120 Ga0070693_100031492 3300005547 Bacteria 2907
121 Ga0070665_100000140 3300005548 Bacteria 135833
122 Ga0070665_100002747 3300005548 Bacteria 19072
123 Ga0070665_100004186 3300005548 Bacteria 15177
124 Ga0070665_100013832 3300005548 Bacteria 8117
125 Ga0070665_100080276 3300005548 Bacteria 3267
126 Ga0070664_100000145 3300005564 Bacteria 48588
127 Ga0070664_100000660 3300005564 Bacteria 26358
128 Ga0070664_100147485 3300005564 Bacteria 2076
129 Ga0068857_100001114 3300005577 Bacteria 20896
130 Ga0068854_100007740 3300005578 Bacteria 6868
131 Ga0068859_100003407 3300005617 Bacteria 16173
132 Ga0068859_100120445 3300005617 Bacteria 2691
133 Ga0068864_100000143 3300005618 Bacteria 69296
134 Ga0068864_100005551 3300005618 Bacteria 10343
135 Ga0068861_100004021 3300005719 Bacteria 9846
136 Ga0068861_100011305 3300005719 Bacteria 6199
137 Ga0068861_100011531 3300005719 Bacteria 6149
138 Ga0068861_100027143 3300005719 Bacteria 4168
139 Ga0068861_100051048 3300005719 Bacteria 3138
140 Ga0068851_10000002 3300005834 Bacteria 302756
141 Ga0068851_10008159 3300005834 Bacteria 4834
142 Ga0068870_10013630 3300005840 Bacteria 3825
143 Ga0068863_100007009 3300005841 Bacteria 11048
144 Ga0068863_100078440 3300005841 Bacteria 3127
145 Ga0068863_100108942 3300005841 Bacteria 2636
146 Ga0068860_100008811 3300005843 Bacteria 10051
147 Ga0068862_100000759 3300005844 Bacteria 32206
148 Ga0068862_100001479 3300005844 Bacteria 21529
149 Ga0068862_100005445 3300005844 Bacteria 10636
150 Ga0068862_100007755 3300005844 Bacteria 8875
151 Ga0068862_100026414 3300005844 Bacteria 4880
152 Ga0075365_10000697 3300006038 Bacteria 13508
153 Ga0075364_10000460 3300006051 Bacteria 20583
154 Ga0075364_10004905 3300006051 Bacteria 7753
155 Ga0075364_10006790 3300006051 Bacteria 6749
156 Ga0075364_10018721 3300006051 Bacteria 4340
157 Ga0075364_10112847 3300006051 Bacteria 1815
158 Ga0075432_10002882 3300006058 Bacteria 5779
159 Ga0075432_10010919 3300006058 Bacteria 3084
160 Ga0075432_10011333 3300006058 Bacteria 3029
161 Ga0075432_10015049 3300006058 Bacteria 2636
162 Ga0075432_10017909 3300006058 Bacteria 2415
163 Ga0068871_100041659 3300006358 Bacteria 3683
164 Ga0068871_100044425 3300006358 Bacteria 3574
165 Ga0075428_100006399 3300006844 Bacteria 13110
166 Ga0075428_100012456 3300006844 Bacteria 9456
167 Ga0075428_100020740 3300006844 Bacteria 7275
168 Ga0075428_100027992 3300006844 Bacteria 6235
169 Ga0075428_100048459 3300006844 Bacteria 4664
170 Ga0075430_100001404 3300006846 Bacteria 19583
171 Ga0075430_100219202 3300006846 Bacteria 1579
172 Ga0075431_100001340 3300006847 Bacteria 22525
173 Ga0075431_100001947 3300006847 Bacteria 19704
174 Ga0075431_100059794 3300006847 Bacteria 3932
175 Ga0075431_100107249 3300006847 Bacteria 2882
176 Ga0075433_10000312 3300006852 Bacteria 29496
177 Ga0075434_100000027 3300006871 Bacteria 66092
178 Ga0075429_100001396 3300006880 Bacteria 19727
179 Ga0075429_100030769 3300006880 Bacteria 4664
180 Ga0075429_100052454 3300006880 Bacteria 3548
181 Ga0068865_100007521 3300006881 Bacteria 6702
182 Ga0097620_100003407 3300006931 Bacteria 16173
183 Ga0097620_100120447 3300006931 Bacteria 2691
184 Ga0099823_1000188 3300006944 Bacteria 34181
185 Ga0079104_1000046 3300006946 Bacteria 183396
186 Ga0079104_1000116 3300006946 Bacteria 114868
187 Ga0079104_1000283 3300006946 Bacteria 65007
188 Ga0079104_1000403 3300006946 Bacteria 49953
189 Ga0079104_1000629 3300006946 Bacteria 34402
190 Ga0079104_1000656 3300006946 Bacteria 33068
191 Ga0079104_1001144 3300006946 Bacteria 19309
192 Ga0079104_1001357 3300006946 Bacteria 16691
193 Ga0079104_1012495 3300006946 Bacteria 2663
194 Ga0079104_1027493 3300006946 Bacteria 1458
195 Ga0099826_10011531 3300006948 Bacteria 6650
196 Ga0099795_10000201 3300007788 Bacteria 10157
197 Ga0105251_10000114 3300009011 Bacteria 80239
198 Ga0105251_10000214 3300009011 Bacteria 58941
199 Ga0105251_10000710 3300009011 Bacteria 30647
200 Ga0105251_10000897 3300009011 Bacteria 26672
201 Ga0105251_10001329 3300009011 Bacteria 21340
202 Ga0105251_10001720 3300009011 Bacteria 18316
203 Ga0105251_10001996 3300009011 Bacteria 16583
204 Ga0105251_10002384 3300009011 Bacteria 14861
205 Ga0105251_10002717 3300009011 Bacteria 13563
206 Ga0105251_10006362 3300009011 Bacteria 7539
207 Ga0105251_10007766 3300009011 Bacteria 6540
208 Ga0105251_10011861 3300009011 Bacteria 4951
209 Ga0105251_10016507 3300009011 Bacteria 3987
210 Ga0105251_10024082 3300009011 Bacteria 3130
211 Ga0105251_10029578 3300009011 Bacteria 2758
212 Ga0105251_10051492 3300009011 Bacteria 1963
213 Ga0105251_10053665 3300009011 Bacteria 1915
214 Ga0105244_10000023 3300009036 Bacteria 233110
215 Ga0105244_10000097 3300009036 Bacteria 91426
216 Ga0105244_10000211 3300009036 Bacteria 60009
217 Ga0105244_10000247 3300009036 Bacteria 55392
218 Ga0105244_10000312 3300009036 Bacteria 47271
219 Ga0105244_10000615 3300009036 Bacteria 31587
220 Ga0105244_10000949 3300009036 Bacteria 24335
221 Ga0105244_10001031 3300009036 Bacteria 23382
222 Ga0105244_10001840 3300009036 Bacteria 16580
223 Ga0105244_10002310 3300009036 Bacteria 14494
224 Ga0105244_10003287 3300009036 Bacteria 11639
225 Ga0105244_10004900 3300009036 Bacteria 9072
226 Ga0105244_10009602 3300009036 Bacteria 5930
227 Ga0105244_10013675 3300009036 Bacteria 4729
228 Ga0105244_10013866 3300009036 Bacteria 4685
229 Ga0105244_10014073 3300009036 Bacteria 4643
230 Ga0105244_10016843 3300009036 Bacteria 4150
231 Ga0105244_10037531 3300009036 Bacteria 2533
232 Ga0105244_10041906 3300009036 Bacteria 2370
233 Ga0105244_10075119 3300009036 Bacteria 1680
234 Ga0105250_10000045 3300009092 Bacteria 127333
235 Ga0105250_10000194 3300009092 Bacteria 51648
236 Ga0105250_10000223 3300009092 Bacteria 47350
237 Ga0105250_10000389 3300009092 Bacteria 32748
238 Ga0105250_10003873 3300009092 Bacteria 7011
239 Ga0105250_10004784 3300009092 Bacteria 6171
240 Ga0105250_10005679 3300009092 Bacteria 5570
241 Ga0105250_10009365 3300009092 Bacteria 4129
242 Ga0105250_10009699 3300009092 Bacteria 4046
243 Ga0105250_10010116 3300009092 Bacteria 3938
244 Ga0105250_10020758 3300009092 Bacteria 2653
245 Ga0105250_10025394 3300009092 Bacteria 2387
246 Ga0105250_10033413 3300009092 Bacteria 2066
247 Ga0105240_10179548 3300009093 Bacteria 2499
248 Ga0111539_10006906 3300009094 Bacteria 14577
249 Ga0111539_10036780 3300009094 Bacteria 5916
250 Ga0111539_10304522 3300009094 Bacteria 1854
251 Ga0105247_10000387 3300009101 Bacteria 37452
252 Ga0114129_10001665 3300009147 Bacteria 30256
253 Ga0114129_10030611 3300009147 Bacteria 7614
254 Ga0114129_10053237 3300009147 Bacteria 5677
255 Ga0105243_10000115 3300009148 Bacteria 92572
256 Ga0105243_10001544 3300009148 Bacteria 20122
257 Ga0105243_10002556 3300009148 Bacteria 15207
258 Ga0105243_10002639 3300009148 Bacteria 14899
259 Ga0105243_10022674 3300009148 Bacteria 4774
260 Ga0105243_10080361 3300009148 Bacteria 2659
261 Ga0105243_10099694 3300009148 Bacteria 2409
262 Ga0105241_10000008 3300009174 Bacteria 334281
263 Ga0105242_10002635 3300009176 Bacteria 14068
264 Ga0105242_10060366 3300009176 Bacteria 3115
265 Ga0105248_10016471 3300009177 Bacteria 8136
266 Ga0105237_10002302 3300009545 Bacteria 23744
267 Ga0105249_10020809 3300009553 Bacteria 5866
268 Ga0099796_10023572 3300010159 Bacteria 1923
269 Ga0105239_10156813 3300010375 Bacteria 2542
270 Ga0105246_10000647 3300011119 Bacteria 19469
271 Ga0105246_10001153 3300011119 Bacteria 15334
272 Ga0105246_10001531 3300011119 Bacteria 13705
273 Ga0105246_10014132 3300011119 Bacteria 5017
274 Ga0157345_1000111 3300012498 Bacteria 15860
275 Ga0157373_10003379 3300013100 Bacteria 12074
276 Ga0157373_10004054 3300013100 Bacteria 11037
277 Ga0157373_10006686 3300013100 Bacteria 8585
278 Ga0157373_10007386 3300013100 Bacteria 8177
279 Ga0157373_10031656 3300013100 Bacteria 3807
280 Ga0157373_10039956 3300013100 Bacteria 3357
281 Ga0157373_10055285 3300013100 Bacteria 2819
282 Ga0157373_10076973 3300013100 Bacteria 2353
283 Ga0157373_10095209 3300013100 Bacteria 2096
284 Ga0157373_10105067 3300013100 Bacteria 1986
285 Ga0157371_10000020 3300013102 Bacteria 304987
286 Ga0157371_10000185 3300013102 Bacteria 91305
287 Ga0157371_10000267 3300013102 Bacteria 71120
288 Ga0157371_10000589 3300013102 Bacteria 43110
289 Ga0157371_10006243 3300013102 Bacteria 9877
290 Ga0157371_10007229 3300013102 Bacteria 9018
291 Ga0157371_10007305 3300013102 Bacteria 8971
292 Ga0157371_10008791 3300013102 Bacteria 8006
293 Ga0157371_10015292 3300013102 Bacteria 5762
294 Ga0157370_10000477 3300013104 Bacteria 50079
295 Ga0157370_10002280 3300013104 Bacteria 23274
296 Ga0157370_10004274 3300013104 Bacteria 16451
297 Ga0157370_10010499 3300013104 Bacteria 9754
298 Ga0157370_10027483 3300013104 Bacteria 5610
299 Ga0157370_10027915 3300013104 Bacteria 5560
300 Ga0157370_10082220 3300013104 Bacteria 3029
301 Ga0157370_10124411 3300013104 Bacteria 2408
302 Ga0157370_10182400 3300013104 Bacteria 1950
303 Ga0157369_10000183 3300013105 Bacteria 86986
304 Ga0157369_10006118 3300013105 Bacteria 13968
305 Ga0157369_10009210 3300013105 Bacteria 11297
306 Ga0157369_10011125 3300013105 Bacteria 10231
307 Ga0157369_10013043 3300013105 Bacteria 9413
308 Ga0157369_10031904 3300013105 Bacteria 5796
309 Ga0157378_10169333 3300013297 Bacteria 2047
310 Ga0163162_10001780 3300013306 Bacteria 20197
311 Ga0163162_10017327 3300013306 Bacteria 7048
312 Ga0157372_10001322 3300013307 Bacteria 26834
313 Ga0157372_10001394 3300013307 Bacteria 26034
314 Ga0157372_10004623 3300013307 Bacteria 14635
315 Ga0157375_10028882 3300013308 Bacteria 5207
316 Ga0157375_10050753 3300013308 Bacteria 4070
317 Ga0157375_10419875 3300013308 Bacteria 1503
318 Ga0163163_10000778 3300014325 Bacteria 27094
319 Ga0163163_10074241 3300014325 Bacteria 3392
320 Ga0163163_10206140 3300014325 Bacteria 2014
321 Ga0157380_10035371 3300014326 Bacteria 3858
322 Ga0182008_10003156 3300014497 Bacteria 10082
323 Ga0182008_10004049 3300014497 Bacteria 8649
324 Ga0182008_10004887 3300014497 Bacteria 7731
325 Ga0182008_10005764 3300014497 Bacteria 7009
326 Ga0182008_10006730 3300014497 Bacteria 6399
327 Ga0182008_10009700 3300014497 Bacteria 5186
328 Ga0182008_10022877 3300014497 Bacteria 3198
329 Ga0182008_10024587 3300014497 Bacteria 3065
330 Ga0157377_10022910 3300014745 Bacteria 3303
331 Ga0182006_1000025 3300015261 Bacteria 255969
332 Ga0182006_1001424 3300015261 Bacteria 14481
333 Ga0182006_1001865 3300015261 Bacteria 12062
334 Ga0182006_1003013 3300015261 Bacteria 8863
335 Ga0182006_1003118 3300015261 Bacteria 8678
336 Ga0182007_10001412 3300015262 Bacteria 12924
337 Ga0182007_10012776 3300015262 Bacteria 3223
338 Ga0182005_1001087 3300015265 Bacteria 11394
339 Ga0182005_1001509 3300015265 Bacteria 9280
340 Ga0182005_1012616 3300015265 Bacteria 2383
341 Ga0183366_1003 3300015679 Bacteria 453474
342 Ga0183370_1003 3300015680 Bacteria 454044
343 Ga0183369_1005 3300015685 Bacteria 453680
344 Ga0183368_1006 3300015687 Bacteria 551576
345 Ga0163161_10000002 3300017792 Bacteria 411983
346 Ga0163161_10005144 3300017792 Bacteria 9096
347 Ga0163161_10019126 3300017792 Bacteria 4802
348 Ga0163161_10021250 3300017792 Bacteria 4562
349 Ga0213874_10001232 3300021377 Bacteria 5268
350 Ga0213876_10000132 3300021384 Bacteria 81285
351 Ga0213875_10000063 3300021388 Bacteria 130631
352 Ga0209435_102069 3300025206 Bacteria 2407
353 Ga0209760_100009 3300025207 Bacteria 207878
354 Ga0209760_100063 3300025207 Bacteria 92173
355 Ga0209760_100157 3300025207 Bacteria 40911
356 Ga0209784_100001 3300025224 Bacteria 3600592
357 Ga0209784_100101 3300025224 Bacteria 100885
358 Ga0209566_100001 3300025225 Bacteria 3600765
359 Ga0209566_100123 3300025225 Bacteria 100885
360 Ga0209674_100002 3300025226 Bacteria 3600592
361 Ga0209674_100145 3300025226 Bacteria 100885
362 Ga0209147_100151 3300025229 Bacteria 100885
363 Ga0209563_100008 3300025230 Bacteria 1554545
364 Ga0209563_100128 3300025230 Bacteria 100885
365 Ga0209563_101750 3300025230 Bacteria 5463
366 Ga0207427_100002 3300025231 Bacteria 1355321
367 Ga0207427_100016 3300025231 Bacteria 538697
368 Ga0207427_100092 3300025231 Bacteria 128454
369 Ga0209437_100011 3300025233 Bacteria 818520
370 Ga0209437_100046 3300025233 Bacteria 405293
371 Ga0209437_100063 3300025233 Bacteria 335477
372 Ga0209437_100065 3300025233 Bacteria 332417
373 Ga0209258_100241 3300025242 Bacteria 100872
374 Ga0209677_100004 3300025253 Bacteria 1554545
375 Ga0209677_100094 3300025253 Bacteria 100885
376 Ga0209759_1005193 3300025256 Bacteria 4634
377 Ga0209129_1000008 3300025258 Bacteria 640959
378 Ga0209233_1000019 3300025261 Bacteria 818520
379 Ga0209233_1000085 3300025261 Bacteria 333078
380 Ga0209233_1003944 3300025261 Bacteria 5145
381 Ga0209676_1000076 3300025292 Bacteria 301393
382 Ga0209676_1000264 3300025292 Bacteria 110593
383 Ga0209676_1000313 3300025292 Bacteria 94925
384 Ga0209676_1000805 3300025292 Bacteria 41142
385 Ga0209676_1001727 3300025292 Bacteria 18738
386 Ga0209676_1017636 3300025292 Bacteria 2520
387 Ga0209050_1000063 3300025298 Bacteria 314955
388 Ga0209050_1000080 3300025298 Bacteria 275154
389 Ga0209050_1000106 3300025298 Bacteria 224396
390 Ga0209050_1001454 3300025298 Bacteria 25396
391 Ga0209051_1000045 3300025303 Bacteria 297882
392 Ga0209051_1000082 3300025303 Bacteria 193133
393 Ga0209051_1000139 3300025303 Bacteria 136281
394 Ga0209257_1000539 3300025304 Bacteria 64964
395 Ga0209257_1012661 3300025304 Bacteria 3865
396 Ga0207656_10000045 3300025321 Bacteria 47492
397 Ga0207696_1000009 3300025711 Bacteria 564405
398 Ga0207696_1000022 3300025711 Bacteria 427529
399 Ga0207696_1000027 3300025711 Bacteria 412783
400 Ga0207696_1000047 3300025711 Bacteria 285005
401 Ga0207696_1000093 3300025711 Bacteria 184278
402 Ga0207696_1000126 3300025711 Bacteria 136197
403 Ga0207696_1000140 3300025711 Bacteria 127393
404 Ga0207696_1000142 3300025711 Bacteria 123519
405 Ga0207696_1000255 3300025711 Bacteria 69740
406 Ga0207696_1000453 3300025711 Bacteria 35831
407 Ga0207696_1001097 3300025711 Bacteria 15865
408 Ga0207696_1002003 3300025711 Bacteria 10320
409 Ga0207696_1002046 3300025711 Bacteria 10184
410 Ga0207696_1002325 3300025711 Bacteria 9426
411 Ga0207696_1002717 3300025711 Bacteria 8463
412 Ga0207696_1003815 3300025711 Bacteria 6708
413 Ga0207696_1006244 3300025711 Bacteria 4825
414 Ga0207655_1000015 3300025728 Bacteria 600662
415 Ga0207655_1000017 3300025728 Bacteria 544403
416 Ga0207655_1000024 3300025728 Bacteria 459774
417 Ga0207655_1000026 3300025728 Bacteria 445528
418 Ga0207655_1000054 3300025728 Bacteria 281894
419 Ga0207655_1000056 3300025728 Bacteria 279166
420 Ga0207655_1000101 3300025728 Bacteria 185883
421 Ga0207655_1000120 3300025728 Bacteria 157018
422 Ga0207655_1000146 3300025728 Bacteria 132221
423 Ga0207655_1000378 3300025728 Bacteria 62082
424 Ga0207655_1000383 3300025728 Bacteria 61839
425 Ga0207655_1000629 3300025728 Bacteria 42354
426 Ga0207655_1001313 3300025728 Bacteria 23498
427 Ga0207655_1001444 3300025728 Bacteria 22008
428 Ga0207655_1003230 3300025728 Bacteria 12243
429 Ga0207655_1003272 3300025728 Bacteria 12157
430 Ga0207655_1003542 3300025728 Bacteria 11564
431 Ga0207655_1005247 3300025728 Bacteria 8894
432 Ga0207655_1007448 3300025728 Bacteria 7098
433 Ga0207655_1007987 3300025728 Bacteria 6786
434 Ga0207655_1007999 3300025728 Bacteria 6780
435 Ga0207655_1008311 3300025728 Bacteria 6602
436 Ga0207655_1008543 3300025728 Bacteria 6481
437 Ga0207655_1008592 3300025728 Bacteria 6461
438 Ga0207655_1008846 3300025728 Bacteria 6329
439 Ga0207655_1009011 3300025728 Bacteria 6251
440 Ga0207655_1014324 3300025728 Bacteria 4489
441 Ga0207655_1014693 3300025728 Bacteria 4405
442 Ga0207655_1029728 3300025728 Bacteria 2552
443 Ga0207713_1000007 3300025735 Bacteria 564979
444 Ga0207713_1000034 3300025735 Bacteria 266214
445 Ga0207713_1000046 3300025735 Bacteria 232796
446 Ga0207713_1000049 3300025735 Bacteria 227882
447 Ga0207713_1000055 3300025735 Bacteria 221387
448 Ga0207713_1000110 3300025735 Bacteria 135907
449 Ga0207713_1000200 3300025735 Bacteria 82983
450 Ga0207713_1000229 3300025735 Bacteria 75343
451 Ga0207713_1000233 3300025735 Bacteria 74522
452 Ga0207713_1000419 3300025735 Bacteria 45136
453 Ga0207713_1000836 3300025735 Bacteria 28375
454 Ga0207713_1001161 3300025735 Bacteria 22265
455 Ga0207713_1001267 3300025735 Bacteria 20840
456 Ga0207713_1001606 3300025735 Bacteria 17647
457 Ga0207713_1002366 3300025735 Bacteria 13792
458 Ga0207713_1003863 3300025735 Bacteria 9994
459 Ga0207713_1004683 3300025735 Bacteria 8820
460 Ga0207713_1006309 3300025735 Bacteria 7243
461 Ga0207713_1007420 3300025735 Bacteria 6473
462 Ga0207713_1008121 3300025735 Bacteria 6086
463 Ga0207713_1010825 3300025735 Bacteria 5015
464 Ga0207713_1014889 3300025735 Bacteria 4014
465 Ga0207713_1020562 3300025735 Bacteria 3193
466 Ga0207713_1060961 3300025735 Bacteria 1438
467 Ga0207682_10003524 3300025893 Bacteria 6778
468 Ga0207682_10013434 3300025893 Bacteria 3190
469 Ga0207710_10000015 3300025900 Bacteria 393018
470 Ga0207710_10043778 3300025900 Bacteria 1992
471 Ga0207645_10000348 3300025907 Bacteria 38649
472 Ga0207643_10003398 3300025908 Bacteria 8581
473 Ga0207654_10000009 3300025911 Bacteria 334291
474 Ga0207671_10000613 3300025914 Bacteria 47054
475 Ga0207693_10029146 3300025915 Bacteria 4362
476 Ga0207660_10006542 3300025917 Bacteria 7559
477 Ga0207660_10020250 3300025917 Bacteria 4461
478 Ga0207662_10000587 3300025918 Bacteria 16215
479 Ga0207649_10000023 3300025920 Bacteria 188467
480 Ga0207681_10000134 3300025923 Bacteria 60646
481 Ga0207681_10007277 3300025923 Bacteria 6784
482 Ga0207681_10102082 3300025923 Bacteria 2070
483 Ga0207681_10144340 3300025923 Bacteria 1776
484 Ga0207650_10000013 3300025925 Bacteria 409471
485 Ga0207650_10000100 3300025925 Bacteria 112181
486 Ga0207650_10000153 3300025925 Bacteria 82970
487 Ga0207659_10019038 3300025926 Bacteria 4510
488 Ga0207659_10072315 3300025926 Bacteria 2520
489 Ga0207664_10013185 3300025929 Bacteria 5922
490 Ga0207644_10000282 3300025931 Bacteria 33804
491 Ga0207690_10020833 3300025932 Bacteria 4058
492 Ga0207706_10000056 3300025933 Bacteria 113022
493 Ga0207706_10002539 3300025933 Bacteria 17789
494 Ga0207706_10003016 3300025933 Bacteria 16232
495 Ga0207706_10020376 3300025933 Bacteria 5961
496 Ga0207706_10071449 3300025933 Bacteria 3052
497 Ga0207686_10001071 3300025934 Bacteria 16087
498 Ga0207709_10000030 3300025935 Bacteria 331710
499 Ga0207709_10000127 3300025935 Bacteria 112650
500 Ga0207709_10002430 3300025935 Bacteria 11708
501 Ga0207709_10019461 3300025935 Bacteria 3818
502 Ga0207709_10085647 3300025935 Bacteria 2043
503 Ga0207670_10029178 3300025936 Bacteria 3511
504 Ga0207669_10017376 3300025937 Bacteria 3687
505 Ga0207669_10041781 3300025937 Bacteria 2672
506 Ga0207704_10021280 3300025938 Bacteria 3451
507 Ga0207704_10023807 3300025938 Bacteria 3307
508 Ga0207665_10074271 3300025939 Bacteria 2327
509 Ga0207691_10011300 3300025940 Bacteria 8567
510 Ga0207691_10012956 3300025940 Bacteria 7985
511 Ga0207691_10041982 3300025940 Bacteria 4219
512 Ga0207691_10078998 3300025940 Bacteria 2961
513 Ga0207691_10083144 3300025940 Bacteria 2874
514 Ga0207691_10140007 3300025940 Bacteria 2133
515 Ga0207711_10002362 3300025941 Bacteria 16903
516 Ga0207711_10148097 3300025941 Bacteria 2116
517 Ga0207689_10055918 3300025942 Bacteria 3247
518 Ga0207689_10069125 3300025942 Bacteria 2902
519 Ga0207689_10072704 3300025942 Bacteria 2825
520 Ga0207679_10000017 3300025945 Bacteria 253004
521 Ga0207651_10008259 3300025960 Bacteria 5612
522 Ga0207651_10084876 3300025960 Bacteria 2295
523 Ga0207668_10028388 3300025972 Bacteria 3658
524 Ga0207668_10046286 3300025972 Bacteria 2971
525 Ga0207640_10178991 3300025981 Bacteria 1588
526 Ga0207658_10000005 3300025986 Bacteria 408341
527 Ga0207658_10139956 3300025986 Bacteria 1957
528 Ga0207703_10003380 3300026035 Bacteria 13405
529 Ga0207639_10005168 3300026041 Bacteria 8804
530 Ga0207708_10009579 3300026075 Bacteria 7182
531 Ga0207708_10010217 3300026075 Bacteria 6969
532 Ga0207641_10033914 3300026088 Bacteria 4244
533 Ga0207641_10126974 3300026088 Bacteria 2284
534 Ga0207641_10189471 3300026088 Bacteria 1889
535 Ga0207648_10005345 3300026089 Bacteria 12946
536 Ga0207648_10014086 3300026089 Bacteria 7398
537 Ga0207648_10042556 3300026089 Bacteria 3986
538 Ga0207676_10000010 3300026095 Bacteria 519402
539 Ga0207676_10004754 3300026095 Bacteria 9633
540 Ga0207676_10076214 3300026095 Bacteria 2709
541 Ga0207674_10002994 3300026116 Bacteria 20952
542 Ga0207674_10008222 3300026116 Bacteria 12089
543 Ga0207674_10030134 3300026116 Bacteria 5708
544 Ga0207674_10083479 3300026116 Bacteria 3194
545 Ga0207675_100001821 3300026118 Bacteria 21367
546 Ga0207675_100002107 3300026118 Bacteria 19713
547 Ga0207675_100004064 3300026118 Bacteria 14163
548 Ga0207675_100072804 3300026118 Bacteria 3214
549 Ga0207675_100172203 3300026118 Bacteria 2069
550 Ga0207683_10012335 3300026121 Bacteria 7293
551 Ga0207683_10033133 3300026121 Bacteria 4487
552 Ga0207683_10048422 3300026121 Bacteria 3722
553 Ga0207683_10146037 3300026121 Bacteria 2133
554 Ga0209281_1000022 3300027111 Bacteria 522913
555 Ga0209281_1000054 3300027111 Bacteria 309505
556 Ga0209281_1000060 3300027111 Bacteria 295683
557 Ga0209281_1000070 3300027111 Bacteria 277098
558 Ga0209281_1000120 3300027111 Bacteria 206692
559 Ga0209281_1000127 3300027111 Bacteria 200036
560 Ga0209281_1000145 3300027111 Bacteria 170793
561 Ga0209281_1000223 3300027111 Bacteria 121161
562 Ga0209281_1000384 3300027111 Bacteria 70059
563 Ga0209281_1000489 3300027111 Bacteria 54514
564 Ga0209281_1000854 3300027111 Bacteria 26809
565 Ga0209281_1001296 3300027111 Bacteria 16009
566 Ga0209281_1001588 3300027111 Bacteria 12323
567 Ga0209389_1000002 3300027296 Bacteria 333932
568 Ga0209371_1000014 3300027312 Bacteria 661118
569 Ga0209371_1000030 3300027312 Bacteria 423605
570 Ga0209371_1000053 3300027312 Bacteria 264616
571 Ga0209371_1000054 3300027312 Bacteria 259676
572 Ga0209371_1000111 3300027312 Bacteria 140093
573 Ga0209371_1000123 3300027312 Bacteria 131854
574 Ga0209371_1000127 3300027312 Bacteria 127069
575 Ga0209371_1000241 3300027312 Bacteria 68278
576 Ga0209371_1000246 3300027312 Bacteria 67449
577 Ga0209371_1000438 3300027312 Bacteria 42301
578 Ga0209371_1001222 3300027312 Bacteria 18480
579 Ga0209371_1001384 3300027312 Bacteria 16656
580 Ga0209371_1001635 3300027312 Bacteria 14443
581 Ga0209371_1001784 3300027312 Bacteria 13481
582 Ga0209371_1010019 3300027312 Bacteria 2958
583 Ga0209371_1017337 3300027312 Bacteria 1868
584 Ga0209983_1000100 3300027665 Bacteria 14518
585 Ga0209971_1001260 3300027682 Bacteria 6319
586 Ga0209998_10001506 3300027717 Bacteria 5602
587 Ga0207428_10003747 3300027907 Bacteria 14590
588 Ga0207428_10008488 3300027907 Bacteria 9278
589 Ga0207428_10022639 3300027907 Bacteria 5300
590 Ga0207428_10037467 3300027907 Bacteria 3945
591 Ga0207428_10091240 3300027907 Bacteria 2365
592 Ga0268266_10000143 3300028379 Bacteria 135829
593 Ga0268266_10005042 3300028379 Bacteria 12465
594 Ga0268266_10006807 3300028379 Bacteria 10413
595 Ga0268266_10043875 3300028379 Bacteria 3822
596 Ga0268266_10071137 3300028379 Bacteria 3015
597 Ga0268265_10000613 3300028380 Bacteria 35613
598 Ga0268265_10002577 3300028380 Bacteria 13530
599 Ga0268264_10000016 3300028381 Bacteria 502537
600 Ga0265334_10000010 3300028573 Bacteria 188179
601 Ga0307517_10068597 3300028786 Bacteria 3227
602 Ga0265338_10034880 3300028800 Bacteria 4850
603 Ga0268256_1000012 3300030500 Bacteria 794553
604 Ga0268256_1000021 3300030500 Bacteria 542735
605 Ga0268256_1000025 3300030500 Bacteria 484317
606 Ga0268256_1000053 3300030500 Bacteria 264616
607 Ga0268256_1000095 3300030500 Bacteria 139698
608 Ga0268256_1000104 3300030500 Bacteria 127069
609 Ga0268256_1000200 3300030500 Bacteria 68278
610 Ga0268256_1000225 3300030500 Bacteria 61749
611 Ga0268256_1001189 3300030500 Bacteria 16656
612 Ga0268256_1001819 3300030500 Bacteria 11992
613 Ga0268256_1002159 3300030500 Bacteria 10445
614 Ga0268256_1002901 3300030500 Bacteria 8225
615 Ga0268256_1002999 3300030500 Bacteria 7974
616 Ga0268256_1005681 3300030500 Bacteria 4823
617 Ga0268256_1007797 3300030500 Bacteria 3760
618 Ga0307511_10077707 3300030521 Bacteria 2361
619 Ga0314311_1116887 3300030733 Bacteria 1988
620 Ga0316178_1150033 3300030735 Bacteria 4482
621 Ga0316183_1017054 3300030742 Bacteria 2584
622 Ga0265331_10014725 3300031250 Bacteria 4153
623 Ga0265331_10019997 3300031250 Bacteria 3446
624 Ga0265327_10000002 3300031251 Bacteria 856593
625 Ga0265327_10000044 3300031251 Bacteria 284808
626 Ga0265327_10001253 3300031251 Bacteria 33702
627 Ga0265327_10002604 3300031251 Bacteria 18671
628 Ga0265327_10058219 3300031251 Bacteria 1984
629 Ga0265316_10000678 3300031344 Bacteria 37854
630 Ga0307513_10013189 3300031456 Bacteria 10152
631 Ga0307513_10014340 3300031456 Bacteria 9679
632 Ga0307513_10059559 3300031456 Bacteria 4053
633 Ga0307513_10128850 3300031456 Bacteria 2480
634 Ga0307513_10137244 3300031456 Bacteria 2378
635 Ga0307509_10024054 3300031507 Bacteria 6828
636 Ga0307408_100000020 3300031548 Bacteria 340408
637 Ga0307408_100000091 3300031548 Bacteria 99968
638 Ga0307408_100000216 3300031548 Bacteria 61491
639 Ga0307408_100008354 3300031548 Bacteria 6835
640 Ga0307408_100016726 3300031548 Bacteria 4901
641 Ga0307408_100019847 3300031548 Bacteria 4527
642 Ga0307408_100041888 3300031548 Bacteria 3248
643 Ga0307408_100053815 3300031548 Bacteria 2908
644 Ga0307408_100069774 3300031548 Bacteria 2592
645 Ga0265313_10000068 3300031595 Bacteria 100563
646 Ga0265313_10010933 3300031595 Bacteria 5688
647 Ga0316575_10000890 3300031665 Bacteria 9175
648 Ga0316575_10002831 3300031665 Bacteria 5883
649 Ga0316575_10057811 3300031665 Bacteria 1546
650 Ga0316579_10033235 3300031691 Bacteria 2367
651 Ga0316579_10062073 3300031691 Bacteria 1760
652 Ga0316576_10000212 3300031727 Bacteria 24453
653 Ga0316576_10000354 3300031727 Bacteria 20585
654 Ga0316576_10002258 3300031727 Bacteria 10915
655 Ga0316576_10023926 3300031727 Bacteria 4261
656 Ga0316576_10054196 3300031727 Bacteria 2924
657 Ga0316576_10063714 3300031727 Bacteria 2706
658 Ga0316576_10065716 3300031727 Bacteria 2666
659 Ga0316576_10109184 3300031727 Bacteria 2073
660 Ga0316576_10165725 3300031727 Bacteria 1667
661 Ga0316576_10186980 3300031727 Bacteria 1562
662 Ga0316578_10001858 3300031728 Bacteria 8884
663 Ga0316578_10002495 3300031728 Bacteria 8107
664 Ga0316578_10011385 3300031728 Bacteria 4651
665 Ga0316578_10011851 3300031728 Bacteria 4578
666 Ga0316578_10017136 3300031728 Bacteria 3938
667 Ga0316578_10027858 3300031728 Bacteria 3196
668 Ga0316578_10097559 3300031728 Bacteria 1760
669 Ga0307516_10000171 3300031730 Bacteria 82839
670 Ga0307405_10000292 3300031731 Bacteria 18517
671 Ga0307405_10007687 3300031731 Bacteria 5415
672 Ga0307405_10017959 3300031731 Bacteria 3893
673 Ga0316577_10022083 3300031733 Bacteria 3533
674 Ga0316577_10045816 3300031733 Bacteria 2443
675 Ga0307413_10003575 3300031824 Bacteria 6577
676 Ga0307406_10075232 3300031901 Bacteria 2227
677 Ga0307406_10120842 3300031901 Bacteria 1821
678 Ga0307407_10010041 3300031903 Bacteria 4444
679 Ga0307407_10036565 3300031903 Bacteria 2706
680 Ga0307412_10001542 3300031911 Bacteria 12735
681 Ga0307412_10002214 3300031911 Bacteria 10787
682 Ga0307412_10002890 3300031911 Bacteria 9521
683 Ga0307409_100010789 3300031995 Bacteria 5711
684 Ga0307409_100139812 3300031995 Bacteria 2084
685 Ga0307416_100005907 3300032002 Bacteria 7598
686 Ga0307414_10032163 3300032004 Bacteria 3451
687 Ga0307414_10142369 3300032004 Bacteria 1879
688 Ga0307411_10003528 3300032005 Bacteria 7278
689 Ga0307411_10016120 3300032005 Bacteria 4223
690 Ga0307411_10054322 3300032005 Bacteria 2629
691 Ga0307415_100013159 3300032126 Bacteria 4819
692 Ga0307415_100040227 3300032126 Bacteria 3095
693 Ga0316583_10004776 3300032133 Bacteria 4841
694 Ga0316583_10024695 3300032133 Bacteria 2146
695 Ga0316583_10038853 3300032133 Bacteria 1686
696 Ga0316585_10000461 3300032137 Bacteria 9538
697 Ga0316585_10020355 3300032137 Bacteria 2030
698 Ga0316580_10000964 3300032139 Bacteria 7166
699 Ga0316580_10001667 3300032139 Bacteria 5904
700 Ga0316593_10010248 3300032168 Bacteria 2681
701 Ga0307510_10011495 3300033180 Bacteria 10518
702 Ga0307510_10072032 3300033180 Bacteria 3436
703 Ga0373923_0034671 3300035111 Bacteria 2050
704 Ga0316574_0000008 3300035398 Bacteria 48126
705 Ga0316574_0002035 3300035398 Bacteria 9971
706 Ga0316574_0002733 3300035398 Bacteria 8940
707 Ga0316574_0002892 3300035398 Bacteria 8730
708 Ga0316574_0030478 3300035398 Bacteria 3267
709 Ga0373924_0019116 3300035410 Bacteria 2651
710 Ga0373931_0033413 3300035691 Bacteria 2666
711 Ga0373927_0000002 3300035695 Bacteria 966219
712 Ga0316582_0002628 3300036647 Bacteria 8508
713 Ga0316582_0027128 3300036647 Bacteria 3456
714 Ga0316582_0054182 3300036647 Bacteria 2552
715 Ga0316582_0073521 3300036647 Bacteria 2218
716 Ga0316584_0003578 3300036712 Bacteria 10149
717 Ga0316584_0007566 3300036712 Bacteria 7442
718 Ga0316584_0039754 3300036712 Bacteria 3502
719 Ga0316584_0057190 3300036712 Bacteria 2919
720 Ga0316584_0123479 3300036712 Bacteria 1934
721 Ga0316584_0124694 3300036712 Bacteria 1924
722 Ga0373925_0108113 3300037068 Bacteria 2146
723 Ga0316581_0001438 3300037588 Bacteria 5354
724 Ga0316581_0007444 3300037588 Bacteria 2938
725 Ga0436364_0036482 3300037853 Bacteria 193771
726 Ga0436364_0939013 3300037853 Bacteria 3839
727 Ga0400483_028483 3300039062 Bacteria 154566
728 Ga0400483_066663 3300039062 Bacteria 16018
729 Ga0400483_085989 3300039062 Bacteria 9005
730 Ga0400483_196526 3300039062 Bacteria 30829
731 Ga0400483_232168 3300039062 Bacteria 10074
732 Ga0400483_246213 3300039062 Bacteria 42716
733 Ga0436365_0084998 3300039437 Bacteria 507888
734 Ga0436365_1036887 3300039437 Bacteria 3414
735 Ga0436363_0467135 3300039450 Bacteria 9763
736 Ga0439436_0024069 3300041404 Bacteria 1798
737 Ga0439438_000003 3300041405 Bacteria 464587
738 Ga0439438_000530 3300041405 Bacteria 17352
739 Ga0439438_001413 3300041405 Bacteria 10590
740 Ga0439438_001885 3300041405 Bacteria 9179
741 Ga0439438_002408 3300041405 Bacteria 7972
742 Ga0439438_002819 3300041405 Bacteria 7257
743 Ga0439438_004575 3300041405 Bacteria 5262
744 Ga0439438_011200 3300041405 Bacteria 2802
745 Ga0439438_011384 3300041405 Bacteria 2773
746 Ga0439438_013745 3300041405 Bacteria 2431
747 Ga0439447_000242 3300041407 Bacteria 19191
748 Ga0439447_000963 3300041407 Bacteria 10486
749 Ga0439447_001174 3300041407 Bacteria 9539
750 Ga0439447_012776 3300041407 Bacteria 2401
751 Ga0439453_0002138 3300041408 Bacteria 2678
752 Ga0439466_0000002 3300041411 Bacteria 494198
753 Ga0439466_0000779 3300041411 Bacteria 12084
754 Ga0439466_0001260 3300041411 Bacteria 9845
755 Ga0439466_0002857 3300041411 Bacteria 6755
756 Ga0439466_0004859 3300041411 Bacteria 5165
757 Ga0439466_0006077 3300041411 Bacteria 4597
758 Ga0439466_0015831 3300041411 Bacteria 2735
759 Ga0439466_0017299 3300041411 Bacteria 2598
760 Ga0439466_0049030 3300041411 Bacteria 1388
761 Ga0439465_0001154 3300041413 Bacteria 8481
762 Ga0451802_0783281 3300041460 Bacteria 2223
763 Ga0451802_1689586 3300041460 Bacteria 3250
764 Ga0451833_1230775 3300041491 Bacteria 2090
765 Ga0451837_1364909 3300041494 Bacteria 2355
766 Ga0439448_0041561 3300042005 Bacteria 1488
767 Ga0439432_000632 3300042006 Bacteria 13211
768 Ga0439432_001436 3300042006 Bacteria 8954
769 Ga0439432_003043 3300042006 Bacteria 6243
770 Ga0439432_003594 3300042006 Bacteria 5741
771 Ga0439432_008727 3300042006 Bacteria 3550
772 Ga0439432_009742 3300042006 Bacteria 3342
773 Ga0439432_014683 3300042006 Bacteria 2649
774 Ga0439451_000947 3300042009 Bacteria 5598
775 Ga0439451_001448 3300042009 Bacteria 4690
776 Ga0439451_002411 3300042009 Bacteria 3789
777 Ga0439451_010777 3300042009 Bacteria 1842
778 Ga0439452_000004 3300042010 Bacteria 764268
779 Ga0439452_000005 3300042010 Bacteria 646919
780 Ga0439452_000007 3300042010 Bacteria 613625
781 Ga0439452_000041 3300042010 Bacteria 142405
782 Ga0439452_000085 3300042010 Bacteria 79496
783 Ga0439452_000149 3300042010 Bacteria 51740
784 Ga0439452_000306 3300042010 Bacteria 31584
785 Ga0439452_000497 3300042010 Bacteria 21515
786 Ga0439452_000581 3300042010 Bacteria 18965
787 Ga0439452_001680 3300042010 Bacteria 8695
788 Ga0439452_006146 3300042010 Bacteria 3788
789 Ga0439456_000013 3300042013 Bacteria 72544
790 Ga0439456_000723 3300042013 Bacteria 6781
791 Ga0439456_004033 3300042013 Bacteria 2980
792 Ga0439456_006156 3300042013 Bacteria 2443
793 Ga0439463_006772 3300042016 Bacteria 2835
794 Ga0450911_000006 3300042115 Bacteria 222143
795 Ga0450911_000521 3300042115 Bacteria 12132
796 Ga0450911_001091 3300042115 Bacteria 6821
797 Ga0450919_000041 3300042121 Bacteria 10737
798 Ga0450920_001489 3300042122 Bacteria 3879
799 Ga0450922_000267 3300042124 Bacteria 5539
800 Ga0450923_002475 3300042125 Bacteria 2657
801 Ga0450891_001666 3300042129 Bacteria 2288
802 Ga0450902_002640 3300042137 Bacteria 2549
803 Ga0450903_002709 3300042138 Bacteria 3120
804 Ga0450904_000693 3300042139 Bacteria 5973
805 Ga0450906_001060 3300042145 Bacteria 6063
806 Ga0450907_000025 3300042146 Bacteria 72853
807 Ga0450907_000244 3300042146 Bacteria 18765
808 Ga0450907_000937 3300042146 Bacteria 6933
809 Ga0450907_006059 3300042146 Bacteria 2027
810 Ga0439446_0000257 3300042156 Bacteria 9897
811 Ga0439446_0001080 3300042156 Bacteria 6015
812 Ga0439446_0009320 3300042156 Bacteria 2626
813 Ga0450908_005394 3300042184 Bacteria 2453
814 Ga0439435_0000641 3300042436 Bacteria 5746
815 Ga0439459_0007172 3300042438 Bacteria 1876
816 Ga0439464_0000526 3300042439 Bacteria 7895
817 Ga0439464_0006608 3300042439 Bacteria 3026
818 Ga0439464_0011656 3300042439 Bacteria 2330
819 Ga0439460_0000989 3300042461 Bacteria 6546
820 Ga0439460_0006429 3300042461 Bacteria 2913
821 Ga0439460_0011233 3300042461 Bacteria 2307
822 Ga0450918_007379 3300042531 Bacteria 1946
823 Ga0450893_0000317 3300042532 Bacteria 6718
824 Ga0450893_0001268 3300042532 Bacteria 3815
825 Ga0451577_0001360 3300042876 Bacteria 32926
826 Ga0451577_0016457 3300042876 Bacteria 6850
827 Ga0451577_0200600 3300042876 Bacteria 1801
828 Ga0439440_0003329 3300042993 Bacteria 3091
829 Ga0466981_0000014 3300044669 Bacteria 109658
830 Ga0453683_0004190 3300044673 Bacteria 10315
831 Ga0453683_0005511 3300044673 Bacteria 8832
832 Ga0453683_0014870 3300044673 Bacteria 5052
833 Ga0453684_0000231 3300044712 Bacteria 241070
834 Ga0453684_0001356 3300044712 Bacteria 71474
835 Ga0453684_0003877 3300044712 Bacteria 32926
836 Ga0453684_0020833 3300044712 Bacteria 9849
837 Ga0453684_0047336 3300044712 Bacteria 5704
838 Ga0453684_0122219 3300044712 Bacteria 3141
839 Ga0453684_0162105 3300044712 Bacteria 2644
840 Ga0451576_0025049 3300045051 Bacteria 6434
841 Ga0451576_0172631 3300045051 Bacteria 2257
842 Ga0451576_0366787 3300045051 Bacteria 1508
843 Ga0495617_000479 3300046452 Bacteria 21276
844 Ga0495617_001534 3300046452 Bacteria 10022
845 Ga0495617_046660 3300046452 Bacteria 1443
846 Ga0495627_000042 3300046453 Bacteria 189845
847 Ga0495627_000104 3300046453 Bacteria 104176
848 Ga0495627_000221 3300046453 Bacteria 61299
849 Ga0495627_003091 3300046453 Bacteria 7555
850 Ga0495627_004493 3300046453 Bacteria 5830
851 Ga0495627_006719 3300046453 Bacteria 4477
852 Ga0495627_006739 3300046453 Bacteria 4470
853 Ga0495603_0003012 3300046455 Bacteria 9980
854 Ga0495590_0001439 3300046457 Bacteria 10271
855 Ga0495590_0002041 3300046457 Bacteria 8473
856 Ga0495590_0005058 3300046457 Bacteria 5258
857 Ga0495590_0008961 3300046457 Bacteria 3802
858 Ga0495590_0013050 3300046457 Bacteria 3063
859 Ga0495591_000087 3300046458 Bacteria 104654
860 Ga0495591_000124 3300046458 Bacteria 84206
861 Ga0495591_000165 3300046458 Bacteria 70496
862 Ga0495591_000167 3300046458 Bacteria 70044
863 Ga0495591_000231 3300046458 Bacteria 54648
864 Ga0495591_001414 3300046458 Bacteria 14966
865 Ga0495591_001515 3300046458 Bacteria 14301
866 Ga0495591_002013 3300046458 Bacteria 11827
867 Ga0495591_003333 3300046458 Bacteria 8359
868 Ga0495591_009099 3300046458 Bacteria 3981
869 Ga0495591_010920 3300046458 Bacteria 3474
870 Ga0495591_011840 3300046458 Bacteria 3278
871 Ga0495591_023217 3300046458 Bacteria 1992
872 Ga0495591_025548 3300046458 Bacteria 1850
873 Ga0495591_037934 3300046458 Bacteria 1391
874 Ga0495629_0009493 3300046459 Bacteria 7113
875 Ga0495638_0006800 3300046460 Bacteria 8259
876 Ga0495638_0007763 3300046460 Bacteria 7659
877 Ga0495638_0007985 3300046460 Bacteria 7545
878 Ga0495638_0008999 3300046460 Bacteria 7038
879 Ga0495638_0010092 3300046460 Bacteria 6582
880 Ga0495638_0010448 3300046460 Bacteria 6443
881 Ga0495638_0016034 3300046460 Bacteria 5022
882 Ga0495638_0027275 3300046460 Bacteria 3698
883 Ga0495638_0065307 3300046460 Bacteria 2240
884 Ga0495641_0054034 3300046461 Bacteria 1826
885 Ga0495653_0000332 3300046463 Bacteria 38593
886 Ga0495653_0048055 3300046463 Bacteria 3296
887 Ga0495653_0056873 3300046463 Bacteria 2980
888 Ga0495653_0060706 3300046463 Bacteria 2863
889 Ga0495650_0000004 3300046471 Bacteria 779487
890 Ga0495650_0000028 3300046471 Bacteria 473012
891 Ga0495650_0000113 3300046471 Bacteria 196536
892 Ga0495650_0002361 3300046471 Bacteria 15508
893 Ga0495650_0004045 3300046471 Bacteria 10273
894 Ga0495650_0005255 3300046471 Bacteria 8481
895 Ga0495650_0006583 3300046471 Bacteria 7219
896 Ga0495650_0007026 3300046471 Bacteria 6858
897 Ga0495650_0011231 3300046471 Bacteria 4923
898 Ga0495582_0039235 3300046473 Bacteria 2607
899 Ga0495605_0000033 3300046474 Bacteria 209203
900 Ga0495605_0000140 3300046474 Bacteria 93059
901 Ga0495605_0000167 3300046474 Bacteria 83036
902 Ga0495605_0001345 3300046474 Bacteria 16276
903 Ga0495605_0006673 3300046474 Bacteria 6608
904 Ga0495605_0010585 3300046474 Bacteria 5158
905 Ga0495605_0011091 3300046474 Bacteria 5033
906 Ga0495605_0027836 3300046474 Bacteria 2923
907 Ga0495605_0028766 3300046474 Bacteria 2866
908 Ga0495639_0000732 3300046475 Bacteria 15017
909 Ga0495584_0001949 3300046491 Bacteria 11875
910 Ga0495584_0003603 3300046491 Bacteria 8448
911 Ga0495584_0003616 3300046491 Bacteria 8431
912 Ga0495584_0004904 3300046491 Bacteria 7142
913 Ga0495584_0008253 3300046491 Bacteria 5397
914 Ga0495584_0010064 3300046491 Bacteria 4855
915 Ga0495585_0000937 3300046492 Bacteria 24621
916 Ga0495585_0004782 3300046492 Bacteria 8713
917 Ga0495585_0005409 3300046492 Bacteria 8053
918 Ga0495585_0010129 3300046492 Bacteria 5631
919 Ga0495596_0001631 3300046500 Bacteria 12744
920 Ga0495596_0012106 3300046500 Bacteria 3703
921 Ga0495607_0000340 3300046501 Bacteria 48340
922 Ga0495607_0000703 3300046501 Bacteria 32246
923 Ga0495607_0001371 3300046501 Bacteria 21663
924 Ga0495607_0001606 3300046501 Bacteria 19634
925 Ga0495607_0001890 3300046501 Bacteria 17769
926 Ga0495607_0002265 3300046501 Bacteria 15867
927 Ga0495607_0002471 3300046501 Bacteria 15006
928 Ga0495607_0003408 3300046501 Bacteria 12183
929 Ga0495607_0005373 3300046501 Bacteria 9194
930 Ga0495607_0006396 3300046501 Bacteria 8295
931 Ga0495607_0008982 3300046501 Bacteria 6800
932 Ga0495607_0009021 3300046501 Bacteria 6780
933 Ga0495607_0014641 3300046501 Bacteria 5099
934 Ga0495607_0062998 3300046501 Bacteria 2099
935 Ga0495607_0063840 3300046501 Bacteria 2081
936 Ga0495583_0000031 3300046506 Bacteria 253982
937 Ga0495583_0002043 3300046506 Bacteria 18367
938 Ga0495583_0002145 3300046506 Bacteria 17616
939 Ga0495583_0002689 3300046506 Bacteria 14779
940 Ga0495583_0004670 3300046506 Bacteria 9658
941 Ga0495583_0005160 3300046506 Bacteria 8992
942 Ga0495583_0006720 3300046506 Bacteria 7447
943 Ga0495583_0020275 3300046506 Bacteria 3449
944 Ga0495606_0000217 3300046507 Bacteria 101671
945 Ga0495606_0000313 3300046507 Bacteria 83765
946 Ga0495606_0000364 3300046507 Bacteria 77490
947 Ga0495606_0004876 3300046507 Bacteria 13148
948 Ga0495606_0007491 3300046507 Bacteria 9749
949 Ga0495606_0008233 3300046507 Bacteria 9107
950 Ga0495606_0008338 3300046507 Bacteria 9027
951 Ga0495606_0009331 3300046507 Bacteria 8316
952 Ga0495606_0014787 3300046507 Bacteria 6062
953 Ga0495606_0024715 3300046507 Bacteria 4322
954 Ga0495606_0082560 3300046507 Bacteria 1994
955 Ga0495610_0006115 3300046512 Bacteria 8394
956 Ga0495610_0006148 3300046512 Bacteria 8353
957 Ga0495610_0007886 3300046512 Bacteria 6996
958 Ga0495610_0008702 3300046512 Bacteria 6531
959 Ga0495610_0011833 3300046512 Bacteria 5301
960 Ga0495610_0014670 3300046512 Bacteria 4593
961 Ga0495610_0019602 3300046512 Bacteria 3778
962 Ga0495610_0020628 3300046512 Bacteria 3654
963 Ga0495610_0023269 3300046512 Bacteria 3372
964 Ga0495616_0000964 3300046513 Bacteria 20644
965 Ga0495616_0003956 3300046513 Bacteria 9437
966 Ga0495616_0004838 3300046513 Bacteria 8436
967 Ga0495616_0005311 3300046513 Bacteria 7940
968 Ga0495616_0013706 3300046513 Bacteria 4563
969 Ga0495616_0034514 3300046513 Bacteria 2627
970 Ga0495616_0044994 3300046513 Bacteria 2236
971 Ga0495616_0053072 3300046513 Bacteria 2016
972 Ga0495616_0054048 3300046513 Bacteria 1993
973 Ga0495620_0000052 3300046515 Bacteria 103693
974 Ga0495620_0000099 3300046515 Bacteria 69356
975 Ga0495620_0000482 3300046515 Bacteria 25941
976 Ga0495620_0000811 3300046515 Bacteria 19225
977 Ga0495620_0004878 3300046515 Bacteria 7531
978 Ga0495620_0006041 3300046515 Bacteria 6702
979 Ga0495620_0006387 3300046515 Bacteria 6482
980 Ga0495620_0007738 3300046515 Bacteria 5804
981 Ga0495620_0034874 3300046515 Bacteria 2269
982 Ga0495630_0018059 3300046517 Bacteria 5177
983 Ga0495630_0054199 3300046517 Bacteria 3004
984 Ga0495630_0107201 3300046517 Bacteria 2116
985 Ga0495631_0000953 3300046518 Bacteria 18020
986 Ga0495631_0003543 3300046518 Bacteria 8533
987 Ga0495631_0004428 3300046518 Bacteria 7482
988 Ga0495632_0001542 3300046519 Bacteria 19038
989 Ga0495632_0002560 3300046519 Bacteria 13770
990 Ga0495632_0007683 3300046519 Bacteria 6733
991 Ga0495632_0007887 3300046519 Bacteria 6615
992 Ga0495632_0008623 3300046519 Bacteria 6225
993 Ga0495632_0008850 3300046519 Bacteria 6122
994 Ga0495632_0011595 3300046519 Bacteria 5133
995 Ga0495632_0011700 3300046519 Bacteria 5107
996 Ga0495632_0015018 3300046519 Bacteria 4357
997 Ga0495632_0016104 3300046519 Bacteria 4168
998 Ga0495632_0016723 3300046519 Bacteria 4069
999 Ga0495632_0022037 3300046519 Bacteria 3422
1000 Ga0495632_0027337 3300046519 Bacteria 2989
1001 Ga0495632_0035855 3300046519 Bacteria 2527
1002 Ga0495632_0049670 3300046519 Bacteria 2072
1003 Ga0495637_0000059 3300046520 Bacteria 96238
1004 Ga0495637_0000816 3300046520 Bacteria 20571
1005 Ga0495637_0000931 3300046520 Bacteria 18727
1006 Ga0495637_0003407 3300046520 Bacteria 8442
1007 Ga0495637_0003519 3300046520 Bacteria 8303
1008 Ga0495637_0004240 3300046520 Bacteria 7450
1009 Ga0495637_0011919 3300046520 Bacteria 4166
1010 Ga0495637_0016561 3300046520 Bacteria 3444
1011 Ga0495637_0018178 3300046520 Bacteria 3265
1012 Ga0495637_0028057 3300046520 Bacteria 2515
1013 Ga0495637_0031181 3300046520 Bacteria 2359
1014 Ga0495637_0048068 3300046520 Bacteria 1798
1015 Ga0495637_0055229 3300046520 Bacteria 1647
1016 Ga0495643_0000197 3300046522 Bacteria 95489
1017 Ga0495643_0000404 3300046522 Bacteria 56411
1018 Ga0495643_0011424 3300046522 Bacteria 5407
1019 Ga0495643_0015062 3300046522 Bacteria 4581
1020 Ga0495643_0031462 3300046522 Bacteria 2952
1021 Ga0495643_0039746 3300046522 Bacteria 2572
1022 Ga0495643_0081844 3300046522 Bacteria 1678
1023 Ga0495644_0000942 3300046523 Bacteria 12035
1024 Ga0495644_0001481 3300046523 Bacteria 9567
1025 Ga0495644_0002056 3300046523 Bacteria 8108
1026 Ga0495644_0004561 3300046523 Bacteria 5446
1027 Ga0495648_0001828 3300046524 Bacteria 20470
1028 Ga0495648_0002424 3300046524 Bacteria 17284
1029 Ga0495648_0004782 3300046524 Bacteria 11454
1030 Ga0495648_0006093 3300046524 Bacteria 9892
1031 Ga0495648_0010250 3300046524 Bacteria 7157
1032 Ga0495648_0011321 3300046524 Bacteria 6729
1033 Ga0495648_0014386 3300046524 Bacteria 5796
1034 Ga0495648_0018256 3300046524 Bacteria 4977
1035 Ga0495648_0018618 3300046524 Bacteria 4908
1036 Ga0495648_0032715 3300046524 Bacteria 3407
1037 Ga0495648_0034269 3300046524 Bacteria 3305
1038 Ga0495648_0075457 3300046524 Bacteria 1939
1039 Ga0495666_0003871 3300046526 Bacteria 7571
1040 Ga0495666_0017193 3300046526 Bacteria 3602
1041 Ga0495666_0027594 3300046526 Bacteria 2794
1042 Ga0495642_0000276 3300046528 Bacteria 29070
1043 Ga0495642_0000490 3300046528 Bacteria 20281
1044 Ga0495654_0000031 3300046530 Bacteria 206800
1045 Ga0495654_0000342 3300046530 Bacteria 40679
1046 Ga0495654_0001661 3300046530 Bacteria 15056
1047 Ga0495654_0001908 3300046530 Bacteria 13842
1048 Ga0495654_0002241 3300046530 Bacteria 12524
1049 Ga0495654_0002255 3300046530 Bacteria 12478
1050 Ga0495654_0004408 3300046530 Bacteria 8360
1051 Ga0495654_0004885 3300046530 Bacteria 7890
1052 Ga0495654_0005191 3300046530 Bacteria 7596
1053 Ga0495654_0006155 3300046530 Bacteria 6860
1054 Ga0495654_0010455 3300046530 Bacteria 5048
1055 Ga0495654_0013393 3300046530 Bacteria 4389
1056 Ga0495654_0028656 3300046530 Bacteria 2845
1057 Ga0495654_0029367 3300046530 Bacteria 2804
1058 Ga0495654_0035733 3300046530 Bacteria 2499
1059 Ga0495654_0081484 3300046530 Bacteria 1516
1060 Ga0495587_0019792 3300046536 Bacteria 4160
1061 Ga0495609_0000018 3300046538 Bacteria 302609
1062 Ga0495609_0000123 3300046538 Bacteria 86194
1063 Ga0495609_0000194 3300046538 Bacteria 60772
1064 Ga0495609_0003847 3300046538 Bacteria 8444
1065 Ga0495609_0003853 3300046538 Bacteria 8432
1066 Ga0495609_0008134 3300046538 Bacteria 5162
1067 Ga0495597_0000066 3300046542 Bacteria 90474
1068 Ga0495597_0001966 3300046542 Bacteria 13805
1069 Ga0495597_0005872 3300046542 Bacteria 6416
1070 Ga0495597_0006609 3300046542 Bacteria 5980
1071 Ga0495597_0013577 3300046542 Bacteria 3897
1072 Ga0495597_0023807 3300046542 Bacteria 2830
1073 Ga0495597_0027194 3300046542 Bacteria 2623
1074 Ga0495597_0033173 3300046542 Bacteria 2339
1075 Ga0495597_0037170 3300046542 Bacteria 2187
1076 Ga0495622_0001082 3300046557 Bacteria 14241
1077 Ga0495622_0003665 3300046557 Bacteria 7205
1078 Ga0495622_0025393 3300046557 Bacteria 2767
1079 Ga0495633_0003764 3300046558 Bacteria 9970
1080 Ga0495633_0004090 3300046558 Bacteria 9412
1081 Ga0495656_0039517 3300046615 Bacteria 1960
1082 Ga0495668_0003074 3300046616 Bacteria 12915
1083 Ga0495668_0004765 3300046616 Bacteria 9485
1084 Ga0495668_0005370 3300046616 Bacteria 8730
1085 Ga0495668_0020614 3300046616 Bacteria 3789
1086 Ga0495668_0051162 3300046616 Bacteria 2287
1087 Ga0495634_0009812 3300046642 Bacteria 7044
1088 Ga0495611_0001586 3300046648 Bacteria 11112
1089 Ga0495611_0004574 3300046648 Bacteria 5957
1090 Ga0495625_0000202 3300046660 Bacteria 94655
1091 Ga0495625_0001706 3300046660 Bacteria 25551
1092 Ga0495625_0005131 3300046660 Bacteria 12100
1093 Ga0495625_0006971 3300046660 Bacteria 9965
1094 Ga0495625_0007674 3300046660 Bacteria 9349
1095 Ga0495625_0011941 3300046660 Bacteria 7051
1096 Ga0495625_0024843 3300046660 Bacteria 4551
1097 Ga0495625_0054711 3300046660 Bacteria 2849
1098 Ga0495635_0007404 3300046663 Bacteria 7661
1099 Ga0495635_0046477 3300046663 Bacteria 2994
1100 Ga0495659_0000457 3300046664 Bacteria 15230
1101 Ga0495659_0002039 3300046664 Bacteria 6616
1102 Ga0495661_0000075 3300046665 Bacteria 119777
1103 Ga0495661_0000133 3300046665 Bacteria 88428
1104 Ga0495661_0000336 3300046665 Bacteria 51167
1105 Ga0495661_0001986 3300046665 Bacteria 16171
1106 Ga0495661_0003038 3300046665 Bacteria 12640
1107 Ga0495661_0005482 3300046665 Bacteria 9001
1108 Ga0495661_0010774 3300046665 Bacteria 6222
1109 Ga0495661_0043538 3300046665 Bacteria 2758
1110 Ga0495661_0073244 3300046665 Bacteria 1996
1111 Ga0495588_0056997 3300046674 Bacteria 2017
1112 Ga0495623_0010642 3300046679 Bacteria 5954
1113 Ga0495646_0031588 3300046680 Bacteria 3298
1114 Ga0495669_0051240 3300046684 Bacteria 1852
1115 Ga0495613_0144945 3300046689 Bacteria 1695
1116 Ga0495624_0001179 3300046690 Bacteria 20701
1117 Ga0495670_0000715 3300046691 Bacteria 15822
1118 Ga0495670_0002855 3300046691 Bacteria 8535
1119 Ga0495670_0007109 3300046691 Bacteria 5512
1120 Ga0495670_0007882 3300046691 Bacteria 5236
1121 Ga0495670_0008345 3300046691 Bacteria 5091
1122 Ga0495670_0009264 3300046691 Bacteria 4842
1123 Ga0495671_0001378 3300046692 Bacteria 16494
1124 Ga0495671_0001513 3300046692 Bacteria 15559
1125 Ga0495671_0004814 3300046692 Bacteria 7977
1126 Ga0495671_0004830 3300046692 Bacteria 7965
1127 Ga0495671_0004870 3300046692 Bacteria 7942
1128 Ga0495671_0005064 3300046692 Bacteria 7760
1129 Ga0495671_0007843 3300046692 Bacteria 6040
1130 Ga0495671_0009478 3300046692 Bacteria 5438
1131 Ga0495671_0011691 3300046692 Bacteria 4814
1132 Ga0495671_0012933 3300046692 Bacteria 4542
1133 Ga0495671_0015819 3300046692 Bacteria 4037
1134 Ga0495671_0018358 3300046692 Bacteria 3713
1135 Ga0495671_0046150 3300046692 Bacteria 2179
1136 Ga0495671_0066731 3300046692 Bacteria 1770
1137 Ga0495649_0001000 3300046694 Bacteria 22223
1138 Ga0495649_0001508 3300046694 Bacteria 17467
1139 Ga0495649_0003489 3300046694 Bacteria 10593
1140 Ga0495649_0004598 3300046694 Bacteria 8977
1141 Ga0495649_0004606 3300046694 Bacteria 8969
1142 Ga0495649_0005123 3300046694 Bacteria 8408
1143 Ga0495649_0006097 3300046694 Bacteria 7537
1144 Ga0495649_0006109 3300046694 Bacteria 7528
1145 Ga0495649_0006258 3300046694 Bacteria 7413
1146 Ga0495649_0009541 3300046694 Bacteria 5757
1147 Ga0495649_0013854 3300046694 Bacteria 4638
1148 Ga0495649_0016529 3300046694 Bacteria 4181
1149 Ga0495649_0022237 3300046694 Bacteria 3548
1150 Ga0495649_0029337 3300046694 Bacteria 3043
1151 Ga0495649_0054306 3300046694 Bacteria 2166
1152 Ga0495589_0000005 3300046794 Bacteria 405112
1153 Ga0495589_0003312 3300046794 Bacteria 8739
1154 Ga0495589_0004738 3300046794 Bacteria 7219
1155 Ga0495589_0005996 3300046794 Bacteria 6418
1156 Ga0495589_0009187 3300046794 Bacteria 5141
1157 Ga0495589_0014113 3300046794 Bacteria 4118
1158 Ga0495589_0017712 3300046794 Bacteria 3655
1159 Ga0495600_0018264 3300046809 Bacteria 4465
1160 Ga0495660_0000013 3300046810 Bacteria 350283
1161 Ga0495660_0000034 3300046810 Bacteria 201261
1162 Ga0495660_0001176 3300046810 Bacteria 18465
1163 Ga0495660_0004652 3300046810 Bacteria 8275
1164 Ga0495660_0006205 3300046810 Bacteria 7093
1165 Ga0495660_0008586 3300046810 Bacteria 5978
1166 Ga0495660_0008799 3300046810 Bacteria 5895
1167 Ga0495660_0011032 3300046810 Bacteria 5246
1168 Ga0495660_0021990 3300046810 Bacteria 3645
1169 Ga0495660_0051365 3300046810 Bacteria 2243
1170 Ga0495660_0079955 3300046810 Bacteria 1716
1171 Ga0495581_0019114 3300047315 Bacteria 3977
1172 Ga0495636_0010709 3300047318 Bacteria 3625
1173 Ga0495674_0017039 3300047319 Bacteria 6771
1174 Ga0495672_0000029 3300047320 Bacteria 305231
1175 Ga0495672_0000051 3300047320 Bacteria 237883
1176 Ga0495672_0000054 3300047320 Bacteria 230777
1177 Ga0495672_0002280 3300047320 Bacteria 17814
1178 Ga0495672_0008082 3300047320 Bacteria 7815
1179 Ga0495672_0009270 3300047320 Bacteria 7151
1180 Ga0495672_0011348 3300047320 Bacteria 6294
1181 Ga0495672_0011640 3300047320 Bacteria 6194
1182 Ga0495672_0011731 3300047320 Bacteria 6162
1183 Ga0495672_0015303 3300047320 Bacteria 5214
1184 Ga0495672_0028587 3300047320 Bacteria 3525
1185 Ga0495672_0032984 3300047320 Bacteria 3213
1186 Ga0495672_0059323 3300047320 Bacteria 2214
1187 Ga0495672_0061030 3300047320 Bacteria 2174
1188 Ga0495676_0000053 3300047321 Bacteria 95693
1189 Ga0495676_0010218 3300047321 Bacteria 8522
1190 Ga0495676_0013031 3300047321 Bacteria 7482
1191 Ga0495680_0008378 3300047322 Bacteria 9400
1192 Ga0495680_0011624 3300047322 Bacteria 7779
1193 Ga0495680_0016108 3300047322 Bacteria 6427
1194 Ga0495680_0158737 3300047322 Bacteria 1643
1195 Ga0495683_0000043 3300047323 Bacteria 136876
1196 Ga0495683_0000082 3300047323 Bacteria 94515
1197 Ga0495683_0001174 3300047323 Bacteria 17901
1198 Ga0495683_0001446 3300047323 Bacteria 15578
1199 Ga0495683_0008158 3300047323 Bacteria 5618
1200 Ga0495683_0032185 3300047323 Bacteria 2671
1201 Ga0495683_0033568 3300047323 Bacteria 2610
1202 Ga0495683_0037968 3300047323 Bacteria 2439
1203 Ga0495687_002579 3300047443 Bacteria 14291
1204 Ga0495687_010786 3300047443 Bacteria 4974
1205 Ga0495687_012830 3300047443 Bacteria 4409
1206 Ga0495675_0017433 3300047444 Bacteria 4550
1207 Ga0495679_000014 3300047446 Bacteria 292767
1208 Ga0495679_000305 3300047446 Bacteria 39514
1209 Ga0495679_000401 3300047446 Bacteria 32512
1210 Ga0495679_000923 3300047446 Bacteria 18335
1211 Ga0495679_012962 3300047446 Bacteria 3149
1212 Ga0495673_0000047 3300047469 Bacteria 266522
1213 Ga0495673_0000517 3300047469 Bacteria 40822
1214 Ga0495673_0001376 3300047469 Bacteria 19632
1215 Ga0495673_0001555 3300047469 Bacteria 17984
1216 Ga0495673_0001645 3300047469 Bacteria 17245
1217 Ga0495673_0001654 3300047469 Bacteria 17196
1218 Ga0495673_0002191 3300047469 Bacteria 14168
1219 Ga0495673_0003703 3300047469 Bacteria 9945
1220 Ga0495673_0004615 3300047469 Bacteria 8574
1221 Ga0495673_0004624 3300047469 Bacteria 8567
1222 Ga0495673_0006316 3300047469 Bacteria 6982
1223 Ga0495673_0006785 3300047469 Bacteria 6686
1224 Ga0495673_0008889 3300047469 Bacteria 5600
1225 Ga0495673_0013301 3300047469 Bacteria 4327
1226 Ga0495673_0027528 3300047469 Bacteria 2704
1227 Ga0495673_0032490 3300047469 Bacteria 2431
1228 Ga0495681_0001974 3300047470 Bacteria 14987
1229 Ga0495681_0002070 3300047470 Bacteria 14573
1230 Ga0495681_0002174 3300047470 Bacteria 14205
1231 Ga0495681_0002684 3300047470 Bacteria 12604
1232 Ga0495681_0006168 3300047470 Bacteria 7915
1233 Ga0495681_0006631 3300047470 Bacteria 7565
1234 Ga0495681_0018594 3300047470 Bacteria 3825
1235 Ga0495681_0023460 3300047470 Bacteria 3276
1236 Ga0495681_0045278 3300047470 Bacteria 2106
1237 Ga0495681_0048968 3300047470 Bacteria 2000
1238 Ga0495686_0008099 3300047472 Bacteria 7771
1239 Ga0495686_0012478 3300047472 Bacteria 5941
1240 Ga0495686_0025928 3300047472 Bacteria 3838
1241 Ga0495593_0006443 3300047673 Bacteria 6880
1242 Ga0495602_0009613 3300048088 Bacteria 10051
1243 Ga0495626_0000261 3300048091 Bacteria 60058
1244 Ga0495626_0001455 3300048091 Bacteria 18744
1245 Ga0495626_0001872 3300048091 Bacteria 15768
1246 Ga0495626_0002288 3300048091 Bacteria 13583
1247 Ga0495626_0002548 3300048091 Bacteria 12504
1248 Ga0495626_0004275 3300048091 Bacteria 8813
1249 Ga0495626_0005048 3300048091 Bacteria 7873
1250 Ga0495626_0005862 3300048091 Bacteria 7080
1251 Ga0496100_0018550 3300048903 Bacteria 4129
1252 Ga0496101_0000158 3300048904 Bacteria 57788
1253 Ga0496102_0002699 3300048905 Bacteria 15088
1254 Ga0496102_0058604 3300048905 Bacteria 3519
1255 Ga0496103_0004499 3300048906 Bacteria 8446
1256 Ga0496104_0000302 3300048907 Bacteria 43843
1257 Ga0496104_0000668 3300048907 Bacteria 29410
1258 Ga0496104_0003933 3300048907 Bacteria 12850
1259 Ga0496105_0003806 3300048908 Bacteria 11251
1260 Ga0496107_0076292 3300048910 Bacteria 2441
1261 Ga0496108_0019313 3300048911 Bacteria 5596
1262 Ga0496110_0110591 3300048913 Bacteria 2469
1263 Ga0496112_0172793 3300048915 Bacteria 2126
1264 Ga0496114_0005875 3300048917 Bacteria 9646
1265 Ga0496116_0000015 3300048919 Bacteria 560702
1266 Ga0496116_0000016 3300048919 Bacteria 555146
1267 Ga0496116_0000107 3300048919 Bacteria 188067
1268 Ga0496116_0000267 3300048919 Bacteria 91320
1269 Ga0496116_0000835 3300048919 Bacteria 38885
1270 Ga0496116_0000904 3300048919 Bacteria 36723
1271 Ga0496116_0003287 3300048919 Bacteria 16068
1272 Ga0496116_0007651 3300048919 Bacteria 9530
1273 Ga0496116_0009027 3300048919 Bacteria 8563
1274 Ga0496116_0009042 3300048919 Bacteria 8552
1275 Ga0496116_0033570 3300048919 Bacteria 3640
1276 Ga0496116_0044155 3300048919 Bacteria 3030
1277 Ga0496116_0054828 3300048919 Bacteria 2623
1278 Ga0496117_0000103 3300048920 Bacteria 189316
1279 Ga0496117_0000183 3300048920 Bacteria 127679
1280 Ga0496117_0000238 3300048920 Bacteria 104303
1281 Ga0496117_0000345 3300048920 Bacteria 82051
1282 Ga0496117_0001664 3300048920 Bacteria 31144
1283 Ga0496117_0003235 3300048920 Bacteria 19188
1284 Ga0496117_0004149 3300048920 Bacteria 16193
1285 Ga0496117_0004534 3300048920 Bacteria 15234
1286 Ga0496117_0004589 3300048920 Bacteria 15103
1287 Ga0496117_0007472 3300048920 Bacteria 10661
1288 Ga0496117_0007955 3300048920 Bacteria 10184
1289 Ga0496117_0009147 3300048920 Bacteria 9286
1290 Ga0496117_0017496 3300048920 Bacteria 5985
1291 Ga0496117_0035949 3300048920 Bacteria 3712
1292 Ga0496117_0035964 3300048920 Bacteria 3711
1293 Ga0496117_0055595 3300048920 Bacteria 2765
1294 Ga0496117_0057654 3300048920 Bacteria 2695
1295 Ga0496118_0000046 3300048921 Bacteria 271783
1296 Ga0496118_0001062 3300048921 Bacteria 42938
1297 Ga0496118_0001278 3300048921 Bacteria 38517
1298 Ga0496118_0002104 3300048921 Bacteria 27943
1299 Ga0496118_0002946 3300048921 Bacteria 22116
1300 Ga0496118_0003804 3300048921 Bacteria 18596
1301 Ga0496118_0003831 3300048921 Bacteria 18510
1302 Ga0496118_0009161 3300048921 Bacteria 10057
1303 Ga0496118_0011289 3300048921 Bacteria 8737
1304 Ga0496118_0022852 3300048921 Bacteria 5452
1305 Ga0496118_0025190 3300048921 Bacteria 5110
1306 Ga0496118_0052119 3300048921 Bacteria 3124
1307 Ga0496118_0071085 3300048921 Bacteria 2507
1308 Ga0496119_0000026 3300048922 Bacteria 254759
1309 Ga0496119_0000031 3300048922 Bacteria 239685
1310 Ga0496119_0000199 3300048922 Bacteria 84539
1311 Ga0496119_0000374 3300048922 Bacteria 61884
1312 Ga0496119_0000391 3300048922 Bacteria 60498
1313 Ga0496119_0001418 3300048922 Bacteria 29010
1314 Ga0496119_0002255 3300048922 Bacteria 21447
1315 Ga0496119_0002834 3300048922 Bacteria 18539
1316 Ga0496119_0002989 3300048922 Bacteria 17940
1317 Ga0496119_0002994 3300048922 Bacteria 17918
1318 Ga0496119_0005635 3300048922 Bacteria 11900
1319 Ga0496119_0027444 3300048922 Bacteria 3911
1320 Ga0496119_0048933 3300048922 Bacteria 2617
1321 Ga0496120_0000017 3300048923 Bacteria 269222
1322 Ga0496120_0000317 3300048923 Bacteria 79762
1323 Ga0496120_0000491 3300048923 Bacteria 61896
1324 Ga0496120_0000806 3300048923 Bacteria 45060
1325 Ga0496120_0000840 3300048923 Bacteria 43691
1326 Ga0496120_0001006 3300048923 Bacteria 37957
1327 Ga0496120_0001012 3300048923 Bacteria 37715
1328 Ga0496120_0001022 3300048923 Bacteria 37416
1329 Ga0496120_0001442 3300048923 Bacteria 28529
1330 Ga0496120_0002864 3300048923 Bacteria 16598
1331 Ga0496120_0006711 3300048923 Bacteria 8756
1332 Ga0496120_0013652 3300048923 Bacteria 5457
1333 Ga0496120_0022993 3300048923 Bacteria 3908
1334 Ga0496120_0026635 3300048923 Bacteria 3567
1335 Ga0496121_0000366 3300048924 Bacteria 92773
1336 Ga0496121_0001130 3300048924 Bacteria 46848
1337 Ga0496121_0001160 3300048924 Bacteria 46200
1338 Ga0496121_0004084 3300048924 Bacteria 20053
1339 Ga0496121_0005503 3300048924 Bacteria 16197
1340 Ga0496121_0005581 3300048924 Bacteria 16068
1341 Ga0496121_0007929 3300048924 Bacteria 12693
1342 Ga0496121_0013954 3300048924 Bacteria 8584
1343 Ga0496121_0027349 3300048924 Bacteria 5338
1344 Ga0496121_0030100 3300048924 Bacteria 4995
1345 Ga0496121_0050458 3300048924 Bacteria 3515
1346 Ga0496121_0052221 3300048924 Bacteria 3435
1347 Ga0496121_0079971 3300048924 Bacteria 2593
1348 Ga0496121_0086603 3300048924 Bacteria 2461
1349 Ga0496122_0000075 3300048925 Bacteria 219099
1350 Ga0496122_0000125 3300048925 Bacteria 179659
1351 Ga0496122_0001095 3300048925 Bacteria 46975
1352 Ga0496122_0001397 3300048925 Bacteria 39198
1353 Ga0496122_0003298 3300048925 Bacteria 21357
1354 Ga0496122_0011931 3300048925 Bacteria 8724
1355 Ga0496122_0013632 3300048925 Bacteria 7934
1356 Ga0496122_0014282 3300048925 Bacteria 7692
1357 Ga0496122_0020330 3300048925 Bacteria 6005
1358 Ga0496122_0037343 3300048925 Bacteria 3911
1359 Ga0496122_0044849 3300048925 Bacteria 3445
1360 Ga0496123_0000019 3300048926 Bacteria 400216
1361 Ga0496123_0000092 3300048926 Bacteria 179551
1362 Ga0496123_0000377 3300048926 Bacteria 83811
1363 Ga0496123_0000432 3300048926 Bacteria 75431
1364 Ga0496123_0012760 3300048926 Bacteria 7125
1365 Ga0496123_0022407 3300048926 Bacteria 4869
1366 Ga0496123_0025637 3300048926 Bacteria 4439
1367 Ga0496123_0032442 3300048926 Bacteria 3781
1368 Ga0496123_0035936 3300048926 Bacteria 3522
1369 Ga0496123_0041327 3300048926 Bacteria 3199
1370 Ga0496123_0049604 3300048926 Bacteria 2812
1371 Ga0496123_0117516 3300048926 Bacteria 1503
1372 Ga0496124_0000058 3300048927 Bacteria 242191
1373 Ga0496124_0000238 3300048927 Bacteria 106881
1374 Ga0496124_0000528 3300048927 Bacteria 65079
1375 Ga0496124_0000965 3300048927 Bacteria 45797
1376 Ga0496124_0002138 3300048927 Bacteria 26556
1377 Ga0496124_0003076 3300048927 Bacteria 20781
1378 Ga0496124_0006598 3300048927 Bacteria 12601
1379 Ga0496124_0008102 3300048927 Bacteria 11041
1380 Ga0496124_0011229 3300048927 Bacteria 8975
1381 Ga0496124_0014414 3300048927 Bacteria 7643
1382 Ga0496124_0021096 3300048927 Bacteria 6007
1383 Ga0496124_0024965 3300048927 Bacteria 5421
1384 Ga0496124_0025396 3300048927 Bacteria 5365
1385 Ga0496124_0028318 3300048927 Bacteria 5013
1386 Ga0496124_0087110 3300048927 Bacteria 2554
1387 Ga0496124_0200625 3300048927 Bacteria 1517
1388 Ga0496125_0000032 3300048928 Bacteria 354078
1389 Ga0496125_0000240 3300048928 Bacteria 112092
1390 Ga0496125_0000384 3300048928 Bacteria 82197
1391 Ga0496125_0004777 3300048928 Bacteria 15428
1392 Ga0496125_0006298 3300048928 Bacteria 12882
1393 Ga0496125_0018484 3300048928 Bacteria 6619
1394 Ga0496125_0018591 3300048928 Bacteria 6597
1395 Ga0496125_0058859 3300048928 Bacteria 3100
1396 Ga0496125_0076321 3300048928 Bacteria 2588
1397 Ga0496126_0000109 3300048929 Bacteria 196717
1398 Ga0496126_0003362 3300048929 Bacteria 20286
1399 Ga0496126_0020625 3300048929 Bacteria 6455
1400 Ga0496126_0024373 3300048929 Bacteria 5842
1401 Ga0496126_0034211 3300048929 Bacteria 4774
1402 Ga0496126_0046990 3300048929 Bacteria 3953
1403 Ga0496126_0069814 3300048929 Bacteria 3132
1404 Ga0495678_000021 3300049459 Bacteria 239150
1405 Ga0495678_000243 3300049459 Bacteria 61378
1406 Ga0495678_000994 3300049459 Bacteria 24294
1407 Ga0495678_002086 3300049459 Bacteria 14214
1408 Ga0495678_004020 3300049459 Bacteria 8760
1409 Ga0495678_004657 3300049459 Bacteria 7869
1410 Ga0495678_006521 3300049459 Bacteria 6198
1411 Ga0495678_010033 3300049459 Bacteria 4627
1412 Ga0495678_010394 3300049459 Bacteria 4527
1413 Ga0495678_038350 3300049459 Bacteria 1939
1414 Ga0495678_045975 3300049459 Bacteria 1718
1415 Ga0495682_0000003 3300049460 Bacteria 515787
1416 Ga0495682_0000118 3300049460 Bacteria 69167
1417 Ga0495682_0000336 3300049460 Bacteria 34757
1418 Ga0495682_0001977 3300049460 Bacteria 10140
1419 Ga0501034_0000330 3300049571 Bacteria 82994
1420 Ga0501034_0143928 3300049571 Bacteria 2362
1421 Ga0501036_0012641 3300049572 Bacteria 7002
1422 Ga0501036_0058143 3300049572 Bacteria 3276
1423 Ga0501037_0026371 3300049573 Bacteria 4295
1424 Ga0501037_0026991 3300049573 Bacteria 4243
1425 Ga0501038_0015356 3300049574 Bacteria 6962
1426 Ga0501038_0036714 3300049574 Bacteria 4300
1427 Ga0501039_0007733 3300049575 Bacteria 8202
1428 Ga0501039_0025995 3300049575 Bacteria 4500
1429 Ga0501040_0002725 3300049576 Bacteria 11378
1430 Ga0501041_0003883 3300049577 Bacteria 8607
1431 Ga0501042_0007640 3300049578 Bacteria 7093
1432 Ga0501042_0084310 3300049578 Bacteria 2278
1433 Ga0501042_0135215 3300049578 Bacteria 1777
1434 Ga0501043_0111543 3300049579 Bacteria 2147
1435 Ga0501046_0070030 3300049580 Bacteria 2728
1436 Ga0501046_0082069 3300049580 Bacteria 2490
1437 Ga0501047_0032511 3300049581 Bacteria 5036
1438 Ga0501048_0011880 3300049582 Bacteria 6493
1439 Ga0501067_0012117 3300049583 Bacteria 4780
1440 Ga0501068_0001066 3300049584 Bacteria 14479
1441 Ga0501069_0046607 3300049585 Bacteria 2405
1442 Ga0501069_0061910 3300049585 Bacteria 2090
1443 Ga0501070_0021040 3300049586 Bacteria 5473
1444 Ga0501070_0042822 3300049586 Bacteria 3770
1445 Ga0501071_0002875 3300049587 Bacteria 10618
1446 Ga0501071_0003941 3300049587 Bacteria 9361
1447 Ga0501071_0012220 3300049587 Bacteria 5815
1448 Ga0501071_0118236 3300049587 Bacteria 1963
1449 Ga0501072_0002404 3300049588 Bacteria 14038
1450 Ga0501072_0016067 3300049588 Bacteria 5740
1451 Ga0501072_0040567 3300049588 Bacteria 3655
1452 Ga0501072_0089139 3300049588 Bacteria 2448
1453 Ga0501073_0002866 3300049589 Bacteria 12915
1454 Ga0501073_0029739 3300049589 Bacteria 3904
1455 Ga0501074_0000122 3300049590 Bacteria 39373
1456 Ga0501074_0026163 3300049590 Bacteria 4231
1457 Ga0501074_0053111 3300049590 Bacteria 2925
1458 Ga0501075_0003232 3300049591 Bacteria 10902
1459 Ga0501075_0039592 3300049591 Bacteria 3527
1460 Ga0501075_0056314 3300049591 Bacteria 2960
1461 Ga0501075_0071097 3300049591 Bacteria 2630
1462 Ga0501076_0005334 3300049592 Bacteria 9232
1463 Ga0501076_0006170 3300049592 Bacteria 8674
1464 Ga0501076_0015408 3300049592 Bacteria 5776
1465 Ga0501076_0017475 3300049592 Bacteria 5452
1466 Ga0501077_0004666 3300049593 Bacteria 8329
1467 Ga0501077_0007570 3300049593 Bacteria 6701
1468 Ga0501079_0000691 3300049741 Bacteria 22700
1469 Ga0501079_0001011 3300049741 Bacteria 19496
1470 Ga0501079_0056664 3300049741 Bacteria 3024
1471 Ga0501080_0003163 3300049742 Bacteria 14507
1472 Ga0501080_0014035 3300049742 Bacteria 7374
1473 Ga0501080_0117770 3300049742 Bacteria 2462
1474 Ga0501080_0130113 3300049742 Bacteria 2330
1475 Ga0501081_0006439 3300049743 Bacteria 7619
1476 Ga0501081_0134086 3300049743 Bacteria 1771
1477 Ga0501241_000456 3300049758 Bacteria 8889
1478 Ga0501241_002164 3300049758 Bacteria 3841
1479 Ga0501035_0024116 3300049822 Bacteria 5581
1480 Ga0501035_0028332 3300049822 Bacteria 5114
1481 Ga0501035_0068049 3300049822 Bacteria 3158
1482 Ga0501044_0000065 3300049823 Bacteria 130072
1483 Ga0501044_0010660 3300049823 Bacteria 9972
1484 Ga0501044_0229725 3300049823 Bacteria 1803
1485 Ga0501045_0003649 3300049824 Bacteria 10582
1486 Ga0501045_0003730 3300049824 Bacteria 10476
1487 Ga0501045_0035721 3300049824 Bacteria 3608
1488 Ga0501226_000004 3300049853 Bacteria 284656
1489 nmdc:mga00v17_38473_c1 3300050491 Bacteria 2861
1490 nmdc:mga00v17_570_c1 3300050491 Bacteria 20583
1491 nmdc:mga0yw44_2366_c1 3300050492 Bacteria 8005
1492 nmdc:mga0yw44_94477_c1 3300050492 Bacteria 1895
1493 nmdc:mga05p37_19353_c1 3300050507 Bacteria 8235
1494 nmdc:mga05p37_19948_c1 3300050507 Bacteria 8110
1495 nmdc:mga05p37_274897_c1 3300050507 Bacteria 2011
1496 nmdc:mga05p37_484_c1 3300050507 Bacteria 43547
1497 nmdc:mga09592_28298_c1 3300050508 Bacteria 4656
1498 nmdc:mga09592_31124_c1 3300050508 Bacteria 4444
1499 nmdc:mga09592_567_c1 3300050508 Bacteria 28034
1500 nmdc:mga0qj67_204369_c1 3300050509 Bacteria 1604
1501 nmdc:mga0qj67_325_c1 3300050509 Bacteria 32921
1502 nmdc:mga0qj67_6220_c1 3300050509 Bacteria 8765
1503 nmdc:mga06r32_27264_c1 3300050510 Bacteria 5335
1504 nmdc:mga06r32_3756_c1 3300050510 Bacteria 13584
1505 nmdc:mga06r32_461_c1 3300050510 Bacteria 34790
1506 nmdc:mga08y16_29965_c1 3300050511 Bacteria 5730
1507 nmdc:mga08y16_32843_c1 3300050511 Bacteria 5456
1508 nmdc:mga0n895_3290_c1 3300050512 Bacteria 12974
1509 nmdc:mga0a205_87_c1 3300050515 Bacteria 51120
1510 Ga0500650_0001226 3300053098 Bacteria 7551
1511 Ga0500556_0000319 3300053104 Bacteria 36216
1512 Ga0500572_001005 3300053111 Bacteria 8512
1513 Ga0500621_000034 3300053126 Bacteria 27593
1514 Ga0500573_0034852 3300053140 Bacteria 2903
1515 Ga0500622_0004521 3300053156 Bacteria 8694
1516 Ga0500622_0014825 3300053156 Bacteria 4178
1517 Ga0500637_0003153 3300053178 Bacteria 7538
1518 Ga0501084_0001911 3300054114 Bacteria 16622
1519 Ga0501084_0019612 3300054114 Bacteria 5634
1520 Ga0501084_0106069 3300054114 Bacteria 2360
1521 Ga0501082_0012374 3300060353 Bacteria 7334
1522 Ga0501082_0025185 3300060353 Bacteria 5126
1523 Ga0501082_0103907 3300060353 Bacteria 2457
1524 Ga0530510_0007950 3300061734 Bacteria 7400
1525 Ga0530510_0032120 3300061734 Bacteria 3775
1526 Ga0530510_0082637 3300061734 Bacteria 2339
1527 Ga0530510_0086299 3300061734 Bacteria 2287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005543 Ga0070672_100000694 Ga0070672_10000069420 379
2 3300005844 Ga0068862_100005445 Ga0068862_1000054456 379
3 3300006881 Ga0068865_100007521 Ga0068865_1000075215 379
4 3300025907 Ga0207645_10000348 Ga0207645_1000034810 379
5 3300025917 Ga0207660_10006542 Ga0207660_100065424 379
6 3300025933 Ga0207706_10002539 Ga0207706_1000253910 379
7 3300025940 Ga0207691_10011300 Ga0207691_100113007 379
8 3300026075 Ga0207708_10009579 Ga0207708_100095792 379
9 3300026089 Ga0207648_10005345 Ga0207648_1000534511 379
10 3300026118 Ga0207675_100002107 Ga0207675_10000210714 379
11 3300027682 Ga0209971_1001260 Ga0209971_10012603 379
12 3300027717 Ga0209998_10001506 Ga0209998_100015063 379
13 3300046461 Ga0495641_0054034 Ga0495641_0054034_660_1799 379
14 3300060353 Ga0501082_0103907 Ga0501082_0103907_1169_2308 379
15 3300042125 Ga0450923_002475 Ga0450923_002475_247_1497 381
16 3300042005 Ga0439448_0041561 Ga0439448_0041561_189_1469 388
17 3300044673 Ga0453683_0014870 Ga0453683_0014870_3336_4517 393
18 3300044712 Ga0453684_0020833 Ga0453684_0020833_3886_5067 393
19 3300045051 Ga0451576_0172631 Ga0451576_0172631_686_1867 393
20 3300006844 Ga0075428_100006399 Ga0075428_1000063996 394
21 3300006847 Ga0075431_100107249 Ga0075431_1001072492 394
22 3300031727 Ga0316576_10000212 Ga0316576_100002124 400
23 3300032168 Ga0316593_10010248 Ga0316593_100102482 400
24 3300035398 Ga0316574_0000008 Ga0316574_0000008_22499_23740 400
25 3300027907 Ga0207428_10037467 Ga0207428_100374673 405
26 3300046694 Ga0495649_0006258 Ga0495649_0006258_51_1325 405
27 3300031727 Ga0316576_10186980 Ga0316576_101869802 407
28 3300049586 Ga0501070_0042822 Ga0501070_0042822_2391_3626 408
29 3300031727 Ga0316576_10165725 Ga0316576_101657251 409
30 3300037588 Ga0316581_0007444 Ga0316581_0007444_326_1696 409
31 3300049581 Ga0501047_0032511 Ga0501047_0032511_3636_4889 411
32 3300049590 Ga0501074_0053111 Ga0501074_0053111_771_2024 411
33 3300049742 Ga0501080_0117770 Ga0501080_0117770_962_2215 411
34 3300049822 Ga0501035_0024116 Ga0501035_0024116_920_2173 411
35 3300049823 Ga0501044_0010660 Ga0501044_0010660_2066_3319 411
36 3300005441 Ga0070700_100059921 Ga0070700_1000599211 412
37 3300035691 Ga0373931_0033413 Ga0373931_0033413_840_2195 412
38 3300005330 Ga0070690_100012283 Ga0070690_1000122834 415
39 3300005340 Ga0070689_100023090 Ga0070689_1000230904 415
40 3300005343 Ga0070687_100010245 Ga0070687_1000102453 415
41 3300005354 Ga0070675_100000334 Ga0070675_1000003342 415
42 3300005365 Ga0070688_100006244 Ga0070688_1000062442 415
43 3300005367 Ga0070667_100023897 Ga0070667_1000238973 415
44 3300005441 Ga0070700_100051436 Ga0070700_1000514362 415
45 3300005456 Ga0070678_100008328 Ga0070678_1000083284 415
46 3300005457 Ga0070662_100040573 Ga0070662_1000405733 415
47 3300005459 Ga0068867_100036345 Ga0068867_1000363452 415
48 3300005543 Ga0070672_100011621 Ga0070672_1000116214 415
49 3300005548 Ga0070665_100013832 Ga0070665_1000138325 415
50 3300005564 Ga0070664_100000660 Ga0070664_1000006604 415
51 3300005617 Ga0068859_100003407 Ga0068859_1000034079 415
52 3300005618 Ga0068864_100005551 Ga0068864_10000555110 415
53 3300005841 Ga0068863_100007009 Ga0068863_1000070093 415
54 3300005844 Ga0068862_100007755 Ga0068862_1000077559 415
55 3300006358 Ga0068871_100041659 Ga0068871_1000416594 415
56 3300006844 Ga0075428_100027992 Ga0075428_1000279926 415
57 3300006931 Ga0097620_100003407 Ga0097620_10000340710 415
58 3300009011 Ga0105251_10024082 Ga0105251_100240821 415
59 3300009092 Ga0105250_10003873 Ga0105250_100038733 415
60 3300009101 Ga0105247_10000387 Ga0105247_100003871 415
61 3300009177 Ga0105248_10016471 Ga0105248_100164719 415
62 3300010375 Ga0105239_10156813 Ga0105239_101568131 415
63 3300013297 Ga0157378_10169333 Ga0157378_101693332 415
64 3300013308 Ga0157375_10050753 Ga0157375_100507532 415
65 3300014326 Ga0157380_10035371 Ga0157380_100353713 415
66 3300017792 Ga0163161_10000002 Ga0163161_10000002150 415
67 3300025711 Ga0207696_1000009 Ga0207696_1000009223 415
68 3300025735 Ga0207713_1000034 Ga0207713_100003443 415
69 3300025900 Ga0207710_10000015 Ga0207710_10000015302 415
70 3300025918 Ga0207662_10000587 Ga0207662_100005872 415
71 3300025926 Ga0207659_10019038 Ga0207659_100190382 415
72 3300025933 Ga0207706_10071449 Ga0207706_100714492 415
73 3300025938 Ga0207704_10021280 Ga0207704_100212802 415
74 3300025938 Ga0207704_10023807 Ga0207704_100238071 415
75 3300025941 Ga0207711_10148097 Ga0207711_101480972 415
76 3300025960 Ga0207651_10084876 Ga0207651_100848762 415
77 3300026075 Ga0207708_10010217 Ga0207708_100102172 415
78 3300026089 Ga0207648_10014086 Ga0207648_100140863 415
79 3300026095 Ga0207676_10004754 Ga0207676_100047544 415
80 3300026121 Ga0207683_10012335 Ga0207683_100123352 415
81 3300036647 Ga0316582_0073521 Ga0316582_0073521_85_1347 415
82 3300045051 Ga0451576_0025049 Ga0451576_0025049_4138_5493 415
83 3300046453 Ga0495627_000042 Ga0495627_000042_50661_52046 415
84 3300048915 Ga0496112_0172793 Ga0496112_0172793_406_1761 415
85 3300048919 Ga0496116_0000015 Ga0496116_0000015_245998_247383 415
86 3300048920 Ga0496117_0035964 Ga0496117_0035964_2316_3701 415
87 3300048921 Ga0496118_0025190 Ga0496118_0025190_3187_4572 415
88 3300050507 nmdc:mga05p37_274897_c1 nmdc:mga05p37_274897_c1_118_1470 415
89 3300050508 nmdc:mga09592_31124_c1 nmdc:mga09592_31124_c1_1855_3207 415
90 3300050509 nmdc:mga0qj67_6220_c1 nmdc:mga0qj67_6220_c1_4428_5780 415
91 3300050510 nmdc:mga06r32_27264_c1 nmdc:mga06r32_27264_c1_2109_3461 415
92 3300006844 Ga0075428_100012456 Ga0075428_1000124562 417
93 3300006847 Ga0075431_100001340 Ga0075431_10000134020 417
94 3300006880 Ga0075429_100030769 Ga0075429_1000307692 417
95 3300006946 Ga0079104_1001357 Ga0079104_10013572 417
96 3300009011 Ga0105251_10001329 Ga0105251_1000132919 417
97 3300009147 Ga0114129_10030611 Ga0114129_100306112 417
98 3300009174 Ga0105241_10000008 Ga0105241_1000000899 417
99 3300013100 Ga0157373_10003379 Ga0157373_100033795 417
100 3300014497 Ga0182008_10004887 Ga0182008_100048875 417
101 3300025735 Ga0207713_1000055 Ga0207713_100005530 417
102 3300025911 Ga0207654_10000009 Ga0207654_1000000999 417
103 3300025937 Ga0207669_10041781 Ga0207669_100417811 417
104 3300027111 Ga0209281_1000054 Ga0209281_100005482 417
105 3300042006 Ga0439432_001436 Ga0439432_001436_3986_5371 417
106 3300046530 Ga0495654_0000342 Ga0495654_0000342_10276_11661 417
107 3300046794 Ga0495589_0000005 Ga0495589_0000005_348668_350053 417
108 3300050507 nmdc:mga05p37_19353_c1 nmdc:mga05p37_19353_c1_3371_4810 417
109 3300050508 nmdc:mga09592_28298_c1 nmdc:mga09592_28298_c1_841_2280 417
110 3300050510 nmdc:mga06r32_3756_c1 nmdc:mga06r32_3756_c1_9021_10460 417
111 3300005335 Ga0070666_10191832 Ga0070666_101918321 418
112 3300005336 Ga0070680_100059561 Ga0070680_1000595612 418
113 3300005344 Ga0070661_100047460 Ga0070661_1000474603 418
114 3300005347 Ga0070668_100057066 Ga0070668_1000570662 418
115 3300005355 Ga0070671_100094508 Ga0070671_1000945081 418
116 3300005458 Ga0070681_10060863 Ga0070681_100608632 418
117 3300005459 Ga0068867_100010572 Ga0068867_1000105724 418
118 3300005535 Ga0070684_100000467 Ga0070684_10000046713 418
119 3300005719 Ga0068861_100004021 Ga0068861_1000040219 418
120 3300005719 Ga0068861_100011531 Ga0068861_1000115312 418
121 3300005844 Ga0068862_100001479 Ga0068862_10000147915 418
122 3300006844 Ga0075428_100048459 Ga0075428_1000484593 418
123 3300006847 Ga0075431_100059794 Ga0075431_1000597942 418
124 3300006880 Ga0075429_100052454 Ga0075429_1000524544 418
125 3300009553 Ga0105249_10020809 Ga0105249_100208092 418
126 3300025917 Ga0207660_10020250 Ga0207660_100202503 418
127 3300025923 Ga0207681_10144340 Ga0207681_101443401 418
128 3300025972 Ga0207668_10046286 Ga0207668_100462862 418
129 3300025981 Ga0207640_10178991 Ga0207640_101789912 418
130 3300026116 Ga0207674_10008222 Ga0207674_1000822210 418
131 3300026116 Ga0207674_10030134 Ga0207674_100301344 418
132 3300026118 Ga0207675_100001821 Ga0207675_1000018212 418
133 3300028380 Ga0268265_10002577 Ga0268265_100025777 418
134 3300048911 Ga0496108_0019313 Ga0496108_0019313_1041_2396 418
135 3300014325 Ga0163163_10074241 Ga0163163_100742412 419
136 3300026116 Ga0207674_10083479 Ga0207674_100834793 419
137 3300031548 Ga0307408_100053815 Ga0307408_1000538151 419
138 3300031901 Ga0307406_10120842 Ga0307406_101208422 419
139 3300046458 Ga0495591_037934 Ga0495591_037934_54_1313 419
140 3300046507 Ga0495606_0082560 Ga0495606_0082560_66_1325 419
141 3300046515 Ga0495620_0034874 Ga0495620_0034874_35_1294 419
142 3300046665 Ga0495661_0073244 Ga0495661_0073244_662_1921 419
143 3300048924 Ga0496121_0086603 Ga0496121_0086603_55_1314 419
144 3300009147 Ga0114129_10053237 Ga0114129_100532372 420
145 3300027907 Ga0207428_10003747 Ga0207428_100037479 420
146 3300050507 nmdc:mga05p37_19948_c1 nmdc:mga05p37_19948_c1_1151_2506 420
147 3300050511 nmdc:mga08y16_32843_c1 nmdc:mga08y16_32843_c1_308_1663 420
148 3300006852 Ga0075433_10000312 Ga0075433_100003124 421
149 3300006871 Ga0075434_100000027 Ga0075434_1000000279 421
150 3300031824 Ga0307413_10003575 Ga0307413_100035756 421
151 3300031903 Ga0307407_10010041 Ga0307407_100100412 421
152 3300031995 Ga0307409_100010789 Ga0307409_1000107895 421
153 3300050512 nmdc:mga0n895_3290_c1 nmdc:mga0n895_3290_c1_323_1678 421
154 3300050515 nmdc:mga0a205_87_c1 nmdc:mga0a205_87_c1_2664_4019 421
155 3300006844 Ga0075428_100020740 Ga0075428_1000207402 422
156 3300006846 Ga0075430_100001404 Ga0075430_10000140414 422
157 3300006847 Ga0075431_100001947 Ga0075431_1000019472 422
158 3300006880 Ga0075429_100001396 Ga0075429_1000013962 422
159 3300009094 Ga0111539_10036780 Ga0111539_100367804 422
160 3300009147 Ga0114129_10001665 Ga0114129_100016652 422
161 3300050507 nmdc:mga05p37_484_c1 nmdc:mga05p37_484_c1_12293_13648 422
162 3300050508 nmdc:mga09592_567_c1 nmdc:mga09592_567_c1_4358_5713 422
163 3300050509 nmdc:mga0qj67_325_c1 nmdc:mga0qj67_325_c1_15106_16461 422
164 3300050510 nmdc:mga06r32_461_c1 nmdc:mga06r32_461_c1_15106_16461 422
165 3300042439 Ga0439464_0011656 Ga0439464_0011656_343_1614 423
166 3300046518 Ga0495631_0000953 Ga0495631_0000953_9188_10555 423
167 3300028800 Ga0265338_10034880 Ga0265338_100348804 424
168 iso_pu_bacteria 2547132416 2548650853 424
169 3300048923 Ga0496120_0001006 Ga0496120_0001006_17391_18731 426
170 3300048927 Ga0496124_0000058 Ga0496124_0000058_14485_15825 426
171 3300009094 Ga0111539_10006906 Ga0111539_1000690611 427
172 3300021377 Ga0213874_10001232 Ga0213874_100012323 427
173 3300039450 Ga0436363_0467135 Ga0436363_0467135_7374_8717 427
174 3300005330 Ga0070690_100006908 Ga0070690_1000069082 428
175 3300005334 Ga0068869_100104039 Ga0068869_1001040392 428
176 3300005340 Ga0070689_100005286 Ga0070689_1000052866 428
177 3300005544 Ga0070686_100011149 Ga0070686_1000111492 428
178 3300005545 Ga0070695_100046114 Ga0070695_1000461142 428
179 3300005719 Ga0068861_100027143 Ga0068861_1000271432 428
180 3300005841 Ga0068863_100108942 Ga0068863_1001089423 428
181 3300005844 Ga0068862_100026414 Ga0068862_1000264142 428
182 3300025936 Ga0207670_10029178 Ga0207670_100291784 428
183 3300025942 Ga0207689_10072704 Ga0207689_100727043 428
184 3300026095 Ga0207676_10076214 Ga0207676_100762142 428
185 3300031728 Ga0316578_10002495 Ga0316578_100024952 428
186 3300031733 Ga0316577_10045816 Ga0316577_100458161 428
187 3300032139 Ga0316580_10001667 Ga0316580_100016676 428
188 3300036647 Ga0316582_0027128 Ga0316582_0027128_830_2176 428
189 3300054114 Ga0501084_0106069 Ga0501084_0106069_706_2058 428
190 3300060353 Ga0501082_0012374 Ga0501082_0012374_4033_5385 428
191 3300005840 Ga0068870_10013630 Ga0068870_100136302 429
192 3300049572 Ga0501036_0058143 Ga0501036_0058143_1900_3252 429
193 3300049587 Ga0501071_0118236 Ga0501071_0118236_175_1524 429
194 3300049588 Ga0501072_0016067 Ga0501072_0016067_3037_4386 429
195 3300049591 Ga0501075_0039592 Ga0501075_0039592_1715_3064 429
196 3300049591 Ga0501075_0056314 Ga0501075_0056314_1097_2449 429
197 3300049824 Ga0501045_0035721 Ga0501045_0035721_1403_2752 429
198 3300061734 Ga0530510_0032120 Ga0530510_0032120_2121_3470 429
199 3300005289 Ga0065704_10081710 Ga0065704_100817104 430
200 3300009094 Ga0111539_10304522 Ga0111539_103045222 430
201 3300031251 Ga0265327_10001253 Ga0265327_1000125314 430
202 3300031344 Ga0265316_10000678 Ga0265316_1000067837 430
203 3300044712 Ga0453684_0162105 Ga0453684_0162105_703_2019 430
204 3300031691 Ga0316579_10033235 Ga0316579_100332351 432
205 3300037588 Ga0316581_0001438 Ga0316581_0001438_1336_2706 432
206 3300050511 nmdc:mga08y16_29965_c1 nmdc:mga08y16_29965_c1_2838_4184 432
207 3300005719 Ga0068861_100011305 Ga0068861_1000113054 433
208 3300026118 Ga0207675_100004064 Ga0207675_1000040644 433
209 3300006058 Ga0075432_10015049 Ga0075432_100150492 434
210 3300006358 Ga0068871_100044425 Ga0068871_1000444252 434
211 3300009011 Ga0105251_10053665 Ga0105251_100536652 434
212 3300009092 Ga0105250_10020758 Ga0105250_100207582 434
213 3300025711 Ga0207696_1002003 Ga0207696_100200311 434
214 3300025986 Ga0207658_10139956 Ga0207658_101399562 434
215 3300005543 Ga0070672_100010076 Ga0070672_1000100762 435
216 3300025940 Ga0207691_10140007 Ga0207691_101400072 435
217 3300026089 Ga0207648_10042556 Ga0207648_100425562 435
218 3300031548 Ga0307408_100000020 Ga0307408_100000020304 435
219 3300031727 Ga0316576_10054196 Ga0316576_100541962 435
220 3300039062 Ga0400483_066663 Ga0400483_066663_10176_11534 435
221 3300042439 Ga0439464_0000526 Ga0439464_0000526_705_2063 435
222 3300046524 Ga0495648_0010250 Ga0495648_0010250_4802_6151 435
223 3300005544 Ga0070686_100136407 Ga0070686_1001364072 436
224 3300031595 Ga0265313_10010933 Ga0265313_100109335 436
225 3300046519 Ga0495632_0035855 Ga0495632_0035855_419_1765 436
226 3300049571 Ga0501034_0143928 Ga0501034_0143928_885_2261 436
227 3300013308 Ga0157375_10419875 Ga0157375_104198752 438
228 3300013100 Ga0157373_10076973 Ga0157373_100769732 439
229 3300032137 Ga0316585_10020355 Ga0316585_100203552 439
230 3300035398 Ga0316574_0002733 Ga0316574_0002733_1536_2906 439
231 3300003320 rootH2_10020955 rootH2_1002095521 440
232 3300006051 Ga0075364_10018721 Ga0075364_100187213 440
233 3300006946 Ga0079104_1000403 Ga0079104_100040341 440
234 3300006946 Ga0079104_1000629 Ga0079104_100062917 440
235 3300009011 Ga0105251_10000710 Ga0105251_1000071011 440
236 3300009036 Ga0105244_10000615 Ga0105244_100006155 440
237 3300009036 Ga0105244_10001840 Ga0105244_100018403 440
238 3300009036 Ga0105244_10004900 Ga0105244_1000490010 440
239 3300009092 Ga0105250_10004784 Ga0105250_100047842 440
240 3300025711 Ga0207696_1003815 Ga0207696_10038156 440
241 3300025728 Ga0207655_1000054 Ga0207655_1000054207 440
242 3300025728 Ga0207655_1008543 Ga0207655_10085436 440
243 3300025735 Ga0207713_1000836 Ga0207713_10008369 440
244 3300027111 Ga0209281_1000120 Ga0209281_100012094 440
245 3300027111 Ga0209281_1000854 Ga0209281_100085422 440
246 3300027312 Ga0209371_1000054 Ga0209371_1000054111 440
247 3300027312 Ga0209371_1017337 Ga0209371_10173372 440
248 3300030500 Ga0268256_1000012 Ga0268256_1000012582 440
249 3300036647 Ga0316582_0054182 Ga0316582_0054182_227_1594 440
250 3300036712 Ga0316584_0123479 Ga0316584_0123479_182_1576 440
251 3300044669 Ga0466981_0000014 Ga0466981_0000014_68517_69902 440
252 3300046515 Ga0495620_0004878 Ga0495620_0004878_2063_3445 440
253 3300046515 Ga0495620_0006041 Ga0495620_0006041_3693_5015 440
254 3300046694 Ga0495649_0005123 Ga0495649_0005123_6873_8255 440
255 3300048922 Ga0496119_0001418 Ga0496119_0001418_26154_27539 440
256 3300048923 Ga0496120_0001022 Ga0496120_0001022_15324_16709 440
257 3300049592 Ga0501076_0005334 Ga0501076_0005334_2777_4126 440
258 3300060353 Ga0501082_0025185 Ga0501082_0025185_1481_2830 440
259 iso_pu_bacteria 2687453129 2687580761 440
260 3300005545 Ga0070695_100181028 Ga0070695_1001810281 441
261 3300006946 Ga0079104_1000046 Ga0079104_100004654 441
262 3300027111 Ga0209281_1000022 Ga0209281_100002256 441
263 3300027312 Ga0209371_1000123 Ga0209371_100012345 441
264 3300027312 Ga0209371_1000246 Ga0209371_100024661 441
265 3300030500 Ga0268256_1000095 Ga0268256_100009543 441
266 3300030500 Ga0268256_1000225 Ga0268256_10002256 441
267 3300031456 Ga0307513_10013189 Ga0307513_1001318910 441
268 3300039437 Ga0436365_1036887 Ga0436365_1036887_1419_2774 441
269 3300042010 Ga0439452_000497 Ga0439452_000497_17255_18637 441
270 3300046512 Ga0495610_0007886 Ga0495610_0007886_5418_6785 441
271 3300046513 Ga0495616_0000964 Ga0495616_0000964_1617_2966 441
272 3300046530 Ga0495654_0006155 Ga0495654_0006155_667_2034 441
273 3300046694 Ga0495649_0009541 Ga0495649_0009541_2972_4339 441
274 3300048091 Ga0495626_0005862 Ga0495626_0005862_212_1579 441
275 3300049459 Ga0495678_045975 Ga0495678_045975_140_1507 441
276 3300003856 Ga0058692_1009390 Ga0058692_10093902 442
277 3300005289 Ga0065704_10003505 Ga0065704_100035054 442
278 3300005337 Ga0070682_100011000 Ga0070682_1000110003 442
279 3300005366 Ga0070659_100019863 Ga0070659_1000198633 442
280 3300005459 Ga0068867_100078602 Ga0068867_1000786022 442
281 3300005548 Ga0070665_100000140 Ga0070665_10000014015 442
282 3300005577 Ga0068857_100001114 Ga0068857_1000011149 442
283 3300005834 Ga0068851_10008159 Ga0068851_100081592 442
284 3300006051 Ga0075364_10006790 Ga0075364_100067905 442
285 3300006946 Ga0079104_1012495 Ga0079104_10124952 442
286 3300009011 Ga0105251_10006362 Ga0105251_100063623 442
287 3300009011 Ga0105251_10011861 Ga0105251_100118612 442
288 3300009092 Ga0105250_10009365 Ga0105250_100093652 442
289 3300009093 Ga0105240_10179548 Ga0105240_101795482 442
290 3300009148 Ga0105243_10099694 Ga0105243_100996942 442
291 3300013104 Ga0157370_10010499 Ga0157370_100104996 442
292 3300015679 Ga0183366_1003 Ga0183366_1003200 442
293 3300015680 Ga0183370_1003 Ga0183370_1003220 442
294 3300015685 Ga0183369_1005 Ga0183369_1005220 442
295 3300015687 Ga0183368_1006 Ga0183368_1006199 442
296 3300025735 Ga0207713_1000046 Ga0207713_1000046107 442
297 3300025735 Ga0207713_1008121 Ga0207713_10081212 442
298 3300025735 Ga0207713_1014889 Ga0207713_10148891 442
299 3300025923 Ga0207681_10102082 Ga0207681_101020822 442
300 3300025932 Ga0207690_10020833 Ga0207690_100208333 442
301 3300025935 Ga0207709_10085647 Ga0207709_100856472 442
302 3300025942 Ga0207689_10069125 Ga0207689_100691252 442
303 3300026116 Ga0207674_10002994 Ga0207674_1000299413 442
304 3300027111 Ga0209281_1000489 Ga0209281_10004895 442
305 3300027312 Ga0209371_1000030 Ga0209371_1000030135 442
306 3300027312 Ga0209371_1000111 Ga0209371_100011162 442
307 3300027312 Ga0209371_1001384 Ga0209371_10013842 442
308 3300028379 Ga0268266_10000143 Ga0268266_10000143131 442
309 3300030500 Ga0268256_1000025 Ga0268256_1000025188 442
310 3300030500 Ga0268256_1001189 Ga0268256_10011892 442
311 3300030500 Ga0268256_1002999 Ga0268256_10029994 442
312 3300031507 Ga0307509_10024054 Ga0307509_100240541 442
313 3300031727 Ga0316576_10023926 Ga0316576_100239262 442
314 3300031903 Ga0307407_10036565 Ga0307407_100365652 442
315 3300031995 Ga0307409_100139812 Ga0307409_1001398122 442
316 3300032005 Ga0307411_10003528 Ga0307411_100035281 442
317 3300032133 Ga0316583_10038853 Ga0316583_100388531 442
318 3300042010 Ga0439452_000306 Ga0439452_000306_25096_26481 442
319 3300046460 Ga0495638_0016034 Ga0495638_0016034_1360_2706 442
320 3300046471 Ga0495650_0000028 Ga0495650_0000028_199443_200828 442
321 3300046692 Ga0495671_0046150 Ga0495671_0046150_741_2084 442
322 3300048907 Ga0496104_0000302 Ga0496104_0000302_26053_27438 442
323 3300048919 Ga0496116_0033570 Ga0496116_0033570_704_2089 442
324 3300048919 Ga0496116_0054828 Ga0496116_0054828_1219_2604 442
325 3300048920 Ga0496117_0000183 Ga0496117_0000183_14629_16014 442
326 3300048921 Ga0496118_0003804 Ga0496118_0003804_3467_4852 442
327 3300048922 Ga0496119_0002989 Ga0496119_0002989_8435_9820 442
328 3300048922 Ga0496119_0002994 Ga0496119_0002994_4682_6067 442
329 3300048923 Ga0496120_0006711 Ga0496120_0006711_4056_5441 442
330 3300048924 Ga0496121_0004084 Ga0496121_0004084_9652_11037 442
331 3300048924 Ga0496121_0030100 Ga0496121_0030100_377_1762 442
332 3300048925 Ga0496122_0001095 Ga0496122_0001095_28841_30226 442
333 3300048925 Ga0496122_0020330 Ga0496122_0020330_512_1897 442
334 3300048926 Ga0496123_0000377 Ga0496123_0000377_15970_17355 442
335 3300048926 Ga0496123_0117516 Ga0496123_0117516_98_1483 442
336 3300048927 Ga0496124_0025396 Ga0496124_0025396_3604_4989 442
337 3300048927 Ga0496124_0028318 Ga0496124_0028318_380_1765 442
338 3300048929 Ga0496126_0003362 Ga0496126_0003362_14917_16302 442
339 3300048929 Ga0496126_0046990 Ga0496126_0046990_45_1430 442
340 3300050491 nmdc:mga00v17_38473_c1 nmdc:mga00v17_38473_c1_1247_2632 442
341 iso_pu_bacteria 8016728285 8016732341 442
342 3300003322 rootL2_10024534 rootL2_100245342 443
343 3300005331 Ga0070670_100267978 Ga0070670_1002679781 443
344 3300005333 Ga0070677_10020243 Ga0070677_100202432 443
345 3300005333 Ga0070677_10023212 Ga0070677_100232121 443
346 3300005334 Ga0068869_100074554 Ga0068869_1000745542 443
347 3300005354 Ga0070675_100036052 Ga0070675_1000360522 443
348 3300005356 Ga0070674_100050836 Ga0070674_1000508361 443
349 3300005364 Ga0070673_100043702 Ga0070673_1000437022 443
350 3300005364 Ga0070673_100056427 Ga0070673_1000564272 443
351 3300005365 Ga0070688_100052647 Ga0070688_1000526471 443
352 3300005367 Ga0070667_100132022 Ga0070667_1001320221 443
353 3300005456 Ga0070678_100018584 Ga0070678_1000185841 443
354 3300005548 Ga0070665_100002747 Ga0070665_1000027477 443
355 3300005719 Ga0068861_100051048 Ga0068861_1000510482 443
356 3300005841 Ga0068863_100078440 Ga0068863_1000784402 443
357 3300006051 Ga0075364_10004905 Ga0075364_100049053 443
358 3300006946 Ga0079104_1001144 Ga0079104_10011442 443
359 3300009036 Ga0105244_10000097 Ga0105244_1000009776 443
360 3300014325 Ga0163163_10206140 Ga0163163_102061401 443
361 3300025711 Ga0207696_1002325 Ga0207696_10023255 443
362 3300025728 Ga0207655_1000017 Ga0207655_1000017302 443
363 3300025728 Ga0207655_1000146 Ga0207655_100014677 443
364 3300025893 Ga0207682_10003524 Ga0207682_100035242 443
365 3300025893 Ga0207682_10013434 Ga0207682_100134341 443
366 3300025908 Ga0207643_10003398 Ga0207643_100033982 443
367 3300025937 Ga0207669_10017376 Ga0207669_100173763 443
368 3300025940 Ga0207691_10012956 Ga0207691_100129568 443
369 3300025940 Ga0207691_10041982 Ga0207691_100419822 443
370 3300025940 Ga0207691_10083144 Ga0207691_100831442 443
371 3300025942 Ga0207689_10055918 Ga0207689_100559183 443
372 3300025960 Ga0207651_10008259 Ga0207651_100082596 443
373 3300026088 Ga0207641_10033914 Ga0207641_100339142 443
374 3300026118 Ga0207675_100072804 Ga0207675_1000728042 443
375 3300026118 Ga0207675_100172203 Ga0207675_1001722032 443
376 3300026121 Ga0207683_10033133 Ga0207683_100331331 443
377 3300026121 Ga0207683_10048422 Ga0207683_100484223 443
378 3300027111 Ga0209281_1000223 Ga0209281_100022335 443
379 3300031456 Ga0307513_10014340 Ga0307513_100143406 443
380 3300031456 Ga0307513_10059559 Ga0307513_100595593 443
381 3300031665 Ga0316575_10000890 Ga0316575_100008902 443
382 3300041460 Ga0451802_0783281 Ga0451802_0783281_385_1731 443
383 3300041460 Ga0451802_1689586 Ga0451802_1689586_638_1987 443
384 3300041491 Ga0451833_1230775 Ga0451833_1230775_139_1485 443
385 3300041494 Ga0451837_1364909 Ga0451837_1364909_682_2028 443
386 3300044673 Ga0453683_0005511 Ga0453683_0005511_4055_5407 443
387 3300046458 Ga0495591_000231 Ga0495591_000231_4486_5868 443
388 3300048921 Ga0496118_0022852 Ga0496118_0022852_3315_4697 443
389 3300048924 Ga0496121_0007929 Ga0496121_0007929_1480_2862 443
390 3300048925 Ga0496122_0000075 Ga0496122_0000075_38567_39949 443
391 3300048926 Ga0496123_0000019 Ga0496123_0000019_131586_132968 443
392 3300048928 Ga0496125_0018591 Ga0496125_0018591_1004_2386 443
393 3300049583 Ga0501067_0012117 Ga0501067_0012117_2798_4144 443
394 3300049584 Ga0501068_0001066 Ga0501068_0001066_2757_4103 443
395 3300049585 Ga0501069_0046607 Ga0501069_0046607_136_1482 443
396 3300049586 Ga0501070_0021040 Ga0501070_0021040_3121_4467 443
397 3300049587 Ga0501071_0012220 Ga0501071_0012220_2798_4144 443
398 3300049589 Ga0501073_0002866 Ga0501073_0002866_6131_7477 443
399 3300049590 Ga0501074_0000122 Ga0501074_0000122_14831_16177 443
400 3300049592 Ga0501076_0017475 Ga0501076_0017475_1377_2723 443
401 3300049593 Ga0501077_0007570 Ga0501077_0007570_4302_5648 443
402 3300049741 Ga0501079_0001011 Ga0501079_0001011_8190_9536 443
403 3300049742 Ga0501080_0003163 Ga0501080_0003163_3373_4719 443
404 3300053104 Ga0500556_0000319 Ga0500556_0000319_12588_13970 443
405 3300054114 Ga0501084_0019612 Ga0501084_0019612_1558_2904 443
406 3300061734 Ga0530510_0082637 Ga0530510_0082637_73_1419 443
407 3300001989 JGI24739J22299_10000026 JGI24739J22299_1000002614 444
408 3300002737 JGI25162J39368_1003143 JGI25162J39368_10031435 444
409 3300002773 JGI25152J39213_1000281 JGI25152J39213_100028137 444
410 3300003856 Ga0058692_1001642 Ga0058692_10016425 444
411 3300003856 Ga0058692_1002000 Ga0058692_10020003 444
412 3300003856 Ga0058692_1005897 Ga0058692_10058973 444
413 3300005328 Ga0070676_10156944 Ga0070676_101569441 444
414 3300005347 Ga0070668_100050241 Ga0070668_1000502412 444
415 3300005457 Ga0070662_100003827 Ga0070662_1000038278 444
416 3300007788 Ga0099795_10000201 Ga0099795_100002011 444
417 3300009011 Ga0105251_10001996 Ga0105251_100019963 444
418 3300009036 Ga0105244_10002310 Ga0105244_100023109 444
419 3300010159 Ga0099796_10023572 Ga0099796_100235721 444
420 3300013102 Ga0157371_10007305 Ga0157371_100073057 444
421 3300013104 Ga0157370_10004274 Ga0157370_1000427412 444
422 3300013105 Ga0157369_10000183 Ga0157369_1000018352 444
423 3300013306 Ga0163162_10017327 Ga0163162_100173272 444
424 3300013307 Ga0157372_10001322 Ga0157372_1000132220 444
425 3300025233 Ga0209437_100063 Ga0209437_100063116 444
426 3300025258 Ga0209129_1000008 Ga0209129_1000008392 444
427 3300025711 Ga0207696_1006244 Ga0207696_10062443 444
428 3300025728 Ga0207655_1003272 Ga0207655_10032724 444
429 3300025735 Ga0207713_1000007 Ga0207713_1000007193 444
430 3300025735 Ga0207713_1003863 Ga0207713_10038637 444
431 3300025933 Ga0207706_10020376 Ga0207706_100203764 444
432 3300025939 Ga0207665_10074271 Ga0207665_100742712 444
433 3300025972 Ga0207668_10028388 Ga0207668_100283882 444
434 3300027312 Ga0209371_1000014 Ga0209371_1000014188 444
435 3300027312 Ga0209371_1000241 Ga0209371_10002415 444
436 3300027312 Ga0209371_1001635 Ga0209371_100163512 444
437 3300027312 Ga0209371_1010019 Ga0209371_10100192 444
438 3300028379 Ga0268266_10071137 Ga0268266_100711372 444
439 3300030500 Ga0268256_1000021 Ga0268256_1000021182 444
440 3300030500 Ga0268256_1000200 Ga0268256_10002005 444
441 3300030500 Ga0268256_1002901 Ga0268256_10029017 444
442 3300030500 Ga0268256_1007797 Ga0268256_10077972 444
443 3300031730 Ga0307516_10000171 Ga0307516_100001714 444
444 3300035111 Ga0373923_0034671 Ga0373923_0034671_604_1959 444
445 3300035410 Ga0373924_0019116 Ga0373924_0019116_1284_2639 444
446 3300037068 Ga0373925_0108113 Ga0373925_0108113_197_1552 444
447 3300041411 Ga0439466_0000002 Ga0439466_0000002_343803_345185 444
448 3300042006 Ga0439432_003043 Ga0439432_003043_1156_2538 444
449 3300042010 Ga0439452_000004 Ga0439452_000004_515836_517218 444
450 3300042010 Ga0439452_000005 Ga0439452_000005_215434_216822 444
451 3300042010 Ga0439452_000041 Ga0439452_000041_5076_6461 444
452 3300042016 Ga0439463_006772 Ga0439463_006772_733_2115 444
453 3300042146 Ga0450907_000244 Ga0450907_000244_1905_3287 444
454 3300042439 Ga0439464_0006608 Ga0439464_0006608_444_1826 444
455 3300042876 Ga0451577_0001360 Ga0451577_0001360_27767_29125 444
456 3300044712 Ga0453684_0003877 Ga0453684_0003877_3802_5160 444
457 3300047320 Ga0495672_0000054 Ga0495672_0000054_1955_3337 444
458 3300047446 Ga0495679_000923 Ga0495679_000923_8937_10319 444
459 3300047469 Ga0495673_0032490 Ga0495673_0032490_11_1360 444
460 3300048903 Ga0496100_0018550 Ga0496100_0018550_1036_2418 444
461 3300048905 Ga0496102_0058604 Ga0496102_0058604_808_2190 444
462 3300048907 Ga0496104_0003933 Ga0496104_0003933_10746_12101 444
463 3300048908 Ga0496105_0003806 Ga0496105_0003806_5958_7313 444
464 3300048910 Ga0496107_0076292 Ga0496107_0076292_536_1891 444
465 3300048917 Ga0496114_0005875 Ga0496114_0005875_7396_8751 444
466 3300048919 Ga0496116_0000904 Ga0496116_0000904_3735_5117 444
467 3300048920 Ga0496117_0000103 Ga0496117_0000103_52690_54072 444
468 3300048920 Ga0496117_0000238 Ga0496117_0000238_88701_90083 444
469 3300048920 Ga0496117_0001664 Ga0496117_0001664_24429_25781 444
470 3300048920 Ga0496117_0003235 Ga0496117_0003235_4835_6217 444
471 3300048920 Ga0496117_0004149 Ga0496117_0004149_9526_10914 444
472 3300048921 Ga0496118_0000046 Ga0496118_0000046_135157_136539 444
473 3300048921 Ga0496118_0001062 Ga0496118_0001062_39587_40969 444
474 3300048921 Ga0496118_0002946 Ga0496118_0002946_5280_6668 444
475 3300048921 Ga0496118_0003831 Ga0496118_0003831_13984_15366 444
476 3300048922 Ga0496119_0000026 Ga0496119_0000026_124655_126043 444
477 3300048922 Ga0496119_0000374 Ga0496119_0000374_34233_35615 444
478 3300048922 Ga0496119_0002255 Ga0496119_0002255_140_1522 444
479 3300048923 Ga0496120_0000491 Ga0496120_0000491_34245_35627 444
480 3300048923 Ga0496120_0000806 Ga0496120_0000806_27080_28462 444
481 3300048923 Ga0496120_0002864 Ga0496120_0002864_13164_14552 444
482 3300048924 Ga0496121_0001130 Ga0496121_0001130_43478_44860 444
483 3300048926 Ga0496123_0035936 Ga0496123_0035936_1239_2627 444
484 3300048927 Ga0496124_0000965 Ga0496124_0000965_2017_3399 444
485 3300048927 Ga0496124_0014414 Ga0496124_0014414_1850_3238 444
486 3300048928 Ga0496125_0018484 Ga0496125_0018484_273_1661 444
487 3300048929 Ga0496126_0034211 Ga0496126_0034211_2364_3752 444
488 iso_pu_bacteria 2919497567 2919498247 444
489 iso_pu_bacteria 2919688452 2919689977 444
490 3300006946 Ga0079104_1027493 Ga0079104_10274931 445
491 3300009011 Ga0105251_10002717 Ga0105251_1000271710 445
492 3300009011 Ga0105251_10051492 Ga0105251_100514922 445
493 3300009036 Ga0105244_10009602 Ga0105244_100096024 445
494 3300009092 Ga0105250_10000389 Ga0105250_1000038922 445
495 3300009092 Ga0105250_10025394 Ga0105250_100253942 445
496 3300021388 Ga0213875_10000063 Ga0213875_1000006347 445
497 3300025711 Ga0207696_1000142 Ga0207696_100014286 445
498 3300025728 Ga0207655_1000026 Ga0207655_1000026294 445
499 3300025728 Ga0207655_1009011 Ga0207655_10090112 445
500 3300025735 Ga0207713_1007420 Ga0207713_10074203 445
501 3300026121 Ga0207683_10146037 Ga0207683_101460371 445
502 3300027111 Ga0209281_1000384 Ga0209281_100038460 445
503 3300027111 Ga0209281_1001588 Ga0209281_10015885 445
504 3300031456 Ga0307513_10137244 Ga0307513_101372442 445
505 3300036712 Ga0316584_0003578 Ga0316584_0003578_6771_8141 445
506 3300037853 Ga0436364_0036482 Ga0436364_0036482_141686_143389 445
507 3300044673 Ga0453683_0004190 Ga0453683_0004190_3332_4699 445
508 3300044712 Ga0453684_0000231 Ga0453684_0000231_43828_45201 445
509 3300046530 Ga0495654_0081484 Ga0495654_0081484_32_1414 445
510 3300046660 Ga0495625_0024843 Ga0495625_0024843_213_1595 445
511 3300047320 Ga0495672_0000051 Ga0495672_0000051_181125_182516 445
512 3300047446 Ga0495679_000014 Ga0495679_000014_102207_103589 445
513 3300048928 Ga0496125_0000032 Ga0496125_0000032_234502_235884 445
514 3300049573 Ga0501037_0026371 Ga0501037_0026371_1644_2996 445
515 3300049574 Ga0501038_0015356 Ga0501038_0015356_4803_6155 445
516 3300049575 Ga0501039_0007733 Ga0501039_0007733_5631_6983 445
517 3300049576 Ga0501040_0002725 Ga0501040_0002725_3531_4883 445
518 3300049577 Ga0501041_0003883 Ga0501041_0003883_3502_4854 445
519 3300049578 Ga0501042_0007640 Ga0501042_0007640_3618_4970 445
520 3300049582 Ga0501048_0011880 Ga0501048_0011880_3199_4551 445
521 3300049587 Ga0501071_0002875 Ga0501071_0002875_3665_5017 445
522 3300049588 Ga0501072_0002404 Ga0501072_0002404_9067_10419 445
523 3300049590 Ga0501074_0026163 Ga0501074_0026163_995_2347 445
524 3300049591 Ga0501075_0003232 Ga0501075_0003232_9174_10526 445
525 3300049592 Ga0501076_0006170 Ga0501076_0006170_3982_5334 445
526 3300049593 Ga0501077_0004666 Ga0501077_0004666_1914_3266 445
527 3300049741 Ga0501079_0000691 Ga0501079_0000691_2114_3466 445
528 3300049742 Ga0501080_0014035 Ga0501080_0014035_683_2035 445
529 3300049743 Ga0501081_0006439 Ga0501081_0006439_3387_4739 445
530 3300049822 Ga0501035_0068049 Ga0501035_0068049_1657_3009 445
531 3300049824 Ga0501045_0003649 Ga0501045_0003649_9087_10439 445
532 3300054114 Ga0501084_0001911 Ga0501084_0001911_4846_6198 445
533 3300061734 Ga0530510_0007950 Ga0530510_0007950_3401_4753 445
534 iso_pu_bacteria 2690315857 2691331615 445
535 iso_pu_bacteria 2881714928 2881716625 445
536 iso_pu_bacteria 2887630918 2887632296 445
537 iso_pu_bacteria 2919493220 2919496718 445
538 iso_pu_bacteria 2919534386 2919536877 445
539 iso_pu_bacteria 2919543075 2919545294 445
540 iso_pu_bacteria 2923525760 2923526961 445
541 iso_pu_bacteria 2952252522 2952255917 445
542 iso_pu_bacteria 8054357960 8054360714 445
543 3300006946 Ga0079104_1000656 Ga0079104_100065620 446
544 3300027111 Ga0209281_1000145 Ga0209281_1000145142 446
545 3300031250 Ga0265331_10019997 Ga0265331_100199972 446
546 3300031251 Ga0265327_10000044 Ga0265327_10000044195 446
547 3300031548 Ga0307408_100000091 Ga0307408_10000009176 446
548 3300031727 Ga0316576_10063714 Ga0316576_100637143 446
549 3300036712 Ga0316584_0124694 Ga0316584_0124694_504_1889 446
550 3300042156 Ga0439446_0009320 Ga0439446_0009320_778_2145 446
551 3300048920 Ga0496117_0007955 Ga0496117_0007955_4578_5963 446
552 3300048924 Ga0496121_0005503 Ga0496121_0005503_575_1960 446
553 iso_pu_bacteria 2554235132 2554817587 446
554 iso_pu_bacteria 2606217733 2608382744 446
555 iso_pu_bacteria 8057160832 8057163537 446
556 3300025915 Ga0207693_10029146 Ga0207693_100291462 447
557 3300025929 Ga0207664_10013185 Ga0207664_100131853 447
558 3300028573 Ga0265334_10000010 Ga0265334_1000001079 447
559 3300031595 Ga0265313_10000068 Ga0265313_100000682 447
560 3300031728 Ga0316578_10011385 Ga0316578_100113851 447
561 3300035695 Ga0373927_0000002 Ga0373927_0000002_860704_862059 447
562 3300036712 Ga0316584_0007566 Ga0316584_0007566_1179_2666 447
563 3300049588 Ga0501072_0040567 Ga0501072_0040567_1621_2970 447
564 3300061734 Ga0530510_0086299 Ga0530510_0086299_667_2016 447
565 3300005288 Ga0065714_10067601 Ga0065714_100676014 448
566 3300005331 Ga0070670_100000134 Ga0070670_10000013447 448
567 3300005335 Ga0070666_10008719 Ga0070666_100087196 448
568 3300005353 Ga0070669_100009888 Ga0070669_1000098886 448
569 3300005355 Ga0070671_100000279 Ga0070671_10000027922 448
570 3300005367 Ga0070667_100000060 Ga0070667_100000060135 448
571 3300005466 Ga0070685_10000063 Ga0070685_1000006333 448
572 3300005617 Ga0068859_100120445 Ga0068859_1001204452 448
573 3300005618 Ga0068864_100000143 Ga0068864_10000014346 448
574 3300005843 Ga0068860_100008811 Ga0068860_1000088111 448
575 3300005844 Ga0068862_100000759 Ga0068862_1000007596 448
576 3300006931 Ga0097620_100120447 Ga0097620_1001204472 448
577 3300014325 Ga0163163_10000778 Ga0163163_100007787 448
578 3300014745 Ga0157377_10022910 Ga0157377_100229102 448
579 3300025735 Ga0207713_1000419 Ga0207713_100041918 448
580 3300025900 Ga0207710_10043778 Ga0207710_100437782 448
581 3300025923 Ga0207681_10007277 Ga0207681_100072776 448
582 3300025925 Ga0207650_10000013 Ga0207650_1000001323 448
583 3300025926 Ga0207659_10072315 Ga0207659_100723152 448
584 3300025931 Ga0207644_10000282 Ga0207644_1000028222 448
585 3300025940 Ga0207691_10078998 Ga0207691_100789982 448
586 3300025941 Ga0207711_10002362 Ga0207711_100023623 448
587 3300025986 Ga0207658_10000005 Ga0207658_1000000524 448
588 3300026035 Ga0207703_10003380 Ga0207703_1000338010 448
589 3300026088 Ga0207641_10126974 Ga0207641_101269742 448
590 3300026088 Ga0207641_10189471 Ga0207641_101894712 448
591 3300026095 Ga0207676_10000010 Ga0207676_10000010121 448
592 3300027312 Ga0209371_1000438 Ga0209371_100043828 448
593 3300028379 Ga0268266_10005042 Ga0268266_100050429 448
594 3300028380 Ga0268265_10000613 Ga0268265_1000061311 448
595 3300028381 Ga0268264_10000016 Ga0268264_10000016128 448
596 3300030500 Ga0268256_1005681 Ga0268256_10056813 448
597 3300031250 Ga0265331_10014725 Ga0265331_100147252 448
598 3300031251 Ga0265327_10058219 Ga0265327_100582192 448
599 3300031728 Ga0316578_10097559 Ga0316578_100975592 448
600 3300032002 Ga0307416_100005907 Ga0307416_1000059072 448
601 3300032004 Ga0307414_10142369 Ga0307414_101423691 448
602 3300032126 Ga0307415_100040227 Ga0307415_1000402272 448
603 3300032133 Ga0316583_10004776 Ga0316583_100047764 448
604 3300041408 Ga0439453_0002138 Ga0439453_0002138_1209_2561 448
605 3300042156 Ga0439446_0000257 Ga0439446_0000257_2419_3771 448
606 3300042184 Ga0450908_005394 Ga0450908_005394_565_2013 448
607 3300042436 Ga0439435_0000641 Ga0439435_0000641_1913_3265 448
608 3300042461 Ga0439460_0011233 Ga0439460_0011233_932_2284 448
609 3300042531 Ga0450918_007379 Ga0450918_007379_295_1743 448
610 3300048919 Ga0496116_0000835 Ga0496116_0000835_26028_27410 448
611 3300048922 Ga0496119_0000391 Ga0496119_0000391_53571_54953 448
612 3300048923 Ga0496120_0000317 Ga0496120_0000317_24708_26090 448
613 3300048927 Ga0496124_0024965 Ga0496124_0024965_1983_3344 448
614 3300048928 Ga0496125_0076321 Ga0496125_0076321_204_1565 448
615 3300049572 Ga0501036_0012641 Ga0501036_0012641_4579_5931 448
616 3300049573 Ga0501037_0026991 Ga0501037_0026991_971_2323 448
617 3300049574 Ga0501038_0036714 Ga0501038_0036714_2463_3815 448
618 3300049575 Ga0501039_0025995 Ga0501039_0025995_2141_3493 448
619 3300049578 Ga0501042_0084310 Ga0501042_0084310_663_2015 448
620 3300049578 Ga0501042_0135215 Ga0501042_0135215_249_1601 448
621 3300049579 Ga0501043_0111543 Ga0501043_0111543_265_1647 448
622 3300049580 Ga0501046_0070030 Ga0501046_0070030_1240_2622 448
623 3300049580 Ga0501046_0082069 Ga0501046_0082069_729_2081 448
624 3300049585 Ga0501069_0061910 Ga0501069_0061910_407_1759 448
625 3300049587 Ga0501071_0003941 Ga0501071_0003941_3878_5230 448
626 3300049588 Ga0501072_0089139 Ga0501072_0089139_931_2283 448
627 3300049589 Ga0501073_0029739 Ga0501073_0029739_1713_3095 448
628 3300049591 Ga0501075_0071097 Ga0501075_0071097_906_2258 448
629 3300049592 Ga0501076_0015408 Ga0501076_0015408_3719_5071 448
630 3300049741 Ga0501079_0056664 Ga0501079_0056664_1359_2711 448
631 3300049742 Ga0501080_0130113 Ga0501080_0130113_805_2157 448
632 3300049743 Ga0501081_0134086 Ga0501081_0134086_243_1595 448
633 3300049822 Ga0501035_0028332 Ga0501035_0028332_1701_3053 448
634 3300049823 Ga0501044_0229725 Ga0501044_0229725_403_1785 448
635 3300049824 Ga0501045_0003730 Ga0501045_0003730_4752_6104 448
636 3300053098 Ga0500650_0001226 Ga0500650_0001226_4399_5760 448
637 iso_pu_bacteria 2600254954 2600443672 448
638 iso_pu_bacteria 2600255389 2602008871 448
639 iso_pu_bacteria 2738541276 2738715384 448
640 iso_pu_bacteria 2823421272 2823425244 448
641 iso_pu_bacteria 2919501602 2919501989 448
642 iso_pu_bacteria 2926063275 2926063662 448
643 iso_pu_bacteria 8002745576 8002748048 448
644 iso_pu_bacteria 8034962539 8034963240 448
645 3300003751 Ga0055538_1000065 Ga0055538_100006538 449
646 3300003752 Ga0055539_1000099 Ga0055539_100009938 449
647 3300003756 Ga0055533_1000109 Ga0055533_100010938 449
648 3300003758 Ga0055532_1000094 Ga0055532_100009438 449
649 3300003759 Ga0055525_1000143 Ga0055525_100014338 449
650 3300003794 Ga0055531_10000266 Ga0055531_1000026610 449
651 3300003841 Ga0055541_1000066 Ga0055541_100006653 449
652 3300005288 Ga0065714_10016908 Ga0065714_100169083 449
653 3300005288 Ga0065714_10079000 Ga0065714_100790002 449
654 3300005344 Ga0070661_100000208 Ga0070661_10000020839 449
655 3300005353 Ga0070669_100000089 Ga0070669_1000000897 449
656 3300005457 Ga0070662_100000419 Ga0070662_1000004192 449
657 3300005548 Ga0070665_100080276 Ga0070665_1000802761 449
658 3300005564 Ga0070664_100000145 Ga0070664_10000014538 449
659 3300005564 Ga0070664_100147485 Ga0070664_1001474852 449
660 3300005578 Ga0068854_100007740 Ga0068854_1000077405 449
661 3300005834 Ga0068851_10000002 Ga0068851_10000002197 449
662 3300006051 Ga0075364_10112847 Ga0075364_101128471 449
663 3300009011 Ga0105251_10029578 Ga0105251_100295783 449
664 3300009036 Ga0105244_10000211 Ga0105244_1000021156 449
665 3300009036 Ga0105244_10000312 Ga0105244_1000031238 449
666 3300009036 Ga0105244_10001031 Ga0105244_1000103116 449
667 3300009092 Ga0105250_10000194 Ga0105250_100001949 449
668 3300009092 Ga0105250_10005679 Ga0105250_100056793 449
669 3300009148 Ga0105243_10022674 Ga0105243_100226743 449
670 3300009176 Ga0105242_10002635 Ga0105242_1000263510 449
671 3300009545 Ga0105237_10002302 Ga0105237_100023026 449
672 3300011119 Ga0105246_10001531 Ga0105246_100015317 449
673 3300013100 Ga0157373_10055285 Ga0157373_100552853 449
674 3300013100 Ga0157373_10095209 Ga0157373_100952093 449
675 3300013100 Ga0157373_10105067 Ga0157373_101050671 449
676 3300013102 Ga0157371_10000185 Ga0157371_1000018544 449
677 3300013104 Ga0157370_10182400 Ga0157370_101824002 449
678 3300013105 Ga0157369_10009210 Ga0157369_1000921010 449
679 3300013105 Ga0157369_10011125 Ga0157369_100111254 449
680 3300013308 Ga0157375_10028882 Ga0157375_100288823 449
681 3300014497 Ga0182008_10009700 Ga0182008_100097003 449
682 3300025206 Ga0209435_102069 Ga0209435_1020691 449
683 3300025224 Ga0209784_100101 Ga0209784_10010153 449
684 3300025225 Ga0209566_100123 Ga0209566_10012353 449
685 3300025226 Ga0209674_100145 Ga0209674_10014553 449
686 3300025229 Ga0209147_100151 Ga0209147_10015153 449
687 3300025230 Ga0209563_100128 Ga0209563_10012853 449
688 3300025242 Ga0209258_100241 Ga0209258_10024153 449
689 3300025253 Ga0209677_100094 Ga0209677_10009453 449
690 3300025256 Ga0209759_1005193 Ga0209759_10051933 449
691 3300025321 Ga0207656_10000045 Ga0207656_1000004532 449
692 3300025711 Ga0207696_1000126 Ga0207696_1000126119 449
693 3300025728 Ga0207655_1000120 Ga0207655_10001206 449
694 3300025728 Ga0207655_1000378 Ga0207655_100037847 449
695 3300025728 Ga0207655_1003230 Ga0207655_10032302 449
696 3300025728 Ga0207655_1007999 Ga0207655_10079992 449
697 3300025735 Ga0207713_1000229 Ga0207713_100022939 449
698 3300025735 Ga0207713_1000233 Ga0207713_100023324 449
699 3300025735 Ga0207713_1001606 Ga0207713_10016063 449
700 3300025914 Ga0207671_10000613 Ga0207671_1000061340 449
701 3300025920 Ga0207649_10000023 Ga0207649_10000023116 449
702 3300025923 Ga0207681_10000134 Ga0207681_1000013454 449
703 3300025925 Ga0207650_10000100 Ga0207650_1000010066 449
704 3300025933 Ga0207706_10000056 Ga0207706_1000005643 449
705 3300025934 Ga0207686_10001071 Ga0207686_100010716 449
706 3300025945 Ga0207679_10000017 Ga0207679_10000017116 449
707 3300026041 Ga0207639_10005168 Ga0207639_100051685 449
708 3300028379 Ga0268266_10043875 Ga0268266_100438753 449
709 3300031251 Ga0265327_10002604 Ga0265327_1000260414 449
710 3300031731 Ga0307405_10007687 Ga0307405_100076874 449
711 3300032133 Ga0316583_10024695 Ga0316583_100246952 449
712 3300037853 Ga0436364_0939013 Ga0436364_0939013_562_1953 449
713 3300039062 Ga0400483_028483 Ga0400483_028483_20717_22081 449
714 3300039062 Ga0400483_196526 Ga0400483_196526_21884_23248 449
715 3300039062 Ga0400483_246213 Ga0400483_246213_16347_17711 449
716 3300044712 Ga0453684_0122219 Ga0453684_0122219_1754_3121 449
717 3300045051 Ga0451576_0366787 Ga0451576_0366787_83_1450 449
718 3300046453 Ga0495627_000104 Ga0495627_000104_80004_81371 449
719 3300046453 Ga0495627_004493 Ga0495627_004493_2396_3763 449
720 3300046458 Ga0495591_000087 Ga0495591_000087_80667_82034 449
721 3300046458 Ga0495591_011840 Ga0495591_011840_1898_3265 449
722 3300046458 Ga0495591_025548 Ga0495591_025548_288_1655 449
723 3300046471 Ga0495650_0002361 Ga0495650_0002361_13122_14489 449
724 3300046474 Ga0495605_0000033 Ga0495605_0000033_1361_2728 449
725 3300046474 Ga0495605_0000140 Ga0495605_0000140_58663_60030 449
726 3300046474 Ga0495605_0006673 Ga0495605_0006673_4072_5439 449
727 3300046501 Ga0495607_0000340 Ga0495607_0000340_46936_48303 449
728 3300046501 Ga0495607_0001890 Ga0495607_0001890_240_1607 449
729 3300046506 Ga0495583_0000031 Ga0495583_0000031_251729_253096 449
730 3300046506 Ga0495583_0002043 Ga0495583_0002043_1232_2599 449
731 3300046506 Ga0495583_0020275 Ga0495583_0020275_1376_2743 449
732 3300046507 Ga0495606_0007491 Ga0495606_0007491_6469_7836 449
733 3300046512 Ga0495610_0019602 Ga0495610_0019602_887_2254 449
734 3300046515 Ga0495620_0000099 Ga0495620_0000099_1007_2374 449
735 3300046519 Ga0495632_0008850 Ga0495632_0008850_1020_2387 449
736 3300046524 Ga0495648_0011321 Ga0495648_0011321_885_2252 449
737 3300046530 Ga0495654_0004408 Ga0495654_0004408_709_2076 449
738 3300046538 Ga0495609_0000018 Ga0495609_0000018_101101_102468 449
739 3300046538 Ga0495609_0000194 Ga0495609_0000194_24813_26180 449
740 3300046542 Ga0495597_0000066 Ga0495597_0000066_66487_67854 449
741 3300046665 Ga0495661_0000336 Ga0495661_0000336_36105_37472 449
742 3300046665 Ga0495661_0001986 Ga0495661_0001986_13918_15285 449
743 3300046665 Ga0495661_0003038 Ga0495661_0003038_9354_10721 449
744 3300046691 Ga0495670_0007882 Ga0495670_0007882_2812_4179 449
745 3300046794 Ga0495589_0005996 Ga0495589_0005996_4135_5502 449
746 3300046794 Ga0495589_0014113 Ga0495589_0014113_1830_3197 449
747 3300046810 Ga0495660_0001176 Ga0495660_0001176_15743_17197 449
748 3300046810 Ga0495660_0008799 Ga0495660_0008799_1124_2491 449
749 3300047320 Ga0495672_0032984 Ga0495672_0032984_1806_3173 449
750 3300047323 Ga0495683_0000082 Ga0495683_0000082_92142_93509 449
751 3300047446 Ga0495679_000305 Ga0495679_000305_1172_2539 449
752 3300048091 Ga0495626_0005048 Ga0495626_0005048_6510_7859 449
753 3300048920 Ga0496117_0004589 Ga0496117_0004589_5068_6435 449
754 3300048920 Ga0496117_0035949 Ga0496117_0035949_726_2093 449
755 3300048920 Ga0496117_0057654 Ga0496117_0057654_151_1518 449
756 3300048921 Ga0496118_0071085 Ga0496118_0071085_1007_2374 449
757 3300048923 Ga0496120_0022993 Ga0496120_0022993_1263_2630 449
758 3300048923 Ga0496120_0026635 Ga0496120_0026635_999_2366 449
759 3300048924 Ga0496121_0052221 Ga0496121_0052221_1057_2424 449
760 3300048925 Ga0496122_0037343 Ga0496122_0037343_738_2105 449
761 3300048925 Ga0496122_0044849 Ga0496122_0044849_1807_3174 449
762 3300048926 Ga0496123_0049604 Ga0496123_0049604_639_2006 449
763 3300048927 Ga0496124_0011229 Ga0496124_0011229_1247_2614 449
764 3300048927 Ga0496124_0087110 Ga0496124_0087110_805_2172 449
765 3300048928 Ga0496125_0004777 Ga0496125_0004777_8751_10118 449
766 3300048928 Ga0496125_0058859 Ga0496125_0058859_1287_2654 449
767 3300048929 Ga0496126_0020625 Ga0496126_0020625_1295_2662 449
768 3300049459 Ga0495678_000021 Ga0495678_000021_998_2365 449
769 3300049823 Ga0501044_0000065 Ga0501044_0000065_1818_3212 449
770 3300053140 Ga0500573_0034852 Ga0500573_0034852_213_1580 449
771 iso_pu_bacteria 2510065053 2510284763 449
772 iso_pu_bacteria 2510065055 2510295076 449
773 iso_pu_bacteria 2510065058 2510312141 449
774 iso_pu_bacteria 2537561728 2538426098 449
775 iso_pu_bacteria 2565956521 2566035509 449
776 iso_pu_bacteria 2648501241 2649121488 449
777 iso_pu_bacteria 2651869818 2652974394 449
778 iso_pu_bacteria 2728369097 2729144970 449
779 iso_pu_bacteria 2773857672 2774131388 449
780 iso_pu_bacteria 2846540461 2846541001 449
781 iso_pu_bacteria 2855195626 2855197650 449
782 iso_pu_bacteria 2858466076 2858466355 449
783 iso_pu_bacteria 2871272651 2871276532 449
784 iso_pu_bacteria 2871282230 2871283863 449
785 iso_pu_bacteria 2900051742 2900056093 449
786 iso_pu_bacteria 2917832318 2917834252 449
787 iso_pu_bacteria 2919125081 2919127807 449
788 iso_pu_bacteria 2974298342 2974298593 449
789 iso_pu_bacteria 2984504281 2984505718 449
790 iso_pu_bacteria 640427133 640486901 449
791 iso_pu_bacteria 651053060 651174774 449
792 3300005295 Ga0065707_10085062 Ga0065707_100850622 450
793 3300006038 Ga0075365_10000697 Ga0075365_1000069714 450
794 3300030742 Ga0316183_1017054 Ga0316183_10170541 450
795 3300031665 Ga0316575_10057811 Ga0316575_100578111 450
796 3300031727 Ga0316576_10002258 Ga0316576_100022583 450
797 3300031727 Ga0316576_10065716 Ga0316576_100657162 450
798 3300031727 Ga0316576_10109184 Ga0316576_101091841 450
799 3300031728 Ga0316578_10011851 Ga0316578_100118512 450
800 3300031728 Ga0316578_10027858 Ga0316578_100278582 450
801 3300031733 Ga0316577_10022083 Ga0316577_100220832 450
802 3300035398 Ga0316574_0002035 Ga0316574_0002035_5859_7217 450
803 3300035398 Ga0316574_0030478 Ga0316574_0030478_1171_2529 450
804 3300046460 Ga0495638_0006800 Ga0495638_0006800_4140_5492 450
805 3300046660 Ga0495625_0001706 Ga0495625_0001706_17143_18495 450
806 3300048919 Ga0496116_0000107 Ga0496116_0000107_27596_28960 450
807 3300048924 Ga0496121_0001160 Ga0496121_0001160_27154_28518 450
808 3300050492 nmdc:mga0yw44_2366_c1 nmdc:mga0yw44_2366_c1_1519_2907 450
809 iso_pu_bacteria 2506520007 2506576642 450
810 iso_pu_bacteria 2506520008 2506581780 450
811 iso_pu_bacteria 2508501071 2508850585 450
812 iso_pu_bacteria 2511231025 2511378341 450
813 iso_pu_bacteria 2511231035 2511433816 450
814 iso_pu_bacteria 2547132181 2547696531 450
815 iso_pu_bacteria 2554235234 2555262012 450
816 iso_pu_bacteria 2561511199 2562465899 450
817 iso_pu_bacteria 2585427591 2585826215 450
818 iso_pu_bacteria 2585427592 2585830755 450
819 iso_pu_bacteria 2599185169 2599412888 450
820 iso_pu_bacteria 2599185299 2599928107 450
821 iso_pu_bacteria 2600255254 2601525641 450
822 iso_pu_bacteria 2600255255 2601530750 450
823 iso_pu_bacteria 2600255256 2601533942 450
824 iso_pu_bacteria 2600255257 2601540110 450
825 iso_pu_bacteria 2600255280 2601617761 450
826 iso_pu_bacteria 2600255281 2601622796 450
827 iso_pu_bacteria 2600255287 2601644659 450
828 iso_pu_bacteria 2600255288 2601651069 450
829 iso_pu_bacteria 2600255289 2601656118 450
830 iso_pu_bacteria 2600255290 2601661042 450
831 iso_pu_bacteria 2600255291 2601664824 450
832 iso_pu_bacteria 2600255298 2601697308 450
833 iso_pu_bacteria 2600255299 2601702696 450
834 iso_pu_bacteria 2600255300 2601708884 450
835 iso_pu_bacteria 2600255301 2601713922 450
836 iso_pu_bacteria 2600255302 2601718967 450
837 iso_pu_bacteria 2600255303 2601722645 450
838 iso_pu_bacteria 2600255304 2601728912 450
839 iso_pu_bacteria 2600255305 2601733913 450
840 iso_pu_bacteria 2600255306 2601738889 450
841 iso_pu_bacteria 2600255307 2601743303 450
842 iso_pu_bacteria 2600255309 2601754429 450
843 iso_pu_bacteria 2600255310 2601758907 450
844 iso_pu_bacteria 2600255311 2601762743 450
845 iso_pu_bacteria 2600255392 2602021370 450
846 iso_pu_bacteria 2602042046 2603640595 450
847 iso_pu_bacteria 2602042047 2603644623 450
848 iso_pu_bacteria 2602042052 2603662859 450
849 iso_pu_bacteria 2602042053 2603667756 450
850 iso_pu_bacteria 2602042066 2603700475 450
851 iso_pu_bacteria 2602042067 2603705915 450
852 iso_pu_bacteria 2602042103 2603841438 450
853 iso_pu_bacteria 2602042104 2603846433 450
854 iso_pu_bacteria 2602042105 2603851508 450
855 iso_pu_bacteria 2602042106 2603856651 450
856 iso_pu_bacteria 2602042109 2603868503 450
857 iso_pu_bacteria 2602042110 2603874155 450
858 iso_pu_bacteria 2602042111 2603878565 450
859 iso_pu_bacteria 2603880178 2606051410 450
860 iso_pu_bacteria 2603880184 2606072313 450
861 iso_pu_bacteria 2603880202 2606149096 450
862 iso_pu_bacteria 2603880211 2606179226 450
863 iso_pu_bacteria 2609459761 2609912002 450
864 iso_pu_bacteria 2636415599 2637227185 450
865 iso_pu_bacteria 2648501693 2650900237 450
866 iso_pu_bacteria 2654587920 2656276461 450
867 iso_pu_bacteria 2667528172 2671103731 450
868 iso_pu_bacteria 2667528173 2671106524 450
869 iso_pu_bacteria 2671180115 2671586837 450
870 iso_pu_bacteria 2675903046 2676409850 450
871 iso_pu_bacteria 2681812866 2681996824 450
872 iso_pu_bacteria 2681812869 2682008605 450
873 iso_pu_bacteria 2684622997 2686354476 450
874 iso_pu_bacteria 2687453601 2689443020 450
875 iso_pu_bacteria 2706794495 2707101255 450
876 iso_pu_bacteria 2711768156 2712472386 450
877 iso_pu_bacteria 2751185917 2753854543 450
878 iso_pu_bacteria 2765235842 2765587402 450
879 iso_pu_bacteria 2772190666 2772437173 450
880 iso_pu_bacteria 2775506706 2775540790 450
881 iso_pu_bacteria 2775507074 2777021583 450
882 iso_pu_bacteria 2791354903 2791924230 450
883 iso_pu_bacteria 2791355010 2792313306 450
884 iso_pu_bacteria 2791355275 2793406944 450
885 iso_pu_bacteria 2806310673 2807177931 450
886 iso_pu_bacteria 2808606379 2808942456 450
887 iso_pu_bacteria 2808606414 2809124236 450
888 iso_pu_bacteria 2811995292 2813730644 450
889 iso_pu_bacteria 2814123068 2814698251 450
890 iso_pu_bacteria 2821118458 2821121406 450
891 iso_pu_bacteria 2823373977 2823377479 450
892 iso_pu_bacteria 2844425489 2844426096 450
893 iso_pu_bacteria 2844528606 2844532622 450
894 iso_pu_bacteria 2847085930 2847089144 450
895 iso_pu_bacteria 2847797336 2847801330 450
896 iso_pu_bacteria 2852103415 2852106154 450
897 iso_pu_bacteria 2854601825 2854605141 450
898 iso_pu_bacteria 2865014394 2865018628 450
899 iso_pu_bacteria 2869551831 2869552424 450
900 iso_pu_bacteria 2876601092 2876605763 450
901 iso_pu_bacteria 2881609920 2881611773 450
902 iso_pu_bacteria 2884086401 2884090558 450
903 iso_pu_bacteria 2888366609 2888367225 450
904 iso_pu_bacteria 2891670763 2891672287 450
905 iso_pu_bacteria 2904474040 2904474328 450
906 iso_pu_bacteria 2904504865 2904507084 450
907 iso_pu_bacteria 2904513164 2904516092 450
908 iso_pu_bacteria 2908669403 2908673086 450
909 iso_pu_bacteria 2919108558 2919112807 450
910 iso_pu_bacteria 2919150387 2919150675 450
911 iso_pu_bacteria 2923634449 2923637932 450
912 iso_pu_bacteria 2927143783 2927145548 450
913 iso_pu_bacteria 2927833300 2927835629 450
914 iso_pu_bacteria 2932406140 2932406525 450
915 iso_pu_bacteria 2935625433 2935627897 450
916 iso_pu_bacteria 2937539931 2937540061 450
917 iso_pu_bacteria 2937967321 2937970780 450
918 iso_pu_bacteria 2939568625 2939571613 450
919 iso_pu_bacteria 2939573065 2939576001 450
920 iso_pu_bacteria 2939577877 2939578053 450
921 iso_pu_bacteria 2939602548 2939606612 450
922 iso_pu_bacteria 2939607340 2939609520 450
923 iso_pu_bacteria 2939617950 2939619683 450
924 iso_pu_bacteria 2939642701 2939645980 450
925 iso_pu_bacteria 2939651529 2939651985 450
926 iso_pu_bacteria 2945874760 2945879827 450
927 iso_pu_bacteria 2945951305 2945954355 450
928 iso_pu_bacteria 2969079654 2969084199 450
929 iso_pu_bacteria 2971820967 2971825706 450
930 iso_pu_bacteria 2974310843 2974313667 450
931 iso_pu_bacteria 2974435778 2974436925 450
932 iso_pu_bacteria 2984494565 2984498161 450
933 iso_pu_bacteria 2984559226 2984561279 450
934 iso_pu_bacteria 2984595703 2984599349 450
935 iso_pu_bacteria 2990196909 2990198091 450
936 iso_pu_bacteria 2990261002 2990265141 450
937 iso_pu_bacteria 3000376612 3000380561 450
938 iso_pu_bacteria 3007252601 3007255496 450
939 iso_pu_bacteria 640753048 640936178 450
940 iso_pu_bacteria 8004592986 8004597875 450
941 iso_pu_bacteria 8015394850 8015396103 450
942 iso_pu_bacteria 8016733728 8016737293 450
943 iso_pu_bacteria 8018221730 8018224969 450
944 iso_pu_bacteria 8018405270 8018409990 450
945 iso_pu_bacteria 8019499862 8019502493 450
946 iso_pu_bacteria 8019504834 8019506795 450
947 iso_pu_bacteria 8054844752 8054848626 450
948 iso_pu_bacteria 8054849141 8054850072 450
949 iso_pu_bacteria 8055087960 8055091491 450
950 iso_pu_bacteria 8055092621 8055092807 450
951 iso_pu_bacteria 8055097453 8055100707 450
952 iso_pu_bacteria 8055693939 8055697638 450
953 iso_pu_bacteria 8057304971 8057307382 450
954 3300003323 rootH1_10012389 rootH1_1001238939 451
955 3300005547 Ga0070693_100031492 Ga0070693_1000314922 451
956 3300006846 Ga0075430_100219202 Ga0075430_1002192021 451
957 3300031548 Ga0307408_100000216 Ga0307408_1000002163 451
958 3300031665 Ga0316575_10002831 Ga0316575_100028313 451
959 3300031691 Ga0316579_10062073 Ga0316579_100620731 451
960 3300031727 Ga0316576_10000354 Ga0316576_100003543 451
961 3300031728 Ga0316578_10001858 Ga0316578_100018581 451
962 3300031728 Ga0316578_10017136 Ga0316578_100171362 451
963 3300031901 Ga0307406_10075232 Ga0307406_100752322 451
964 3300032137 Ga0316585_10000461 Ga0316585_100004612 451
965 3300032139 Ga0316580_10000964 Ga0316580_100009643 451
966 3300035398 Ga0316574_0002892 Ga0316574_0002892_4927_6306 451
967 3300036647 Ga0316582_0002628 Ga0316582_0002628_6900_8279 451
968 3300036712 Ga0316584_0039754 Ga0316584_0039754_528_1955 451
969 3300036712 Ga0316584_0057190 Ga0316584_0057190_90_1469 451
970 3300042129 Ga0450891_001666 Ga0450891_001666_205_1575 451
971 3300049758 Ga0501241_002164 Ga0501241_002164_804_2174 451
972 3300050509 nmdc:mga0qj67_204369_c1 nmdc:mga0qj67_204369_c1_72_1427 451
973 3300053156 Ga0500622_0004521 Ga0500622_0004521_4245_5606 451
974 3300053156 Ga0500622_0014825 Ga0500622_0014825_2689_4050 451
975 3300053178 Ga0500637_0003153 Ga0500637_0003153_35_1399 451
976 iso_pu_bacteria 2511231004 2511252922 451
977 iso_pu_bacteria 2511231006 2511267762 451
978 iso_pu_bacteria 2511231007 2511271359 451
979 iso_pu_bacteria 2511231008 2511278493 451
980 iso_pu_bacteria 2511231010 2511287772 451
981 iso_pu_bacteria 2511231011 2511295280 451
982 iso_pu_bacteria 2511231012 2511304978 451
983 iso_pu_bacteria 2511231014 2511315860 451
984 iso_pu_bacteria 2511231015 2511323218 451
985 iso_pu_bacteria 2511231016 2511326842 451
986 iso_pu_bacteria 2511231017 2511335026 451
987 iso_pu_bacteria 2511231018 2511338322 451
988 iso_pu_bacteria 2511231019 2511344547 451
989 iso_pu_bacteria 2511231020 2511350933 451
990 iso_pu_bacteria 2511231021 2511359911 451
991 iso_pu_bacteria 2511231022 2511362053 451
992 iso_pu_bacteria 2511231023 2511370636 451
993 iso_pu_bacteria 2511231024 2511375148 451
994 iso_pu_bacteria 2511231031 2511411447 451
995 iso_pu_bacteria 2511231156 2511827069 451
996 iso_pu_bacteria 2512047018 2512324681 451
997 iso_pu_bacteria 2554235231 2555245658 451
998 iso_pu_bacteria 2554235341 2555672273 451
999 iso_pu_bacteria 2582580891 2583794760 451
1000 iso_pu_bacteria 2597489887 2597860352 451
1001 iso_pu_bacteria 2597489888 2597866087 451
1002 iso_pu_bacteria 2597489889 2597871916 451
1003 iso_pu_bacteria 2599185155 2599329471 451
1004 iso_pu_bacteria 2599185160 2599358291 451
1005 iso_pu_bacteria 2599185161 2599364640 451
1006 iso_pu_bacteria 2599185162 2599370824 451
1007 iso_pu_bacteria 2599185163 2599376846 451
1008 iso_pu_bacteria 2599185164 2599383456 451
1009 iso_pu_bacteria 2599185165 2599389903 451
1010 iso_pu_bacteria 2599185166 2599396186 451
1011 iso_pu_bacteria 2599185167 2599401450 451
1012 iso_pu_bacteria 2599185168 2599408026 451
1013 iso_pu_bacteria 2599185179 2599453137 451
1014 iso_pu_bacteria 2599185181 2599465106 451
1015 iso_pu_bacteria 2599185182 2599471415 451
1016 iso_pu_bacteria 2599185185 2599486806 451
1017 iso_pu_bacteria 2599185186 2599493979 451
1018 iso_pu_bacteria 2599185188 2599505207 451
1019 iso_pu_bacteria 2599185189 2599509885 451
1020 iso_pu_bacteria 2599185190 2599515140 451
1021 iso_pu_bacteria 2599185191 2599520305 451
1022 iso_pu_bacteria 2599185212 2599616894 451
1023 iso_pu_bacteria 2599185248 2599772862 451
1024 iso_pu_bacteria 2599185257 2599807070 451
1025 iso_pu_bacteria 2599185288 2599881742 451
1026 iso_pu_bacteria 2599185289 2599888176 451
1027 iso_pu_bacteria 2599185290 2599894520 451
1028 iso_pu_bacteria 2599185291 2599901042 451
1029 iso_pu_bacteria 2599185300 2599934525 451
1030 iso_pu_bacteria 2599185302 2599945104 451
1031 iso_pu_bacteria 2599185303 2599949367 451
1032 iso_pu_bacteria 2599185304 2599955167 451
1033 iso_pu_bacteria 2599185305 2599962772 451
1034 iso_pu_bacteria 2599185306 2599969278 451
1035 iso_pu_bacteria 2599185307 2599974515 451
1036 iso_pu_bacteria 2599185308 2599980651 451
1037 iso_pu_bacteria 2599185309 2599983900 451
1038 iso_pu_bacteria 2599185310 2599990382 451
1039 iso_pu_bacteria 2599185311 2599997382 451
1040 iso_pu_bacteria 2599185312 2600001676 451
1041 iso_pu_bacteria 2599185313 2600008417 451
1042 iso_pu_bacteria 2599185314 2600014257 451
1043 iso_pu_bacteria 2599185315 2600020834 451
1044 iso_pu_bacteria 2599185316 2600026284 451
1045 iso_pu_bacteria 2599185317 2600031790 451
1046 iso_pu_bacteria 2599185318 2600038631 451
1047 iso_pu_bacteria 2599185319 2600044079 451
1048 iso_pu_bacteria 2599185320 2600048916 451
1049 iso_pu_bacteria 2599185321 2600056100 451
1050 iso_pu_bacteria 2599185322 2600062770 451
1051 iso_pu_bacteria 2599185323 2600067767 451
1052 iso_pu_bacteria 2599185324 2600073823 451
1053 iso_pu_bacteria 2599185325 2600079508 451
1054 iso_pu_bacteria 2599185356 2600217840 451
1055 iso_pu_bacteria 2600254930 2600360316 451
1056 iso_pu_bacteria 2600254931 2600367134 451
1057 iso_pu_bacteria 2600255283 2601623443 451
1058 iso_pu_bacteria 2600255296 2601693976 451
1059 iso_pu_bacteria 2600255313 2601778007 451
1060 iso_pu_bacteria 2600255318 2601800449 451
1061 iso_pu_bacteria 2603880185 2606078743 451
1062 iso_pu_bacteria 2603880199 2606125597 451
1063 iso_pu_bacteria 2619619299 2621297377 451
1064 iso_pu_bacteria 2623620443 2624482864 451
1065 iso_pu_bacteria 2623620446 2624494405 451
1066 iso_pu_bacteria 2643221565 2643844783 451
1067 iso_pu_bacteria 2643221571 2643869677 451
1068 iso_pu_bacteria 2643221589 2643957552 451
1069 iso_pu_bacteria 2643221602 2644025666 451
1070 iso_pu_bacteria 2643221633 2644189083 451
1071 iso_pu_bacteria 2643221650 2644286008 451
1072 iso_pu_bacteria 2643221713 2644625363 451
1073 iso_pu_bacteria 2667528170 2671093936 451
1074 iso_pu_bacteria 2667528171 2671100812 451
1075 iso_pu_bacteria 2667528176 2671130436 451
1076 iso_pu_bacteria 2671180172 2671773372 451
1077 iso_pu_bacteria 2675903420 2677895801 451
1078 iso_pu_bacteria 2675903515 2678265577 451
1079 iso_pu_bacteria 2713897148 2715752300 451
1080 iso_pu_bacteria 2713897149 2715759039 451
1081 iso_pu_bacteria 2718217725 2718636078 451
1082 iso_pu_bacteria 2721755607 2723250825 451
1083 iso_pu_bacteria 2738541265 2738672898 451
1084 iso_pu_bacteria 2738541271 2738687177 451
1085 iso_pu_bacteria 2738541282 2738751291 451
1086 iso_pu_bacteria 2738541294 2738810294 451
1087 iso_pu_bacteria 2738541303 2738860332 451
1088 iso_pu_bacteria 2738541309 2738897654 451
1089 iso_pu_bacteria 2738543004 2739198196 451
1090 iso_pu_bacteria 2738543015 2739260960 451
1091 iso_pu_bacteria 2738543016 2739262798 451
1092 iso_pu_bacteria 2738543020 2739289359 451
1093 iso_pu_bacteria 2738543021 2739294671 451
1094 iso_pu_bacteria 2738543025 2739316597 451
1095 iso_pu_bacteria 2740892503 2743739894 451
1096 iso_pu_bacteria 2744054620 2745006814 451
1097 iso_pu_bacteria 2765235841 2765585975 451
1098 iso_pu_bacteria 2773857670 2774121776 451
1099 iso_pu_bacteria 2773857673 2774137019 451
1100 iso_pu_bacteria 2784132063 2784262356 451
1101 iso_pu_bacteria 2784132072 2784314439 451
1102 iso_pu_bacteria 2791355520 2794598431 451
1103 iso_pu_bacteria 2806310737 2807410289 451
1104 iso_pu_bacteria 2806310745 2807458637 451
1105 iso_pu_bacteria 2808606361 2808858154 451
1106 iso_pu_bacteria 2808606373 2808906625 451
1107 iso_pu_bacteria 2808606376 2808926776 451
1108 iso_pu_bacteria 2808606377 2808930830 451
1109 iso_pu_bacteria 2808606378 2808938369 451
1110 iso_pu_bacteria 2808606380 2808948891 451
1111 iso_pu_bacteria 2808606381 2808952952 451
1112 iso_pu_bacteria 2808606382 2808959282 451
1113 iso_pu_bacteria 2808606383 2808966639 451
1114 iso_pu_bacteria 2808606385 2808977655 451
1115 iso_pu_bacteria 2808606388 2808992687 451
1116 iso_pu_bacteria 2808606389 2809001469 451
1117 iso_pu_bacteria 2808606445 2809219313 451
1118 iso_pu_bacteria 2811994881 2812368758 451
1119 iso_pu_bacteria 2816332298 2817493516 451
1120 iso_pu_bacteria 2818991456 2819659156 451
1121 iso_pu_bacteria 2818991464 2819706480 451
1122 iso_pu_bacteria 2825651385 2825655664 451
1123 iso_pu_bacteria 2826581358 2826586429 451
1124 iso_pu_bacteria 2834028612 2834033282 451
1125 iso_pu_bacteria 2842805378 2842808095 451
1126 iso_pu_bacteria 2842815866 2842818377 451
1127 iso_pu_bacteria 2842826826 2842831568 451
1128 iso_pu_bacteria 2842832357 2842837002 451
1129 iso_pu_bacteria 2842837860 2842840391 451
1130 iso_pu_bacteria 2842843487 2842847741 451
1131 iso_pu_bacteria 2842849001 2842853713 451
1132 iso_pu_bacteria 2842854478 2842859693 451
1133 iso_pu_bacteria 2844665904 2844666444 451
1134 iso_pu_bacteria 2852612431 2852618192 451
1135 iso_pu_bacteria 2852657418 2852660989 451
1136 iso_pu_bacteria 2852667396 2852673250 451
1137 iso_pu_bacteria 2860339153 2860343849 451
1138 iso_pu_bacteria 2860867994 2860872507 451
1139 iso_pu_bacteria 2878029506 2878034797 451
1140 iso_pu_bacteria 2880230671 2880235446 451
1141 iso_pu_bacteria 2904518522 2904522988 451
1142 iso_pu_bacteria 2904550169 2904555898 451
1143 iso_pu_bacteria 2908446538 2908452023 451
1144 iso_pu_bacteria 2912963787 2912964476 451
1145 iso_pu_bacteria 2913036834 2913041990 451
1146 iso_pu_bacteria 2917070673 2917076154 451
1147 iso_pu_bacteria 2919063839 2919067821 451
1148 iso_pu_bacteria 2919155634 2919156523 451
1149 iso_pu_bacteria 2919385768 2919390709 451
1150 iso_pu_bacteria 2919456309 2919461781 451
1151 iso_pu_bacteria 2919481497 2919485829 451
1152 iso_pu_bacteria 2919487758 2919490988 451
1153 iso_pu_bacteria 2919697872 2919701494 451
1154 iso_pu_bacteria 2923153595 2923158984 451
1155 iso_pu_bacteria 2923519811 2923522823 451
1156 iso_pu_bacteria 2923586266 2923590949 451
1157 iso_pu_bacteria 2929144301 2929149369 451
1158 iso_pu_bacteria 2929189879 2929194614 451
1159 iso_pu_bacteria 2931369376 2931373214 451
1160 iso_pu_bacteria 2931390751 2931395890 451
1161 iso_pu_bacteria 2931396565 2931397519 451
1162 iso_pu_bacteria 2935353572 2935359578 451
1163 iso_pu_bacteria 2939636861 2939641789 451
1164 iso_pu_bacteria 2945928738 2945931435 451
1165 iso_pu_bacteria 2946006987 2946007496 451
1166 iso_pu_bacteria 2946027586 2946033108 451
1167 iso_pu_bacteria 2947233263 2947233870 451
1168 iso_pu_bacteria 2969304461 2969309615 451
1169 iso_pu_bacteria 2974289157 2974294652 451
1170 iso_pu_bacteria 2984286254 2984287184 451
1171 iso_pu_bacteria 2988728565 2988730914 451
1172 iso_pu_bacteria 2998139840 2998144866 451
1173 iso_pu_bacteria 3007315729 3007320410 451
1174 iso_pu_bacteria 3007395558 3007398607 451
1175 iso_pu_bacteria 3007419365 3007420394 451
1176 iso_pu_bacteria 3007511990 3007516652 451
1177 iso_pu_bacteria 3007614139 3007615230 451
1178 iso_pu_bacteria 3007619802 3007621079 451
1179 iso_pu_bacteria 3007718800 3007722255 451
1180 iso_pu_bacteria 3007803356 3007803535 451
1181 iso_pu_bacteria 3007855910 3007860073 451
1182 iso_pu_bacteria 3007866637 3007870977 451
1183 iso_pu_bacteria 3007872151 3007876189 451
1184 iso_pu_bacteria 637000220 637322691 451
1185 iso_pu_bacteria 8011350971 8011352916 451
1186 iso_pu_bacteria 8015687852 8015693070 451
1187 iso_pu_bacteria 8019769354 8019771394 451
1188 iso_pu_bacteria 8019775933 8019781889 451
1189 iso_pu_bacteria 8029995093 8029996029 451
1190 iso_pu_bacteria 8052494512 8052495456 451
1191 iso_pu_bacteria 8054285046 8054288876 451
1192 iso_pu_bacteria 8054347763 8054353052 451
1193 iso_pu_bacteria 8054503363 8054508395 451
1194 iso_pu_bacteria 8054929484 8054932967 451
1195 iso_pu_bacteria 8055770955 8055776317 451
1196 iso_pu_bacteria 8055817908 8055823348 451
1197 iso_pu_bacteria 8055878733 8055882617 451
1198 iso_pu_bacteria 8056115690 8056120637 451
1199 iso_pu_bacteria 8056120720 8056121539 451
1200 iso_pu_bacteria 8056125926 8056131079 451
1201 iso_pu_bacteria 8056131705 8056136753 451
1202 iso_pu_bacteria 8056137416 8056142280 451
1203 iso_pu_bacteria 8056143049 8056148196 451
1204 iso_pu_bacteria 8056148874 8056150279 451
1205 iso_pu_bacteria 8056155041 8056156277 451
1206 iso_pu_bacteria 8056161164 8056163068 451
1207 iso_pu_bacteria 8056166840 8056171702 451
1208 iso_pu_bacteria 8056172158 8056172381 451
1209 iso_pu_bacteria 8056177738 8056179143 451
1210 iso_pu_bacteria 8056569372 8056571897 451
1211 iso_pu_bacteria 8057798959 8057805156 451
1212 3300031251 Ga0265327_10000002 Ga0265327_10000002425 452
1213 3300031456 Ga0307513_10128850 Ga0307513_101288502 452
1214 3300042876 Ga0451577_0016457 Ga0451577_0016457_1976_3358 452
1215 3300042876 Ga0451577_0200600 Ga0451577_0200600_259_1629 452
1216 3300044712 Ga0453684_0001356 Ga0453684_0001356_49568_50938 452
1217 3300044712 Ga0453684_0047336 Ga0453684_0047336_2729_4111 452
1218 2162886007 SwRhRL2b_contig_667648 SwRhRL2b_0985.00003210 453
1219 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001262 453
1220 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001167 453
1221 3300003751 Ga0055538_1000004 Ga0055538_1000004297 453
1222 3300003752 Ga0055539_1000004 Ga0055539_1000004262 453
1223 3300003756 Ga0055533_1000007 Ga0055533_1000007297 453
1224 3300003759 Ga0055525_1000007 Ga0055525_1000007297 453
1225 3300003841 Ga0055541_1000004 Ga0055541_1000004297 453
1226 3300003856 Ga0058692_1000154 Ga0058692_10001546 453
1227 3300005289 Ga0065704_10000047 Ga0065704_1000004742 453
1228 3300006051 Ga0075364_10000460 Ga0075364_1000046022 453
1229 3300009011 Ga0105251_10000897 Ga0105251_1000089710 453
1230 3300009036 Ga0105244_10000023 Ga0105244_1000002344 453
1231 3300009036 Ga0105244_10000247 Ga0105244_1000024718 453
1232 3300009036 Ga0105244_10013866 Ga0105244_100138663 453
1233 3300009036 Ga0105244_10016843 Ga0105244_100168435 453
1234 3300009036 Ga0105244_10075119 Ga0105244_100751191 453
1235 3300009092 Ga0105250_10000045 Ga0105250_10000045111 453
1236 3300009092 Ga0105250_10000223 Ga0105250_1000022318 453
1237 3300009092 Ga0105250_10009699 Ga0105250_100096992 453
1238 3300009092 Ga0105250_10033413 Ga0105250_100334132 453
1239 3300009148 Ga0105243_10002639 Ga0105243_1000263910 453
1240 3300013100 Ga0157373_10007386 Ga0157373_100073863 453
1241 3300013102 Ga0157371_10000020 Ga0157371_10000020110 453
1242 3300013102 Ga0157371_10000267 Ga0157371_1000026746 453
1243 3300013102 Ga0157371_10000589 Ga0157371_1000058925 453
1244 3300013102 Ga0157371_10006243 Ga0157371_100062436 453
1245 3300013104 Ga0157370_10002280 Ga0157370_1000228014 453
1246 3300015261 Ga0182006_1000025 Ga0182006_1000025163 453
1247 3300021384 Ga0213876_10000132 Ga0213876_1000013214 453
1248 3300025207 Ga0209760_100063 Ga0209760_10006364 453
1249 3300025224 Ga0209784_100001 Ga0209784_100001291 453
1250 3300025225 Ga0209566_100001 Ga0209566_100001291 453
1251 3300025226 Ga0209674_100002 Ga0209674_100002291 453
1252 3300025230 Ga0209563_100008 Ga0209563_100008294 453
1253 3300025231 Ga0207427_100002 Ga0207427_100002986 453
1254 3300025233 Ga0209437_100046 Ga0209437_10004696 453
1255 3300025253 Ga0209677_100004 Ga0209677_100004294 453
1256 3300025261 Ga0209233_1003944 Ga0209233_10039442 453
1257 3300025711 Ga0207696_1000027 Ga0207696_1000027213 453
1258 3300025711 Ga0207696_1000093 Ga0207696_100009329 453
1259 3300025711 Ga0207696_1000140 Ga0207696_1000140111 453
1260 3300025711 Ga0207696_1000453 Ga0207696_100045324 453
1261 3300025711 Ga0207696_1002046 Ga0207696_10020466 453
1262 3300025728 Ga0207655_1000024 Ga0207655_1000024161 453
1263 3300025728 Ga0207655_1000056 Ga0207655_1000056155 453
1264 3300025728 Ga0207655_1000101 Ga0207655_100010134 453
1265 3300025728 Ga0207655_1000629 Ga0207655_10006297 453
1266 3300025728 Ga0207655_1008592 Ga0207655_10085922 453
1267 3300025728 Ga0207655_1014693 Ga0207655_10146932 453
1268 3300025735 Ga0207713_1000110 Ga0207713_100011023 453
1269 3300025935 Ga0207709_10002430 Ga0207709_1000243010 453
1270 3300027111 Ga0209281_1000060 Ga0209281_1000060155 453
1271 3300027111 Ga0209281_1001296 Ga0209281_10012969 453
1272 3300027312 Ga0209371_1000053 Ga0209371_1000053171 453
1273 3300027312 Ga0209371_1001222 Ga0209371_10012228 453
1274 3300027665 Ga0209983_1000100 Ga0209983_100010015 453
1275 3300030500 Ga0268256_1000053 Ga0268256_100005363 453
1276 3300030500 Ga0268256_1001819 Ga0268256_10018195 453
1277 3300032126 Ga0307415_100013159 Ga0307415_1000131591 453
1278 3300039062 Ga0400483_085989 Ga0400483_085989_6661_8043 453
1279 3300039062 Ga0400483_232168 Ga0400483_232168_4019_5401 453
1280 3300039437 Ga0436365_0084998 Ga0436365_0084998_246437_247819 453
1281 3300041405 Ga0439438_000003 Ga0439438_000003_220479_221861 453
1282 3300041405 Ga0439438_013745 Ga0439438_013745_982_2364 453
1283 3300042010 Ga0439452_000007 Ga0439452_000007_273971_275353 453
1284 3300042532 Ga0450893_0001268 Ga0450893_0001268_1462_2844 453
1285 3300046458 Ga0495591_000124 Ga0495591_000124_25859_27244 453
1286 3300046471 Ga0495650_0000004 Ga0495650_0000004_323237_324619 453
1287 3300046471 Ga0495650_0000113 Ga0495650_0000113_18069_19451 453
1288 3300046507 Ga0495606_0000217 Ga0495606_0000217_78615_79997 453
1289 3300046523 Ga0495644_0004561 Ga0495644_0004561_936_2318 453
1290 3300046524 Ga0495648_0018618 Ga0495648_0018618_2847_4229 453
1291 3300046530 Ga0495654_0000031 Ga0495654_0000031_79500_80885 453
1292 3300046692 Ga0495671_0004830 Ga0495671_0004830_3625_5007 453
1293 3300046694 Ga0495649_0003489 Ga0495649_0003489_8825_10207 453
1294 3300046794 Ga0495589_0009187 Ga0495589_0009187_1811_3193 453
1295 3300046810 Ga0495660_0000013 Ga0495660_0000013_295546_296928 453
1296 3300046810 Ga0495660_0000034 Ga0495660_0000034_136239_137621 453
1297 3300047320 Ga0495672_0000029 Ga0495672_0000029_27419_28801 453
1298 3300047469 Ga0495673_0000047 Ga0495673_0000047_32309_33691 453
1299 3300047469 Ga0495673_0000517 Ga0495673_0000517_24478_25860 453
1300 3300048904 Ga0496101_0000158 Ga0496101_0000158_13747_15132 453
1301 3300048907 Ga0496104_0000668 Ga0496104_0000668_25582_26964 453
1302 3300048919 Ga0496116_0000016 Ga0496116_0000016_194315_195697 453
1303 3300048919 Ga0496116_0044155 Ga0496116_0044155_593_1975 453
1304 3300048920 Ga0496117_0007472 Ga0496117_0007472_2918_4300 453
1305 3300048921 Ga0496118_0002104 Ga0496118_0002104_3355_4845 453
1306 3300048921 Ga0496118_0009161 Ga0496118_0009161_299_1681 453
1307 3300048922 Ga0496119_0000031 Ga0496119_0000031_146993_148375 453
1308 3300048922 Ga0496119_0002834 Ga0496119_0002834_11233_12615 453
1309 3300048922 Ga0496119_0005635 Ga0496119_0005635_2997_4379 453
1310 3300048922 Ga0496119_0048933 Ga0496119_0048933_593_1978 453
1311 3300048923 Ga0496120_0000017 Ga0496120_0000017_251362_252744 453
1312 3300048923 Ga0496120_0001012 Ga0496120_0001012_35256_36638 453
1313 3300048923 Ga0496120_0001442 Ga0496120_0001442_26067_27452 453
1314 3300048923 Ga0496120_0013652 Ga0496120_0013652_3609_4991 453
1315 3300048925 Ga0496122_0000125 Ga0496122_0000125_55090_56472 453
1316 3300048925 Ga0496122_0003298 Ga0496122_0003298_3510_4895 453
1317 3300048925 Ga0496122_0013632 Ga0496122_0013632_1931_3313 453
1318 3300048926 Ga0496123_0000092 Ga0496123_0000092_123197_124579 453
1319 3300048926 Ga0496123_0012760 Ga0496123_0012760_4808_6193 453
1320 3300048926 Ga0496123_0025637 Ga0496123_0025637_1953_3335 453
1321 3300048926 Ga0496123_0041327 Ga0496123_0041327_1009_2391 453
1322 3300048927 Ga0496124_0000238 Ga0496124_0000238_45009_46391 453
1323 3300048927 Ga0496124_0000528 Ga0496124_0000528_44762_46144 453
1324 3300048927 Ga0496124_0008102 Ga0496124_0008102_1069_2451 453
1325 3300048927 Ga0496124_0021096 Ga0496124_0021096_86_1471 453
1326 3300048928 Ga0496125_0000384 Ga0496125_0000384_27250_28632 453
1327 3300048929 Ga0496126_0000109 Ga0496126_0000109_37615_38997 453
1328 3300048929 Ga0496126_0024373 Ga0496126_0024373_1966_3348 453
1329 3300048929 Ga0496126_0069814 Ga0496126_0069814_364_1749 453
1330 3300049459 Ga0495678_000994 Ga0495678_000994_10237_11619 453
1331 3300049460 Ga0495682_0000003 Ga0495682_0000003_266311_267693 453
1332 3300050491 nmdc:mga00v17_570_c1 nmdc:mga00v17_570_c1_18045_19439 453
1333 3300050492 nmdc:mga0yw44_94477_c1 nmdc:mga0yw44_94477_c1_246_1640 453
1334 3300053126 Ga0500621_000034 Ga0500621_000034_4369_5751 453
1335 iso_pu_bacteria 2984499530 2984500835 453
1336 3300041404 Ga0439436_0024069 Ga0439436_0024069_167_1531 454
1337 3300041411 Ga0439466_0004859 Ga0439466_0004859_3752_5116 454
1338 2124908027 MRS2a_Contig_1736 MRS2a_00593500 455
1339 3300002737 JGI25162J39368_1000332 JGI25162J39368_100033240 455
1340 3300002737 JGI25162J39368_1000502 JGI25162J39368_100050212 455
1341 3300002771 JGI25163J39215_1000713 JGI25163J39215_10007138 455
1342 3300002771 JGI25163J39215_1000964 JGI25163J39215_10009645 455
1343 3300002772 JGI25164J39214_1000244 JGI25164J39214_10002443 455
1344 3300002772 JGI25164J39214_1000340 JGI25164J39214_100034017 455
1345 3300003214 JGI25165J46597_1000391 JGI25165J46597_100039117 455
1346 3300003214 JGI25165J46597_1000452 JGI25165J46597_100045240 455
1347 3300003781 Ga0055536_1000059 Ga0055536_100005971 455
1348 3300003781 Ga0055536_1001145 Ga0055536_100114516 455
1349 3300003781 Ga0055536_1001219 Ga0055536_100121915 455
1350 3300003791 Ga0055530_10000036 Ga0055530_100000363 455
1351 3300003791 Ga0055530_10000096 Ga0055530_1000009660 455
1352 3300003791 Ga0055530_10000874 Ga0055530_1000087415 455
1353 3300003792 Ga0055540_1000072 Ga0055540_10000723 455
1354 3300003792 Ga0055540_1000084 Ga0055540_100008425 455
1355 3300003792 Ga0055540_1000648 Ga0055540_10006489 455
1356 3300003856 Ga0058692_1008168 Ga0058692_10081682 455
1357 3300005288 Ga0065714_10002683 Ga0065714_100026833 455
1358 3300005288 Ga0065714_10003206 Ga0065714_1000320613 455
1359 3300005288 Ga0065714_10003555 Ga0065714_1000355513 455
1360 3300005288 Ga0065714_10003704 Ga0065714_100037043 455
1361 3300005288 Ga0065714_10009694 Ga0065714_100096943 455
1362 3300005289 Ga0065704_10007587 Ga0065704_100075875 455
1363 3300005289 Ga0065704_10008178 Ga0065704_100081781 455
1364 3300005289 Ga0065704_10071220 Ga0065704_100712206 455
1365 3300005289 Ga0065704_10089844 Ga0065704_100898442 455
1366 3300005290 Ga0065712_10068190 Ga0065712_100681905 455
1367 3300005290 Ga0065712_10073244 Ga0065712_100732443 455
1368 3300005331 Ga0070670_100004209 Ga0070670_1000042094 455
1369 3300005548 Ga0070665_100004186 Ga0070665_1000041868 455
1370 3300006058 Ga0075432_10002882 Ga0075432_100028825 455
1371 3300006058 Ga0075432_10010919 Ga0075432_100109193 455
1372 3300006058 Ga0075432_10011333 Ga0075432_100113332 455
1373 3300006058 Ga0075432_10017909 Ga0075432_100179093 455
1374 3300006944 Ga0099823_1000188 Ga0099823_100018810 455
1375 3300006946 Ga0079104_1000116 Ga0079104_10001163 455
1376 3300006946 Ga0079104_1000283 Ga0079104_100028358 455
1377 3300006948 Ga0099826_10011531 Ga0099826_100115312 455
1378 3300009011 Ga0105251_10000114 Ga0105251_100001149 455
1379 3300009011 Ga0105251_10000214 Ga0105251_1000021446 455
1380 3300009011 Ga0105251_10001720 Ga0105251_100017209 455
1381 3300009011 Ga0105251_10002384 Ga0105251_1000238413 455
1382 3300009011 Ga0105251_10007766 Ga0105251_100077667 455
1383 3300009011 Ga0105251_10016507 Ga0105251_100165072 455
1384 3300009036 Ga0105244_10000949 Ga0105244_100009498 455
1385 3300009036 Ga0105244_10003287 Ga0105244_100032873 455
1386 3300009036 Ga0105244_10013675 Ga0105244_100136751 455
1387 3300009036 Ga0105244_10014073 Ga0105244_100140733 455
1388 3300009036 Ga0105244_10037531 Ga0105244_100375313 455
1389 3300009036 Ga0105244_10041906 Ga0105244_100419062 455
1390 3300009092 Ga0105250_10010116 Ga0105250_100101163 455
1391 3300009148 Ga0105243_10000115 Ga0105243_1000011578 455
1392 3300009148 Ga0105243_10001544 Ga0105243_1000154411 455
1393 3300009148 Ga0105243_10002556 Ga0105243_1000255610 455
1394 3300009148 Ga0105243_10080361 Ga0105243_100803612 455
1395 3300009176 Ga0105242_10060366 Ga0105242_100603663 455
1396 3300011119 Ga0105246_10000647 Ga0105246_100006477 455
1397 3300011119 Ga0105246_10001153 Ga0105246_100011539 455
1398 3300011119 Ga0105246_10014132 Ga0105246_100141324 455
1399 3300012498 Ga0157345_1000111 Ga0157345_10001113 455
1400 3300013100 Ga0157373_10004054 Ga0157373_1000405410 455
1401 3300013100 Ga0157373_10006686 Ga0157373_100066863 455
1402 3300013100 Ga0157373_10031656 Ga0157373_100316562 455
1403 3300013100 Ga0157373_10039956 Ga0157373_100399563 455
1404 3300013102 Ga0157371_10007229 Ga0157371_100072299 455
1405 3300013102 Ga0157371_10008791 Ga0157371_100087913 455
1406 3300013102 Ga0157371_10015292 Ga0157371_100152921 455
1407 3300013104 Ga0157370_10000477 Ga0157370_1000047714 455
1408 3300013104 Ga0157370_10027483 Ga0157370_100274834 455
1409 3300013104 Ga0157370_10027915 Ga0157370_100279153 455
1410 3300013104 Ga0157370_10082220 Ga0157370_100822202 455
1411 3300013104 Ga0157370_10124411 Ga0157370_101244113 455
1412 3300013105 Ga0157369_10006118 Ga0157369_100061183 455
1413 3300013105 Ga0157369_10013043 Ga0157369_100130439 455
1414 3300013105 Ga0157369_10031904 Ga0157369_100319043 455
1415 3300013306 Ga0163162_10001780 Ga0163162_100017809 455
1416 3300013307 Ga0157372_10001394 Ga0157372_1000139418 455
1417 3300013307 Ga0157372_10004623 Ga0157372_1000462315 455
1418 3300014497 Ga0182008_10003156 Ga0182008_100031564 455
1419 3300014497 Ga0182008_10004049 Ga0182008_1000404910 455
1420 3300014497 Ga0182008_10005764 Ga0182008_100057647 455
1421 3300014497 Ga0182008_10006730 Ga0182008_100067305 455
1422 3300014497 Ga0182008_10022877 Ga0182008_100228771 455
1423 3300014497 Ga0182008_10024587 Ga0182008_100245872 455
1424 3300015261 Ga0182006_1001424 Ga0182006_10014243 455
1425 3300015261 Ga0182006_1001865 Ga0182006_10018654 455
1426 3300015261 Ga0182006_1003013 Ga0182006_10030132 455
1427 3300015261 Ga0182006_1003118 Ga0182006_10031183 455
1428 3300015262 Ga0182007_10001412 Ga0182007_100014125 455
1429 3300015262 Ga0182007_10012776 Ga0182007_100127763 455
1430 3300015265 Ga0182005_1001087 Ga0182005_10010871 455
1431 3300015265 Ga0182005_1001509 Ga0182005_10015093 455
1432 3300015265 Ga0182005_1012616 Ga0182005_10126162 455
1433 3300017792 Ga0163161_10005144 Ga0163161_100051447 455
1434 3300017792 Ga0163161_10019126 Ga0163161_100191265 455
1435 3300017792 Ga0163161_10021250 Ga0163161_100212504 455
1436 3300025207 Ga0209760_100009 Ga0209760_10000978 455
1437 3300025207 Ga0209760_100157 Ga0209760_10015717 455
1438 3300025230 Ga0209563_101750 Ga0209563_1017504 455
1439 3300025231 Ga0207427_100016 Ga0207427_100016429 455
1440 3300025231 Ga0207427_100092 Ga0207427_100092110 455
1441 3300025233 Ga0209437_100011 Ga0209437_100011618 455
1442 3300025233 Ga0209437_100065 Ga0209437_100065199 455
1443 3300025261 Ga0209233_1000019 Ga0209233_1000019618 455
1444 3300025261 Ga0209233_1000085 Ga0209233_1000085199 455
1445 3300025292 Ga0209676_1000076 Ga0209676_1000076108 455
1446 3300025292 Ga0209676_1000264 Ga0209676_100026425 455
1447 3300025292 Ga0209676_1000313 Ga0209676_100031359 455
1448 3300025292 Ga0209676_1000805 Ga0209676_100080517 455
1449 3300025292 Ga0209676_1001727 Ga0209676_10017273 455
1450 3300025292 Ga0209676_1017636 Ga0209676_10176362 455
1451 3300025298 Ga0209050_1000063 Ga0209050_1000063210 455
1452 3300025298 Ga0209050_1000080 Ga0209050_1000080244 455
1453 3300025298 Ga0209050_1000106 Ga0209050_1000106183 455
1454 3300025298 Ga0209050_1001454 Ga0209050_100145425 455
1455 3300025303 Ga0209051_1000045 Ga0209051_1000045183 455
1456 3300025303 Ga0209051_1000082 Ga0209051_1000082175 455
1457 3300025303 Ga0209051_1000139 Ga0209051_1000139100 455
1458 3300025304 Ga0209257_1000539 Ga0209257_100053926 455
1459 3300025304 Ga0209257_1012661 Ga0209257_10126612 455
1460 3300025711 Ga0207696_1000022 Ga0207696_1000022350 455
1461 3300025711 Ga0207696_1000047 Ga0207696_1000047103 455
1462 3300025711 Ga0207696_1000255 Ga0207696_10002556 455
1463 3300025711 Ga0207696_1001097 Ga0207696_10010973 455
1464 3300025711 Ga0207696_1002717 Ga0207696_100271710 455
1465 3300025728 Ga0207655_1000015 Ga0207655_100001549 455
1466 3300025728 Ga0207655_1000383 Ga0207655_100038337 455
1467 3300025728 Ga0207655_1001313 Ga0207655_10013133 455
1468 3300025728 Ga0207655_1001444 Ga0207655_100144416 455
1469 3300025728 Ga0207655_1003542 Ga0207655_10035422 455
1470 3300025728 Ga0207655_1005247 Ga0207655_10052478 455
1471 3300025728 Ga0207655_1007448 Ga0207655_10074488 455
1472 3300025728 Ga0207655_1007987 Ga0207655_10079873 455
1473 3300025728 Ga0207655_1008311 Ga0207655_10083112 455
1474 3300025728 Ga0207655_1008846 Ga0207655_10088467 455
1475 3300025728 Ga0207655_1014324 Ga0207655_10143243 455
1476 3300025728 Ga0207655_1029728 Ga0207655_10297283 455
1477 3300025735 Ga0207713_1000049 Ga0207713_100004941 455
1478 3300025735 Ga0207713_1000200 Ga0207713_100020064 455
1479 3300025735 Ga0207713_1001161 Ga0207713_100116111 455
1480 3300025735 Ga0207713_1001267 Ga0207713_100126713 455
1481 3300025735 Ga0207713_1002366 Ga0207713_10023665 455
1482 3300025735 Ga0207713_1004683 Ga0207713_10046832 455
1483 3300025735 Ga0207713_1006309 Ga0207713_10063094 455
1484 3300025735 Ga0207713_1010825 Ga0207713_10108253 455
1485 3300025735 Ga0207713_1020562 Ga0207713_10205622 455
1486 3300025735 Ga0207713_1060961 Ga0207713_10609611 455
1487 3300025925 Ga0207650_10000153 Ga0207650_100001536 455
1488 3300025933 Ga0207706_10003016 Ga0207706_1000301612 455
1489 3300025935 Ga0207709_10000030 Ga0207709_10000030211 455
1490 3300025935 Ga0207709_10000127 Ga0207709_1000012727 455
1491 3300025935 Ga0207709_10019461 Ga0207709_100194612 455
1492 3300027111 Ga0209281_1000070 Ga0209281_1000070160 455
1493 3300027111 Ga0209281_1000127 Ga0209281_1000127184 455
1494 3300027296 Ga0209389_1000002 Ga0209389_100000235 455
1495 3300027312 Ga0209371_1000127 Ga0209371_100012735 455
1496 3300027312 Ga0209371_1001784 Ga0209371_100178411 455
1497 3300027907 Ga0207428_10008488 Ga0207428_100084888 455
1498 3300027907 Ga0207428_10022639 Ga0207428_100226394 455
1499 3300027907 Ga0207428_10091240 Ga0207428_100912402 455
1500 3300028379 Ga0268266_10006807 Ga0268266_100068073 455
1501 3300028786 Ga0307517_10068597 Ga0307517_100685972 455
1502 3300030500 Ga0268256_1000104 Ga0268256_100010435 455
1503 3300030500 Ga0268256_1002159 Ga0268256_10021594 455
1504 3300030521 Ga0307511_10077707 Ga0307511_100777071 455
1505 3300030733 Ga0314311_1116887 Ga0314311_11168872 455
1506 3300030735 Ga0316178_1150033 Ga0316178_11500333 455
1507 3300031548 Ga0307408_100008354 Ga0307408_1000083543 455
1508 3300031548 Ga0307408_100016726 Ga0307408_1000167264 455
1509 3300031548 Ga0307408_100019847 Ga0307408_1000198473 455
1510 3300031548 Ga0307408_100041888 Ga0307408_1000418883 455
1511 3300031548 Ga0307408_100069774 Ga0307408_1000697743 455
1512 3300031731 Ga0307405_10000292 Ga0307405_100002923 455
1513 3300031731 Ga0307405_10017959 Ga0307405_100179593 455
1514 3300031911 Ga0307412_10001542 Ga0307412_1000154212 455
1515 3300031911 Ga0307412_10002214 Ga0307412_1000221410 455
1516 3300031911 Ga0307412_10002890 Ga0307412_100028903 455
1517 3300032004 Ga0307414_10032163 Ga0307414_100321633 455
1518 3300032005 Ga0307411_10016120 Ga0307411_100161203 455
1519 3300032005 Ga0307411_10054322 Ga0307411_100543223 455
1520 3300033180 Ga0307510_10011495 Ga0307510_100114953 455
1521 3300033180 Ga0307510_10072032 Ga0307510_100720322 455
1522 3300041405 Ga0439438_000530 Ga0439438_000530_15239_16606 455
1523 3300041405 Ga0439438_001413 Ga0439438_001413_8737_10104 455
1524 3300041405 Ga0439438_001885 Ga0439438_001885_6389_7756 455
1525 3300041405 Ga0439438_002408 Ga0439438_002408_1062_2429 455
1526 3300041405 Ga0439438_002819 Ga0439438_002819_4782_6149 455
1527 3300041405 Ga0439438_004575 Ga0439438_004575_771_2198 455
1528 3300041405 Ga0439438_011200 Ga0439438_011200_726_2093 455
1529 3300041405 Ga0439438_011384 Ga0439438_011384_681_2048 455
1530 3300041407 Ga0439447_000242 Ga0439447_000242_16439_17806 455
1531 3300041407 Ga0439447_000963 Ga0439447_000963_7193_8560 455
1532 3300041407 Ga0439447_001174 Ga0439447_001174_1253_2620 455
1533 3300041407 Ga0439447_012776 Ga0439447_012776_847_2274 455
1534 3300041411 Ga0439466_0000779 Ga0439466_0000779_1422_2849 455
1535 3300041411 Ga0439466_0001260 Ga0439466_0001260_6044_7411 455
1536 3300041411 Ga0439466_0002857 Ga0439466_0002857_1013_2380 455
1537 3300041411 Ga0439466_0006077 Ga0439466_0006077_55_1422 455
1538 3300041411 Ga0439466_0015831 Ga0439466_0015831_306_1673 455
1539 3300041411 Ga0439466_0017299 Ga0439466_0017299_761_2128 455
1540 3300041411 Ga0439466_0049030 Ga0439466_0049030_11_1378 455
1541 3300041413 Ga0439465_0001154 Ga0439465_0001154_6416_7783 455
1542 3300042006 Ga0439432_000632 Ga0439432_000632_434_1801 455
1543 3300042006 Ga0439432_003594 Ga0439432_003594_1877_3244 455
1544 3300042006 Ga0439432_008727 Ga0439432_008727_763_2130 455
1545 3300042006 Ga0439432_009742 Ga0439432_009742_726_2093 455
1546 3300042006 Ga0439432_014683 Ga0439432_014683_707_2074 455
1547 3300042009 Ga0439451_000947 Ga0439451_000947_2338_3705 455
1548 3300042009 Ga0439451_001448 Ga0439451_001448_3275_4642 455
1549 3300042009 Ga0439451_002411 Ga0439451_002411_681_2048 455
1550 3300042009 Ga0439451_010777 Ga0439451_010777_146_1513 455
1551 3300042010 Ga0439452_000085 Ga0439452_000085_73493_74920 455
1552 3300042010 Ga0439452_000149 Ga0439452_000149_49561_50928 455
1553 3300042010 Ga0439452_000581 Ga0439452_000581_10233_11600 455
1554 3300042010 Ga0439452_001680 Ga0439452_001680_2162_3529 455
1555 3300042010 Ga0439452_006146 Ga0439452_006146_682_2049 455
1556 3300042013 Ga0439456_000013 Ga0439456_000013_56805_58172 455
1557 3300042013 Ga0439456_000723 Ga0439456_000723_4477_5844 455
1558 3300042013 Ga0439456_004033 Ga0439456_004033_1188_2555 455
1559 3300042013 Ga0439456_006156 Ga0439456_006156_649_2016 455
1560 3300042115 Ga0450911_000006 Ga0450911_000006_49942_51309 455
1561 3300042115 Ga0450911_000521 Ga0450911_000521_2665_4032 455
1562 3300042115 Ga0450911_001091 Ga0450911_001091_4861_6228 455
1563 3300042121 Ga0450919_000041 Ga0450919_000041_7804_9171 455
1564 3300042122 Ga0450920_001489 Ga0450920_001489_1181_2548 455
1565 3300042124 Ga0450922_000267 Ga0450922_000267_1076_2443 455
1566 3300042137 Ga0450902_002640 Ga0450902_002640_460_1827 455
1567 3300042138 Ga0450903_002709 Ga0450903_002709_909_2276 455
1568 3300042139 Ga0450904_000693 Ga0450904_000693_680_2047 455
1569 3300042145 Ga0450906_001060 Ga0450906_001060_1073_2440 455
1570 3300042146 Ga0450907_000025 Ga0450907_000025_62194_63561 455
1571 3300042146 Ga0450907_000937 Ga0450907_000937_4488_5855 455
1572 3300042146 Ga0450907_006059 Ga0450907_006059_567_1934 455
1573 3300042156 Ga0439446_0001080 Ga0439446_0001080_3820_5187 455
1574 3300042438 Ga0439459_0007172 Ga0439459_0007172_499_1866 455
1575 3300042461 Ga0439460_0000989 Ga0439460_0000989_817_2184 455
1576 3300042461 Ga0439460_0006429 Ga0439460_0006429_1121_2488 455
1577 3300042532 Ga0450893_0000317 Ga0450893_0000317_2032_3399 455
1578 3300042993 Ga0439440_0003329 Ga0439440_0003329_973_2340 455
1579 3300046452 Ga0495617_000479 Ga0495617_000479_7409_8776 455
1580 3300046452 Ga0495617_001534 Ga0495617_001534_6471_7838 455
1581 3300046452 Ga0495617_046660 Ga0495617_046660_44_1411 455
1582 3300046453 Ga0495627_000221 Ga0495627_000221_2417_3817 455
1583 3300046453 Ga0495627_003091 Ga0495627_003091_707_2074 455
1584 3300046453 Ga0495627_006719 Ga0495627_006719_616_1983 455
1585 3300046453 Ga0495627_006739 Ga0495627_006739_2495_3862 455
1586 3300046455 Ga0495603_0003012 Ga0495603_0003012_6082_7449 455
1587 3300046457 Ga0495590_0001439 Ga0495590_0001439_7818_9185 455
1588 3300046457 Ga0495590_0002041 Ga0495590_0002041_6492_7859 455
1589 3300046457 Ga0495590_0005058 Ga0495590_0005058_3224_4591 455
1590 3300046457 Ga0495590_0008961 Ga0495590_0008961_2100_3467 455
1591 3300046457 Ga0495590_0013050 Ga0495590_0013050_701_2068 455
1592 3300046458 Ga0495591_000165 Ga0495591_000165_8172_9539 455
1593 3300046458 Ga0495591_000167 Ga0495591_000167_15034_16404 455
1594 3300046458 Ga0495591_001414 Ga0495591_001414_12587_13954 455
1595 3300046458 Ga0495591_001515 Ga0495591_001515_12385_13752 455
1596 3300046458 Ga0495591_002013 Ga0495591_002013_3606_4973 455
1597 3300046458 Ga0495591_003333 Ga0495591_003333_543_1910 455
1598 3300046458 Ga0495591_009099 Ga0495591_009099_112_1479 455
1599 3300046458 Ga0495591_010920 Ga0495591_010920_1342_2712 455
1600 3300046458 Ga0495591_023217 Ga0495591_023217_541_1908 455
1601 3300046459 Ga0495629_0009493 Ga0495629_0009493_4739_6106 455
1602 3300046460 Ga0495638_0007763 Ga0495638_0007763_1019_2386 455
1603 3300046460 Ga0495638_0007985 Ga0495638_0007985_692_2119 455
1604 3300046460 Ga0495638_0008999 Ga0495638_0008999_4643_6010 455
1605 3300046460 Ga0495638_0010092 Ga0495638_0010092_4097_5464 455
1606 3300046460 Ga0495638_0010448 Ga0495638_0010448_5064_6431 455
1607 3300046460 Ga0495638_0027275 Ga0495638_0027275_582_1949 455
1608 3300046460 Ga0495638_0065307 Ga0495638_0065307_199_1566 455
1609 3300046463 Ga0495653_0000332 Ga0495653_0000332_1669_3036 455
1610 3300046463 Ga0495653_0048055 Ga0495653_0048055_1008_2375 455
1611 3300046463 Ga0495653_0056873 Ga0495653_0056873_372_1739 455
1612 3300046463 Ga0495653_0060706 Ga0495653_0060706_825_2192 455
1613 3300046471 Ga0495650_0004045 Ga0495650_0004045_4633_6003 455
1614 3300046471 Ga0495650_0005255 Ga0495650_0005255_6475_7842 455
1615 3300046471 Ga0495650_0006583 Ga0495650_0006583_3224_4591 455
1616 3300046471 Ga0495650_0007026 Ga0495650_0007026_4886_6253 455
1617 3300046471 Ga0495650_0011231 Ga0495650_0011231_78_1445 455
1618 3300046473 Ga0495582_0039235 Ga0495582_0039235_891_2258 455
1619 3300046474 Ga0495605_0000167 Ga0495605_0000167_77508_78878 455
1620 3300046474 Ga0495605_0001345 Ga0495605_0001345_10237_11604 455
1621 3300046474 Ga0495605_0010585 Ga0495605_0010585_3123_4490 455
1622 3300046474 Ga0495605_0011091 Ga0495605_0011091_2713_4080 455
1623 3300046474 Ga0495605_0027836 Ga0495605_0027836_1540_2907 455
1624 3300046474 Ga0495605_0028766 Ga0495605_0028766_369_1736 455
1625 3300046475 Ga0495639_0000732 Ga0495639_0000732_12463_13830 455
1626 3300046491 Ga0495584_0001949 Ga0495584_0001949_4391_5758 455
1627 3300046491 Ga0495584_0003603 Ga0495584_0003603_7052_8419 455
1628 3300046491 Ga0495584_0003616 Ga0495584_0003616_601_1968 455
1629 3300046491 Ga0495584_0004904 Ga0495584_0004904_5091_6458 455
1630 3300046491 Ga0495584_0008253 Ga0495584_0008253_1000_2367 455
1631 3300046491 Ga0495584_0010064 Ga0495584_0010064_3352_4719 455
1632 3300046492 Ga0495585_0000937 Ga0495585_0000937_22527_23894 455
1633 3300046492 Ga0495585_0004782 Ga0495585_0004782_6766_8133 455
1634 3300046492 Ga0495585_0005409 Ga0495585_0005409_5551_6918 455
1635 3300046492 Ga0495585_0010129 Ga0495585_0010129_1534_2901 455
1636 3300046500 Ga0495596_0001631 Ga0495596_0001631_1049_2416 455
1637 3300046500 Ga0495596_0012106 Ga0495596_0012106_973_2343 455
1638 3300046501 Ga0495607_0000703 Ga0495607_0000703_20521_21891 455
1639 3300046501 Ga0495607_0001371 Ga0495607_0001371_8457_9824 455
1640 3300046501 Ga0495607_0001606 Ga0495607_0001606_3074_4444 455
1641 3300046501 Ga0495607_0002265 Ga0495607_0002265_10561_11931 455
1642 3300046501 Ga0495607_0002471 Ga0495607_0002471_641_2008 455
1643 3300046501 Ga0495607_0003408 Ga0495607_0003408_3088_4455 455
1644 3300046501 Ga0495607_0005373 Ga0495607_0005373_7181_8548 455
1645 3300046501 Ga0495607_0006396 Ga0495607_0006396_581_1948 455
1646 3300046501 Ga0495607_0008982 Ga0495607_0008982_448_1818 455
1647 3300046501 Ga0495607_0009021 Ga0495607_0009021_5175_6542 455
1648 3300046501 Ga0495607_0014641 Ga0495607_0014641_785_2152 455
1649 3300046501 Ga0495607_0062998 Ga0495607_0062998_17_1384 455
1650 3300046501 Ga0495607_0063840 Ga0495607_0063840_612_1979 455
1651 3300046506 Ga0495583_0002145 Ga0495583_0002145_1822_3189 455
1652 3300046506 Ga0495583_0002689 Ga0495583_0002689_286_1653 455
1653 3300046506 Ga0495583_0004670 Ga0495583_0004670_4062_5432 455
1654 3300046506 Ga0495583_0005160 Ga0495583_0005160_1256_2623 455
1655 3300046506 Ga0495583_0006720 Ga0495583_0006720_4682_6052 455
1656 3300046507 Ga0495606_0000313 Ga0495606_0000313_77839_79209 455
1657 3300046507 Ga0495606_0000364 Ga0495606_0000364_66062_67429 455
1658 3300046507 Ga0495606_0004876 Ga0495606_0004876_10393_11760 455
1659 3300046507 Ga0495606_0008233 Ga0495606_0008233_543_1910 455
1660 3300046507 Ga0495606_0008338 Ga0495606_0008338_7470_8837 455
1661 3300046507 Ga0495606_0009331 Ga0495606_0009331_1543_2913 455
1662 3300046507 Ga0495606_0014787 Ga0495606_0014787_4601_5968 455
1663 3300046507 Ga0495606_0024715 Ga0495606_0024715_669_2036 455
1664 3300046512 Ga0495610_0006115 Ga0495610_0006115_6438_7805 455
1665 3300046512 Ga0495610_0006148 Ga0495610_0006148_616_1983 455
1666 3300046512 Ga0495610_0008702 Ga0495610_0008702_1116_2483 455
1667 3300046512 Ga0495610_0011833 Ga0495610_0011833_575_1942 455
1668 3300046512 Ga0495610_0014670 Ga0495610_0014670_2067_3434 455
1669 3300046512 Ga0495610_0020628 Ga0495610_0020628_1096_2463 455
1670 3300046512 Ga0495610_0023269 Ga0495610_0023269_260_1627 455
1671 3300046513 Ga0495616_0003956 Ga0495616_0003956_7387_8754 455
1672 3300046513 Ga0495616_0004838 Ga0495616_0004838_629_1996 455
1673 3300046513 Ga0495616_0005311 Ga0495616_0005311_426_1793 455
1674 3300046513 Ga0495616_0013706 Ga0495616_0013706_702_2069 455
1675 3300046513 Ga0495616_0034514 Ga0495616_0034514_1139_2506 455
1676 3300046513 Ga0495616_0044994 Ga0495616_0044994_157_1527 455
1677 3300046513 Ga0495616_0053072 Ga0495616_0053072_583_1950 455
1678 3300046513 Ga0495616_0054048 Ga0495616_0054048_387_1754 455
1679 3300046515 Ga0495620_0000052 Ga0495620_0000052_44315_45685 455
1680 3300046515 Ga0495620_0000482 Ga0495620_0000482_14026_15396 455
1681 3300046515 Ga0495620_0000811 Ga0495620_0000811_5661_7028 455
1682 3300046515 Ga0495620_0006387 Ga0495620_0006387_3348_4715 455
1683 3300046515 Ga0495620_0007738 Ga0495620_0007738_3421_4818 455
1684 3300046517 Ga0495630_0018059 Ga0495630_0018059_1153_2520 455
1685 3300046517 Ga0495630_0054199 Ga0495630_0054199_234_1601 455
1686 3300046517 Ga0495630_0107201 Ga0495630_0107201_263_1630 455
1687 3300046518 Ga0495631_0003543 Ga0495631_0003543_695_2062 455
1688 3300046518 Ga0495631_0004428 Ga0495631_0004428_3826_5226 455
1689 3300046519 Ga0495632_0001542 Ga0495632_0001542_7499_8866 455
1690 3300046519 Ga0495632_0002560 Ga0495632_0002560_6567_7934 455
1691 3300046519 Ga0495632_0007683 Ga0495632_0007683_4647_6014 455
1692 3300046519 Ga0495632_0007887 Ga0495632_0007887_623_1993 455
1693 3300046519 Ga0495632_0008623 Ga0495632_0008623_4401_5768 455
1694 3300046519 Ga0495632_0011595 Ga0495632_0011595_1272_2639 455
1695 3300046519 Ga0495632_0011700 Ga0495632_0011700_3637_5037 455
1696 3300046519 Ga0495632_0015018 Ga0495632_0015018_1557_2927 455
1697 3300046519 Ga0495632_0016104 Ga0495632_0016104_2400_3800 455
1698 3300046519 Ga0495632_0016723 Ga0495632_0016723_2495_3862 455
1699 3300046519 Ga0495632_0022037 Ga0495632_0022037_1522_2892 455
1700 3300046519 Ga0495632_0027337 Ga0495632_0027337_438_1805 455
1701 3300046519 Ga0495632_0049670 Ga0495632_0049670_670_2037 455
1702 3300046520 Ga0495637_0000059 Ga0495637_0000059_11220_12590 455
1703 3300046520 Ga0495637_0000816 Ga0495637_0000816_7759_9129 455
1704 3300046520 Ga0495637_0000931 Ga0495637_0000931_7476_8843 455
1705 3300046520 Ga0495637_0003407 Ga0495637_0003407_6460_7827 455
1706 3300046520 Ga0495637_0003519 Ga0495637_0003519_6416_7783 455
1707 3300046520 Ga0495637_0004240 Ga0495637_0004240_1393_2760 455
1708 3300046520 Ga0495637_0011919 Ga0495637_0011919_1943_3310 455
1709 3300046520 Ga0495637_0016561 Ga0495637_0016561_851_2218 455
1710 3300046520 Ga0495637_0018178 Ga0495637_0018178_1218_2585 455
1711 3300046520 Ga0495637_0028057 Ga0495637_0028057_885_2252 455
1712 3300046520 Ga0495637_0031181 Ga0495637_0031181_222_1589 455
1713 3300046520 Ga0495637_0048068 Ga0495637_0048068_408_1775 455
1714 3300046520 Ga0495637_0055229 Ga0495637_0055229_237_1604 455
1715 3300046522 Ga0495643_0000197 Ga0495643_0000197_2149_3519 455
1716 3300046522 Ga0495643_0000404 Ga0495643_0000404_38211_39578 455
1717 3300046522 Ga0495643_0011424 Ga0495643_0011424_660_2027 455
1718 3300046522 Ga0495643_0015062 Ga0495643_0015062_2349_3716 455
1719 3300046522 Ga0495643_0031462 Ga0495643_0031462_713_2080 455
1720 3300046522 Ga0495643_0039746 Ga0495643_0039746_1046_2413 455
1721 3300046522 Ga0495643_0081844 Ga0495643_0081844_241_1611 455
1722 3300046523 Ga0495644_0000942 Ga0495644_0000942_9943_11310 455
1723 3300046523 Ga0495644_0001481 Ga0495644_0001481_5413_6780 455
1724 3300046523 Ga0495644_0002056 Ga0495644_0002056_1979_3346 455
1725 3300046524 Ga0495648_0001828 Ga0495648_0001828_8833_10200 455
1726 3300046524 Ga0495648_0002424 Ga0495648_0002424_4347_5714 455
1727 3300046524 Ga0495648_0004782 Ga0495648_0004782_4033_5403 455
1728 3300046524 Ga0495648_0006093 Ga0495648_0006093_676_2043 455
1729 3300046524 Ga0495648_0014386 Ga0495648_0014386_4196_5566 455
1730 3300046524 Ga0495648_0018256 Ga0495648_0018256_1429_2796 455
1731 3300046524 Ga0495648_0032715 Ga0495648_0032715_1521_2888 455
1732 3300046524 Ga0495648_0034269 Ga0495648_0034269_1144_2511 455
1733 3300046524 Ga0495648_0075457 Ga0495648_0075457_454_1821 455
1734 3300046526 Ga0495666_0003871 Ga0495666_0003871_5615_6982 455
1735 3300046526 Ga0495666_0017193 Ga0495666_0017193_1005_2372 455
1736 3300046526 Ga0495666_0027594 Ga0495666_0027594_435_1802 455
1737 3300046528 Ga0495642_0000276 Ga0495642_0000276_14455_15822 455
1738 3300046528 Ga0495642_0000490 Ga0495642_0000490_710_2077 455
1739 3300046530 Ga0495654_0001661 Ga0495654_0001661_12525_13892 455
1740 3300046530 Ga0495654_0001908 Ga0495654_0001908_687_2054 455
1741 3300046530 Ga0495654_0002241 Ga0495654_0002241_2420_3820 455
1742 3300046530 Ga0495654_0002255 Ga0495654_0002255_1332_2699 455
1743 3300046530 Ga0495654_0004885 Ga0495654_0004885_3863_5230 455
1744 3300046530 Ga0495654_0005191 Ga0495654_0005191_5936_7306 455
1745 3300046530 Ga0495654_0010455 Ga0495654_0010455_1257_2624 455
1746 3300046530 Ga0495654_0013393 Ga0495654_0013393_587_1954 455
1747 3300046530 Ga0495654_0028656 Ga0495654_0028656_573_1940 455
1748 3300046530 Ga0495654_0029367 Ga0495654_0029367_796_2163 455
1749 3300046530 Ga0495654_0035733 Ga0495654_0035733_380_1747 455
1750 3300046536 Ga0495587_0019792 Ga0495587_0019792_1786_3153 455
1751 3300046538 Ga0495609_0000123 Ga0495609_0000123_80616_81986 455
1752 3300046538 Ga0495609_0003847 Ga0495609_0003847_609_1976 455
1753 3300046538 Ga0495609_0003853 Ga0495609_0003853_616_1983 455
1754 3300046538 Ga0495609_0008134 Ga0495609_0008134_1233_2600 455
1755 3300046542 Ga0495597_0001966 Ga0495597_0001966_11748_13115 455
1756 3300046542 Ga0495597_0005872 Ga0495597_0005872_4329_5696 455
1757 3300046542 Ga0495597_0006609 Ga0495597_0006609_4534_5901 455
1758 3300046542 Ga0495597_0013577 Ga0495597_0013577_1660_3027 455
1759 3300046542 Ga0495597_0023807 Ga0495597_0023807_642_2009 455
1760 3300046542 Ga0495597_0027194 Ga0495597_0027194_33_1400 455
1761 3300046542 Ga0495597_0033173 Ga0495597_0033173_519_1886 455
1762 3300046542 Ga0495597_0037170 Ga0495597_0037170_788_2155 455
1763 3300046557 Ga0495622_0001082 Ga0495622_0001082_699_2066 455
1764 3300046557 Ga0495622_0003665 Ga0495622_0003665_2199_3566 455
1765 3300046557 Ga0495622_0025393 Ga0495622_0025393_1148_2515 455
1766 3300046558 Ga0495633_0003764 Ga0495633_0003764_693_2060 455
1767 3300046558 Ga0495633_0004090 Ga0495633_0004090_1971_3338 455
1768 3300046615 Ga0495656_0039517 Ga0495656_0039517_313_1680 455
1769 3300046616 Ga0495668_0003074 Ga0495668_0003074_5630_6997 455
1770 3300046616 Ga0495668_0004765 Ga0495668_0004765_2238_3605 455
1771 3300046616 Ga0495668_0005370 Ga0495668_0005370_6675_8162 455
1772 3300046616 Ga0495668_0020614 Ga0495668_0020614_341_1711 455
1773 3300046616 Ga0495668_0051162 Ga0495668_0051162_577_1944 455
1774 3300046642 Ga0495634_0009812 Ga0495634_0009812_4510_5877 455
1775 3300046648 Ga0495611_0001586 Ga0495611_0001586_2730_4097 455
1776 3300046648 Ga0495611_0004574 Ga0495611_0004574_4350_5720 455
1777 3300046660 Ga0495625_0000202 Ga0495625_0000202_82086_83456 455
1778 3300046660 Ga0495625_0005131 Ga0495625_0005131_8930_10297 455
1779 3300046660 Ga0495625_0006971 Ga0495625_0006971_5961_7328 455
1780 3300046660 Ga0495625_0007674 Ga0495625_0007674_799_2166 455
1781 3300046660 Ga0495625_0011941 Ga0495625_0011941_681_2048 455
1782 3300046660 Ga0495625_0054711 Ga0495625_0054711_643_2010 455
1783 3300046663 Ga0495635_0007404 Ga0495635_0007404_5208_6575 455
1784 3300046663 Ga0495635_0046477 Ga0495635_0046477_629_1996 455
1785 3300046664 Ga0495659_0000457 Ga0495659_0000457_6854_8221 455
1786 3300046664 Ga0495659_0002039 Ga0495659_0002039_4941_6308 455
1787 3300046665 Ga0495661_0000075 Ga0495661_0000075_86611_87978 455
1788 3300046665 Ga0495661_0000133 Ga0495661_0000133_82725_84095 455
1789 3300046665 Ga0495661_0005482 Ga0495661_0005482_263_1630 455
1790 3300046665 Ga0495661_0010774 Ga0495661_0010774_520_1887 455
1791 3300046665 Ga0495661_0043538 Ga0495661_0043538_1025_2392 455
1792 3300046674 Ga0495588_0056997 Ga0495588_0056997_526_1893 455
1793 3300046679 Ga0495623_0010642 Ga0495623_0010642_1023_2390 455
1794 3300046680 Ga0495646_0031588 Ga0495646_0031588_922_2289 455
1795 3300046684 Ga0495669_0051240 Ga0495669_0051240_32_1399 455
1796 3300046689 Ga0495613_0144945 Ga0495613_0144945_252_1619 455
1797 3300046690 Ga0495624_0001179 Ga0495624_0001179_6007_7374 455
1798 3300046691 Ga0495670_0000715 Ga0495670_0000715_2166_3533 455
1799 3300046691 Ga0495670_0002855 Ga0495670_0002855_6468_7835 455
1800 3300046691 Ga0495670_0007109 Ga0495670_0007109_1244_2611 455
1801 3300046691 Ga0495670_0008345 Ga0495670_0008345_105_1472 455
1802 3300046691 Ga0495670_0009264 Ga0495670_0009264_1127_2494 455
1803 3300046692 Ga0495671_0001378 Ga0495671_0001378_14451_15818 455
1804 3300046692 Ga0495671_0001513 Ga0495671_0001513_1406_2773 455
1805 3300046692 Ga0495671_0004814 Ga0495671_0004814_5859_7226 455
1806 3300046692 Ga0495671_0004870 Ga0495671_0004870_3830_5200 455
1807 3300046692 Ga0495671_0005064 Ga0495671_0005064_2261_3628 455
1808 3300046692 Ga0495671_0007843 Ga0495671_0007843_754_2121 455
1809 3300046692 Ga0495671_0009478 Ga0495671_0009478_706_2073 455
1810 3300046692 Ga0495671_0011691 Ga0495671_0011691_700_2100 455
1811 3300046692 Ga0495671_0012933 Ga0495671_0012933_2489_3856 455
1812 3300046692 Ga0495671_0015819 Ga0495671_0015819_1079_2446 455
1813 3300046692 Ga0495671_0018358 Ga0495671_0018358_609_1976 455
1814 3300046692 Ga0495671_0066731 Ga0495671_0066731_248_1615 455
1815 3300046694 Ga0495649_0001000 Ga0495649_0001000_8242_9609 455
1816 3300046694 Ga0495649_0001508 Ga0495649_0001508_14951_16318 455
1817 3300046694 Ga0495649_0004598 Ga0495649_0004598_664_2031 455
1818 3300046694 Ga0495649_0004606 Ga0495649_0004606_2290_3657 455
1819 3300046694 Ga0495649_0006097 Ga0495649_0006097_848_2215 455
1820 3300046694 Ga0495649_0006109 Ga0495649_0006109_5382_6749 455
1821 3300046694 Ga0495649_0013854 Ga0495649_0013854_698_2065 455
1822 3300046694 Ga0495649_0016529 Ga0495649_0016529_1155_2522 455
1823 3300046694 Ga0495649_0022237 Ga0495649_0022237_2047_3417 455
1824 3300046694 Ga0495649_0029337 Ga0495649_0029337_376_1803 455
1825 3300046694 Ga0495649_0054306 Ga0495649_0054306_688_2055 455
1826 3300046794 Ga0495589_0003312 Ga0495589_0003312_6490_7857 455
1827 3300046794 Ga0495589_0004738 Ga0495589_0004738_675_2042 455
1828 3300046794 Ga0495589_0017712 Ga0495589_0017712_594_1961 455
1829 3300046809 Ga0495600_0018264 Ga0495600_0018264_813_2180 455
1830 3300046810 Ga0495660_0004652 Ga0495660_0004652_6334_7701 455
1831 3300046810 Ga0495660_0006205 Ga0495660_0006205_712_2079 455
1832 3300046810 Ga0495660_0008586 Ga0495660_0008586_4014_5381 455
1833 3300046810 Ga0495660_0011032 Ga0495660_0011032_475_1842 455
1834 3300046810 Ga0495660_0021990 Ga0495660_0021990_1700_3067 455
1835 3300046810 Ga0495660_0051365 Ga0495660_0051365_33_1400 455
1836 3300046810 Ga0495660_0079955 Ga0495660_0079955_270_1640 455
1837 3300047315 Ga0495581_0019114 Ga0495581_0019114_1605_2972 455
1838 3300047318 Ga0495636_0010709 Ga0495636_0010709_1017_2384 455
1839 3300047319 Ga0495674_0017039 Ga0495674_0017039_5393_6760 455
1840 3300047320 Ga0495672_0002280 Ga0495672_0002280_5858_7225 455
1841 3300047320 Ga0495672_0008082 Ga0495672_0008082_1124_2491 455
1842 3300047320 Ga0495672_0009270 Ga0495672_0009270_2866_4233 455
1843 3300047320 Ga0495672_0011348 Ga0495672_0011348_4005_5372 455
1844 3300047320 Ga0495672_0011640 Ga0495672_0011640_1056_2423 455
1845 3300047320 Ga0495672_0011731 Ga0495672_0011731_1022_2389 455
1846 3300047320 Ga0495672_0015303 Ga0495672_0015303_1407_2807 455
1847 3300047320 Ga0495672_0028587 Ga0495672_0028587_940_2307 455
1848 3300047320 Ga0495672_0059323 Ga0495672_0059323_167_1534 455
1849 3300047320 Ga0495672_0061030 Ga0495672_0061030_212_1579 455
1850 3300047321 Ga0495676_0000053 Ga0495676_0000053_83089_84459 455
1851 3300047321 Ga0495676_0010218 Ga0495676_0010218_6470_7837 455
1852 3300047321 Ga0495676_0013031 Ga0495676_0013031_5820_7187 455
1853 3300047322 Ga0495680_0008378 Ga0495680_0008378_7260_8627 455
1854 3300047322 Ga0495680_0011624 Ga0495680_0011624_1821_3188 455
1855 3300047322 Ga0495680_0016108 Ga0495680_0016108_1029_2396 455
1856 3300047322 Ga0495680_0158737 Ga0495680_0158737_215_1582 455
1857 3300047323 Ga0495683_0000043 Ga0495683_0000043_112719_114086 455
1858 3300047323 Ga0495683_0001174 Ga0495683_0001174_7344_8711 455
1859 3300047323 Ga0495683_0001446 Ga0495683_0001446_7069_8436 455
1860 3300047323 Ga0495683_0008158 Ga0495683_0008158_3099_4466 455
1861 3300047323 Ga0495683_0032185 Ga0495683_0032185_239_1606 455
1862 3300047323 Ga0495683_0033568 Ga0495683_0033568_844_2211 455
1863 3300047323 Ga0495683_0037968 Ga0495683_0037968_1041_2408 455
1864 3300047443 Ga0495687_002579 Ga0495687_002579_5864_7231 455
1865 3300047443 Ga0495687_010786 Ga0495687_010786_762_2129 455
1866 3300047443 Ga0495687_012830 Ga0495687_012830_2292_3659 455
1867 3300047444 Ga0495675_0017433 Ga0495675_0017433_898_2265 455
1868 3300047446 Ga0495679_000401 Ga0495679_000401_20082_21452 455
1869 3300047446 Ga0495679_012962 Ga0495679_012962_1058_2425 455
1870 3300047469 Ga0495673_0001376 Ga0495673_0001376_6969_8336 455
1871 3300047469 Ga0495673_0001555 Ga0495673_0001555_9173_10540 455
1872 3300047469 Ga0495673_0001645 Ga0495673_0001645_9897_11264 455
1873 3300047469 Ga0495673_0001654 Ga0495673_0001654_5479_6846 455
1874 3300047469 Ga0495673_0002191 Ga0495673_0002191_5087_6457 455
1875 3300047469 Ga0495673_0003703 Ga0495673_0003703_7871_9238 455
1876 3300047469 Ga0495673_0004615 Ga0495673_0004615_3224_4591 455
1877 3300047469 Ga0495673_0004624 Ga0495673_0004624_688_2055 455
1878 3300047469 Ga0495673_0006316 Ga0495673_0006316_454_1821 455
1879 3300047469 Ga0495673_0006785 Ga0495673_0006785_4652_6019 455
1880 3300047469 Ga0495673_0008889 Ga0495673_0008889_3350_4720 455
1881 3300047469 Ga0495673_0013301 Ga0495673_0013301_2729_4099 455
1882 3300047469 Ga0495673_0027528 Ga0495673_0027528_750_2117 455
1883 3300047470 Ga0495681_0001974 Ga0495681_0001974_640_2007 455
1884 3300047470 Ga0495681_0002070 Ga0495681_0002070_6490_7857 455
1885 3300047470 Ga0495681_0002174 Ga0495681_0002174_10750_12117 455
1886 3300047470 Ga0495681_0002684 Ga0495681_0002684_1458_2825 455
1887 3300047470 Ga0495681_0006168 Ga0495681_0006168_1167_2534 455
1888 3300047470 Ga0495681_0006631 Ga0495681_0006631_5249_6616 455
1889 3300047470 Ga0495681_0018594 Ga0495681_0018594_422_1789 455
1890 3300047470 Ga0495681_0023460 Ga0495681_0023460_653_2020 455
1891 3300047470 Ga0495681_0045278 Ga0495681_0045278_55_1422 455
1892 3300047470 Ga0495681_0048968 Ga0495681_0048968_223_1590 455
1893 3300047472 Ga0495686_0008099 Ga0495686_0008099_4707_6074 455
1894 3300047472 Ga0495686_0012478 Ga0495686_0012478_1044_2411 455
1895 3300047472 Ga0495686_0025928 Ga0495686_0025928_723_2090 455
1896 3300047673 Ga0495593_0006443 Ga0495593_0006443_4769_6136 455
1897 3300048088 Ga0495602_0009613 Ga0495602_0009613_884_2251 455
1898 3300048091 Ga0495626_0000261 Ga0495626_0000261_5602_6972 455
1899 3300048091 Ga0495626_0001455 Ga0495626_0001455_5509_6876 455
1900 3300048091 Ga0495626_0001872 Ga0495626_0001872_5451_6818 455
1901 3300048091 Ga0495626_0002288 Ga0495626_0002288_6591_7958 455
1902 3300048091 Ga0495626_0002548 Ga0495626_0002548_10090_11457 455
1903 3300048091 Ga0495626_0004275 Ga0495626_0004275_682_2049 455
1904 3300048905 Ga0496102_0002699 Ga0496102_0002699_8440_9807 455
1905 3300048906 Ga0496103_0004499 Ga0496103_0004499_5508_6875 455
1906 3300048913 Ga0496110_0110591 Ga0496110_0110591_486_1853 455
1907 3300048919 Ga0496116_0000267 Ga0496116_0000267_9613_10980 455
1908 3300048919 Ga0496116_0003287 Ga0496116_0003287_2246_3613 455
1909 3300048919 Ga0496116_0007651 Ga0496116_0007651_684_2051 455
1910 3300048919 Ga0496116_0009027 Ga0496116_0009027_694_2061 455
1911 3300048919 Ga0496116_0009042 Ga0496116_0009042_690_2057 455
1912 3300048920 Ga0496117_0000345 Ga0496117_0000345_80319_81686 455
1913 3300048920 Ga0496117_0004534 Ga0496117_0004534_4543_5913 455
1914 3300048920 Ga0496117_0009147 Ga0496117_0009147_5221_6588 455
1915 3300048920 Ga0496117_0017496 Ga0496117_0017496_969_2339 455
1916 3300048920 Ga0496117_0055595 Ga0496117_0055595_147_1517 455
1917 3300048921 Ga0496118_0001278 Ga0496118_0001278_28173_29543 455
1918 3300048921 Ga0496118_0011289 Ga0496118_0011289_861_2228 455
1919 3300048921 Ga0496118_0052119 Ga0496118_0052119_1652_3019 455
1920 3300048922 Ga0496119_0000199 Ga0496119_0000199_37421_38791 455
1921 3300048922 Ga0496119_0027444 Ga0496119_0027444_1863_3230 455
1922 3300048923 Ga0496120_0000840 Ga0496120_0000840_18308_19678 455
1923 3300048924 Ga0496121_0000366 Ga0496121_0000366_9627_10994 455
1924 3300048924 Ga0496121_0005581 Ga0496121_0005581_10484_11854 455
1925 3300048924 Ga0496121_0013954 Ga0496121_0013954_6362_7846 455
1926 3300048924 Ga0496121_0027349 Ga0496121_0027349_2073_3440 455
1927 3300048924 Ga0496121_0050458 Ga0496121_0050458_897_2267 455
1928 3300048924 Ga0496121_0079971 Ga0496121_0079971_440_1807 455
1929 3300048925 Ga0496122_0001397 Ga0496122_0001397_10565_11935 455
1930 3300048925 Ga0496122_0011931 Ga0496122_0011931_6698_8065 455
1931 3300048925 Ga0496122_0014282 Ga0496122_0014282_4010_5377 455
1932 3300048926 Ga0496123_0000432 Ga0496123_0000432_10563_11933 455
1933 3300048926 Ga0496123_0022407 Ga0496123_0022407_1118_2485 455
1934 3300048926 Ga0496123_0032442 Ga0496123_0032442_1087_2454 455
1935 3300048927 Ga0496124_0002138 Ga0496124_0002138_325_1692 455
1936 3300048927 Ga0496124_0003076 Ga0496124_0003076_15233_16600 455
1937 3300048927 Ga0496124_0006598 Ga0496124_0006598_934_2301 455
1938 3300048927 Ga0496124_0200625 Ga0496124_0200625_65_1435 455
1939 3300048928 Ga0496125_0000240 Ga0496125_0000240_66513_67883 455
1940 3300048928 Ga0496125_0006298 Ga0496125_0006298_2965_4332 455
1941 3300049459 Ga0495678_000243 Ga0495678_000243_25743_27113 455
1942 3300049459 Ga0495678_002086 Ga0495678_002086_6431_7798 455
1943 3300049459 Ga0495678_004020 Ga0495678_004020_6120_7490 455
1944 3300049459 Ga0495678_004657 Ga0495678_004657_5454_6821 455
1945 3300049459 Ga0495678_006521 Ga0495678_006521_84_1451 455
1946 3300049459 Ga0495678_010033 Ga0495678_010033_2260_3627 455
1947 3300049459 Ga0495678_010394 Ga0495678_010394_688_2055 455
1948 3300049459 Ga0495678_038350 Ga0495678_038350_51_1478 455
1949 3300049460 Ga0495682_0000118 Ga0495682_0000118_5691_7058 455
1950 3300049460 Ga0495682_0000336 Ga0495682_0000336_1175_2545 455
1951 3300049460 Ga0495682_0001977 Ga0495682_0001977_675_2042 455
1952 3300049571 Ga0501034_0000330 Ga0501034_0000330_44459_45829 455
1953 3300049758 Ga0501241_000456 Ga0501241_000456_6813_8180 455
1954 3300049853 Ga0501226_000004 Ga0501226_000004_112515_113882 455
1955 3300053111 Ga0500572_001005 Ga0500572_001005_690_2057 455
1956 iso_pu_bacteria 3007861166 3007866323 455

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

57

84

0.97

PF06745

ATPase

KaiC

122

203

0.93

PF13541

ChlI

Subunit ChlI of Mg-chelatase

375

478

0.91

PF13481

AAA_25

AAA domain

121

271

0.86

PF05362

Lon_C

Lon protease (S16) C-terminal proteolytic domain

397

502

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lkq-assembly1.cif.gz_B protease domain of rada 0.9454 280 454
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9358 290 455
5lkq-assembly1.cif.gz_B protease domain of rada 0.93 280 454
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9014 290 455
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.8922 289 452
ID Description Score Start End Superfamily
af_P24554_314_459_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9983 311 455 3.30.230.10
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9881 60 274 3.40.50.300
af_F4K8X8_240_443_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.985 80 276 3.40.50.300
af_P24554_314_459_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9848 311 455 3.30.230.10
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9836 60 274 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258B630-F1-model_v4 DNA repair protein RadA 0.9977 321 454 GO:0000725
GO:0004176
GO:0004252
GO:0005829
GO:0006508
AF-G5N717-F1-model_v4 DNA repair protein RadA 0.9957 297 454 GO:0000725
GO:0005829
AF-W1XIA3-F1-model_v4 DNA repair protein RadA 0.9939 296 404 GO:0000725
GO:0005829
AF-A0A5U8SVP6-F1-model_v4 DNA repair protein RadA 0.993 386 454
AF-A0A143HYP2-F1-model_v4 deleted 0.9912 84 208

Feature Viewer

pLDDT pTM Quality
85.87 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map