F496137

General Info

Members Datasets Scaffolds Average Seq Length
1953 766 1722 202

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1070407|Ga0081540_10704073
Length 242
Sequence MSALSKLVMPGLVPGIHVLAADEEKDVDGRDNPGHDGGEKMFTGIVTDIGEIVALTPTAQGQLHRMRIACRYDQTTIADGASIACNGVCLTVVASGVADGKTWFDVDAAAETLGMTTAKHWAKGSKLNLERALKIGDELGGHIVAGHADGIATIVKRDDLPDMARFELRTTRELARFIAAKGSVTLDGVSLTVNTVEDVTFSVLIIPHTLGVTTLSGWRAGSEVNIEVDLMARYAARLSEMK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
32 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
33 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
34 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
35 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
36 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
37 2791355199
38 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
39 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
40 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
41 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
42 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
43 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
44 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
45 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
46 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
47 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
48 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
49 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
50 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
51 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
52 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
53 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
54 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
55 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
56 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
57 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
58 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
59 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
60 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
61 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
62 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
63 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
64 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
65 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
66 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
67 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
68 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
69 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
70 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
71 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
72 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
73 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
74 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
75 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
76 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
77 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
78 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
79 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
80 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
81 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
82 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
83 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
84 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
85 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
86 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
87 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
88 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
89 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
90 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
91 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
92 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
93 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
94 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
95 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
96 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
97 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
100 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
101 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
102 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
103 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
104 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
105 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
106 2904699407
107 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
108 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
109 2906610324
110 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
111 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
112 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
113 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
114 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
115 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
116 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
117 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
118 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
119 2922368715
120 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
121 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
122 2922425934
123 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
124 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
125 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
126 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
127 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
128 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
129 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
130 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
131 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
132 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
133 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
134 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
135 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
136 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
137 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
138 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
139 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
140 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
141 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
142 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
143 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
144 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
145 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
146 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
147 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
148 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
149 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
150 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
151 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
152 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
153 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
154 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
155 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
156 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
157 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
158 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
159 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
160 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
161 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
162 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
163 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
164 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
165 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
166 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
167 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
168 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
169 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
170 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
171 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
172 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
173 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
174 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
175 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
176 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
177 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
178 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
179 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
180 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
181 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
182 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
183 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
184 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
185 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
186 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
187 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
188 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
189 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
190 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
191 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
192 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
193 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
194 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
195 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
196 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
197 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
198 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
199 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
200 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
201 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
202 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
203 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
204 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
205 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
206 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
207 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
208 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
209 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
212 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
213 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
214 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
215 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
216 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
217 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
218 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
219 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
220 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
221 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
222 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
223 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
224 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
225 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
226 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
227 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
228 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
229 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
230 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
231 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
232 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
233 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
234 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
235 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
236 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
237 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
238 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
239 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
240 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
241 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
242 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
243 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
244 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
245 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
246 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
247 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
248 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
249 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
250 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
251 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
252 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
253 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
254 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
255 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
256 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
257 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
258 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
259 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
260 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
261 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
262 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
263 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
264 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
265 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
266 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
267 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
268 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
269 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
270 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
271 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
272 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
273 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
274 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
275 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
276 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
277 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
278 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
279 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
280 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
281 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
282 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
283 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
284 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
285 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
286 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
287 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
288 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
289 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
290 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
291 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
292 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
293 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
294 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
295 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
296 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
297 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
298 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
299 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
300 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
301 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
302 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
303 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
304 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
305 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
306 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
307 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
308 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
309 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
310 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
311 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
312 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
313 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
314 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
315 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
316 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
317 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
318 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
319 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
320 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
321 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
322 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
323 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
324 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
325 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
326 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
327 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
328 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
329 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
330 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
331 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
332 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
333 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
334 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
335 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
336 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
337 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
338 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
339 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
340 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
341 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
344 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
348 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
350 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
413 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
414 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
415 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
416 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
419 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
420 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
424 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
425 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
426 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
427 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
428 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
429 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
430 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
431 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
432 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
435 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
436 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
437 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
438 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
439 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
440 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
441 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
442 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
443 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
444 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
445 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
446 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
447 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
448 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
449 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
450 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
451 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
452 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
453 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
454 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
455 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
456 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
457 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
458 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
459 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
460 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
461 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
462 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
463 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
464 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
465 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
466 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
467 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
468 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
469 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
470 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
471 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
472 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
473 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
474 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
475 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
476 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
477 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
478 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
479 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
480 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
481 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
482 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
483 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
484 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
485 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
486 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
487 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
488 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
489 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
490 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
491 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
492 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
493 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
494 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
495 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
496 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
497 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
498 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
499 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
500 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
501 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
502 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
503 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
504 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
505 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
506 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
507 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
508 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
509 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
510 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
511 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
512 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
513 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
514 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
515 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
516 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
517 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
518 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
519 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
520 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
521 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
522 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
523 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
524 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
525 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
526 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
527 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
528 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
529 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
530 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
531 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
532 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
533 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
534 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
535 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
536 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
537 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
538 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
539 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
540 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
541 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
542 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
543 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
544 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
545 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
546 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
547 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
548 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
549 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
550 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
551 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
552 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
553 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
554 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
555 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
556 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
557 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
558 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
559 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
560 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
561 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
562 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
563 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
564 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
565 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
566 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
567 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
568 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
569 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
570 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
571 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
572 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
573 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
574 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
575 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
576 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
577 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
578 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
579 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
580 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
581 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
582 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
583 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
584 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
585 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
586 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
587 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
588 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
589 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
590 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
591 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
592 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
593 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
594 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
595 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
596 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
597 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
598 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
599 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
600 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
601 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
602 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
603 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
604 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
605 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
606 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
607 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
608 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
609 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
610 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
611 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
612 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
613 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
614 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
615 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
616 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
617 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
618 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
619 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
620 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
621 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
622 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
623 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
624 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
625 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
626 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
628 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
630 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
633 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
634 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
635 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
636 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
639 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
640 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
641 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
642 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
643 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
644 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
645 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
646 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
647 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
648 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
649 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
650 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
653 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
654 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
655 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
656 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
657 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
658 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
659 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
660 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
661 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
662 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
663 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
664 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
665 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
666 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
667 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
668 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
669 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
670 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
671 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
672 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
673 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
674 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
675 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
676 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
677 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
678 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
679 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
680 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
681 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
682 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
683 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
684 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
685 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
686 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
687 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
688 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
689 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
690 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
691 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
692 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
693 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
694 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
695 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
696 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
697 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
698 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
699 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
700 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
701 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
702 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
703 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
704 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
705 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
706 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
707 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
708 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
709 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
710 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
711 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
712 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
713 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
714 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
715 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
716 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
717 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
718 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
719 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
720 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
721 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
722 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
723 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
724 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
725 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
726 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
727 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
728 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
729 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
730 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
731 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
732 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
733 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
734 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
735 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
736 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
737 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
738 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
739 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
740 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
741 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
742 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
743 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
744 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
745 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
746 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
747 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
748 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
749 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
750 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
751 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
752 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
753 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
754 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
755 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
756 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
757 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
758 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
759 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
760 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
761 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
762 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
763 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
764 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
765 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
766 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.14
Metatranscriptomes 0.26
Isolates 11.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.36
Nodule 9.47
Rhizoplane 6.2
Rhizosphere 60.93
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010207 3300001979 Bacteria 3629
2 JGI24735J21928_10065329 3300002067 Bacteria 1044
3 JGI24744J21845_10024691 3300002077 Bacteria 1175
4 JGI25165J46597_1009195 3300003214 Bacteria 1502
5 JGI25153J46596_10006284 3300003215 Bacteria 6058
6 JGI25153J46596_10006654 3300003215 Bacteria 5813
7 JGI25153J46596_10007981 3300003215 Bacteria 5122
8 JGI25153J46596_10039211 3300003215 Bacteria 1482
9 rootH1_10026525 3300003323 Bacteria 4213
10 JGI25160J50197_1000570 3300003354 Bacteria 20798
11 JGI25160J50197_1012405 3300003354 Bacteria 2960
12 JGI25161J50226_1009290 3300003374 Bacteria 1418
13 JGI25404J52841_10002998 3300003659 Bacteria 3284
14 JGI25404J52841_10006844 3300003659 Bacteria 2395
15 JGI25404J52841_10009108 3300003659 Bacteria 2122
16 JGI25404J52841_10010395 3300003659 Bacteria 2002
17 JGI25404J52841_10014813 3300003659 Bacteria 1693
18 JGI25404J52841_10031935 3300003659 Bacteria 1124
19 JGI25404J52841_10064330 3300003659 Bacteria 767
20 Ga0055542_1002915 3300003762 Bacteria 5046
21 Ga0055531_10006489 3300003794 Bacteria 6632
22 Ga0055543_1007785 3300004625 Bacteria 2441
23 Ga0055543_1046132 3300004625 Bacteria 724
24 Ga0065165_1002717 3300005262 Bacteria 14168
25 Ga0065165_1006587 3300005262 Bacteria 6035
26 Ga0065165_1012226 3300005262 Bacteria 3511
27 Ga0070658_10035508 3300005327 Bacteria 4016
28 Ga0070658_10178675 3300005327 Bacteria 1786
29 Ga0070658_10395439 3300005327 Bacteria 1187
30 Ga0070658_10413887 3300005327 Bacteria 1159
31 Ga0070683_100008870 3300005329 Bacteria 8563
32 Ga0070683_100018259 3300005329 Bacteria 6209
33 Ga0070683_100065154 3300005329 Bacteria 3392
34 Ga0070690_100195337 3300005330 Bacteria 1405
35 Ga0070670_100122671 3300005331 Bacteria 2242
36 Ga0070670_100345921 3300005331 Bacteria 1306
37 Ga0070670_100557240 3300005331 Bacteria 1023
38 Ga0070677_10327235 3300005333 Bacteria 787
39 Ga0068869_100039722 3300005334 Bacteria 3361
40 Ga0068869_100463665 3300005334 Bacteria 1052
41 Ga0068869_100535621 3300005334 Bacteria 982
42 Ga0068869_100553609 3300005334 Bacteria 966
43 Ga0070666_10148701 3300005335 Bacteria 1634
44 Ga0070680_100013418 3300005336 Bacteria 6379
45 Ga0070680_100091412 3300005336 Bacteria 2519
46 Ga0070680_100128730 3300005336 Bacteria 2117
47 Ga0070680_100158963 3300005336 Bacteria 1898
48 Ga0070682_100256910 3300005337 Bacteria 1262
49 Ga0070682_100322223 3300005337 Bacteria 1142
50 Ga0070682_100481258 3300005337 Bacteria 958
51 Ga0068868_100106929 3300005338 Bacteria 2270
52 Ga0068868_100170607 3300005338 Bacteria 1801
53 Ga0068868_100375991 3300005338 Bacteria 1221
54 Ga0070660_100025241 3300005339 Bacteria 4416
55 Ga0070660_100047285 3300005339 Bacteria 3301
56 Ga0070660_100096353 3300005339 Bacteria 2339
57 Ga0070660_100470405 3300005339 Bacteria 1044
58 Ga0070691_10103167 3300005341 Bacteria 1419
59 Ga0070661_100189395 3300005344 Bacteria 1569
60 Ga0070661_100377774 3300005344 Bacteria 1117
61 Ga0070668_100103767 3300005347 Bacteria 2255
62 Ga0070668_100128954 3300005347 Bacteria 2028
63 Ga0070668_100194702 3300005347 Bacteria 1662
64 Ga0070668_100313646 3300005347 Bacteria 1318
65 Ga0070669_100793458 3300005353 Bacteria 804
66 Ga0070675_100461251 3300005354 Bacteria 1141
67 Ga0070671_100122733 3300005355 Bacteria 2186
68 Ga0070671_100547227 3300005355 Bacteria 998
69 Ga0070674_100104116 3300005356 Bacteria 2073
70 Ga0070673_100206315 3300005364 Bacteria 1695
71 Ga0070673_100463641 3300005364 Bacteria 1141
72 Ga0070688_100550887 3300005365 Bacteria 877
73 Ga0070659_100400976 3300005366 Bacteria 1158
74 Ga0070667_100035336 3300005367 Bacteria 4185
75 Ga0070667_100391049 3300005367 Bacteria 1264
76 Ga0070667_100986744 3300005367 Bacteria 786
77 Ga0070709_10001472 3300005434 Bacteria 12716
78 Ga0070709_10011172 3300005434 Bacteria 4995
79 Ga0070714_100009772 3300005435 Bacteria 7560
80 Ga0070714_100012609 3300005435 Bacteria 6750
81 Ga0070714_100016860 3300005435 Bacteria 5909
82 Ga0070714_100198138 3300005435 Bacteria 1836
83 Ga0070714_100520028 3300005435 Bacteria 1137
84 Ga0070714_100747880 3300005435 Bacteria 945
85 Ga0070714_100768896 3300005435 Bacteria 932
86 Ga0070713_100010458 3300005436 Bacteria 6700
87 Ga0070713_100025412 3300005436 Bacteria 4630
88 Ga0070713_100032350 3300005436 Bacteria 4176
89 Ga0070713_100041607 3300005436 Bacteria 3745
90 Ga0070713_100170016 3300005436 Bacteria 1952
91 Ga0070713_100197830 3300005436 Bacteria 1814
92 Ga0070710_10012826 3300005437 Bacteria 4175
93 Ga0070710_10020189 3300005437 Bacteria 3453
94 Ga0070710_10127103 3300005437 Bacteria 1550
95 Ga0070710_10139068 3300005437 Bacteria 1487
96 Ga0070701_10104467 3300005438 Bacteria 1574
97 Ga0070711_100025343 3300005439 Bacteria 3880
98 Ga0070711_100068534 3300005439 Bacteria 2493
99 Ga0070711_100070677 3300005439 Bacteria 2458
100 Ga0070711_100328566 3300005439 Bacteria 1224
101 Ga0070700_100284853 3300005441 Bacteria 1199
102 Ga0070700_100482840 3300005441 Bacteria 949
103 Ga0070694_100202930 3300005444 Bacteria 1479
104 Ga0070663_100033456 3300005455 Bacteria 3552
105 Ga0070663_100035536 3300005455 Bacteria 3458
106 Ga0070663_100048324 3300005455 Bacteria 3017
107 Ga0070663_100051920 3300005455 Bacteria 2922
108 Ga0070663_100078954 3300005455 Bacteria 2413
109 Ga0070663_100189809 3300005455 Bacteria 1598
110 Ga0070663_100213722 3300005455 Bacteria 1511
111 Ga0070663_100239856 3300005455 Bacteria 1430
112 Ga0070663_100355190 3300005455 Bacteria 1188
113 Ga0070663_100634479 3300005455 Bacteria 902
114 Ga0070663_100825096 3300005455 Bacteria 796
115 Ga0070678_100133873 3300005456 Bacteria 1974
116 Ga0070678_100176078 3300005456 Bacteria 1747
117 Ga0070678_101064304 3300005456 Bacteria 746
118 Ga0070662_100230404 3300005457 Bacteria 1482
119 Ga0070662_100570729 3300005457 Bacteria 949
120 Ga0070681_10010719 3300005458 Bacteria 9058
121 Ga0070681_10056295 3300005458 Bacteria 3914
122 Ga0070681_10228445 3300005458 Bacteria 1775
123 Ga0070681_10684692 3300005458 Bacteria 941
124 Ga0068867_100127587 3300005459 Bacteria 1973
125 Ga0068867_100288787 3300005459 Bacteria 1348
126 Ga0070685_10254998 3300005466 Bacteria 1164
127 Ga0070698_100032519 3300005471 Bacteria 5403
128 Ga0070699_100409509 3300005518 Bacteria 1227
129 Ga0070679_100040267 3300005530 Bacteria 4649
130 Ga0070679_100046297 3300005530 Bacteria 4335
131 Ga0070679_100104324 3300005530 Bacteria 2821
132 Ga0070679_100126467 3300005530 Bacteria 2538
133 Ga0070679_100388162 3300005530 Bacteria 1343
134 Ga0070679_100579062 3300005530 Bacteria 1066
135 Ga0070684_100007202 3300005535 Bacteria 8643
136 Ga0070684_100015483 3300005535 Bacteria 6211
137 Ga0070697_100062919 3300005536 Bacteria 3030
138 Ga0068853_100041634 3300005539 Bacteria 3925
139 Ga0068853_100110502 3300005539 Bacteria 2442
140 Ga0068853_100286839 3300005539 Bacteria 1519
141 Ga0070672_100332438 3300005543 Bacteria 1293
142 Ga0070686_100208454 3300005544 Bacteria 1405
143 Ga0070686_100456864 3300005544 Bacteria 983
144 Ga0070695_100838946 3300005545 Bacteria 739
145 Ga0070696_101009428 3300005546 Bacteria 695
146 Ga0070693_100035480 3300005547 Bacteria 2767
147 Ga0070693_100036115 3300005547 Bacteria 2745
148 Ga0070693_100067173 3300005547 Bacteria 2100
149 Ga0070693_100084154 3300005547 Bacteria 1903
150 Ga0070665_100101925 3300005548 Bacteria 2874
151 Ga0070665_100144276 3300005548 Bacteria 2384
152 Ga0070665_100188338 3300005548 Bacteria 2064
153 Ga0070665_100194986 3300005548 Bacteria 2026
154 Ga0070665_100196379 3300005548 Bacteria 2019
155 Ga0070665_100244910 3300005548 Bacteria 1793
156 Ga0070665_100351923 3300005548 Bacteria 1479
157 Ga0070665_100404808 3300005548 Bacteria 1373
158 Ga0070665_100405364 3300005548 Bacteria 1372
159 Ga0070665_100447244 3300005548 Bacteria 1301
160 Ga0070665_100518591 3300005548 Bacteria 1203
161 Ga0070665_100632253 3300005548 Bacteria 1083
162 Ga0070665_100965870 3300005548 Bacteria 864
163 Ga0070665_101051090 3300005548 Bacteria 826
164 Ga0070665_101183008 3300005548 Bacteria 775
165 Ga0070704_100127465 3300005549 Bacteria 1966
166 Ga0070704_100444905 3300005549 Bacteria 1115
167 Ga0068855_100015485 3300005563 Bacteria 9181
168 Ga0068855_100025913 3300005563 Bacteria 7014
169 Ga0068855_100071080 3300005563 Bacteria 4047
170 Ga0068855_100097667 3300005563 Bacteria 3383
171 Ga0068855_100266533 3300005563 Bacteria 1906
172 Ga0068855_100286657 3300005563 Bacteria 1827
173 Ga0068855_100314624 3300005563 Bacteria 1731
174 Ga0068855_100747573 3300005563 Bacteria 1043
175 Ga0068855_100756818 3300005563 Bacteria 1035
176 Ga0070664_100059581 3300005564 Bacteria 3248
177 Ga0068857_100026301 3300005577 Bacteria 5128
178 Ga0068857_100479051 3300005577 Bacteria 1166
179 Ga0068854_100021850 3300005578 Bacteria 4349
180 Ga0068854_100143866 3300005578 Bacteria 1832
181 Ga0068854_100207454 3300005578 Bacteria 1544
182 Ga0068854_100266267 3300005578 Bacteria 1374
183 Ga0068854_100671422 3300005578 Bacteria 892
184 Ga0068856_100000322 3300005614 Bacteria 52603
185 Ga0068856_100006948 3300005614 Bacteria 11066
186 Ga0068856_100069122 3300005614 Bacteria 3492
187 Ga0068856_100554107 3300005614 Bacteria 1171
188 Ga0068856_100567017 3300005614 Bacteria 1157
189 Ga0068856_100684582 3300005614 Bacteria 1046
190 Ga0068856_101152857 3300005614 Bacteria 792
191 Ga0070702_100278648 3300005615 Bacteria 1147
192 Ga0070702_100766319 3300005615 Bacteria 743
193 Ga0068852_100008838 3300005616 Bacteria 7453
194 Ga0068852_100053814 3300005616 Bacteria 3466
195 Ga0068852_100169499 3300005616 Bacteria 2045
196 Ga0068852_100187600 3300005616 Bacteria 1948
197 Ga0068852_100194606 3300005616 Bacteria 1915
198 Ga0068852_100336686 3300005616 Bacteria 1470
199 Ga0068864_100515370 3300005618 Bacteria 1152
200 Ga0068861_100049131 3300005719 Bacteria 3192
201 Ga0068861_100176349 3300005719 Bacteria 1775
202 Ga0068851_10004612 3300005834 Bacteria 6218
203 Ga0068851_10066696 3300005834 Bacteria 1855
204 Ga0068851_10187000 3300005834 Bacteria 1150
205 Ga0068858_100099286 3300005842 Bacteria 2714
206 Ga0068858_100198281 3300005842 Bacteria 1897
207 Ga0068858_100328900 3300005842 Bacteria 1462
208 Ga0068858_100340909 3300005842 Bacteria 1434
209 Ga0068858_100572658 3300005842 Bacteria 1094
210 Ga0068858_100632184 3300005842 Bacteria 1039
211 Ga0068860_100000058 3300005843 Bacteria 197181
212 Ga0068860_100077341 3300005843 Bacteria 3164
213 Ga0068860_100327471 3300005843 Bacteria 1504
214 Ga0068860_100425705 3300005843 Bacteria 1316
215 Ga0068860_101171722 3300005843 Bacteria 788
216 Ga0068862_100268062 3300005844 Bacteria 1561
217 Ga0068862_100349331 3300005844 Bacteria 1372
218 Ga0068862_100361912 3300005844 Bacteria 1348
219 Ga0068862_100542459 3300005844 Bacteria 1109
220 Ga0068862_100606372 3300005844 Bacteria 1052
221 Ga0068862_101225344 3300005844 Bacteria 750
222 Ga0081455_10001410 3300005937 Bacteria 29737
223 Ga0081455_10011346 3300005937 Bacteria 8961
224 Ga0081455_10024857 3300005937 Bacteria 5537
225 Ga0081455_10028819 3300005937 Bacteria 5069
226 Ga0081455_10160831 3300005937 Bacteria 1721
227 Ga0081538_10014522 3300005981 Bacteria 6160
228 Ga0081540_1002077 3300005983 Bacteria 16706
229 Ga0081540_1002578 3300005983 Bacteria 14710
230 Ga0081540_1004984 3300005983 Bacteria 9982
231 Ga0081540_1005335 3300005983 Bacteria 9620
232 Ga0081540_1009717 3300005983 Bacteria 6601
233 Ga0081540_1016645 3300005983 Bacteria 4590
234 Ga0081540_1016857 3300005983 Bacteria 4550
235 Ga0081540_1017725 3300005983 Bacteria 4398
236 Ga0081540_1020035 3300005983 Bacteria 4039
237 Ga0081540_1039803 3300005983 Bacteria 2460
238 Ga0081540_1070407 3300005983 Bacteria 1620
239 Ga0081540_1071981 3300005983 Bacteria 1595
240 Ga0081540_1135330 3300005983 Bacteria 999
241 Ga0081540_1199526 3300005983 Bacteria 729
242 Ga0081539_10000176 3300005985 Bacteria 150292
243 Ga0081539_10000231 3300005985 Bacteria 131197
244 Ga0081539_10024192 3300005985 Bacteria 3950
245 Ga0081539_10071580 3300005985 Bacteria 1856
246 Ga0070717_10003916 3300006028 Bacteria 10717
247 Ga0070717_10043223 3300006028 Bacteria 3677
248 Ga0070717_10108991 3300006028 Bacteria 2360
249 Ga0070717_10434322 3300006028 Bacteria 1182
250 Ga0075365_10001152 3300006038 Bacteria 11583
251 Ga0075365_10048661 3300006038 Bacteria 2791
252 Ga0075365_10173757 3300006038 Bacteria 1504
253 Ga0075365_10223718 3300006038 Bacteria 1320
254 Ga0075365_10328325 3300006038 Bacteria 1077
255 Ga0075365_10407417 3300006038 Bacteria 960
256 Ga0075365_10494444 3300006038 Bacteria 864
257 Ga0075365_10572324 3300006038 Bacteria 799
258 Ga0075368_10014602 3300006042 Bacteria 2903
259 Ga0075368_10044851 3300006042 Bacteria 1745
260 Ga0075368_10068679 3300006042 Bacteria 1428
261 Ga0075368_10083408 3300006042 Bacteria 1302
262 Ga0075368_10094133 3300006042 Bacteria 1227
263 Ga0075368_10094532 3300006042 Bacteria 1224
264 Ga0075363_100016588 3300006048 Bacteria 3640
265 Ga0075363_100058514 3300006048 Bacteria 2070
266 Ga0075364_10031991 3300006051 Bacteria 3379
267 Ga0075364_10070205 3300006051 Bacteria 2306
268 Ga0075364_10071983 3300006051 Bacteria 2278
269 Ga0075364_10146721 3300006051 Bacteria 1589
270 Ga0075364_10195114 3300006051 Bacteria 1372
271 Ga0075364_10295565 3300006051 Bacteria 1102
272 Ga0070715_10002113 3300006163 Bacteria 6007
273 Ga0070715_10083098 3300006163 Bacteria 1458
274 Ga0070716_100003787 3300006173 Bacteria 7170
275 Ga0070712_100043803 3300006175 Bacteria 3083
276 Ga0070712_100057171 3300006175 Bacteria 2739
277 Ga0070712_100089755 3300006175 Bacteria 2249
278 Ga0070712_100173136 3300006175 Bacteria 1676
279 Ga0070712_100390773 3300006175 Bacteria 1147
280 Ga0070712_100631317 3300006175 Bacteria 909
281 Ga0075362_10035817 3300006177 Bacteria 2168
282 Ga0075362_10046905 3300006177 Bacteria 1923
283 Ga0075362_10069135 3300006177 Bacteria 1610
284 Ga0075362_10081503 3300006177 Bacteria 1492
285 Ga0075367_10012829 3300006178 Bacteria 4486
286 Ga0075367_10029555 3300006178 Bacteria 3136
287 Ga0075367_10056138 3300006178 Bacteria 2339
288 Ga0075367_10086661 3300006178 Bacteria 1901
289 Ga0075367_10152126 3300006178 Bacteria 1436
290 Ga0075367_10193112 3300006178 Bacteria 1270
291 Ga0075367_10244634 3300006178 Bacteria 1124
292 Ga0075369_10039695 3300006186 Bacteria 2010
293 Ga0075369_10071892 3300006186 Bacteria 1523
294 Ga0075369_10102712 3300006186 Bacteria 1284
295 Ga0075369_10162009 3300006186 Bacteria 1025
296 Ga0075369_10195683 3300006186 Bacteria 932
297 Ga0075366_10004938 3300006195 Bacteria 7193
298 Ga0075366_10049316 3300006195 Bacteria 2498
299 Ga0075366_10075306 3300006195 Bacteria 2013
300 Ga0097621_100224043 3300006237 Bacteria 1639
301 Ga0097621_100420962 3300006237 Bacteria 1199
302 Ga0097621_101030146 3300006237 Bacteria 771
303 Ga0075370_10014062 3300006353 Bacteria 4262
304 Ga0075370_10025057 3300006353 Bacteria 3297
305 Ga0075370_10054596 3300006353 Bacteria 2269
306 Ga0075370_10277502 3300006353 Bacteria 995
307 Ga0068871_100051360 3300006358 Bacteria 3338
308 Ga0068871_100149237 3300006358 Bacteria 1993
309 Ga0075428_100089591 3300006844 Bacteria 3355
310 Ga0075428_101214433 3300006844 Bacteria 794
311 Ga0075434_100150853 3300006871 Bacteria 2345
312 Ga0068865_100132313 3300006881 Bacteria 1870
313 Ga0068865_100279534 3300006881 Bacteria 1328
314 Ga0099825_1021078 3300006941 Bacteria 4498
315 Ga0099825_1026986 3300006941 Bacteria 2985
316 Ga0099824_1004823 3300006942 Bacteria 19291
317 Ga0099824_1013628 3300006942 Bacteria 8374
318 Ga0099822_1000628 3300006943 Bacteria 34929
319 Ga0099822_1049229 3300006943 Bacteria 1825
320 Ga0099823_1071406 3300006944 Bacteria 1531
321 Ga0075435_100166884 3300007076 Bacteria 1856
322 Ga0099794_10019131 3300007265 Bacteria 3080
323 Ga0099794_10033913 3300007265 Bacteria 2402
324 Ga0099794_10034139 3300007265 Bacteria 2395
325 Ga0099794_10086053 3300007265 Bacteria 1556
326 Ga0099795_10242404 3300007788 Bacteria 775
327 Ga0099795_10243986 3300007788 Bacteria 772
328 Ga0105251_10235172 3300009011 Bacteria 825
329 Ga0105244_10060146 3300009036 Bacteria 1914
330 Ga0105250_10166686 3300009092 Bacteria 921
331 Ga0105240_10018154 3300009093 Bacteria 9457
332 Ga0105240_10069625 3300009093 Bacteria 4354
333 Ga0105240_10071121 3300009093 Bacteria 4303
334 Ga0105240_10095845 3300009093 Bacteria 3617
335 Ga0105240_10208392 3300009093 Bacteria 2286
336 Ga0105240_10234953 3300009093 Bacteria 2128
337 Ga0105240_10235763 3300009093 Bacteria 2124
338 Ga0105240_10293713 3300009093 Bacteria 1862
339 Ga0105240_10482621 3300009093 Bacteria 1381
340 Ga0105240_11261227 3300009093 Bacteria 781
341 Ga0111539_10981306 3300009094 Bacteria 982
342 Ga0105245_10005424 3300009098 Bacteria 11198
343 Ga0105245_10033567 3300009098 Bacteria 4549
344 Ga0105245_10120982 3300009098 Bacteria 2446
345 Ga0105245_10185030 3300009098 Bacteria 1992
346 Ga0105245_10220248 3300009098 Bacteria 1831
347 Ga0105245_10747896 3300009098 Bacteria 1013
348 Ga0105245_11169324 3300009098 Bacteria 817
349 Ga0105247_10062640 3300009101 Bacteria 2308
350 Ga0105247_10103514 3300009101 Bacteria 1823
351 Ga0105247_10125012 3300009101 Bacteria 1671
352 Ga0105247_10261663 3300009101 Bacteria 1186
353 Ga0105247_10295004 3300009101 Bacteria 1123
354 Ga0105247_10333223 3300009101 Bacteria 1062
355 Ga0114129_10439436 3300009147 Bacteria 1713
356 Ga0105243_10339919 3300009148 Bacteria 1375
357 Ga0105243_10431461 3300009148 Bacteria 1232
358 Ga0105241_10000269 3300009174 Bacteria 38808
359 Ga0105241_10020908 3300009174 Bacteria 4838
360 Ga0105241_10030937 3300009174 Bacteria 4003
361 Ga0105241_10133519 3300009174 Bacteria 2012
362 Ga0105241_10221313 3300009174 Bacteria 1591
363 Ga0105241_10542042 3300009174 Bacteria 1043
364 Ga0105241_10613867 3300009174 Bacteria 984
365 Ga0105241_10912548 3300009174 Bacteria 816
366 Ga0105241_11235846 3300009174 Bacteria 709
367 Ga0105242_10156868 3300009176 Bacteria 1989
368 Ga0105242_10211351 3300009176 Bacteria 1729
369 Ga0105248_10085478 3300009177 Bacteria 3550
370 Ga0105248_10228534 3300009177 Bacteria 2094
371 Ga0105248_10478773 3300009177 Bacteria 1403
372 Ga0105248_11471659 3300009177 Bacteria 771
373 Ga0105237_10005556 3300009545 Bacteria 14219
374 Ga0105237_10042063 3300009545 Bacteria 4608
375 Ga0105237_10056235 3300009545 Bacteria 3939
376 Ga0105237_10096146 3300009545 Bacteria 2952
377 Ga0105237_10105709 3300009545 Bacteria 2806
378 Ga0105237_10160932 3300009545 Bacteria 2243
379 Ga0105237_10235062 3300009545 Bacteria 1834
380 Ga0105237_10342632 3300009545 Bacteria 1499
381 Ga0105237_10356028 3300009545 Bacteria 1468
382 Ga0105237_10374440 3300009545 Bacteria 1429
383 Ga0105237_10618201 3300009545 Bacteria 1090
384 Ga0105237_10718219 3300009545 Bacteria 1006
385 Ga0105237_10777716 3300009545 Bacteria 964
386 Ga0105237_10827943 3300009545 Bacteria 932
387 Ga0105237_11482417 3300009545 Bacteria 685
388 Ga0105238_10002811 3300009551 Bacteria 17365
389 Ga0105238_10023251 3300009551 Bacteria 6318
390 Ga0105238_10035641 3300009551 Bacteria 5057
391 Ga0105238_10134607 3300009551 Bacteria 2449
392 Ga0105238_10140850 3300009551 Bacteria 2388
393 Ga0105238_10170976 3300009551 Bacteria 2149
394 Ga0105238_10238271 3300009551 Bacteria 1797
395 Ga0105238_10321515 3300009551 Bacteria 1533
396 Ga0105238_10712638 3300009551 Bacteria 1016
397 Ga0105238_10775739 3300009551 Bacteria 973
398 Ga0105249_10359083 3300009553 Bacteria 1478
399 Ga0105249_10469918 3300009553 Bacteria 1299
400 Ga0099796_10004735 3300010159 Bacteria 3325
401 Ga0099796_10071689 3300010159 Bacteria 1252
402 Ga0105239_10042504 3300010375 Bacteria 4980
403 Ga0105239_10062146 3300010375 Bacteria 4099
404 Ga0105239_10099221 3300010375 Bacteria 3219
405 Ga0105239_10108782 3300010375 Bacteria 3071
406 Ga0105239_10120100 3300010375 Bacteria 2918
407 Ga0105239_10153972 3300010375 Bacteria 2566
408 Ga0105239_10156020 3300010375 Bacteria 2549
409 Ga0105239_10173262 3300010375 Bacteria 2413
410 Ga0105239_10280756 3300010375 Bacteria 1875
411 Ga0105239_10461170 3300010375 Bacteria 1442
412 Ga0105239_10816327 3300010375 Bacteria 1069
413 Ga0105246_10560833 3300011119 Bacteria 980
414 Ga0105246_10909824 3300011119 Bacteria 790
415 Ga0157370_10089058 3300013104 Bacteria 2899
416 Ga0157370_10420330 3300013104 Bacteria 1230
417 Ga0157370_10587125 3300013104 Bacteria 1020
418 Ga0157369_10006882 3300013105 Bacteria 13122
419 Ga0157369_10013624 3300013105 Bacteria 9198
420 Ga0157369_10017710 3300013105 Bacteria 8001
421 Ga0157369_10019891 3300013105 Bacteria 7510
422 Ga0157369_10138690 3300013105 Bacteria 2574
423 Ga0157369_10308334 3300013105 Bacteria 1646
424 Ga0157374_10027074 3300013296 Bacteria 5166
425 Ga0157374_10115651 3300013296 Bacteria 2584
426 Ga0157374_10130511 3300013296 Bacteria 2432
427 Ga0157374_11175257 3300013296 Bacteria 788
428 Ga0157378_10704316 3300013297 Bacteria 1029
429 Ga0157378_10728754 3300013297 Bacteria 1013
430 Ga0163162_10504021 3300013306 Bacteria 1341
431 Ga0163162_10535489 3300013306 Bacteria 1300
432 Ga0163162_10664411 3300013306 Bacteria 1165
433 Ga0157372_10105216 3300013307 Bacteria 3228
434 Ga0157372_10139170 3300013307 Bacteria 2796
435 Ga0157372_10836217 3300013307 Bacteria 1069
436 Ga0157375_10050933 3300013308 Bacteria 4064
437 Ga0157375_10184288 3300013308 Bacteria 2240
438 Ga0157375_10612499 3300013308 Bacteria 1247
439 Ga0157375_11390319 3300013308 Bacteria 827
440 Ga0163163_10048228 3300014325 Bacteria 4188
441 Ga0163163_10084099 3300014325 Bacteria 3188
442 Ga0163163_10263106 3300014325 Bacteria 1776
443 Ga0163163_11151625 3300014325 Bacteria 838
444 Ga0157380_10047987 3300014326 Bacteria 3361
445 Ga0157380_10108355 3300014326 Bacteria 2329
446 Ga0157377_10224725 3300014745 Bacteria 1204
447 Ga0157377_10711719 3300014745 Bacteria 730
448 Ga0157379_10327866 3300014968 Bacteria 1398
449 Ga0157379_10732692 3300014968 Bacteria 930
450 Ga0157379_10949244 3300014968 Bacteria 818
451 Ga0157376_10045781 3300014969 Bacteria 3605
452 Ga0157376_10061068 3300014969 Bacteria 3167
453 Ga0157376_10745838 3300014969 Bacteria 988
454 Ga0163161_10113065 3300017792 Bacteria 2032
455 Ga0163161_10705126 3300017792 Bacteria 841
456 Ga0197907_10676022 3300020069 Bacteria 1570
457 Ga0206353_10395622 3300020082 Bacteria 1125
458 Ga0214544_1000009 3300021320 Bacteria 285865
459 Ga0214542_1000002 3300021321 Bacteria 720798
460 Ga0214545_1000002 3300021324 Bacteria 727485
461 Ga0214543_1000013 3300021327 Bacteria 329117
462 Ga0213873_10026699 3300021358 Bacteria 1404
463 Ga0213872_10034455 3300021361 Bacteria 2317
464 Ga0213876_10001864 3300021384 Bacteria 12685
465 Ga0213875_10146078 3300021388 Bacteria 1108
466 Ga0213875_10222050 3300021388 Bacteria 890
467 Ga0213871_10068335 3300021441 Bacteria 1000
468 Ga0207425_1012633 3300025245 Bacteria 1974
469 Ga0209677_111450 3300025253 Bacteria 1385
470 Ga0209148_1001286 3300025254 Bacteria 13659
471 Ga0209233_1001922 3300025261 Bacteria 7948
472 Ga0209233_1004167 3300025261 Bacteria 4970
473 Ga0209233_1007747 3300025261 Bacteria 3375
474 Ga0209233_1020700 3300025261 Bacteria 1718
475 Ga0209455_1000966 3300025272 Bacteria 14592
476 Ga0209455_1001948 3300025272 Bacteria 8514
477 Ga0209455_1002229 3300025272 Bacteria 7636
478 Ga0209673_1038670 3300025273 Bacteria 1386
479 Ga0209564_1009117 3300025295 Bacteria 4775
480 Ga0209564_1027597 3300025295 Bacteria 1839
481 Ga0209758_1000100 3300025297 Bacteria 227948
482 Ga0209758_1000553 3300025297 Bacteria 59265
483 Ga0209758_1001023 3300025297 Bacteria 36896
484 Ga0209758_1001046 3300025297 Bacteria 36253
485 Ga0209758_1003784 3300025297 Bacteria 13337
486 Ga0209758_1008833 3300025297 Bacteria 6414
487 Ga0209758_1011625 3300025297 Bacteria 5066
488 Ga0209256_1007171 3300025299 Bacteria 5600
489 Ga0207426_1001143 3300025302 Bacteria 23926
490 Ga0207426_1001204 3300025302 Bacteria 22997
491 Ga0207426_1017074 3300025302 Bacteria 2589
492 Ga0207426_1021401 3300025302 Bacteria 2236
493 Ga0207426_1090871 3300025302 Bacteria 808
494 Ga0209257_1002621 3300025304 Bacteria 17360
495 Ga0207697_10109282 3300025315 Bacteria 1183
496 Ga0207656_10005805 3300025321 Bacteria 4394
497 Ga0207653_10029986 3300025885 Bacteria 1754
498 Ga0207692_10007163 3300025898 Bacteria 4557
499 Ga0207692_10010628 3300025898 Bacteria 3887
500 Ga0207692_10064716 3300025898 Bacteria 1905
501 Ga0207692_10097901 3300025898 Bacteria 1604
502 Ga0207692_10263305 3300025898 Bacteria 1037
503 Ga0207642_10021368 3300025899 Bacteria 2546
504 Ga0207710_10034146 3300025900 Bacteria 2234
505 Ga0207710_10069137 3300025900 Bacteria 1616
506 Ga0207710_10070484 3300025900 Bacteria 1602
507 Ga0207710_10185343 3300025900 Bacteria 1023
508 Ga0207688_10031462 3300025901 Bacteria 2929
509 Ga0207688_10077352 3300025901 Bacteria 1896
510 Ga0207688_10266277 3300025901 Bacteria 1041
511 Ga0207647_10026181 3300025904 Bacteria 3819
512 Ga0207647_10164731 3300025904 Bacteria 1292
513 Ga0207647_10390199 3300025904 Bacteria 785
514 Ga0207685_10002827 3300025905 Bacteria 4076
515 Ga0207699_10005411 3300025906 Bacteria 6114
516 Ga0207699_10005881 3300025906 Bacteria 5900
517 Ga0207699_10149327 3300025906 Bacteria 1544
518 Ga0207699_10176370 3300025906 Bacteria 1433
519 Ga0207699_10366461 3300025906 Bacteria 1020
520 Ga0207645_10319812 3300025907 Bacteria 1035
521 Ga0207643_10204433 3300025908 Bacteria 1204
522 Ga0207643_10456875 3300025908 Bacteria 813
523 Ga0207705_10138295 3300025909 Bacteria 1817
524 Ga0207705_10221110 3300025909 Bacteria 1438
525 Ga0207705_10236199 3300025909 Bacteria 1391
526 Ga0207705_10406202 3300025909 Bacteria 1054
527 Ga0207684_10025940 3300025910 Bacteria 4996
528 Ga0207684_10636344 3300025910 Bacteria 909
529 Ga0207654_10000968 3300025911 Bacteria 15767
530 Ga0207654_10101795 3300025911 Bacteria 1771
531 Ga0207654_10285808 3300025911 Bacteria 1117
532 Ga0207654_10497355 3300025911 Bacteria 860
533 Ga0207707_10006172 3300025912 Bacteria 10468
534 Ga0207707_10006273 3300025912 Bacteria 10383
535 Ga0207707_10012016 3300025912 Bacteria 7527
536 Ga0207707_10033065 3300025912 Bacteria 4526
537 Ga0207707_10179746 3300025912 Bacteria 1847
538 Ga0207707_10703040 3300025912 Bacteria 849
539 Ga0207695_10000278 3300025913 Bacteria 127446
540 Ga0207695_10003702 3300025913 Bacteria 21304
541 Ga0207695_10022178 3300025913 Bacteria 7221
542 Ga0207695_10044366 3300025913 Bacteria 4729
543 Ga0207695_10141279 3300025913 Bacteria 2356
544 Ga0207695_10209769 3300025913 Bacteria 1859
545 Ga0207695_10236300 3300025913 Bacteria 1730
546 Ga0207695_10583249 3300025913 Bacteria 999
547 Ga0207671_10005180 3300025914 Bacteria 12117
548 Ga0207671_10023776 3300025914 Bacteria 4618
549 Ga0207671_10116307 3300025914 Bacteria 2040
550 Ga0207671_10130000 3300025914 Bacteria 1932
551 Ga0207671_10144947 3300025914 Bacteria 1832
552 Ga0207671_10186497 3300025914 Bacteria 1616
553 Ga0207671_10281246 3300025914 Bacteria 1312
554 Ga0207671_10434343 3300025914 Bacteria 1045
555 Ga0207671_10434810 3300025914 Bacteria 1044
556 Ga0207671_10542992 3300025914 Bacteria 927
557 Ga0207671_10553097 3300025914 Bacteria 917
558 Ga0207671_10819323 3300025914 Bacteria 738
559 Ga0207693_10003588 3300025915 Bacteria 13253
560 Ga0207693_10023940 3300025915 Bacteria 4847
561 Ga0207693_10024035 3300025915 Bacteria 4838
562 Ga0207693_10038146 3300025915 Bacteria 3784
563 Ga0207693_10059166 3300025915 Bacteria 3001
564 Ga0207693_10445504 3300025915 Bacteria 1012
565 Ga0207693_10679342 3300025915 Bacteria 799
566 Ga0207663_10008155 3300025916 Bacteria 5461
567 Ga0207663_10042572 3300025916 Bacteria 2775
568 Ga0207663_10097560 3300025916 Bacteria 1966
569 Ga0207663_10224527 3300025916 Bacteria 1368
570 Ga0207660_10016158 3300025917 Bacteria 4937
571 Ga0207660_10023387 3300025917 Bacteria 4173
572 Ga0207660_10207222 3300025917 Bacteria 1534
573 Ga0207657_10038725 3300025919 Bacteria 4241
574 Ga0207657_10087220 3300025919 Bacteria 2611
575 Ga0207657_10093540 3300025919 Bacteria 2504
576 Ga0207657_10104232 3300025919 Bacteria 2350
577 Ga0207649_10122966 3300025920 Bacteria 1752
578 Ga0207649_10190311 3300025920 Bacteria 1443
579 Ga0207649_10207207 3300025920 Bacteria 1389
580 Ga0207652_10031813 3300025921 Bacteria 4431
581 Ga0207652_10101304 3300025921 Bacteria 2544
582 Ga0207652_10151762 3300025921 Bacteria 2075
583 Ga0207652_10195357 3300025921 Bacteria 1820
584 Ga0207652_10443119 3300025921 Bacteria 1171
585 Ga0207652_10658342 3300025921 Bacteria 936
586 Ga0207646_10088363 3300025922 Bacteria 2773
587 Ga0207646_10137564 3300025922 Bacteria 2199
588 Ga0207694_10000787 3300025924 Bacteria 28518
589 Ga0207694_10118745 3300025924 Bacteria 2110
590 Ga0207694_10125855 3300025924 Bacteria 2050
591 Ga0207694_10148744 3300025924 Bacteria 1886
592 Ga0207694_10329132 3300025924 Bacteria 1262
593 Ga0207694_10552015 3300025924 Bacteria 967
594 Ga0207650_10040196 3300025925 Bacteria 3421
595 Ga0207650_10338947 3300025925 Bacteria 1234
596 Ga0207659_10207142 3300025926 Bacteria 1569
597 Ga0207687_10061269 3300025927 Bacteria 2657
598 Ga0207687_10102736 3300025927 Bacteria 2106
599 Ga0207687_10126905 3300025927 Bacteria 1917
600 Ga0207687_10134168 3300025927 Bacteria 1870
601 Ga0207687_10669337 3300025927 Bacteria 879
602 Ga0207700_10012637 3300025928 Bacteria 5454
603 Ga0207700_10013045 3300025928 Bacteria 5390
604 Ga0207700_10024634 3300025928 Bacteria 4167
605 Ga0207700_10136332 3300025928 Bacteria 2011
606 Ga0207700_10439216 3300025928 Bacteria 1149
607 Ga0207700_10589089 3300025928 Bacteria 989
608 Ga0207700_10737261 3300025928 Bacteria 880
609 Ga0207664_10010024 3300025929 Bacteria 6676
610 Ga0207664_10010714 3300025929 Bacteria 6484
611 Ga0207664_10012723 3300025929 Bacteria 6022
612 Ga0207664_10036726 3300025929 Bacteria 3787
613 Ga0207664_10091770 3300025929 Bacteria 2492
614 Ga0207664_10220208 3300025929 Bacteria 1645
615 Ga0207664_10474432 3300025929 Bacteria 1119
616 Ga0207644_10039893 3300025931 Bacteria 3316
617 Ga0207644_10491082 3300025931 Bacteria 1012
618 Ga0207690_10076348 3300025932 Bacteria 2326
619 Ga0207690_10130772 3300025932 Bacteria 1837
620 Ga0207690_10383840 3300025932 Bacteria 1117
621 Ga0207706_10032287 3300025933 Bacteria 4663
622 Ga0207706_10105967 3300025933 Bacteria 2473
623 Ga0207706_10214775 3300025933 Bacteria 1685
624 Ga0207686_10385976 3300025934 Bacteria 1063
625 Ga0207709_10124657 3300025935 Bacteria 1745
626 Ga0207709_10197750 3300025935 Bacteria 1433
627 Ga0207669_10047613 3300025937 Bacteria 2541
628 Ga0207704_10160116 3300025938 Bacteria 1600
629 Ga0207704_10189900 3300025938 Bacteria 1493
630 Ga0207704_11046845 3300025938 Bacteria 692
631 Ga0207665_10000769 3300025939 Bacteria 21572
632 Ga0207665_10085029 3300025939 Bacteria 2184
633 Ga0207665_10153073 3300025939 Bacteria 1653
634 Ga0207665_10423561 3300025939 Bacteria 1017
635 Ga0207665_10628424 3300025939 Bacteria 840
636 Ga0207691_10062447 3300025940 Bacteria 3380
637 Ga0207691_10097698 3300025940 Bacteria 2624
638 Ga0207691_10701322 3300025940 Bacteria 854
639 Ga0207691_10713431 3300025940 Bacteria 845
640 Ga0207711_10145437 3300025941 Bacteria 2135
641 Ga0207711_10215888 3300025941 Bacteria 1753
642 Ga0207711_10279467 3300025941 Bacteria 1537
643 Ga0207711_10497986 3300025941 Bacteria 1135
644 Ga0207711_11103518 3300025941 Bacteria 734
645 Ga0207689_10220515 3300025942 Bacteria 1567
646 Ga0207689_10313827 3300025942 Bacteria 1300
647 Ga0207661_10004791 3300025944 Bacteria 9475
648 Ga0207661_10215204 3300025944 Bacteria 1695
649 Ga0207679_10061962 3300025945 Bacteria 2786
650 Ga0207679_10181413 3300025945 Bacteria 1742
651 Ga0207667_10076656 3300025949 Bacteria 3469
652 Ga0207667_10107196 3300025949 Bacteria 2882
653 Ga0207667_10170162 3300025949 Bacteria 2239
654 Ga0207667_10624302 3300025949 Bacteria 1085
655 Ga0207667_10669824 3300025949 Bacteria 1042
656 Ga0207667_10717422 3300025949 Bacteria 1001
657 Ga0207667_11000431 3300025949 Bacteria 823
658 Ga0207667_11301347 3300025949 Bacteria 703
659 Ga0207651_10190326 3300025960 Bacteria 1636
660 Ga0207668_10082949 3300025972 Bacteria 2331
661 Ga0207668_10381508 3300025972 Bacteria 1186
662 Ga0207640_10063901 3300025981 Bacteria 2448
663 Ga0207640_10064935 3300025981 Bacteria 2433
664 Ga0207640_10125252 3300025981 Bacteria 1849
665 Ga0207640_11092107 3300025981 Bacteria 705
666 Ga0207658_10055153 3300025986 Bacteria 2944
667 Ga0207658_10112117 3300025986 Bacteria 2158
668 Ga0207658_10743099 3300025986 Bacteria 888
669 Ga0207658_10850175 3300025986 Bacteria 830
670 Ga0207677_10023509 3300026023 Bacteria 3810
671 Ga0207677_10195372 3300026023 Bacteria 1604
672 Ga0207703_10132857 3300026035 Bacteria 2151
673 Ga0207703_10340107 3300026035 Bacteria 1379
674 Ga0207703_10407882 3300026035 Bacteria 1262
675 Ga0207639_10137502 3300026041 Bacteria 2031
676 Ga0207639_10170572 3300026041 Bacteria 1842
677 Ga0207639_10197449 3300026041 Bacteria 1723
678 Ga0207639_10274308 3300026041 Bacteria 1481
679 Ga0207639_10686397 3300026041 Bacteria 949
680 Ga0207678_10034089 3300026067 Bacteria 4434
681 Ga0207678_10054617 3300026067 Bacteria 3440
682 Ga0207678_10092892 3300026067 Bacteria 2579
683 Ga0207678_10103333 3300026067 Bacteria 2432
684 Ga0207678_10147245 3300026067 Bacteria 2010
685 Ga0207678_10211764 3300026067 Bacteria 1658
686 Ga0207678_10246770 3300026067 Bacteria 1529
687 Ga0207678_10250966 3300026067 Bacteria 1515
688 Ga0207678_10696423 3300026067 Bacteria 894
689 Ga0207678_10721723 3300026067 Bacteria 878
690 Ga0207708_10087380 3300026075 Bacteria 2401
691 Ga0207708_10152061 3300026075 Bacteria 1823
692 Ga0207702_10000005 3300026078 Bacteria 420296
693 Ga0207702_10000178 3300026078 Bacteria 76683
694 Ga0207702_10005949 3300026078 Bacteria 10595
695 Ga0207702_10386681 3300026078 Bacteria 1346
696 Ga0207702_10531139 3300026078 Bacteria 1149
697 Ga0207702_10786227 3300026078 Bacteria 940
698 Ga0207702_10857098 3300026078 Bacteria 899
699 Ga0207702_10913949 3300026078 Bacteria 870
700 Ga0207648_10242045 3300026089 Bacteria 1606
701 Ga0207676_10056087 3300026095 Bacteria 3096
702 Ga0207676_10476547 3300026095 Bacteria 1181
703 Ga0207674_10009555 3300026116 Bacteria 11064
704 Ga0207674_10019980 3300026116 Bacteria 7248
705 Ga0207674_10239449 3300026116 Bacteria 1761
706 Ga0207674_11172463 3300026116 Bacteria 738
707 Ga0207675_100155253 3300026118 Bacteria 2181
708 Ga0207675_100360695 3300026118 Bacteria 1426
709 Ga0207675_100390859 3300026118 Bacteria 1369
710 Ga0207683_10110138 3300026121 Bacteria 2465
711 Ga0207683_10202212 3300026121 Bacteria 1806
712 Ga0207683_10714537 3300026121 Bacteria 929
713 Ga0207698_10057556 3300026142 Bacteria 3008
714 Ga0207698_10128273 3300026142 Bacteria 2162
715 Ga0207698_10148368 3300026142 Bacteria 2032
716 Ga0207698_10279237 3300026142 Bacteria 1544
717 Ga0207698_10318817 3300026142 Bacteria 1455
718 Ga0207698_10636859 3300026142 Bacteria 1055
719 Ga0207698_11167681 3300026142 Bacteria 783
720 Ga0209389_1000084 3300027296 Bacteria 85267
721 Ga0209389_1000769 3300027296 Bacteria 20282
722 Ga0209589_1000023 3300027357 Bacteria 177856
723 Ga0209589_1000041 3300027357 Bacteria 125191
724 Ga0209489_100032 3300027361 Bacteria 177856
725 Ga0209489_100070 3300027361 Bacteria 138580
726 Ga0209489_106642 3300027361 Bacteria 18334
727 Ga0209700_100021 3300027363 Bacteria 230859
728 Ga0209700_100040 3300027363 Bacteria 177856
729 Ga0209179_1026462 3300027512 Bacteria 1164
730 Ga0209588_1029962 3300027671 Bacteria 1737
731 Ga0209813_10020675 3300027866 Bacteria 1844
732 Ga0209813_10048312 3300027866 Bacteria 1321
733 Ga0209813_10130088 3300027866 Bacteria 885
734 Ga0207428_10664932 3300027907 Bacteria 747
735 Ga0268266_10011621 3300028379 Bacteria 7643
736 Ga0268266_10022797 3300028379 Bacteria 5330
737 Ga0268266_10049379 3300028379 Bacteria 3608
738 Ga0268266_10071394 3300028379 Bacteria 3009
739 Ga0268266_10137410 3300028379 Bacteria 2190
740 Ga0268266_10243638 3300028379 Bacteria 1660
741 Ga0268266_10291782 3300028379 Bacteria 1519
742 Ga0268266_10391775 3300028379 Bacteria 1312
743 Ga0268266_10412134 3300028379 Bacteria 1279
744 Ga0268266_10858790 3300028379 Bacteria 877
745 Ga0268266_10895323 3300028379 Bacteria 858
746 Ga0268265_10385049 3300028380 Bacteria 1291
747 Ga0268264_10000022 3300028381 Bacteria 476624
748 Ga0268264_10168366 3300028381 Bacteria 1980
749 Ga0268264_10297397 3300028381 Bacteria 1518
750 Ga0268264_10554374 3300028381 Bacteria 1128
751 Ga0268264_10622776 3300028381 Bacteria 1066
752 Ga0268264_10769601 3300028381 Bacteria 960
753 Ga0268264_10832849 3300028381 Bacteria 923
754 Ga0265319_1004069 3300028563 Bacteria 7374
755 Ga0265334_10022785 3300028573 Bacteria 2549
756 Ga0265318_10047421 3300028577 Bacteria 1620
757 Ga0265323_10007731 3300028653 Bacteria 4450
758 Ga0265336_10001715 3300028666 Bacteria 9629
759 Ga0307517_10005009 3300028786 Bacteria 20143
760 Ga0307517_10222716 3300028786 Bacteria 1144
761 Ga0307515_10053817 3300028794 Bacteria 5924
762 Ga0307515_10171893 3300028794 Bacteria 2156
763 Ga0265338_10000393 3300028800 Bacteria 78303
764 Ga0265324_10058423 3300029957 Bacteria 1319
765 Ga0265762_1032733 3300030760 Bacteria 993
766 Ga0265763_1008241 3300030763 Bacteria 928
767 Ga0265330_10037631 3300031235 Bacteria 2153
768 Ga0265330_10060272 3300031235 Bacteria 1652
769 Ga0265330_10084965 3300031235 Bacteria 1361
770 Ga0265332_10043871 3300031238 Bacteria 1930
771 Ga0265328_10000237 3300031239 Bacteria 25362
772 Ga0265325_10015936 3300031241 Bacteria 4211
773 Ga0265340_10028458 3300031247 Bacteria 2810
774 Ga0265340_10051033 3300031247 Bacteria 2004
775 Ga0265339_10001342 3300031249 Bacteria 18396
776 Ga0265339_10020763 3300031249 Bacteria 3831
777 Ga0265331_10098531 3300031250 Bacteria 1347
778 Ga0265316_10352581 3300031344 Bacteria 1065
779 Ga0307513_10377835 3300031456 Bacteria 1157
780 Ga0307513_10415164 3300031456 Bacteria 1077
781 Ga0307408_100482767 3300031548 Bacteria 1081
782 Ga0307508_10000009 3300031616 Bacteria 256966
783 Ga0307508_10032585 3300031616 Bacteria 4707
784 Ga0307508_10033482 3300031616 Bacteria 4638
785 Ga0307508_10169929 3300031616 Bacteria 1783
786 Ga0307508_10265713 3300031616 Bacteria 1310
787 Ga0307508_10364572 3300031616 Bacteria 1036
788 Ga0307508_10400317 3300031616 Bacteria 964
789 Ga0265314_10047708 3300031711 Bacteria 3012
790 Ga0265314_10049680 3300031711 Bacteria 2935
791 Ga0265342_10006351 3300031712 Bacteria 8813
792 Ga0265342_10024669 3300031712 Bacteria 3793
793 Ga0265342_10128330 3300031712 Bacteria 1423
794 Ga0307516_10012009 3300031730 Bacteria 9363
795 Ga0307516_10030323 3300031730 Bacteria 5458
796 Ga0307516_10110701 3300031730 Bacteria 2549
797 Ga0307405_10262830 3300031731 Bacteria 1290
798 Ga0307413_10066597 3300031824 Bacteria 2248
799 Ga0307413_10573640 3300031824 Bacteria 919
800 Ga0307410_10249163 3300031852 Bacteria 1380
801 Ga0307407_10276134 3300031903 Bacteria 1162
802 Ga0307407_10505450 3300031903 Bacteria 887
803 Ga0307412_10093254 3300031911 Bacteria 2112
804 Ga0307412_10117337 3300031911 Bacteria 1911
805 Ga0307409_100527222 3300031995 Bacteria 1155
806 Ga0307409_100547312 3300031995 Bacteria 1135
807 Ga0307416_100220992 3300032002 Bacteria 1817
808 Ga0307416_100230819 3300032002 Bacteria 1784
809 Ga0307414_10436064 3300032004 Bacteria 1146
810 Ga0307411_10405452 3300032005 Bacteria 1128
811 Ga0307415_100161327 3300032126 Bacteria 1738
812 Ga0307415_101405925 3300032126 Bacteria 664
813 Ga0307507_10090137 3300033179 Bacteria 2633
814 Ga0307510_10016530 3300033180 Bacteria 8708
815 Ga0307510_10064843 3300033180 Bacteria 3706
816 Ga0307510_10104938 3300033180 Bacteria 2597
817 Ga0315911_1000001 3300033442 Bacteria 1088602
818 Ga0316215_1007286 3300033544 Bacteria 1077
819 Ga0373930_0028134 3300034816 Bacteria 1143
820 Ga0373928_0010459 3300035084 Bacteria 1823
821 Ga0373934_0013574 3300035086 Bacteria 3082
822 Ga0373934_0033430 3300035086 Bacteria 2018
823 Ga0373934_0218016 3300035086 Bacteria 787
824 Ga0373944_0027389 3300035089 Bacteria 1689
825 Ga0373952_0019158 3300035092 Bacteria 1422
826 Ga0373923_0016358 3300035111 Bacteria 2816
827 Ga0373923_0017798 3300035111 Bacteria 2723
828 Ga0373936_0010808 3300035113 Bacteria 3447
829 Ga0373936_0012154 3300035113 Bacteria 3270
830 Ga0373936_0044158 3300035113 Bacteria 1793
831 Ga0373941_0122683 3300035115 Bacteria 928
832 Ga0373941_0130218 3300035115 Bacteria 906
833 Ga0373953_0034417 3300035117 Bacteria 1986
834 Ga0373953_0169588 3300035117 Bacteria 939
835 Ga0373954_0006961 3300035118 Bacteria 4937
836 Ga0373954_0039643 3300035118 Bacteria 2193
837 Ga0373956_0015711 3300035119 Bacteria 3173
838 Ga0373957_0001164 3300035120 Bacteria 6989
839 Ga0373957_0016123 3300035120 Bacteria 2582
840 Ga0373943_0006623 3300035170 Bacteria 5193
841 Ga0373943_0031471 3300035170 Bacteria 2517
842 Ga0373943_0070961 3300035170 Bacteria 1764
843 Ga0373946_0060990 3300035171 Bacteria 1605
844 Ga0373955_0001365 3300035172 Bacteria 10370
845 Ga0373955_0055151 3300035172 Bacteria 2175
846 Ga0373955_0091256 3300035172 Bacteria 1736
847 Ga0373955_0365679 3300035172 Bacteria 875
848 Ga0373961_0193945 3300035241 Bacteria 714
849 Ga0373924_0043356 3300035410 Bacteria 1847
850 Ga0373924_0049841 3300035410 Bacteria 1733
851 Ga0373935_0000146 3300035692 Bacteria 32473
852 Ga0373927_0000069 3300035695 Bacteria 74096
853 Ga0373927_0010050 3300035695 Bacteria 6336
854 Ga0373927_0014565 3300035695 Bacteria 5203
855 Ga0373927_0036575 3300035695 Bacteria 3192
856 Ga0373927_0050269 3300035695 Bacteria 2695
857 Ga0373927_0057991 3300035695 Bacteria 2504
858 Ga0373933_0045513 3300035724 Bacteria 2602
859 Ga0373933_0123734 3300035724 Bacteria 1621
860 Ga0373933_0130761 3300035724 Bacteria 1578
861 Ga0373947_0001838 3300035725 Bacteria 12978
862 Ga0373947_0003617 3300035725 Bacteria 9122
863 Ga0373947_0015569 3300035725 Bacteria 4368
864 Ga0373947_0181014 3300035725 Bacteria 1372
865 Ga0373947_0267032 3300035725 Bacteria 1135
866 Ga0373937_0118954 3300036401 Bacteria 2461
867 Ga0373937_0131845 3300036401 Bacteria 2334
868 Ga0373937_0374282 3300036401 Bacteria 1350
869 Ga0373937_0443253 3300036401 Bacteria 1233
870 Ga0373937_0512407 3300036401 Bacteria 1140
871 Ga0373937_0779722 3300036401 Bacteria 904
872 Ga0373937_0803575 3300036401 Bacteria 888
873 Ga0373937_0935470 3300036401 Bacteria 815
874 Ga0372808_004102 3300036459 Bacteria 1834
875 Ga0373925_0003396 3300037068 Bacteria 12347
876 Ga0373925_0004119 3300037068 Bacteria 11034
877 Ga0373925_0039837 3300037068 Bacteria 3477
878 Ga0373925_0051914 3300037068 Bacteria 3062
879 Ga0373925_0206426 3300037068 Bacteria 1564
880 Ga0373925_0278150 3300037068 Bacteria 1348
881 Ga0373925_0325909 3300037068 Bacteria 1244
882 Ga0373925_0792716 3300037068 Bacteria 781
883 Ga0395899_0391835 3300037312 Bacteria 921
884 Ga0395900_0002015 3300037418 Bacteria 22873
885 Ga0395900_0362802 3300037418 Bacteria 1420
886 Ga0395900_0412637 3300037418 Bacteria 1312
887 Ga0395900_1067987 3300037418 Bacteria 725
888 Ga0395898_0080332 3300037466 Bacteria 3145
889 Ga0395898_0201492 3300037466 Bacteria 1900
890 Ga0395898_0818500 3300037466 Bacteria 871
891 Ga0395905_0016873 3300037471 Bacteria 6938
892 Ga0395905_0056247 3300037471 Bacteria 3681
893 Ga0436364_0372345 3300037853 Bacteria 6329
894 Ga0436364_0608579 3300037853 Bacteria 1416
895 Ga0436364_0782971 3300037853 Bacteria 2291
896 Ga0436364_0968132 3300037853 Bacteria 1161
897 Ga0395901_0033469 3300038443 Bacteria 5306
898 Ga0395901_0230676 3300038443 Bacteria 1933
899 Ga0395901_0248799 3300038443 Bacteria 1852
900 Ga0395901_0351911 3300038443 Bacteria 1520
901 Ga0436365_0096763 3300039437 Bacteria 11983
902 Ga0436365_0300598 3300039437 Bacteria 971
903 Ga0436365_0324877 3300039437 Bacteria 2882
904 Ga0436365_0811160 3300039437 Bacteria 1657
905 Ga0436365_1028631 3300039437 Bacteria 7603
906 Ga0436365_1277930 3300039437 Bacteria 3753
907 Ga0436360_0091466 3300039438 Bacteria 3057
908 Ga0436361_0037185 3300039447 Bacteria 5134
909 Ga0436361_0384206 3300039447 Bacteria 2381
910 Ga0436361_0421378 3300039447 Bacteria 2337
911 Ga0436361_0954332 3300039447 Bacteria 596
912 Ga0436361_1169507 3300039447 Bacteria 2266
913 Ga0436363_0297092 3300039450 Bacteria 761
914 Ga0436363_0529094 3300039450 Bacteria 3535
915 Ga0436363_0686784 3300039450 Bacteria 9702
916 Ga0436362_1129828 3300039453 Bacteria 740
917 Ga0436362_1265351 3300039453 Bacteria 2880
918 Ga0451793_0862873 3300041452 Bacteria 882
919 Ga0451800_1555217 3300041459 Bacteria 865
920 Ga0451807_2207588 3300041486 Bacteria 1218
921 Ga0451851_1090162 3300041507 Bacteria 913
922 Ga0466972_0000544 3300044658 Bacteria 18468
923 Ga0466972_0005541 3300044658 Bacteria 6325
924 Ga0466972_0065101 3300044658 Bacteria 1744
925 Ga0466965_0033529 3300044683 Bacteria 2510
926 Ga0466965_0106668 3300044683 Bacteria 1437
927 Ga0466966_0000464 3300044684 Bacteria 25987
928 Ga0466966_0031011 3300044684 Bacteria 3468
929 Ga0466966_0311449 3300044684 Bacteria 946
930 Ga0466961_0000064 3300044693 Bacteria 63553
931 Ga0466963_0012147 3300044694 Bacteria 5264
932 Ga0466963_0026671 3300044694 Bacteria 3696
933 Ga0466963_0266635 3300044694 Bacteria 1203
934 Ga0466971_0233474 3300044719 Bacteria 874
935 Ga0466968_0009497 3300044735 Bacteria 3741
936 Ga0466968_0121388 3300044735 Bacteria 1182
937 Ga0466968_0319393 3300044735 Bacteria 750
938 Ga0466970_0505669 3300044765 Bacteria 696
939 Ga0466957_0198939 3300044842 Bacteria 1315
940 Ga0466960_0033351 3300044901 Bacteria 2392
941 Ga0466960_0320922 3300044901 Bacteria 877
942 Ga0466960_0394260 3300044901 Bacteria 796
943 Ga0466959_0076469 3300045049 Bacteria 2417
944 Ga0466959_0472119 3300045049 Bacteria 849
945 Ga0466958_0139855 3300045836 Bacteria 1524
946 Ga0466958_0275603 3300045836 Bacteria 1078
947 Ga0466967_0045862 3300045976 Bacteria 3801
948 Ga0466967_0191918 3300045976 Bacteria 1931
949 Ga0466967_0255813 3300045976 Bacteria 1674
950 Ga0495592_0034221 3300046454 Bacteria 3830
951 Ga0495592_0064790 3300046454 Bacteria 2677
952 Ga0495592_0118340 3300046454 Bacteria 1866
953 Ga0495603_0001909 3300046455 Bacteria 12296
954 Ga0495603_0018102 3300046455 Bacteria 4261
955 Ga0495603_0116820 3300046455 Bacteria 1555
956 Ga0495590_0054853 3300046457 Bacteria 1392
957 Ga0495629_0000083 3300046459 Bacteria 83715
958 Ga0495629_0005721 3300046459 Bacteria 9276
959 Ga0495629_0048353 3300046459 Bacteria 2982
960 Ga0495629_0140682 3300046459 Bacteria 1679
961 Ga0495629_0144033 3300046459 Bacteria 1658
962 Ga0495629_0188943 3300046459 Bacteria 1426
963 Ga0495629_0211175 3300046459 Bacteria 1340
964 Ga0495629_0265725 3300046459 Bacteria 1179
965 Ga0495638_0009058 3300046460 Bacteria 7014
966 Ga0495638_0033022 3300046460 Bacteria 3311
967 Ga0495638_0050021 3300046460 Bacteria 2611
968 Ga0495638_0127253 3300046460 Bacteria 1500
969 Ga0495638_0140928 3300046460 Bacteria 1407
970 Ga0495638_0193666 3300046460 Bacteria 1152
971 Ga0495651_0011064 3300046462 Bacteria 6942
972 Ga0495651_0024124 3300046462 Bacteria 4732
973 Ga0495651_0079859 3300046462 Bacteria 2471
974 Ga0495653_0022712 3300046463 Bacteria 5075
975 Ga0495653_0049003 3300046463 Bacteria 3257
976 Ga0495653_0050712 3300046463 Bacteria 3190
977 Ga0495650_0119158 3300046471 Bacteria 973
978 Ga0495580_0001769 3300046472 Bacteria 18986
979 Ga0495580_0036011 3300046472 Bacteria 3556
980 Ga0495580_0231499 3300046472 Bacteria 1268
981 Ga0495580_0525176 3300046472 Bacteria 788
982 Ga0495582_0000206 3300046473 Bacteria 32664
983 Ga0495639_0000167 3300046475 Bacteria 34509
984 Ga0495639_0055239 3300046475 Bacteria 1811
985 Ga0495639_0280182 3300046475 Bacteria 828
986 Ga0495662_0001226 3300046476 Bacteria 12623
987 Ga0495662_0034386 3300046476 Bacteria 2447
988 Ga0495662_0123779 3300046476 Bacteria 1270
989 Ga0495662_0209044 3300046476 Bacteria 962
990 Ga0495664_0012724 3300046477 Bacteria 4766
991 Ga0495664_0018663 3300046477 Bacteria 3978
992 Ga0495664_0028540 3300046477 Bacteria 3258
993 Ga0495664_0233359 3300046477 Bacteria 1113
994 Ga0495664_0336805 3300046477 Bacteria 909
995 Ga0495584_0156258 3300046491 Bacteria 1159
996 Ga0495584_0240223 3300046491 Bacteria 921
997 Ga0495585_0058134 3300046492 Bacteria 2133
998 Ga0495585_0264847 3300046492 Bacteria 854
999 Ga0495585_0286303 3300046492 Bacteria 813
1000 Ga0495594_0019970 3300046499 Bacteria 3565
1001 Ga0495594_0071310 3300046499 Bacteria 1932
1002 Ga0495594_0077609 3300046499 Bacteria 1853
1003 Ga0495594_0156437 3300046499 Bacteria 1295
1004 Ga0495596_0114156 3300046500 Bacteria 1049
1005 Ga0495596_0120013 3300046500 Bacteria 1021
1006 Ga0495607_0066347 3300046501 Bacteria 2031
1007 Ga0495607_0240220 3300046501 Bacteria 877
1008 Ga0495583_0023388 3300046506 Bacteria 3127
1009 Ga0495583_0181034 3300046506 Bacteria 863
1010 Ga0495606_0013321 3300046507 Bacteria 6509
1011 Ga0495606_0091259 3300046507 Bacteria 1873
1012 Ga0495606_0147726 3300046507 Bacteria 1382
1013 Ga0495606_0200167 3300046507 Bacteria 1139
1014 Ga0495606_0336950 3300046507 Bacteria 805
1015 Ga0495608_0014244 3300046511 Bacteria 5517
1016 Ga0495608_0043738 3300046511 Bacteria 2992
1017 Ga0495608_0079609 3300046511 Bacteria 2131
1018 Ga0495608_0219913 3300046511 Bacteria 1192
1019 Ga0495610_0150542 3300046512 Bacteria 993
1020 Ga0495616_0033023 3300046513 Bacteria 2700
1021 Ga0495616_0103911 3300046513 Bacteria 1328
1022 Ga0495616_0192138 3300046513 Bacteria 902
1023 Ga0495618_0025681 3300046514 Bacteria 3658
1024 Ga0495618_0090739 3300046514 Bacteria 1953
1025 Ga0495618_0167354 3300046514 Bacteria 1399
1026 Ga0495618_0454052 3300046514 Bacteria 777
1027 Ga0495618_0489630 3300046514 Bacteria 742
1028 Ga0495620_0043544 3300046515 Bacteria 1955
1029 Ga0495628_0014653 3300046516 Bacteria 6567
1030 Ga0495628_0031146 3300046516 Bacteria 4315
1031 Ga0495628_0062492 3300046516 Bacteria 2919
1032 Ga0495628_0062821 3300046516 Bacteria 2910
1033 Ga0495630_0013263 3300046517 Bacteria 5995
1034 Ga0495630_0086736 3300046517 Bacteria 2364
1035 Ga0495637_0113703 3300046520 Bacteria 1047
1036 Ga0495637_0141151 3300046520 Bacteria 914
1037 Ga0495643_0028445 3300046522 Bacteria 3134
1038 Ga0495643_0041847 3300046522 Bacteria 2497
1039 Ga0495644_0090277 3300046523 Bacteria 1156
1040 Ga0495648_0000160 3300046524 Bacteria 80523
1041 Ga0495648_0001196 3300046524 Bacteria 25992
1042 Ga0495648_0087412 3300046524 Bacteria 1755
1043 Ga0495648_0098219 3300046524 Bacteria 1622
1044 Ga0495648_0240366 3300046524 Bacteria 880
1045 Ga0495648_0276545 3300046524 Bacteria 798
1046 Ga0495666_0009182 3300046526 Bacteria 4946
1047 Ga0495666_0092882 3300046526 Bacteria 1424
1048 Ga0495652_0006710 3300046529 Bacteria 10684
1049 Ga0495652_0025125 3300046529 Bacteria 5273
1050 Ga0495652_0161489 3300046529 Bacteria 1739
1051 Ga0495654_0114097 3300046530 Bacteria 1230
1052 Ga0495665_0000399 3300046531 Bacteria 22087
1053 Ga0495665_0023581 3300046531 Bacteria 3305
1054 Ga0495665_0157072 3300046531 Bacteria 1186
1055 Ga0495640_0002380 3300046533 Bacteria 15099
1056 Ga0495640_0028028 3300046533 Bacteria 4057
1057 Ga0495640_0050947 3300046533 Bacteria 2849
1058 Ga0495640_0061307 3300046533 Bacteria 2555
1059 Ga0495586_0077715 3300046535 Bacteria 1820
1060 Ga0495586_0165054 3300046535 Bacteria 1250
1061 Ga0495586_0316969 3300046535 Bacteria 894
1062 Ga0495587_0001761 3300046536 Bacteria 14465
1063 Ga0495587_0050231 3300046536 Bacteria 2467
1064 Ga0495587_0074654 3300046536 Bacteria 1969
1065 Ga0495587_0428295 3300046536 Bacteria 734
1066 Ga0495598_0019152 3300046537 Bacteria 1790
1067 Ga0495597_0020857 3300046542 Bacteria 3048
1068 Ga0495597_0119787 3300046542 Bacteria 1098
1069 Ga0495597_0255275 3300046542 Bacteria 688
1070 Ga0495645_0034702 3300046543 Bacteria 3678
1071 Ga0495645_0041758 3300046543 Bacteria 3344
1072 Ga0495645_0427287 3300046543 Bacteria 840
1073 Ga0495622_0009591 3300046557 Bacteria 4477
1074 Ga0495622_0031815 3300046557 Bacteria 2464
1075 Ga0495622_0051568 3300046557 Bacteria 1909
1076 Ga0495622_0053225 3300046557 Bacteria 1878
1077 Ga0495622_0152231 3300046557 Bacteria 1046
1078 Ga0495622_0164768 3300046557 Bacteria 998
1079 Ga0495667_0017344 3300046559 Bacteria 4864
1080 Ga0495667_0017845 3300046559 Bacteria 4795
1081 Ga0495667_0019890 3300046559 Bacteria 4531
1082 Ga0495667_0052678 3300046559 Bacteria 2680
1083 Ga0495667_0058587 3300046559 Bacteria 2530
1084 Ga0495656_0007281 3300046615 Bacteria 3905
1085 Ga0495656_0023685 3300046615 Bacteria 2418
1086 Ga0495656_0044509 3300046615 Bacteria 1869
1087 Ga0495668_0040069 3300046616 Bacteria 2614
1088 Ga0495668_0045057 3300046616 Bacteria 2451
1089 Ga0495668_0120946 3300046616 Bacteria 1432
1090 Ga0495668_0363460 3300046616 Bacteria 795
1091 Ga0495634_0001116 3300046642 Bacteria 24891
1092 Ga0495634_0028911 3300046642 Bacteria 3842
1093 Ga0495634_0061319 3300046642 Bacteria 2500
1094 Ga0495634_0065642 3300046642 Bacteria 2405
1095 Ga0495625_0067965 3300046660 Bacteria 2506
1096 Ga0495625_0096654 3300046660 Bacteria 2034
1097 Ga0495625_0215103 3300046660 Bacteria 1262
1098 Ga0495625_0383243 3300046660 Bacteria 882
1099 Ga0495635_0004122 3300046663 Bacteria 10078
1100 Ga0495635_0009798 3300046663 Bacteria 6698
1101 Ga0495635_0072250 3300046663 Bacteria 2364
1102 Ga0495635_0318259 3300046663 Bacteria 1042
1103 Ga0495635_0422567 3300046663 Bacteria 883
1104 Ga0495661_0239166 3300046665 Bacteria 932
1105 Ga0495661_0268252 3300046665 Bacteria 865
1106 Ga0495661_0344786 3300046665 Bacteria 735
1107 Ga0495588_0015755 3300046674 Bacteria 3645
1108 Ga0495588_0022459 3300046674 Bacteria 3118
1109 Ga0495588_0138774 3300046674 Bacteria 1284
1110 Ga0495588_0161946 3300046674 Bacteria 1183
1111 Ga0495657_0010159 3300046675 Bacteria 7088
1112 Ga0495657_0024479 3300046675 Bacteria 4298
1113 Ga0495657_0075779 3300046675 Bacteria 2186
1114 Ga0495599_0019035 3300046678 Bacteria 4281
1115 Ga0495599_0045885 3300046678 Bacteria 2740
1116 Ga0495599_0067560 3300046678 Bacteria 2232
1117 Ga0495623_0027908 3300046679 Bacteria 3633
1118 Ga0495623_0070485 3300046679 Bacteria 2178
1119 Ga0495646_0041026 3300046680 Bacteria 2846
1120 Ga0495646_0081318 3300046680 Bacteria 1888
1121 Ga0495647_0006697 3300046681 Bacteria 3830
1122 Ga0495647_0072848 3300046681 Bacteria 1379
1123 Ga0495647_0321061 3300046681 Bacteria 701
1124 Ga0495658_0002678 3300046683 Bacteria 8967
1125 Ga0495658_0019454 3300046683 Bacteria 3545
1126 Ga0495669_0010576 3300046684 Bacteria 3901
1127 Ga0495669_0067456 3300046684 Bacteria 1626
1128 Ga0495669_0159761 3300046684 Bacteria 1069
1129 Ga0495669_0160453 3300046684 Bacteria 1067
1130 Ga0495613_0005847 3300046689 Bacteria 9201
1131 Ga0495613_0075641 3300046689 Bacteria 2451
1132 Ga0495613_0088328 3300046689 Bacteria 2246
1133 Ga0495613_0139782 3300046689 Bacteria 1731
1134 Ga0495624_0000096 3300046690 Bacteria 59307
1135 Ga0495624_0103178 3300046690 Bacteria 1755
1136 Ga0495624_0114147 3300046690 Bacteria 1660
1137 Ga0495624_0198671 3300046690 Bacteria 1219
1138 Ga0495670_0005402 3300046691 Bacteria 6276
1139 Ga0495670_0126905 3300046691 Bacteria 1328
1140 Ga0495671_0212219 3300046692 Bacteria 938
1141 Ga0495649_0010963 3300046694 Bacteria 5338
1142 Ga0495589_0113172 3300046794 Bacteria 1309
1143 Ga0495600_0021127 3300046809 Bacteria 4167
1144 Ga0495600_0064610 3300046809 Bacteria 2392
1145 Ga0495600_0092483 3300046809 Bacteria 1972
1146 Ga0495600_0094882 3300046809 Bacteria 1945
1147 Ga0495600_0130415 3300046809 Bacteria 1634
1148 Ga0495600_0216297 3300046809 Bacteria 1227
1149 Ga0495660_0196459 3300046810 Bacteria 966
1150 Ga0495581_0000311 3300047315 Bacteria 23901
1151 Ga0495581_0020721 3300047315 Bacteria 3813
1152 Ga0495581_0052270 3300047315 Bacteria 2360
1153 Ga0495581_0187593 3300047315 Bacteria 1209
1154 Ga0495581_0194330 3300047315 Bacteria 1187
1155 Ga0495604_0008901 3300047317 Bacteria 7934
1156 Ga0495604_0038851 3300047317 Bacteria 3744
1157 Ga0495604_0240146 3300047317 Bacteria 1239
1158 Ga0495604_0260149 3300047317 Bacteria 1180
1159 Ga0495636_0123915 3300047318 Bacteria 1145
1160 Ga0495674_0050033 3300047319 Bacteria 3688
1161 Ga0495674_0058805 3300047319 Bacteria 3359
1162 Ga0495674_0065294 3300047319 Bacteria 3162
1163 Ga0495674_0152144 3300047319 Bacteria 1939
1164 Ga0495674_0353797 3300047319 Bacteria 1192
1165 Ga0495672_0024038 3300047320 Bacteria 3933
1166 Ga0495672_0065112 3300047320 Bacteria 2084
1167 Ga0495672_0082292 3300047320 Bacteria 1791
1168 Ga0495676_0039532 3300047321 Bacteria 3906
1169 Ga0495676_0089239 3300047321 Bacteria 2310
1170 Ga0495676_0126783 3300047321 Bacteria 1849
1171 Ga0495676_0200008 3300047321 Bacteria 1389
1172 Ga0495680_0001163 3300047322 Bacteria 29006
1173 Ga0495680_0035984 3300047322 Bacteria 3981
1174 Ga0495680_0251130 3300047322 Bacteria 1253
1175 Ga0495680_0327252 3300047322 Bacteria 1071
1176 Ga0495680_0449552 3300047322 Bacteria 882
1177 Ga0495683_0038748 3300047323 Bacteria 2412
1178 Ga0495683_0055378 3300047323 Bacteria 1974
1179 Ga0495683_0127368 3300047323 Bacteria 1204
1180 Ga0495683_0189377 3300047323 Bacteria 934
1181 Ga0495687_019628 3300047443 Bacteria 3311
1182 Ga0495675_0026164 3300047444 Bacteria 3719
1183 Ga0495675_0032440 3300047444 Bacteria 3333
1184 Ga0495675_0051848 3300047444 Bacteria 2605
1185 Ga0495675_0390170 3300047444 Bacteria 813
1186 Ga0495685_084558 3300047447 Bacteria 1055
1187 Ga0495673_0026040 3300047469 Bacteria 2802
1188 Ga0495673_0080324 3300047469 Bacteria 1352
1189 Ga0495673_0091207 3300047469 Bacteria 1245
1190 Ga0495673_0120971 3300047469 Bacteria 1037
1191 Ga0495681_0215680 3300047470 Bacteria 772
1192 Ga0495684_0000942 3300047471 Bacteria 23681
1193 Ga0495684_0017663 3300047471 Bacteria 5494
1194 Ga0495684_0058325 3300047471 Bacteria 2941
1195 Ga0495686_0067551 3300047472 Bacteria 2207
1196 Ga0495686_0147415 3300047472 Bacteria 1384
1197 Ga0495686_0275891 3300047472 Bacteria 936
1198 Ga0495593_0000071 3300047673 Bacteria 43314
1199 Ga0495593_0013019 3300047673 Bacteria 4750
1200 Ga0495593_0018979 3300047673 Bacteria 3858
1201 Ga0495593_0268935 3300047673 Bacteria 853
1202 Ga0495593_0383695 3300047673 Bacteria 703
1203 Ga0495602_0021297 3300048088 Bacteria 6386
1204 Ga0495602_0067114 3300048088 Bacteria 3088
1205 Ga0495602_0094093 3300048088 Bacteria 2477
1206 Ga0495602_0198154 3300048088 Bacteria 1534
1207 Ga0495614_0008727 3300048089 Bacteria 4504
1208 Ga0495614_0034558 3300048089 Bacteria 2173
1209 Ga0495615_0057302 3300048090 Bacteria 1019
1210 Ga0496100_0006862 3300048903 Bacteria 6237
1211 Ga0496100_0030017 3300048903 Bacteria 3368
1212 Ga0496100_0067081 3300048903 Bacteria 2382
1213 Ga0496100_0193582 3300048903 Bacteria 1478
1214 Ga0496100_0551566 3300048903 Bacteria 892
1215 Ga0496101_0019446 3300048904 Bacteria 4636
1216 Ga0496101_0033539 3300048904 Bacteria 3621
1217 Ga0496101_0210252 3300048904 Bacteria 1507
1218 Ga0496102_0001926 3300048905 Bacteria 17867
1219 Ga0496102_0060654 3300048905 Bacteria 3460
1220 Ga0496102_0139743 3300048905 Bacteria 2271
1221 Ga0496102_0148795 3300048905 Bacteria 2199
1222 Ga0496102_0164345 3300048905 Bacteria 2088
1223 Ga0496103_0014496 3300048906 Bacteria 4679
1224 Ga0496103_0036742 3300048906 Bacteria 3000
1225 Ga0496103_0219533 3300048906 Bacteria 1223
1226 Ga0496103_0222744 3300048906 Bacteria 1213
1227 Ga0496103_0246223 3300048906 Bacteria 1150
1228 Ga0496103_0408644 3300048906 Bacteria 872
1229 Ga0496103_0489627 3300048906 Bacteria 787
1230 Ga0496104_0020064 3300048907 Bacteria 6122
1231 Ga0496104_0064265 3300048907 Bacteria 3481
1232 Ga0496104_0100802 3300048907 Bacteria 2764
1233 Ga0496104_0137467 3300048907 Bacteria 2347
1234 Ga0496104_0415737 3300048907 Bacteria 1257
1235 Ga0496104_0791599 3300048907 Bacteria 854
1236 Ga0496104_1197137 3300048907 Bacteria 663
1237 Ga0496105_0010459 3300048908 Bacteria 7295
1238 Ga0496105_0035128 3300048908 Bacteria 4125
1239 Ga0496105_0101150 3300048908 Bacteria 2380
1240 Ga0496105_0288934 3300048908 Bacteria 1320
1241 Ga0496105_0327819 3300048908 Bacteria 1226
1242 Ga0496105_0706675 3300048908 Bacteria 773
1243 Ga0496106_0000540 3300048909 Bacteria 26830
1244 Ga0496106_0034172 3300048909 Bacteria 3797
1245 Ga0496106_0036470 3300048909 Bacteria 3678
1246 Ga0496106_0046945 3300048909 Bacteria 3248
1247 Ga0496106_0090658 3300048909 Bacteria 2359
1248 Ga0496106_0104600 3300048909 Bacteria 2198
1249 Ga0496106_0172083 3300048909 Bacteria 1717
1250 Ga0496107_0010385 3300048910 Bacteria 6469
1251 Ga0496107_0041442 3300048910 Bacteria 3305
1252 Ga0496107_0073122 3300048910 Bacteria 2493
1253 Ga0496107_0099120 3300048910 Bacteria 2135
1254 Ga0496107_0101115 3300048910 Bacteria 2114
1255 Ga0496107_0110746 3300048910 Bacteria 2018
1256 Ga0496107_0452242 3300048910 Bacteria 954
1257 Ga0496107_0486083 3300048910 Bacteria 916
1258 Ga0496107_0530016 3300048910 Bacteria 873
1259 Ga0496107_0714140 3300048910 Bacteria 737
1260 Ga0496108_0024248 3300048911 Bacteria 4995
1261 Ga0496108_0037119 3300048911 Bacteria 4057
1262 Ga0496108_0125497 3300048911 Bacteria 2203
1263 Ga0496108_0372702 3300048911 Bacteria 1246
1264 Ga0496108_0375281 3300048911 Bacteria 1242
1265 Ga0496108_0420830 3300048911 Bacteria 1167
1266 Ga0496109_0047773 3300048912 Bacteria 3892
1267 Ga0496109_0072134 3300048912 Bacteria 3171
1268 Ga0496109_0077064 3300048912 Bacteria 3067
1269 Ga0496109_0084984 3300048912 Bacteria 2920
1270 Ga0496109_0131657 3300048912 Bacteria 2335
1271 Ga0496109_0276554 3300048912 Bacteria 1582
1272 Ga0496109_0411191 3300048912 Bacteria 1278
1273 Ga0496109_0480948 3300048912 Bacteria 1172
1274 Ga0496109_0907620 3300048912 Bacteria 819
1275 Ga0496110_0062468 3300048913 Bacteria 3289
1276 Ga0496110_0108416 3300048913 Bacteria 2493
1277 Ga0496110_0222310 3300048913 Bacteria 1717
1278 Ga0496110_0238529 3300048913 Bacteria 1654
1279 Ga0496110_0238647 3300048913 Bacteria 1654
1280 Ga0496110_0335604 3300048913 Bacteria 1377
1281 Ga0496110_0484064 3300048913 Bacteria 1127
1282 Ga0496110_0598562 3300048913 Bacteria 1000
1283 Ga0496110_0764082 3300048913 Bacteria 870
1284 Ga0496110_0910499 3300048913 Bacteria 786
1285 Ga0496111_0211286 3300048914 Bacteria 1441
1286 Ga0496111_0243776 3300048914 Bacteria 1334
1287 Ga0496111_0280536 3300048914 Bacteria 1235
1288 Ga0496111_0754043 3300048914 Bacteria 706
1289 Ga0496112_0000079 3300048915 Bacteria 64101
1290 Ga0496112_0002172 3300048915 Bacteria 15587
1291 Ga0496112_0030477 3300048915 Bacteria 5221
1292 Ga0496112_0033389 3300048915 Bacteria 5003
1293 Ga0496112_0033894 3300048915 Bacteria 4967
1294 Ga0496112_0037869 3300048915 Bacteria 4709
1295 Ga0496112_0065781 3300048915 Bacteria 3577
1296 Ga0496112_0113520 3300048915 Bacteria 2680
1297 Ga0496112_0400071 3300048915 Bacteria 1313
1298 Ga0496112_0532323 3300048915 Bacteria 1109
1299 Ga0496112_0543156 3300048915 Bacteria 1096
1300 Ga0496112_0627653 3300048915 Bacteria 1005
1301 Ga0496113_0013381 3300048916 Bacteria 5556
1302 Ga0496113_0091280 3300048916 Bacteria 2348
1303 Ga0496113_0096003 3300048916 Bacteria 2291
1304 Ga0496113_0141941 3300048916 Bacteria 1890
1305 Ga0496113_0353452 3300048916 Bacteria 1179
1306 Ga0496113_0821986 3300048916 Bacteria 737
1307 Ga0496114_0006304 3300048917 Bacteria 9334
1308 Ga0496114_0040317 3300048917 Bacteria 3866
1309 Ga0496114_0151995 3300048917 Bacteria 2008
1310 Ga0496114_0154034 3300048917 Bacteria 1995
1311 Ga0496114_0160505 3300048917 Bacteria 1954
1312 Ga0496114_0214888 3300048917 Bacteria 1687
1313 Ga0496114_0253949 3300048917 Bacteria 1547
1314 Ga0496114_0313920 3300048917 Bacteria 1385
1315 Ga0496114_0381784 3300048917 Bacteria 1247
1316 Ga0496114_0941435 3300048917 Bacteria 746
1317 Ga0496114_0968738 3300048917 Bacteria 733
1318 Ga0496114_0996471 3300048917 Bacteria 721
1319 Ga0496115_0001660 3300048918 Bacteria 16005
1320 Ga0496115_0018998 3300048918 Bacteria 5285
1321 Ga0496115_0036183 3300048918 Bacteria 3908
1322 Ga0496115_0081579 3300048918 Bacteria 2634
1323 Ga0496115_0085600 3300048918 Bacteria 2571
1324 Ga0496115_0103181 3300048918 Bacteria 2339
1325 Ga0496115_0217968 3300048918 Bacteria 1575
1326 Ga0496116_0008457 3300048919 Bacteria 8921
1327 Ga0496116_0013474 3300048919 Bacteria 6589
1328 Ga0496116_0208315 3300048919 Bacteria 1016
1329 Ga0496116_0301033 3300048919 Bacteria 763
1330 Ga0496117_0040953 3300048920 Bacteria 3401
1331 Ga0496117_0042403 3300048920 Bacteria 3321
1332 Ga0496117_0064814 3300048920 Bacteria 2488
1333 Ga0496117_0065415 3300048920 Bacteria 2472
1334 Ga0496117_0123355 3300048920 Bacteria 1587
1335 Ga0496118_0014293 3300048921 Bacteria 7444
1336 Ga0496118_0026297 3300048921 Bacteria 4962
1337 Ga0496118_0035320 3300048921 Bacteria 4061
1338 Ga0496118_0046314 3300048921 Bacteria 3385
1339 Ga0496118_0054074 3300048921 Bacteria 3045
1340 Ga0496118_0068550 3300048921 Bacteria 2575
1341 Ga0496118_0085058 3300048921 Bacteria 2204
1342 Ga0496118_0093097 3300048921 Bacteria 2066
1343 Ga0496118_0157644 3300048921 Bacteria 1409
1344 Ga0496118_0245060 3300048921 Bacteria 1023
1345 Ga0496118_0383565 3300048921 Bacteria 736
1346 Ga0496118_0449724 3300048921 Bacteria 654
1347 Ga0496119_0010284 3300048922 Bacteria 7887
1348 Ga0496119_0040732 3300048922 Bacteria 2967
1349 Ga0496119_0076545 3300048922 Bacteria 1941
1350 Ga0496119_0148565 3300048922 Bacteria 1258
1351 Ga0496119_0154376 3300048922 Bacteria 1227
1352 Ga0496119_0173111 3300048922 Bacteria 1138
1353 Ga0496119_0291313 3300048922 Bacteria 808
1354 Ga0496120_0010513 3300048923 Bacteria 6450
1355 Ga0496120_0082896 3300048923 Bacteria 1732
1356 Ga0496121_0000456 3300048924 Bacteria 80536
1357 Ga0496121_0000495 3300048924 Bacteria 75339
1358 Ga0496121_0009589 3300048924 Bacteria 11091
1359 Ga0496121_0015286 3300048924 Bacteria 8060
1360 Ga0496121_0015647 3300048924 Bacteria 7915
1361 Ga0496121_0043716 3300048924 Bacteria 3875
1362 Ga0496121_0051494 3300048924 Bacteria 3467
1363 Ga0496121_0092235 3300048924 Bacteria 2361
1364 Ga0496121_0116831 3300048924 Bacteria 2022
1365 Ga0496121_0181720 3300048924 Bacteria 1517
1366 Ga0496121_0202572 3300048924 Bacteria 1413
1367 Ga0496121_0343105 3300048924 Bacteria 997
1368 Ga0496121_0365010 3300048924 Bacteria 957
1369 Ga0496121_0387285 3300048924 Bacteria 920
1370 Ga0496121_0402935 3300048924 Bacteria 895
1371 Ga0496121_0458639 3300048924 Bacteria 819
1372 Ga0496122_0029991 3300048925 Bacteria 4569
1373 Ga0496122_0031920 3300048925 Bacteria 4368
1374 Ga0496122_0152066 3300048925 Bacteria 1427
1375 Ga0496122_0211868 3300048925 Bacteria 1121
1376 Ga0496123_0065727 3300048926 Bacteria 2303
1377 Ga0496124_0001010 3300048927 Bacteria 44569
1378 Ga0496124_0036927 3300048927 Bacteria 4255
1379 Ga0496124_0059856 3300048927 Bacteria 3197
1380 Ga0496124_0147960 3300048927 Bacteria 1846
1381 Ga0496124_0215043 3300048927 Bacteria 1451
1382 Ga0496125_0000756 3300048928 Bacteria 52960
1383 Ga0496125_0004034 3300048928 Bacteria 17214
1384 Ga0496125_0006620 3300048928 Bacteria 12474
1385 Ga0496125_0038020 3300048928 Bacteria 4174
1386 Ga0496125_0042591 3300048928 Bacteria 3864
1387 Ga0496125_0073181 3300048928 Bacteria 2666
1388 Ga0496125_0104432 3300048928 Bacteria 2075
1389 Ga0496125_0112928 3300048928 Bacteria 1962
1390 Ga0496125_0235786 3300048928 Bacteria 1166
1391 Ga0496125_0262857 3300048928 Bacteria 1080
1392 Ga0496126_0002797 3300048929 Bacteria 22948
1393 Ga0496126_0003586 3300048929 Bacteria 19458
1394 Ga0496126_0008043 3300048929 Bacteria 11440
1395 Ga0496126_0015157 3300048929 Bacteria 7762
1396 Ga0496126_0027082 3300048929 Bacteria 5484
1397 Ga0496126_0048536 3300048929 Bacteria 3878
1398 Ga0496126_0051250 3300048929 Bacteria 3758
1399 Ga0496126_0064624 3300048929 Bacteria 3277
1400 Ga0496126_0065928 3300048929 Bacteria 3238
1401 Ga0496126_0068643 3300048929 Bacteria 3164
1402 Ga0496126_0087978 3300048929 Bacteria 2737
1403 Ga0496126_0093838 3300048929 Bacteria 2634
1404 Ga0496126_0095321 3300048929 Bacteria 2610
1405 Ga0496126_0137681 3300048929 Bacteria 2104
1406 Ga0496126_0168852 3300048929 Bacteria 1865
1407 Ga0496126_0214560 3300048929 Bacteria 1619
1408 Ga0496126_0237224 3300048929 Bacteria 1525
1409 Ga0496126_0245084 3300048929 Bacteria 1495
1410 Ga0496126_0267588 3300048929 Bacteria 1419
1411 Ga0496126_0277742 3300048929 Bacteria 1388
1412 Ga0496126_0311835 3300048929 Bacteria 1295
1413 Ga0496126_0370328 3300048929 Bacteria 1168
1414 Ga0496126_0401194 3300048929 Bacteria 1112
1415 Ga0496126_0456779 3300048929 Bacteria 1027
1416 Ga0496126_0482999 3300048929 Bacteria 992
1417 Ga0496126_0558388 3300048929 Bacteria 907
1418 Ga0495682_0127049 3300049460 Bacteria 912
1419 Ga0501032_0000087 3300049569 Bacteria 79948
1420 Ga0501032_0010672 3300049569 Bacteria 6611
1421 Ga0501032_0055989 3300049569 Bacteria 2652
1422 Ga0501032_0279992 3300049569 Bacteria 1080
1423 Ga0501032_0301581 3300049569 Bacteria 1036
1424 Ga0501033_0000181 3300049570 Bacteria 60365
1425 Ga0501033_0034556 3300049570 Bacteria 3791
1426 Ga0501033_0049110 3300049570 Bacteria 3133
1427 Ga0501033_0050895 3300049570 Bacteria 3071
1428 Ga0501033_0065114 3300049570 Bacteria 2681
1429 Ga0501034_0000021 3300049571 Bacteria 266023
1430 Ga0501034_0037311 3300049571 Bacteria 4920
1431 Ga0501034_0091826 3300049571 Bacteria 3033
1432 Ga0501034_0093281 3300049571 Bacteria 3007
1433 Ga0501034_0115638 3300049571 Bacteria 2671
1434 Ga0501034_0300822 3300049571 Bacteria 1541
1435 Ga0501034_0434731 3300049571 Bacteria 1232
1436 Ga0501036_0000069 3300049572 Bacteria 64331
1437 Ga0501036_0016792 3300049572 Bacteria 6115
1438 Ga0501036_0017040 3300049572 Bacteria 6071
1439 Ga0501036_0156882 3300049572 Bacteria 1919
1440 Ga0501036_0876661 3300049572 Bacteria 737
1441 Ga0501037_0000495 3300049573 Bacteria 31828
1442 Ga0501037_0073189 3300049573 Bacteria 2491
1443 Ga0501037_0094513 3300049573 Bacteria 2161
1444 Ga0501037_0103338 3300049573 Bacteria 2055
1445 Ga0501037_0274837 3300049573 Bacteria 1175
1446 Ga0501037_0526896 3300049573 Bacteria 799
1447 Ga0501038_0000213 3300049574 Bacteria 49756
1448 Ga0501038_0043090 3300049574 Bacteria 3926
1449 Ga0501038_0072164 3300049574 Bacteria 2926
1450 Ga0501038_0118899 3300049574 Bacteria 2181
1451 Ga0501038_0462939 3300049574 Bacteria 974
1452 Ga0501039_0000179 3300049575 Bacteria 45148
1453 Ga0501039_0186625 3300049575 Bacteria 1631
1454 Ga0501039_0188218 3300049575 Bacteria 1623
1455 Ga0501039_0256428 3300049575 Bacteria 1375
1456 Ga0501042_0084778 3300049578 Bacteria 2272
1457 Ga0501042_0496536 3300049578 Bacteria 886
1458 Ga0501043_0000033 3300049579 Bacteria 139500
1459 Ga0501043_0010992 3300049579 Bacteria 7088
1460 Ga0501043_0013892 3300049579 Bacteria 6300
1461 Ga0501043_0025162 3300049579 Bacteria 4669
1462 Ga0501046_0000412 3300049580 Bacteria 42614
1463 Ga0501046_0155393 3300049580 Bacteria 1724
1464 Ga0501046_0204927 3300049580 Bacteria 1466
1465 Ga0501046_0294958 3300049580 Bacteria 1185
1466 Ga0501046_0586252 3300049580 Bacteria 792
1467 Ga0501047_0000434 3300049581 Bacteria 46522
1468 Ga0501047_0008542 3300049581 Bacteria 9661
1469 Ga0501047_0062036 3300049581 Bacteria 3606
1470 Ga0501047_0071390 3300049581 Bacteria 3342
1471 Ga0501047_0082155 3300049581 Bacteria 3097
1472 Ga0501047_0089817 3300049581 Bacteria 2949
1473 Ga0501047_0747041 3300049581 Bacteria 794
1474 Ga0501047_0919688 3300049581 Bacteria 688
1475 Ga0501048_0000290 3300049582 Bacteria 34170
1476 Ga0501048_0174646 3300049582 Bacteria 1523
1477 Ga0501067_0000067 3300049583 Bacteria 59367
1478 Ga0501067_0126029 3300049583 Bacteria 1425
1479 Ga0501067_0138328 3300049583 Bacteria 1356
1480 Ga0501068_0013955 3300049584 Bacteria 4582
1481 Ga0501069_0000881 3300049585 Bacteria 14312
1482 Ga0501069_0364810 3300049585 Bacteria 852
1483 Ga0501069_0431827 3300049585 Bacteria 782
1484 Ga0501070_0022361 3300049586 Bacteria 5296
1485 Ga0501070_0027930 3300049586 Bacteria 4733
1486 Ga0501070_0029702 3300049586 Bacteria 4581
1487 Ga0501070_0060634 3300049586 Bacteria 3135
1488 Ga0501070_0210106 3300049586 Bacteria 1598
1489 Ga0501070_0394879 3300049586 Bacteria 1119
1490 Ga0501071_0319655 3300049587 Bacteria 1179
1491 Ga0501072_0000515 3300049588 Bacteria 27822
1492 Ga0501073_0000144 3300049589 Bacteria 47087
1493 Ga0501073_0024963 3300049589 Bacteria 4289
1494 Ga0501073_0048988 3300049589 Bacteria 2963
1495 Ga0501073_0060403 3300049589 Bacteria 2645
1496 Ga0501074_0001865 3300049590 Bacteria 14459
1497 Ga0501074_0024045 3300049590 Bacteria 4427
1498 Ga0501074_0146378 3300049590 Bacteria 1689
1499 Ga0501076_0123414 3300049592 Bacteria 2098
1500 Ga0501076_0172129 3300049592 Bacteria 1765
1501 Ga0501079_0002688 3300049741 Bacteria 12942
1502 Ga0501079_0638234 3300049741 Bacteria 838
1503 Ga0501080_0038126 3300049742 Bacteria 4488
1504 Ga0501080_0064726 3300049742 Bacteria 3400
1505 Ga0501080_0339730 3300049742 Bacteria 1357
1506 Ga0501083_0000192 3300049744 Bacteria 39270
1507 Ga0501035_0000323 3300049822 Bacteria 55329
1508 Ga0501035_0005152 3300049822 Bacteria 12360
1509 Ga0501035_0016979 3300049822 Bacteria 6708
1510 Ga0501035_0035821 3300049822 Bacteria 4502
1511 Ga0501035_0155616 3300049822 Bacteria 1981
1512 Ga0501035_0649093 3300049822 Bacteria 856
1513 Ga0501044_0000181 3300049823 Bacteria 78075
1514 Ga0501044_0000238 3300049823 Bacteria 69472
1515 Ga0501044_0024928 3300049823 Bacteria 6343
1516 Ga0501044_0035861 3300049823 Bacteria 5191
1517 Ga0501044_0095291 3300049823 Bacteria 2999
1518 Ga0501044_0145931 3300049823 Bacteria 2352
1519 Ga0501044_0282870 3300049823 Bacteria 1591
1520 Ga0501044_0510591 3300049823 Bacteria 1102
1521 Ga0501045_0284937 3300049824 Bacteria 1230
1522 nmdc:mga03683_24574_c1 3300050489 Bacteria 2358
1523 nmdc:mga03683_81382_c1 3300050489 Bacteria 1399
1524 nmdc:mga03n38_122309_c1 3300050490 Bacteria 1281
1525 nmdc:mga03n38_83329_c1 3300050490 Bacteria 1507
1526 nmdc:mga00v17_128961_c1 3300050491 Bacteria 1615
1527 nmdc:mga00v17_27050_c1 3300050491 Bacteria 3346
1528 nmdc:mga00v17_314761_c1 3300050491 Bacteria 1017
1529 nmdc:mga00v17_377837_c1 3300050491 Bacteria 921
1530 nmdc:mga00v17_68427_c1 3300050491 Bacteria 2195
1531 nmdc:mga00v17_81779_c2 3300050491 Bacteria 1172
1532 nmdc:mga0yw44_10077_c1 3300050492 Bacteria 4811
1533 nmdc:mga0yw44_104673_c1 3300050492 Bacteria 1807
1534 nmdc:mga0yw44_2399_c1 3300050492 Bacteria 7973
1535 nmdc:mga0yw44_5976_c1 3300050492 Bacteria 5826
1536 nmdc:mga0yw44_60640_c1 3300050492 Bacteria 2318
1537 nmdc:mga0yw44_62902_c1 3300050492 Bacteria 2281
1538 nmdc:mga0yw44_64408_c1 3300050492 Bacteria 2256
1539 nmdc:mga0yw44_6626_c2 3300050492 Bacteria 4599
1540 nmdc:mga0k408_114975_c1 3300050493 Bacteria 1592
1541 nmdc:mga0k408_143534_c1 3300050493 Bacteria 1421
1542 nmdc:mga0k408_237458_c1 3300050493 Bacteria 1088
1543 nmdc:mga0k408_26093_c1 3300050493 Bacteria 3312
1544 nmdc:mga06z11_112896_c1 3300050494 Bacteria 1507
1545 nmdc:mga06z11_161833_c1 3300050494 Bacteria 1280
1546 nmdc:mga06z11_53261_c1 3300050494 Bacteria 2080
1547 nmdc:mga06z11_59373_c1 3300050494 Bacteria 1988
1548 nmdc:mga04h51_115138_c1 3300050495 Bacteria 996
1549 nmdc:mga04h51_193241_c1 3300050495 Bacteria 797
1550 nmdc:mga04h51_24653_c1 3300050495 Bacteria 1844
1551 nmdc:mga04h51_8385_c1 3300050495 Bacteria 2765
1552 nmdc:mga07m45_135248_c1 3300050496 Bacteria 1427
1553 nmdc:mga07m45_41318_c1 3300050496 Bacteria 2582
1554 nmdc:mga07m45_457544_c1 3300050496 Bacteria 740
1555 nmdc:mga07m45_52157_c1 3300050496 Bacteria 1477
1556 nmdc:mga07m45_95811_c1 3300050496 Bacteria 1703
1557 nmdc:mga05p37_124774_c1 3300050507 Bacteria 3162
1558 nmdc:mga06r32_487432_c1 3300050510 Bacteria 1210
1559 nmdc:mga08y16_1145489_c1 3300050511 Bacteria 751
1560 nmdc:mga08y16_553336_c1 3300050511 Bacteria 1164
1561 nmdc:mga0n895_498138_c1 3300050512 Bacteria 1227
1562 nmdc:mga0n895_59739_c1 3300050512 Bacteria 3761
1563 nmdc:mga0rr50_46931_c1 3300050513 Bacteria 3182
1564 nmdc:mga0sz30_120505_c1 3300050516 Bacteria 1153
1565 nmdc:mga0sz30_151569_c1 3300050516 Bacteria 1026
1566 nmdc:mga0sz30_186597_c1 3300050516 Bacteria 920
1567 nmdc:mga0sz30_260679_c1 3300050516 Bacteria 772
1568 nmdc:mga0sz30_32650_c1 3300050516 Bacteria 2160
1569 nmdc:mga0sz30_70903_c1 3300050516 Bacteria 1500
1570 Ga0495601_0000703 3300053077 Bacteria 17935
1571 Ga0495601_0047178 3300053077 Bacteria 2711
1572 Ga0495601_0088907 3300053077 Bacteria 1986
1573 Ga0495601_0135041 3300053077 Bacteria 1608
1574 Ga0495601_0174912 3300053077 Bacteria 1403
1575 Ga0495601_0201795 3300053077 Bacteria 1299
1576 Ga0495601_0469424 3300053077 Bacteria 813
1577 Ga0495612_0014050 3300053078 Bacteria 3224
1578 Ga0495612_0237982 3300053078 Bacteria 808
1579 Ga0500610_0032201 3300053079 Bacteria 2668
1580 Ga0500635_0003137 3300053080 Bacteria 4131
1581 Ga0500635_0041734 3300053080 Bacteria 1536
1582 Ga0500635_0058429 3300053080 Bacteria 1339
1583 Ga0495655_0169856 3300053083 Bacteria 697
1584 Ga0495595_0007593 3300053084 Bacteria 4440
1585 Ga0495595_0025490 3300053084 Bacteria 2621
1586 Ga0495595_0095194 3300053084 Bacteria 1432
1587 Ga0495619_0001717 3300053085 Bacteria 14530
1588 Ga0495619_0009953 3300053085 Bacteria 5989
1589 Ga0495619_0088328 3300053085 Bacteria 2096
1590 Ga0495619_0160289 3300053085 Bacteria 1554
1591 Ga0495619_0296567 3300053085 Bacteria 1120
1592 Ga0500578_0236728 3300053086 Bacteria 1104
1593 Ga0500578_0264321 3300053086 Bacteria 1032
1594 Ga0500578_0282221 3300053086 Bacteria 990
1595 Ga0500578_0335867 3300053086 Bacteria 887
1596 Ga0500643_000025 3300053087 Bacteria 259605
1597 Ga0500644_0039104 3300053088 Bacteria 1561
1598 Ga0500644_0098389 3300053088 Bacteria 1107
1599 Ga0500646_0100135 3300053090 Bacteria 909
1600 Ga0500651_0003265 3300053093 Bacteria 8829
1601 Ga0500651_0070720 3300053093 Bacteria 2172
1602 Ga0500651_0078441 3300053093 Bacteria 2048
1603 Ga0500651_0290623 3300053093 Bacteria 940
1604 Ga0500566_0000406 3300053094 Bacteria 23916
1605 Ga0500566_0001145 3300053094 Bacteria 15389
1606 Ga0500566_0003188 3300053094 Bacteria 9807
1607 Ga0500566_0009562 3300053094 Bacteria 5727
1608 Ga0500566_0119576 3300053094 Bacteria 1422
1609 Ga0500566_0275738 3300053094 Bacteria 804
1610 Ga0500566_0378062 3300053094 Bacteria 641
1611 Ga0500640_000608 3300053095 Bacteria 9293
1612 Ga0500641_0002048 3300053096 Bacteria 7162
1613 Ga0500641_0002764 3300053096 Bacteria 6206
1614 Ga0500641_0027801 3300053096 Bacteria 2204
1615 Ga0500641_0034580 3300053096 Bacteria 2012
1616 Ga0500641_0205815 3300053096 Bacteria 839
1617 Ga0500648_067107 3300053097 Bacteria 2031
1618 Ga0500650_0000714 3300053098 Bacteria 8925
1619 Ga0500650_0113435 3300053098 Bacteria 1265
1620 Ga0500554_040844 3300053102 Bacteria 1423
1621 Ga0500554_042612 3300053102 Bacteria 1399
1622 Ga0500555_003431 3300053103 Bacteria 4517
1623 Ga0500556_0000030 3300053104 Bacteria 165098
1624 Ga0500556_0187565 3300053104 Bacteria 817
1625 Ga0500557_000001 3300053105 Bacteria 241298
1626 Ga0500562_002772 3300053108 Bacteria 4360
1627 Ga0500569_009762 3300053109 Bacteria 2239
1628 Ga0500569_120246 3300053109 Bacteria 874
1629 Ga0500572_001706 3300053111 Bacteria 5715
1630 Ga0500572_002385 3300053111 Bacteria 4538
1631 Ga0500591_107444 3300053115 Bacteria 1178
1632 Ga0500592_008131 3300053116 Bacteria 1663
1633 Ga0500592_008310 3300053116 Bacteria 1647
1634 Ga0500594_0031374 3300053118 Bacteria 1401
1635 Ga0500594_0037346 3300053118 Bacteria 1311
1636 Ga0500595_000659 3300053119 Bacteria 20724
1637 Ga0500595_001827 3300053119 Bacteria 11016
1638 Ga0500595_003263 3300053119 Bacteria 7660
1639 Ga0500595_003336 3300053119 Bacteria 7539
1640 Ga0500595_003366 3300053119 Bacteria 7492
1641 Ga0500595_004436 3300053119 Bacteria 6305
1642 Ga0500595_015590 3300053119 Bacteria 2849
1643 Ga0500595_024767 3300053119 Bacteria 2091
1644 Ga0500595_025947 3300053119 Bacteria 2024
1645 Ga0500607_056328 3300053121 Bacteria 2076
1646 Ga0500607_119360 3300053121 Bacteria 1278
1647 Ga0500608_031005 3300053122 Bacteria 2536
1648 Ga0500608_060325 3300053122 Bacteria 1813
1649 Ga0500608_210556 3300053122 Bacteria 795
1650 Ga0500614_003114 3300053123 Bacteria 3603
1651 Ga0500642_0000147 3300053130 Bacteria 30536
1652 Ga0500642_0000514 3300053130 Bacteria 11767
1653 Ga0500642_0065325 3300053130 Bacteria 1644
1654 Ga0500642_0142689 3300053130 Bacteria 1123
1655 Ga0500652_000124 3300053131 Bacteria 29312
1656 Ga0500652_000786 3300053131 Bacteria 10652
1657 Ga0500652_177497 3300053131 Bacteria 874
1658 Ga0500655_009798 3300053133 Bacteria 1730
1659 Ga0500559_0000850 3300053136 Bacteria 19692
1660 Ga0500559_0004009 3300053136 Bacteria 7074
1661 Ga0500559_0005859 3300053136 Bacteria 5599
1662 Ga0500559_0018957 3300053136 Bacteria 2907
1663 Ga0500559_0022200 3300053136 Bacteria 2692
1664 Ga0500564_156748 3300053138 Bacteria 966
1665 Ga0500568_0001244 3300053139 Bacteria 16891
1666 Ga0500568_0009905 3300053139 Bacteria 4500
1667 Ga0500568_0070485 3300053139 Bacteria 1339
1668 Ga0500568_0071594 3300053139 Bacteria 1327
1669 Ga0500568_0085520 3300053139 Bacteria 1194
1670 Ga0500577_0001615 3300053142 Bacteria 5770
1671 Ga0500586_000987 3300053145 Bacteria 5866
1672 Ga0500588_0021920 3300053146 Bacteria 1732
1673 Ga0500588_0257947 3300053146 Bacteria 656
1674 Ga0500590_061269 3300053148 Bacteria 1890
1675 Ga0500590_088806 3300053148 Bacteria 1505
1676 Ga0500603_001799 3300053150 Bacteria 4815
1677 Ga0500603_151280 3300053150 Bacteria 720
1678 Ga0500604_0010382 3300053151 Bacteria 2491
1679 Ga0500604_0061548 3300053151 Bacteria 1180
1680 Ga0500604_0300935 3300053151 Bacteria 556
1681 Ga0500616_0000139 3300053153 Bacteria 123841
1682 Ga0500616_0000252 3300053153 Bacteria 83060
1683 Ga0500616_0214026 3300053153 Bacteria 845
1684 Ga0500620_000817 3300053155 Bacteria 5415
1685 Ga0500620_136204 3300053155 Bacteria 859
1686 Ga0500622_0004010 3300053156 Bacteria 9487
1687 Ga0500627_0043471 3300053158 Bacteria 1938
1688 Ga0500634_0043922 3300053161 Bacteria 2421
1689 Ga0500638_004624 3300053162 Bacteria 5342
1690 Ga0500638_031941 3300053162 Bacteria 2540
1691 Ga0500638_109952 3300053162 Bacteria 1274
1692 Ga0500638_202166 3300053162 Bacteria 839
1693 Ga0500639_000004 3300053163 Bacteria 216921
1694 Ga0500639_008750 3300053163 Bacteria 5280
1695 Ga0500639_063822 3300053163 Bacteria 1893
1696 Ga0500636_0000419 3300053177 Bacteria 23389
1697 Ga0500636_0006547 3300053177 Bacteria 6690
1698 Ga0500636_0129063 3300053177 Bacteria 1410
1699 Ga0500636_0153438 3300053177 Bacteria 1262
1700 Ga0500636_0166198 3300053177 Bacteria 1198
1701 Ga0500637_0000766 3300053178 Bacteria 12906
1702 Ga0500637_0022656 3300053178 Bacteria 3425
1703 Ga0500637_0109979 3300053178 Bacteria 1598
1704 Ga0500637_0138599 3300053178 Bacteria 1408
1705 Ga0500611_100619 3300053727 Bacteria 748
1706 Ga0500625_002083 3300053729 Bacteria 7309
1707 Ga0500645_024198 3300053730 Bacteria 1857
1708 Ga0500609_002539 3300053731 Bacteria 2604
1709 Ga0500609_032520 3300053731 Bacteria 717
1710 Ga0500596_000135 3300053735 Bacteria 10967
1711 Ga0500596_006374 3300053735 Bacteria 2002
1712 Ga0500596_032856 3300053735 Bacteria 809
1713 Ga0500599_000240 3300053736 Bacteria 5182
1714 Ga0500601_000671 3300053737 Bacteria 4667
1715 Ga0500601_002035 3300053737 Bacteria 2171
1716 Ga0500601_011442 3300053737 Bacteria 998
1717 Ga0501084_0000303 3300054114 Bacteria 37274
1718 Ga0500661_000388 3300055283 Bacteria 8103
1719 Ga0501082_0005482 3300060353 Bacteria 11015
1720 Ga0501082_0415729 3300060353 Bacteria 1174
1721 Ga0501082_0949045 3300060353 Bacteria 752
1722 Ga0501082_0991375 3300060353 Bacteria 735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0954332 Ga0436361_0954332_41_574 177
2 3300041459 Ga0451800_1555217 Ga0451800_1555217_22_555 177
3 3300046471 Ga0495650_0119158 Ga0495650_0119158_18_551 177
4 3300046616 Ga0495668_0363460 Ga0495668_0363460_236_769 177
5 3300048910 Ga0496107_0714140 Ga0496107_0714140_16_549 177
6 3300048924 Ga0496121_0365010 Ga0496121_0365010_392_925 177
7 3300050496 nmdc:mga07m45_95811_c1 nmdc:mga07m45_95811_c1_1160_1693 177
8 3300050516 nmdc:mga0sz30_260679_c1 nmdc:mga0sz30_260679_c1_29_562 177
9 3300053151 Ga0500604_0300935 Ga0500604_0300935_13_546 177
10 3300053109 Ga0500569_120246 Ga0500569_120246_305_862 180
11 3300053178 Ga0500637_0022656 Ga0500637_0022656_2873_3415 180
12 3300048914 Ga0496111_0754043 Ga0496111_0754043_20_580 181
13 3300053119 Ga0500595_004436 Ga0500595_004436_2696_3298 186
14 3300005547 Ga0070693_100036115 Ga0070693_1000361153 189
15 3300049569 Ga0501032_0279992 Ga0501032_0279992_242_847 190
16 3300046492 Ga0495585_0058134 Ga0495585_0058134_1181_1813 195
17 3300049569 Ga0501032_0301581 Ga0501032_0301581_75_668 195
18 iso_pu_bacteria 2511231028 2511393248 197
19 iso_pu_bacteria 2517093001 2517106688 197
20 iso_pu_bacteria 2524023205 2524439782 197
21 iso_pu_bacteria 2643221547 2643756108 197
22 iso_pu_bacteria 2744054633 2745081775 197
23 iso_pu_bacteria 2824704595 2824708506 197
24 iso_pu_bacteria 2824753945 2824760234 197
25 iso_pu_bacteria 2824763712 2824767223 197
26 iso_pu_bacteria 2842038055 2842039862 197
27 iso_pu_bacteria 2842045827 2842047192 197
28 iso_pu_bacteria 2847930680 2847935156 197
29 iso_pu_bacteria 2876761206 2876770842 197
30 iso_pu_bacteria 2879083081 2879090120 197
31 iso_pu_bacteria 2885409591 2885412717 197
32 iso_pu_bacteria 2904711408 2904717060 197
33 iso_pu_bacteria 2906643746 2906650593 197
34 iso_pu_bacteria 2935769743 2935775907 197
35 iso_pu_bacteria 2935777560 2935780667 197
36 iso_pu_bacteria 2935785616 2935791356 197
37 iso_pu_bacteria 2935793552 2935799768 197
38 iso_pu_bacteria 2935959822 2935964417 197
39 iso_pu_bacteria 3005718088 3005721516 197
40 iso_pu_bacteria 8016522445 8016530486 197
41 iso_pu_bacteria 8016530956 8016535759 197
42 iso_pu_bacteria 8016539877 8016540042 197
43 iso_pu_bacteria 8016548790 8016553190 197
44 iso_pu_bacteria 8016557553 8016561570 197
45 iso_pu_bacteria 8016566248 8016574099 197
46 iso_pu_bacteria 8016575299 8016578212 197
47 iso_pu_bacteria 8016583857 8016592880 197
48 iso_pu_bacteria 8016595262 8016599411 197
49 iso_pu_bacteria 8016613128 8016622176 197
50 iso_pu_bacteria 8016622563 8016627673 197
51 iso_pu_bacteria 8019538911 8019543994 197
52 iso_pu_bacteria 8019547302 8019554777 197
53 iso_pu_bacteria 8056967851 8056972637 197
54 3300046536 Ga0495587_0074654 Ga0495587_0074654_1291_1902 198
55 3300053139 Ga0500568_0070485 Ga0500568_0070485_580_1176 198
56 iso_pu_bacteria 2507262055 2507509447 198
57 iso_pu_bacteria 2508501009 2508543496 198
58 iso_pu_bacteria 2508501128 2509147181 198
59 iso_pu_bacteria 2513237094 2513638014 198
60 iso_pu_bacteria 2513237095 2513646540 198
61 iso_pu_bacteria 2513237096 2513656567 198
62 iso_pu_bacteria 2513237098 2513672376 198
63 iso_pu_bacteria 2513237101 2513691746 198
64 iso_pu_bacteria 2513237102 2513702308 198
65 iso_pu_bacteria 2513237104 2513717529 198
66 iso_pu_bacteria 2513237137 2513859546 198
67 iso_pu_bacteria 2513237139 2513880291 198
68 iso_pu_bacteria 2513237141 2513889290 198
69 iso_pu_bacteria 2513237145 2513917752 198
70 iso_pu_bacteria 2513237161 2514010691 198
71 iso_pu_bacteria 2515154112 2515630415 198
72 iso_pu_bacteria 2517572143 2517893176 198
73 iso_pu_bacteria 2524023210 2524466819 198
74 iso_pu_bacteria 2524023228 2524537265 198
75 iso_pu_bacteria 2528768022 2528855793 198
76 iso_pu_bacteria 2602042107 2603859685 198
77 iso_pu_bacteria 2617270735 2617352208 198
78 iso_pu_bacteria 2643221651 2644288202 198
79 iso_pu_bacteria 2667528175 2671117810 198
80 iso_pu_bacteria 2721755755 2723845842 198
81 iso_pu_bacteria 2728368998 2728754588 198
82 iso_pu_bacteria 2791355196 2793064803 198
83 iso_pu_bacteria 2791355197 2793069956 198
84 iso_pu_bacteria 2791355199 2793077161 198
85 iso_pu_bacteria 2802429603 2805920182 198
86 iso_pu_bacteria 2816332527 2818240267 198
87 iso_pu_bacteria 2824600985 2824604182 198
88 iso_pu_bacteria 2824609381 2824613171 198
89 iso_pu_bacteria 2824617872 2824619729 198
90 iso_pu_bacteria 2824626560 2824629337 198
91 iso_pu_bacteria 2824635225 2824640785 198
92 iso_pu_bacteria 2824644064 2824652883 198
93 iso_pu_bacteria 2824653114 2824657571 198
94 iso_pu_bacteria 2824661429 2824666236 198
95 iso_pu_bacteria 2824671348 2824674674 198
96 iso_pu_bacteria 2824687955 2824696066 198
97 iso_pu_bacteria 2824696289 2824704362 198
98 iso_pu_bacteria 2824714736 2824717298 198
99 iso_pu_bacteria 2824723954 2824727484 198
100 iso_pu_bacteria 2824773399 2824779288 198
101 iso_pu_bacteria 2838122688 2838128608 198
102 iso_pu_bacteria 2841941048 2841947308 198
103 iso_pu_bacteria 2841949485 2841950754 198
104 iso_pu_bacteria 2841957949 2841964435 198
105 iso_pu_bacteria 2841966195 2841967068 198
106 iso_pu_bacteria 2841974524 2841975815 198
107 iso_pu_bacteria 2841983080 2841991073 198
108 iso_pu_bacteria 2844315083 2844318281 198
109 iso_pu_bacteria 2847939898 2847945729 198
110 iso_pu_bacteria 2857509624 2857510511 198
111 iso_pu_bacteria 2857524615 2857528916 198
112 iso_pu_bacteria 2874590934 2874591446 198
113 iso_pu_bacteria 2874604998 2874609512 198
114 iso_pu_bacteria 2874612657 2874612745 198
115 iso_pu_bacteria 2874620515 2874627064 198
116 iso_pu_bacteria 2874628541 2874636362 198
117 iso_pu_bacteria 2874645413 2874646233 198
118 iso_pu_bacteria 2876771140 2876771554 198
119 iso_pu_bacteria 2876808645 2876810991 198
120 iso_pu_bacteria 2876818435 2876818889 198
121 iso_pu_bacteria 2879074833 2879075341 198
122 iso_pu_bacteria 2879099564 2879102192 198
123 iso_pu_bacteria 2879110137 2879115714 198
124 iso_pu_bacteria 2879127579 2879134594 198
125 iso_pu_bacteria 2879142872 2879149871 198
126 iso_pu_bacteria 2881364244 2881366609 198
127 iso_pu_bacteria 2881665667 2881672122 198
128 iso_pu_bacteria 2885366525 2885373333 198
129 iso_pu_bacteria 2885374607 2885374770 198
130 iso_pu_bacteria 2885383462 2885391535 198
131 iso_pu_bacteria 2888378607 2888383157 198
132 iso_pu_bacteria 2888419890 2888423603 198
133 iso_pu_bacteria 2889033259 2889040683 198
134 iso_pu_bacteria 2893066018 2893070373 198
135 iso_pu_bacteria 2903727486 2903729228 198
136 iso_pu_bacteria 2903748898 2903754552 198
137 iso_pu_bacteria 2903768456 2903777568 198
138 iso_pu_bacteria 2904666416 2904669765 198
139 iso_pu_bacteria 2904690495 2904696478 198
140 iso_pu_bacteria 2904699407 2904702023 198
141 iso_pu_bacteria 2906602504 2906605174 198
142 iso_pu_bacteria 2906610324 2906617616 198
143 iso_pu_bacteria 2906626472 2906631521 198
144 iso_pu_bacteria 2908739725 2908743567 198
145 iso_pu_bacteria 2908756301 2908760327 198
146 iso_pu_bacteria 2922361189 2922367785 198
147 iso_pu_bacteria 2922368715 2922373351 198
148 iso_pu_bacteria 2922386360 2922392312 198
149 iso_pu_bacteria 2922425934 2922429312 198
150 iso_pu_bacteria 2932784394 2932791936 198
151 iso_pu_bacteria 2932794094 2932796398 198
152 iso_pu_bacteria 2932801729 2932808977 198
153 iso_pu_bacteria 2932809354 2932815676 198
154 iso_pu_bacteria 2932818245 2932819244 198
155 iso_pu_bacteria 2932828146 2932835941 198
156 iso_pu_bacteria 2935608549 2935611669 198
157 iso_pu_bacteria 2935616580 2935624338 198
158 iso_pu_bacteria 2935638405 2935647257 198
159 iso_pu_bacteria 2935665750 2935674437 198
160 iso_pu_bacteria 2935675223 2935678277 198
161 iso_pu_bacteria 2935684952 2935688300 198
162 iso_pu_bacteria 2935694250 2935698963 198
163 iso_pu_bacteria 2935703347 2935708580 198
164 iso_pu_bacteria 2935713505 2935715319 198
165 iso_pu_bacteria 2935722832 2935726117 198
166 iso_pu_bacteria 2935732158 2935734138 198
167 iso_pu_bacteria 2935741537 2935743517 198
168 iso_pu_bacteria 2935750917 2935754446 198
169 iso_pu_bacteria 2935760218 2935768217 198
170 iso_pu_bacteria 2935801545 2935809415 198
171 iso_pu_bacteria 2935810662 2935818914 198
172 iso_pu_bacteria 2935819856 2935821146 198
173 iso_pu_bacteria 2935827899 2935836712 198
174 iso_pu_bacteria 2935837841 2935846564 198
175 iso_pu_bacteria 2935847175 2935850594 198
176 iso_pu_bacteria 2935855204 2935862628 198
177 iso_pu_bacteria 2935864058 2935871773 198
178 iso_pu_bacteria 2935873716 2935881860 198
179 iso_pu_bacteria 2935883170 2935886690 198
180 iso_pu_bacteria 2935908558 2935915531 198
181 iso_pu_bacteria 2935916978 2935921366 198
182 iso_pu_bacteria 2935926038 2935932869 198
183 iso_pu_bacteria 2935934488 2935941519 198
184 iso_pu_bacteria 2935942939 2935949644 198
185 iso_pu_bacteria 2935951376 2935958339 198
186 iso_pu_bacteria 2935967501 2935974491 198
187 iso_pu_bacteria 2935975950 2935980862 198
188 iso_pu_bacteria 2935992306 2935998871 198
189 iso_pu_bacteria 2936002035 2936007425 198
190 iso_pu_bacteria 2936037263 2936045628 198
191 iso_pu_bacteria 2940556831 2940560178 198
192 iso_pu_bacteria 2941538514 2941546672 198
193 iso_pu_bacteria 3005474847 3005479480 198
194 iso_pu_bacteria 3005483717 3005489362 198
195 iso_pu_bacteria 3005506211 3005511783 198
196 iso_pu_bacteria 3005587118 3005590909 198
197 iso_pu_bacteria 3005594810 3005598354 198
198 iso_pu_bacteria 3005710791 3005714067 198
199 iso_pu_bacteria 8006933436 8006941676 198
200 iso_pu_bacteria 8006964411 8006971967 198
201 iso_pu_bacteria 8006973647 8006981390 198
202 iso_pu_bacteria 8006984368 8006990379 198
203 iso_pu_bacteria 8006994254 8006996398 198
204 iso_pu_bacteria 8016511872 8016514387 198
205 iso_pu_bacteria 8017057580 8017062037 198
206 iso_pu_bacteria 8019555841 8019557582 198
207 iso_pu_bacteria 8019565922 8019567716 198
208 iso_pu_bacteria 8019576017 8019581577 198
209 iso_pu_bacteria 8019586578 8019589210 198
210 iso_pu_bacteria 8019597564 8019602023 198
211 iso_pu_bacteria 8019619141 8019627210 198
212 iso_pu_bacteria 8019629233 8019635336 198
213 iso_pu_bacteria 8019638758 8019644371 198
214 iso_pu_bacteria 8019648815 8019657414 198
215 iso_pu_bacteria 8019659431 8019663163 198
216 iso_pu_bacteria 8019668869 8019672770 198
217 iso_pu_bacteria 8019678201 8019683368 198
218 iso_pu_bacteria 8056673599 8056674668 198
219 iso_pu_bacteria 8056681323 8056688536 198
220 iso_pu_bacteria 8056689827 8056690258 198
221 3300035113 Ga0373936_0012154 Ga0373936_0012154_21_635 199
222 iso_pu_bacteria 2508501042 2508698725 199
223 iso_pu_bacteria 2513237092 2513624725 199
224 iso_pu_bacteria 2849076700 2849080099 199
225 iso_pu_bacteria 2919073203 2919076316 199
226 iso_pu_bacteria 2929615660 2929617131 199
227 iso_pu_bacteria 2929624759 2929626817 199
228 iso_pu_bacteria 2933577622 2933579088 199
229 iso_pu_bacteria 2935648319 2935651735 199
230 iso_pu_bacteria 2935656913 2935660545 199
231 iso_pu_bacteria 2935984226 2935990344 199
232 iso_pu_bacteria 2936011229 2936014601 199
233 iso_pu_bacteria 2936019824 2936023603 199
234 iso_pu_bacteria 2936028420 2936032631 199
235 iso_pu_bacteria 2936046547 2936050342 199
236 iso_pu_bacteria 2936055302 2936059166 199
237 iso_pu_bacteria 2941531003 2941534038 199
238 iso_pu_bacteria 8016630954 8016631968 199
239 iso_pu_bacteria 8055742211 8055747274 199
240 3300005327 Ga0070658_10395439 Ga0070658_103954392 200
241 3300005334 Ga0068869_100463665 Ga0068869_1004636651 200
242 3300005544 Ga0070686_100208454 Ga0070686_1002084542 200
243 3300005563 Ga0068855_100747573 Ga0068855_1007475732 200
244 3300005618 Ga0068864_100515370 Ga0068864_1005153701 200
245 3300006038 Ga0075365_10494444 Ga0075365_104944441 200
246 3300006042 Ga0075368_10094532 Ga0075368_100945322 200
247 3300006186 Ga0075369_10071892 Ga0075369_100718922 200
248 3300006358 Ga0068871_100051360 Ga0068871_1000513602 200
249 3300009098 Ga0105245_10005424 Ga0105245_100054246 200
250 3300009148 Ga0105243_10339919 Ga0105243_103399192 200
251 3300009551 Ga0105238_10134607 Ga0105238_101346072 200
252 3300021388 Ga0213875_10146078 Ga0213875_101460781 200
253 3300025909 Ga0207705_10406202 Ga0207705_104062022 200
254 3300025912 Ga0207707_10703040 Ga0207707_107030401 200
255 3300025924 Ga0207694_10148744 Ga0207694_101487443 200
256 3300025927 Ga0207687_10126905 Ga0207687_101269053 200
257 3300026095 Ga0207676_10476547 Ga0207676_104765471 200
258 3300037853 Ga0436364_0608579 Ga0436364_0608579_803_1405 200
259 3300048910 Ga0496107_0110746 Ga0496107_0110746_124_726 200
260 3300048913 Ga0496110_0238647 Ga0496110_0238647_65_667 200
261 3300048917 Ga0496114_0381784 Ga0496114_0381784_340_942 200
262 3300049571 Ga0501034_0093281 Ga0501034_0093281_1773_2378 200
263 3300050490 nmdc:mga03n38_83329_c1 nmdc:mga03n38_83329_c1_332_934 200
264 3300050494 nmdc:mga06z11_112896_c1 nmdc:mga06z11_112896_c1_310_912 200
265 3300050495 nmdc:mga04h51_115138_c1 nmdc:mga04h51_115138_c1_216_818 200
266 3300050516 nmdc:mga0sz30_151569_c1 nmdc:mga0sz30_151569_c1_24_626 200
267 3300053096 Ga0500641_0002764 Ga0500641_0002764_567_1169 200
268 3300053130 Ga0500642_0065325 Ga0500642_0065325_225_827 200
269 3300053131 Ga0500652_000124 Ga0500652_000124_8801_9403 200
270 3300060353 Ga0501082_0991375 Ga0501082_0991375_72_677 200
271 iso_pu_bacteria 2617270741 2617376571 200
272 iso_pu_bacteria 2824679649 2824686412 200
273 iso_pu_bacteria 2824732956 2824739799 200
274 iso_pu_bacteria 2824746037 2824749681 200
275 iso_pu_bacteria 2908775508 2908779324 200
276 iso_pu_bacteria 2922393267 2922395536 200
277 3300003215 JGI25153J46596_10006284 JGI25153J46596_100062844 201
278 3300003374 JGI25161J50226_1009290 JGI25161J50226_10092902 201
279 3300003659 JGI25404J52841_10064330 JGI25404J52841_100643301 201
280 3300003762 Ga0055542_1002915 Ga0055542_10029152 201
281 3300003794 Ga0055531_10006489 Ga0055531_100064898 201
282 3300004625 Ga0055543_1007785 Ga0055543_10077853 201
283 3300005262 Ga0065165_1002717 Ga0065165_100271716 201
284 3300005262 Ga0065165_1006587 Ga0065165_10065873 201
285 3300005262 Ga0065165_1012226 Ga0065165_10122264 201
286 3300005331 Ga0070670_100122671 Ga0070670_1001226712 201
287 3300005336 Ga0070680_100128730 Ga0070680_1001287302 201
288 3300005338 Ga0068868_100170607 Ga0068868_1001706071 201
289 3300005339 Ga0070660_100047285 Ga0070660_1000472853 201
290 3300005347 Ga0070668_100103767 Ga0070668_1001037671 201
291 3300005355 Ga0070671_100122733 Ga0070671_1001227331 201
292 3300005367 Ga0070667_100035336 Ga0070667_1000353364 201
293 3300005455 Ga0070663_100048324 Ga0070663_1000483244 201
294 3300005455 Ga0070663_100634479 Ga0070663_1006344792 201
295 3300005457 Ga0070662_100230404 Ga0070662_1002304041 201
296 3300005458 Ga0070681_10010719 Ga0070681_100107197 201
297 3300005458 Ga0070681_10228445 Ga0070681_102284452 201
298 3300005530 Ga0070679_100126467 Ga0070679_1001264674 201
299 3300005530 Ga0070679_100579062 Ga0070679_1005790622 201
300 3300005539 Ga0068853_100286839 Ga0068853_1002868391 201
301 3300005547 Ga0070693_100035480 Ga0070693_1000354802 201
302 3300005548 Ga0070665_100144276 Ga0070665_1001442762 201
303 3300005548 Ga0070665_100196379 Ga0070665_1001963792 201
304 3300005563 Ga0068855_100071080 Ga0068855_1000710804 201
305 3300005563 Ga0068855_100266533 Ga0068855_1002665333 201
306 3300005578 Ga0068854_100207454 Ga0068854_1002074542 201
307 3300005614 Ga0068856_100567017 Ga0068856_1005670172 201
308 3300005842 Ga0068858_100328900 Ga0068858_1003289001 201
309 3300005844 Ga0068862_101225344 Ga0068862_1012253441 201
310 3300005983 Ga0081540_1135330 Ga0081540_11353301 201
311 3300006028 Ga0070717_10434322 Ga0070717_104343222 201
312 3300006038 Ga0075365_10173757 Ga0075365_101737573 201
313 3300006042 Ga0075368_10014602 Ga0075368_100146022 201
314 3300006042 Ga0075368_10044851 Ga0075368_100448512 201
315 3300006048 Ga0075363_100016588 Ga0075363_1000165884 201
316 3300006051 Ga0075364_10031991 Ga0075364_100319912 201
317 3300006051 Ga0075364_10071983 Ga0075364_100719832 201
318 3300006177 Ga0075362_10035817 Ga0075362_100358173 201
319 3300006178 Ga0075367_10056138 Ga0075367_100561384 201
320 3300006178 Ga0075367_10152126 Ga0075367_101521262 201
321 3300006186 Ga0075369_10162009 Ga0075369_101620092 201
322 3300006195 Ga0075366_10004938 Ga0075366_100049387 201
323 3300006353 Ga0075370_10014062 Ga0075370_100140624 201
324 3300006353 Ga0075370_10025057 Ga0075370_100250572 201
325 3300006941 Ga0099825_1021078 Ga0099825_10210784 201
326 3300009093 Ga0105240_10234953 Ga0105240_102349533 201
327 3300009093 Ga0105240_10235763 Ga0105240_102357632 201
328 3300009101 Ga0105247_10103514 Ga0105247_101035142 201
329 3300009174 Ga0105241_10133519 Ga0105241_101335193 201
330 3300009174 Ga0105241_10221313 Ga0105241_102213132 201
331 3300009174 Ga0105241_10912548 Ga0105241_109125481 201
332 3300009177 Ga0105248_10228534 Ga0105248_102285342 201
333 3300009545 Ga0105237_10042063 Ga0105237_100420635 201
334 3300009545 Ga0105237_10105709 Ga0105237_101057092 201
335 3300009545 Ga0105237_11482417 Ga0105237_114824171 201
336 3300009551 Ga0105238_10775739 Ga0105238_107757392 201
337 3300010375 Ga0105239_10042504 Ga0105239_100425046 201
338 3300010375 Ga0105239_10099221 Ga0105239_100992214 201
339 3300010375 Ga0105239_10173262 Ga0105239_101732622 201
340 3300010375 Ga0105239_10816327 Ga0105239_108163272 201
341 3300013296 Ga0157374_10130511 Ga0157374_101305112 201
342 3300025245 Ga0207425_1012633 Ga0207425_10126333 201
343 3300025254 Ga0209148_1001286 Ga0209148_10012864 201
344 3300025261 Ga0209233_1004167 Ga0209233_10041674 201
345 3300025261 Ga0209233_1020700 Ga0209233_10207002 201
346 3300025272 Ga0209455_1000966 Ga0209455_10009669 201
347 3300025295 Ga0209564_1027597 Ga0209564_10275972 201
348 3300025297 Ga0209758_1000100 Ga0209758_100010072 201
349 3300025299 Ga0209256_1007171 Ga0209256_10071715 201
350 3300025302 Ga0207426_1001143 Ga0207426_100114326 201
351 3300025302 Ga0207426_1090871 Ga0207426_10908711 201
352 3300025304 Ga0209257_1002621 Ga0209257_10026217 201
353 3300025904 Ga0207647_10026181 Ga0207647_100261816 201
354 3300025911 Ga0207654_10101795 Ga0207654_101017951 201
355 3300025912 Ga0207707_10033065 Ga0207707_100330655 201
356 3300025912 Ga0207707_10179746 Ga0207707_101797462 201
357 3300025913 Ga0207695_10044366 Ga0207695_100443664 201
358 3300025914 Ga0207671_10023776 Ga0207671_100237764 201
359 3300025914 Ga0207671_10116307 Ga0207671_101163072 201
360 3300025917 Ga0207660_10016158 Ga0207660_100161586 201
361 3300025919 Ga0207657_10087220 Ga0207657_100872202 201
362 3300025921 Ga0207652_10031813 Ga0207652_100318134 201
363 3300025921 Ga0207652_10101304 Ga0207652_101013042 201
364 3300025921 Ga0207652_10658342 Ga0207652_106583422 201
365 3300025924 Ga0207694_10125855 Ga0207694_101258552 201
366 3300025925 Ga0207650_10040196 Ga0207650_100401964 201
367 3300025927 Ga0207687_10669337 Ga0207687_106693372 201
368 3300025931 Ga0207644_10039893 Ga0207644_100398934 201
369 3300025932 Ga0207690_10076348 Ga0207690_100763482 201
370 3300025933 Ga0207706_10105967 Ga0207706_101059673 201
371 3300025935 Ga0207709_10124657 Ga0207709_101246571 201
372 3300025941 Ga0207711_10279467 Ga0207711_102794672 201
373 3300025949 Ga0207667_10624302 Ga0207667_106243021 201
374 3300025986 Ga0207658_10112117 Ga0207658_101121172 201
375 3300026023 Ga0207677_10195372 Ga0207677_101953722 201
376 3300026041 Ga0207639_10274308 Ga0207639_102743083 201
377 3300026067 Ga0207678_10211764 Ga0207678_102117642 201
378 3300026067 Ga0207678_10696423 Ga0207678_106964232 201
379 3300026078 Ga0207702_10913949 Ga0207702_109139491 201
380 3300026116 Ga0207674_10239449 Ga0207674_102394491 201
381 3300026121 Ga0207683_10714537 Ga0207683_107145371 201
382 3300026142 Ga0207698_11167681 Ga0207698_111676811 201
383 3300027296 Ga0209389_1000769 Ga0209389_100076911 201
384 3300027361 Ga0209489_106642 Ga0209489_10664214 201
385 3300027363 Ga0209700_100021 Ga0209700_100021237 201
386 3300027866 Ga0209813_10048312 Ga0209813_100483122 201
387 3300028379 Ga0268266_10137410 Ga0268266_101374102 201
388 3300028379 Ga0268266_10412134 Ga0268266_104121342 201
389 3300028381 Ga0268264_10832849 Ga0268264_108328492 201
390 3300033180 Ga0307510_10016530 Ga0307510_100165306 201
391 3300035725 Ga0373947_0267032 Ga0373947_0267032_411_1016 201
392 3300037068 Ga0373925_0051914 Ga0373925_0051914_90_695 201
393 3300037068 Ga0373925_0206426 Ga0373925_0206426_195_803 201
394 3300037312 Ga0395899_0391835 Ga0395899_0391835_278_886 201
395 3300037418 Ga0395900_0002015 Ga0395900_0002015_1255_1863 201
396 3300038443 Ga0395901_0033469 Ga0395901_0033469_2599_3207 201
397 3300039437 Ga0436365_0300598 Ga0436365_0300598_258_863 201
398 3300044658 Ga0466972_0000544 Ga0466972_0000544_6398_7006 201
399 3300044683 Ga0466965_0033529 Ga0466965_0033529_827_1435 201
400 3300044683 Ga0466965_0106668 Ga0466965_0106668_685_1293 201
401 3300044694 Ga0466963_0012147 Ga0466963_0012147_3786_4394 201
402 3300044719 Ga0466971_0233474 Ga0466971_0233474_196_804 201
403 3300044735 Ga0466968_0121388 Ga0466968_0121388_365_973 201
404 3300045049 Ga0466959_0472119 Ga0466959_0472119_118_726 201
405 3300045976 Ga0466967_0045862 Ga0466967_0045862_1247_1855 201
406 3300046513 Ga0495616_0033023 Ga0495616_0033023_238_846 201
407 3300046514 Ga0495618_0454052 Ga0495618_0454052_59_667 201
408 3300046522 Ga0495643_0041847 Ga0495643_0041847_1017_1625 201
409 3300046524 Ga0495648_0001196 Ga0495648_0001196_24421_25029 201
410 3300046524 Ga0495648_0098219 Ga0495648_0098219_981_1589 201
411 3300046542 Ga0495597_0020857 Ga0495597_0020857_1592_2200 201
412 3300046616 Ga0495668_0045057 Ga0495668_0045057_1499_2107 201
413 3300046665 Ga0495661_0344786 Ga0495661_0344786_46_654 201
414 3300047323 Ga0495683_0038748 Ga0495683_0038748_1487_2095 201
415 3300047443 Ga0495687_019628 Ga0495687_019628_712_1320 201
416 3300048905 Ga0496102_0164345 Ga0496102_0164345_1016_1624 201
417 3300048906 Ga0496103_0036742 Ga0496103_0036742_835_1443 201
418 3300048908 Ga0496105_0010459 Ga0496105_0010459_3369_3977 201
419 3300048909 Ga0496106_0172083 Ga0496106_0172083_1045_1653 201
420 3300048910 Ga0496107_0101115 Ga0496107_0101115_1457_2065 201
421 3300048911 Ga0496108_0125497 Ga0496108_0125497_261_869 201
422 3300048912 Ga0496109_0077064 Ga0496109_0077064_263_871 201
423 3300048912 Ga0496109_0411191 Ga0496109_0411191_130_735 201
424 3300048913 Ga0496110_0238529 Ga0496110_0238529_911_1519 201
425 3300048913 Ga0496110_0484064 Ga0496110_0484064_392_997 201
426 3300048915 Ga0496112_0037869 Ga0496112_0037869_2593_3201 201
427 3300048916 Ga0496113_0013381 Ga0496113_0013381_3110_3718 201
428 3300048920 Ga0496117_0040953 Ga0496117_0040953_891_1499 201
429 3300048920 Ga0496117_0123355 Ga0496117_0123355_506_1114 201
430 3300048921 Ga0496118_0026297 Ga0496118_0026297_83_691 201
431 3300048921 Ga0496118_0035320 Ga0496118_0035320_1779_2387 201
432 3300048922 Ga0496119_0154376 Ga0496119_0154376_100_708 201
433 3300048923 Ga0496120_0082896 Ga0496120_0082896_945_1553 201
434 3300048924 Ga0496121_0402935 Ga0496121_0402935_22_630 201
435 3300048927 Ga0496124_0147960 Ga0496124_0147960_703_1311 201
436 3300048929 Ga0496126_0311835 Ga0496126_0311835_599_1207 201
437 3300049570 Ga0501033_0050895 Ga0501033_0050895_903_1508 201
438 3300049571 Ga0501034_0091826 Ga0501034_0091826_1662_2267 201
439 3300049571 Ga0501034_0115638 Ga0501034_0115638_1942_2547 201
440 3300049572 Ga0501036_0017040 Ga0501036_0017040_788_1393 201
441 3300049573 Ga0501037_0073189 Ga0501037_0073189_795_1400 201
442 3300049573 Ga0501037_0094513 Ga0501037_0094513_795_1400 201
443 3300049574 Ga0501038_0043090 Ga0501038_0043090_654_1259 201
444 3300049575 Ga0501039_0186625 Ga0501039_0186625_404_1009 201
445 3300049578 Ga0501042_0496536 Ga0501042_0496536_63_668 201
446 3300049579 Ga0501043_0010992 Ga0501043_0010992_774_1379 201
447 3300049580 Ga0501046_0155393 Ga0501046_0155393_1015_1620 201
448 3300049580 Ga0501046_0204927 Ga0501046_0204927_83_688 201
449 3300049581 Ga0501047_0089817 Ga0501047_0089817_795_1400 201
450 3300049586 Ga0501070_0060634 Ga0501070_0060634_903_1508 201
451 3300049589 Ga0501073_0048988 Ga0501073_0048988_1564_2169 201
452 3300049589 Ga0501073_0060403 Ga0501073_0060403_477_1082 201
453 3300049590 Ga0501074_0024045 Ga0501074_0024045_3055_3660 201
454 3300049592 Ga0501076_0123414 Ga0501076_0123414_112_717 201
455 3300049741 Ga0501079_0638234 Ga0501079_0638234_110_715 201
456 3300049822 Ga0501035_0005152 Ga0501035_0005152_903_1508 201
457 3300049823 Ga0501044_0000238 Ga0501044_0000238_45503_46108 201
458 3300049823 Ga0501044_0095291 Ga0501044_0095291_733_1338 201
459 3300049823 Ga0501044_0282870 Ga0501044_0282870_895_1500 201
460 3300049823 Ga0501044_0510591 Ga0501044_0510591_450_1055 201
461 3300050489 nmdc:mga03683_24574_c1 nmdc:mga03683_24574_c1_900_1508 201
462 3300050491 nmdc:mga00v17_377837_c1 nmdc:mga00v17_377837_c1_86_694 201
463 3300050491 nmdc:mga00v17_68427_c1 nmdc:mga00v17_68427_c1_639_1247 201
464 3300050492 nmdc:mga0yw44_62902_c1 nmdc:mga0yw44_62902_c1_1651_2259 201
465 3300050493 nmdc:mga0k408_26093_c1 nmdc:mga0k408_26093_c1_926_1534 201
466 3300050494 nmdc:mga06z11_161833_c1 nmdc:mga06z11_161833_c1_638_1258 201
467 3300050495 nmdc:mga04h51_8385_c1 nmdc:mga04h51_8385_c1_1898_2506 201
468 3300050496 nmdc:mga07m45_135248_c1 nmdc:mga07m45_135248_c1_789_1409 201
469 3300050516 nmdc:mga0sz30_120505_c1 nmdc:mga0sz30_120505_c1_367_975 201
470 3300053078 Ga0495612_0237982 Ga0495612_0237982_139_747 201
471 3300053080 Ga0500635_0041734 Ga0500635_0041734_312_920 201
472 3300053087 Ga0500643_000025 Ga0500643_000025_141049_141657 201
473 3300053094 Ga0500566_0275738 Ga0500566_0275738_185_793 201
474 3300053103 Ga0500555_003431 Ga0500555_003431_918_1526 201
475 3300053105 Ga0500557_000001 Ga0500557_000001_49161_49769 201
476 3300053116 Ga0500592_008310 Ga0500592_008310_564_1172 201
477 3300053121 Ga0500607_119360 Ga0500607_119360_406_1014 201
478 3300053122 Ga0500608_210556 Ga0500608_210556_141_749 201
479 3300053130 Ga0500642_0000147 Ga0500642_0000147_6470_7078 201
480 3300053131 Ga0500652_177497 Ga0500652_177497_11_619 201
481 3300053136 Ga0500559_0018957 Ga0500559_0018957_1837_2445 201
482 3300053139 Ga0500568_0009905 Ga0500568_0009905_2298_2906 201
483 3300053151 Ga0500604_0061548 Ga0500604_0061548_218_823 201
484 3300053155 Ga0500620_000817 Ga0500620_000817_873_1481 201
485 3300053158 Ga0500627_0043471 Ga0500627_0043471_891_1499 201
486 3300053162 Ga0500638_202166 Ga0500638_202166_71_679 201
487 3300053177 Ga0500636_0000419 Ga0500636_0000419_2756_3364 201
488 3300053729 Ga0500625_002083 Ga0500625_002083_3351_3959 201
489 3300053737 Ga0500601_000671 Ga0500601_000671_2396_3004 201
490 3300002077 JGI24744J21845_10024691 JGI24744J21845_100246912 202
491 3300003214 JGI25165J46597_1009195 JGI25165J46597_10091952 202
492 3300003215 JGI25153J46596_10006654 JGI25153J46596_100066544 202
493 3300003215 JGI25153J46596_10007981 JGI25153J46596_100079811 202
494 3300003215 JGI25153J46596_10039211 JGI25153J46596_100392113 202
495 3300003323 rootH1_10026525 rootH1_100265256 202
496 3300003354 JGI25160J50197_1000570 JGI25160J50197_100057022 202
497 3300003354 JGI25160J50197_1012405 JGI25160J50197_10124052 202
498 3300003659 JGI25404J52841_10002998 JGI25404J52841_100029982 202
499 3300003659 JGI25404J52841_10006844 JGI25404J52841_100068442 202
500 3300003659 JGI25404J52841_10009108 JGI25404J52841_100091082 202
501 3300003659 JGI25404J52841_10010395 JGI25404J52841_100103951 202
502 3300003659 JGI25404J52841_10014813 JGI25404J52841_100148132 202
503 3300003659 JGI25404J52841_10031935 JGI25404J52841_100319352 202
504 3300004625 Ga0055543_1046132 Ga0055543_10461321 202
505 3300005327 Ga0070658_10035508 Ga0070658_100355082 202
506 3300005327 Ga0070658_10178675 Ga0070658_101786752 202
507 3300005327 Ga0070658_10413887 Ga0070658_104138871 202
508 3300005329 Ga0070683_100008870 Ga0070683_1000088705 202
509 3300005329 Ga0070683_100018259 Ga0070683_1000182598 202
510 3300005329 Ga0070683_100065154 Ga0070683_1000651543 202
511 3300005330 Ga0070690_100195337 Ga0070690_1001953372 202
512 3300005331 Ga0070670_100345921 Ga0070670_1003459211 202
513 3300005331 Ga0070670_100557240 Ga0070670_1005572401 202
514 3300005333 Ga0070677_10327235 Ga0070677_103272351 202
515 3300005334 Ga0068869_100039722 Ga0068869_1000397225 202
516 3300005334 Ga0068869_100535621 Ga0068869_1005356212 202
517 3300005334 Ga0068869_100553609 Ga0068869_1005536091 202
518 3300005335 Ga0070666_10148701 Ga0070666_101487011 202
519 3300005336 Ga0070680_100013418 Ga0070680_1000134182 202
520 3300005336 Ga0070680_100091412 Ga0070680_1000914123 202
521 3300005336 Ga0070680_100158963 Ga0070680_1001589632 202
522 3300005337 Ga0070682_100256910 Ga0070682_1002569102 202
523 3300005337 Ga0070682_100322223 Ga0070682_1003222232 202
524 3300005337 Ga0070682_100481258 Ga0070682_1004812581 202
525 3300005338 Ga0068868_100106929 Ga0068868_1001069292 202
526 3300005338 Ga0068868_100375991 Ga0068868_1003759911 202
527 3300005339 Ga0070660_100025241 Ga0070660_1000252414 202
528 3300005339 Ga0070660_100096353 Ga0070660_1000963534 202
529 3300005341 Ga0070691_10103167 Ga0070691_101031672 202
530 3300005344 Ga0070661_100189395 Ga0070661_1001893952 202
531 3300005344 Ga0070661_100377774 Ga0070661_1003777742 202
532 3300005347 Ga0070668_100128954 Ga0070668_1001289542 202
533 3300005347 Ga0070668_100194702 Ga0070668_1001947022 202
534 3300005347 Ga0070668_100313646 Ga0070668_1003136462 202
535 3300005353 Ga0070669_100793458 Ga0070669_1007934581 202
536 3300005354 Ga0070675_100461251 Ga0070675_1004612512 202
537 3300005355 Ga0070671_100547227 Ga0070671_1005472272 202
538 3300005356 Ga0070674_100104116 Ga0070674_1001041162 202
539 3300005364 Ga0070673_100206315 Ga0070673_1002063151 202
540 3300005364 Ga0070673_100463641 Ga0070673_1004636412 202
541 3300005365 Ga0070688_100550887 Ga0070688_1005508871 202
542 3300005366 Ga0070659_100400976 Ga0070659_1004009762 202
543 3300005367 Ga0070667_100391049 Ga0070667_1003910492 202
544 3300005367 Ga0070667_100986744 Ga0070667_1009867441 202
545 3300005434 Ga0070709_10001472 Ga0070709_1000147212 202
546 3300005434 Ga0070709_10011172 Ga0070709_100111721 202
547 3300005435 Ga0070714_100009772 Ga0070714_1000097727 202
548 3300005435 Ga0070714_100012609 Ga0070714_1000126099 202
549 3300005435 Ga0070714_100016860 Ga0070714_1000168604 202
550 3300005435 Ga0070714_100198138 Ga0070714_1001981382 202
551 3300005435 Ga0070714_100520028 Ga0070714_1005200281 202
552 3300005435 Ga0070714_100747880 Ga0070714_1007478802 202
553 3300005435 Ga0070714_100768896 Ga0070714_1007688961 202
554 3300005436 Ga0070713_100010458 Ga0070713_1000104584 202
555 3300005436 Ga0070713_100025412 Ga0070713_1000254122 202
556 3300005436 Ga0070713_100032350 Ga0070713_1000323504 202
557 3300005436 Ga0070713_100041607 Ga0070713_1000416074 202
558 3300005436 Ga0070713_100170016 Ga0070713_1001700162 202
559 3300005436 Ga0070713_100197830 Ga0070713_1001978303 202
560 3300005437 Ga0070710_10012826 Ga0070710_100128264 202
561 3300005437 Ga0070710_10020189 Ga0070710_100201893 202
562 3300005437 Ga0070710_10127103 Ga0070710_101271032 202
563 3300005437 Ga0070710_10139068 Ga0070710_101390681 202
564 3300005438 Ga0070701_10104467 Ga0070701_101044672 202
565 3300005439 Ga0070711_100025343 Ga0070711_1000253432 202
566 3300005439 Ga0070711_100068534 Ga0070711_1000685342 202
567 3300005439 Ga0070711_100070677 Ga0070711_1000706773 202
568 3300005439 Ga0070711_100328566 Ga0070711_1003285662 202
569 3300005441 Ga0070700_100284853 Ga0070700_1002848532 202
570 3300005441 Ga0070700_100482840 Ga0070700_1004828402 202
571 3300005444 Ga0070694_100202930 Ga0070694_1002029302 202
572 3300005455 Ga0070663_100035536 Ga0070663_1000355362 202
573 3300005455 Ga0070663_100051920 Ga0070663_1000519202 202
574 3300005455 Ga0070663_100078954 Ga0070663_1000789544 202
575 3300005455 Ga0070663_100189809 Ga0070663_1001898092 202
576 3300005455 Ga0070663_100239856 Ga0070663_1002398562 202
577 3300005455 Ga0070663_100355190 Ga0070663_1003551902 202
578 3300005455 Ga0070663_100825096 Ga0070663_1008250961 202
579 3300005456 Ga0070678_100133873 Ga0070678_1001338732 202
580 3300005456 Ga0070678_100176078 Ga0070678_1001760782 202
581 3300005456 Ga0070678_101064304 Ga0070678_1010643041 202
582 3300005457 Ga0070662_100570729 Ga0070662_1005707291 202
583 3300005458 Ga0070681_10056295 Ga0070681_100562954 202
584 3300005458 Ga0070681_10684692 Ga0070681_106846921 202
585 3300005459 Ga0068867_100127587 Ga0068867_1001275872 202
586 3300005459 Ga0068867_100288787 Ga0068867_1002887872 202
587 3300005466 Ga0070685_10254998 Ga0070685_102549981 202
588 3300005471 Ga0070698_100032519 Ga0070698_1000325195 202
589 3300005518 Ga0070699_100409509 Ga0070699_1004095091 202
590 3300005530 Ga0070679_100040267 Ga0070679_1000402674 202
591 3300005530 Ga0070679_100046297 Ga0070679_1000462974 202
592 3300005530 Ga0070679_100104324 Ga0070679_1001043243 202
593 3300005530 Ga0070679_100388162 Ga0070679_1003881622 202
594 3300005535 Ga0070684_100007202 Ga0070684_1000072026 202
595 3300005535 Ga0070684_100015483 Ga0070684_1000154835 202
596 3300005536 Ga0070697_100062919 Ga0070697_1000629193 202
597 3300005539 Ga0068853_100041634 Ga0068853_1000416341 202
598 3300005543 Ga0070672_100332438 Ga0070672_1003324382 202
599 3300005544 Ga0070686_100456864 Ga0070686_1004568642 202
600 3300005545 Ga0070695_100838946 Ga0070695_1008389461 202
601 3300005546 Ga0070696_101009428 Ga0070696_1010094281 202
602 3300005547 Ga0070693_100067173 Ga0070693_1000671732 202
603 3300005547 Ga0070693_100084154 Ga0070693_1000841542 202
604 3300005548 Ga0070665_100101925 Ga0070665_1001019252 202
605 3300005548 Ga0070665_100188338 Ga0070665_1001883382 202
606 3300005548 Ga0070665_100194986 Ga0070665_1001949861 202
607 3300005548 Ga0070665_100244910 Ga0070665_1002449102 202
608 3300005548 Ga0070665_100351923 Ga0070665_1003519232 202
609 3300005548 Ga0070665_100404808 Ga0070665_1004048081 202
610 3300005548 Ga0070665_100405364 Ga0070665_1004053642 202
611 3300005548 Ga0070665_100447244 Ga0070665_1004472442 202
612 3300005548 Ga0070665_100518591 Ga0070665_1005185912 202
613 3300005548 Ga0070665_100632253 Ga0070665_1006322531 202
614 3300005548 Ga0070665_100965870 Ga0070665_1009658702 202
615 3300005548 Ga0070665_101051090 Ga0070665_1010510901 202
616 3300005548 Ga0070665_101183008 Ga0070665_1011830081 202
617 3300005549 Ga0070704_100127465 Ga0070704_1001274652 202
618 3300005549 Ga0070704_100444905 Ga0070704_1004449051 202
619 3300005563 Ga0068855_100015485 Ga0068855_1000154859 202
620 3300005563 Ga0068855_100097667 Ga0068855_1000976675 202
621 3300005563 Ga0068855_100314624 Ga0068855_1003146242 202
622 3300005563 Ga0068855_100756818 Ga0068855_1007568182 202
623 3300005564 Ga0070664_100059581 Ga0070664_1000595814 202
624 3300005577 Ga0068857_100479051 Ga0068857_1004790512 202
625 3300005578 Ga0068854_100143866 Ga0068854_1001438662 202
626 3300005578 Ga0068854_100266267 Ga0068854_1002662672 202
627 3300005578 Ga0068854_100671422 Ga0068854_1006714222 202
628 3300005614 Ga0068856_100000322 Ga0068856_10000032252 202
629 3300005614 Ga0068856_100554107 Ga0068856_1005541072 202
630 3300005614 Ga0068856_100684582 Ga0068856_1006845822 202
631 3300005615 Ga0070702_100278648 Ga0070702_1002786481 202
632 3300005615 Ga0070702_100766319 Ga0070702_1007663191 202
633 3300005616 Ga0068852_100008838 Ga0068852_1000088385 202
634 3300005616 Ga0068852_100169499 Ga0068852_1001694992 202
635 3300005616 Ga0068852_100187600 Ga0068852_1001876002 202
636 3300005616 Ga0068852_100194606 Ga0068852_1001946062 202
637 3300005719 Ga0068861_100049131 Ga0068861_1000491312 202
638 3300005719 Ga0068861_100176349 Ga0068861_1001763493 202
639 3300005834 Ga0068851_10066696 Ga0068851_100666962 202
640 3300005834 Ga0068851_10187000 Ga0068851_101870002 202
641 3300005842 Ga0068858_100099286 Ga0068858_1000992862 202
642 3300005842 Ga0068858_100198281 Ga0068858_1001982812 202
643 3300005842 Ga0068858_100340909 Ga0068858_1003409092 202
644 3300005842 Ga0068858_100572658 Ga0068858_1005726581 202
645 3300005842 Ga0068858_100632184 Ga0068858_1006321841 202
646 3300005843 Ga0068860_100000058 Ga0068860_100000058189 202
647 3300005843 Ga0068860_100077341 Ga0068860_1000773415 202
648 3300005843 Ga0068860_100327471 Ga0068860_1003274711 202
649 3300005843 Ga0068860_100425705 Ga0068860_1004257053 202
650 3300005843 Ga0068860_101171722 Ga0068860_1011717221 202
651 3300005844 Ga0068862_100268062 Ga0068862_1002680621 202
652 3300005844 Ga0068862_100349331 Ga0068862_1003493312 202
653 3300005844 Ga0068862_100361912 Ga0068862_1003619122 202
654 3300005844 Ga0068862_100542459 Ga0068862_1005424592 202
655 3300005844 Ga0068862_100606372 Ga0068862_1006063722 202
656 3300005937 Ga0081455_10011346 Ga0081455_100113462 202
657 3300005937 Ga0081455_10024857 Ga0081455_100248575 202
658 3300005937 Ga0081455_10028819 Ga0081455_100288194 202
659 3300005937 Ga0081455_10160831 Ga0081455_101608312 202
660 3300005981 Ga0081538_10014522 Ga0081538_100145226 202
661 3300005983 Ga0081540_1002077 Ga0081540_10020772 202
662 3300005983 Ga0081540_1002578 Ga0081540_10025789 202
663 3300005983 Ga0081540_1004984 Ga0081540_10049846 202
664 3300005983 Ga0081540_1005335 Ga0081540_10053355 202
665 3300005983 Ga0081540_1009717 Ga0081540_10097173 202
666 3300005983 Ga0081540_1016645 Ga0081540_10166453 202
667 3300005983 Ga0081540_1016857 Ga0081540_10168575 202
668 3300005983 Ga0081540_1017725 Ga0081540_10177255 202
669 3300005983 Ga0081540_1020035 Ga0081540_10200355 202
670 3300005983 Ga0081540_1039803 Ga0081540_10398034 202
671 3300005983 Ga0081540_1070407 Ga0081540_10704073 202
672 3300005983 Ga0081540_1071981 Ga0081540_10719812 202
673 3300005983 Ga0081540_1199526 Ga0081540_11995261 202
674 3300005985 Ga0081539_10000176 Ga0081539_1000017649 202
675 3300005985 Ga0081539_10000231 Ga0081539_1000023141 202
676 3300006028 Ga0070717_10003916 Ga0070717_100039162 202
677 3300006028 Ga0070717_10043223 Ga0070717_100432234 202
678 3300006028 Ga0070717_10108991 Ga0070717_101089912 202
679 3300006038 Ga0075365_10001152 Ga0075365_1000115213 202
680 3300006038 Ga0075365_10048661 Ga0075365_100486613 202
681 3300006038 Ga0075365_10223718 Ga0075365_102237182 202
682 3300006038 Ga0075365_10328325 Ga0075365_103283251 202
683 3300006038 Ga0075365_10407417 Ga0075365_104074172 202
684 3300006038 Ga0075365_10572324 Ga0075365_105723241 202
685 3300006042 Ga0075368_10068679 Ga0075368_100686792 202
686 3300006042 Ga0075368_10083408 Ga0075368_100834082 202
687 3300006042 Ga0075368_10094133 Ga0075368_100941332 202
688 3300006048 Ga0075363_100058514 Ga0075363_1000585142 202
689 3300006051 Ga0075364_10070205 Ga0075364_100702052 202
690 3300006051 Ga0075364_10146721 Ga0075364_101467212 202
691 3300006051 Ga0075364_10195114 Ga0075364_101951142 202
692 3300006051 Ga0075364_10295565 Ga0075364_102955651 202
693 3300006163 Ga0070715_10002113 Ga0070715_100021135 202
694 3300006163 Ga0070715_10083098 Ga0070715_100830981 202
695 3300006173 Ga0070716_100003787 Ga0070716_1000037875 202
696 3300006175 Ga0070712_100043803 Ga0070712_1000438032 202
697 3300006175 Ga0070712_100057171 Ga0070712_1000571714 202
698 3300006175 Ga0070712_100089755 Ga0070712_1000897553 202
699 3300006175 Ga0070712_100173136 Ga0070712_1001731362 202
700 3300006175 Ga0070712_100390773 Ga0070712_1003907732 202
701 3300006175 Ga0070712_100631317 Ga0070712_1006313172 202
702 3300006177 Ga0075362_10046905 Ga0075362_100469052 202
703 3300006177 Ga0075362_10069135 Ga0075362_100691352 202
704 3300006177 Ga0075362_10081503 Ga0075362_100815032 202
705 3300006178 Ga0075367_10012829 Ga0075367_100128292 202
706 3300006178 Ga0075367_10029555 Ga0075367_100295552 202
707 3300006178 Ga0075367_10086661 Ga0075367_100866612 202
708 3300006178 Ga0075367_10193112 Ga0075367_101931122 202
709 3300006178 Ga0075367_10244634 Ga0075367_102446342 202
710 3300006186 Ga0075369_10039695 Ga0075369_100396954 202
711 3300006186 Ga0075369_10102712 Ga0075369_101027122 202
712 3300006186 Ga0075369_10195683 Ga0075369_101956832 202
713 3300006195 Ga0075366_10049316 Ga0075366_100493162 202
714 3300006195 Ga0075366_10075306 Ga0075366_100753064 202
715 3300006237 Ga0097621_100224043 Ga0097621_1002240432 202
716 3300006237 Ga0097621_100420962 Ga0097621_1004209622 202
717 3300006237 Ga0097621_101030146 Ga0097621_1010301461 202
718 3300006353 Ga0075370_10054596 Ga0075370_100545963 202
719 3300006353 Ga0075370_10277502 Ga0075370_102775022 202
720 3300006358 Ga0068871_100149237 Ga0068871_1001492373 202
721 3300006844 Ga0075428_100089591 Ga0075428_1000895913 202
722 3300006844 Ga0075428_101214433 Ga0075428_1012144332 202
723 3300006871 Ga0075434_100150853 Ga0075434_1001508533 202
724 3300006881 Ga0068865_100132313 Ga0068865_1001323132 202
725 3300006881 Ga0068865_100279534 Ga0068865_1002795342 202
726 3300006941 Ga0099825_1026986 Ga0099825_10269864 202
727 3300006942 Ga0099824_1004823 Ga0099824_100482326 202
728 3300006942 Ga0099824_1013628 Ga0099824_10136289 202
729 3300006943 Ga0099822_1000628 Ga0099822_100062829 202
730 3300006943 Ga0099822_1049229 Ga0099822_10492293 202
731 3300006944 Ga0099823_1071406 Ga0099823_10714062 202
732 3300007076 Ga0075435_100166884 Ga0075435_1001668842 202
733 3300007265 Ga0099794_10033913 Ga0099794_100339133 202
734 3300007265 Ga0099794_10034139 Ga0099794_100341392 202
735 3300007265 Ga0099794_10086053 Ga0099794_100860532 202
736 3300007788 Ga0099795_10242404 Ga0099795_102424042 202
737 3300007788 Ga0099795_10243986 Ga0099795_102439861 202
738 3300009011 Ga0105251_10235172 Ga0105251_102351721 202
739 3300009036 Ga0105244_10060146 Ga0105244_100601462 202
740 3300009092 Ga0105250_10166686 Ga0105250_101666862 202
741 3300009093 Ga0105240_10018154 Ga0105240_100181549 202
742 3300009093 Ga0105240_10071121 Ga0105240_100711213 202
743 3300009093 Ga0105240_10095845 Ga0105240_100958452 202
744 3300009093 Ga0105240_10208392 Ga0105240_102083923 202
745 3300009093 Ga0105240_10293713 Ga0105240_102937132 202
746 3300009093 Ga0105240_10482621 Ga0105240_104826212 202
747 3300009093 Ga0105240_11261227 Ga0105240_112612271 202
748 3300009094 Ga0111539_10981306 Ga0111539_109813061 202
749 3300009098 Ga0105245_10033567 Ga0105245_100335672 202
750 3300009098 Ga0105245_10120982 Ga0105245_101209823 202
751 3300009098 Ga0105245_10185030 Ga0105245_101850302 202
752 3300009098 Ga0105245_10220248 Ga0105245_102202482 202
753 3300009098 Ga0105245_10747896 Ga0105245_107478962 202
754 3300009098 Ga0105245_11169324 Ga0105245_111693241 202
755 3300009101 Ga0105247_10062640 Ga0105247_100626402 202
756 3300009101 Ga0105247_10125012 Ga0105247_101250122 202
757 3300009101 Ga0105247_10261663 Ga0105247_102616632 202
758 3300009101 Ga0105247_10295004 Ga0105247_102950042 202
759 3300009101 Ga0105247_10333223 Ga0105247_103332232 202
760 3300009147 Ga0114129_10439436 Ga0114129_104394362 202
761 3300009148 Ga0105243_10431461 Ga0105243_104314612 202
762 3300009174 Ga0105241_10020908 Ga0105241_100209085 202
763 3300009174 Ga0105241_10030937 Ga0105241_100309372 202
764 3300009174 Ga0105241_10542042 Ga0105241_105420421 202
765 3300009174 Ga0105241_10613867 Ga0105241_106138672 202
766 3300009174 Ga0105241_11235846 Ga0105241_112358461 202
767 3300009176 Ga0105242_10156868 Ga0105242_101568683 202
768 3300009176 Ga0105242_10211351 Ga0105242_102113513 202
769 3300009177 Ga0105248_10085478 Ga0105248_100854782 202
770 3300009177 Ga0105248_10478773 Ga0105248_104787732 202
771 3300009177 Ga0105248_11471659 Ga0105248_114716592 202
772 3300009545 Ga0105237_10005556 Ga0105237_100055564 202
773 3300009545 Ga0105237_10096146 Ga0105237_100961464 202
774 3300009545 Ga0105237_10160932 Ga0105237_101609321 202
775 3300009545 Ga0105237_10235062 Ga0105237_102350622 202
776 3300009545 Ga0105237_10342632 Ga0105237_103426323 202
777 3300009545 Ga0105237_10356028 Ga0105237_103560282 202
778 3300009545 Ga0105237_10374440 Ga0105237_103744401 202
779 3300009545 Ga0105237_10718219 Ga0105237_107182192 202
780 3300009545 Ga0105237_10777716 Ga0105237_107777162 202
781 3300009545 Ga0105237_10827943 Ga0105237_108279432 202
782 3300009551 Ga0105238_10023251 Ga0105238_100232514 202
783 3300009551 Ga0105238_10035641 Ga0105238_100356414 202
784 3300009551 Ga0105238_10170976 Ga0105238_101709762 202
785 3300009551 Ga0105238_10238271 Ga0105238_102382712 202
786 3300009551 Ga0105238_10712638 Ga0105238_107126382 202
787 3300009553 Ga0105249_10359083 Ga0105249_103590832 202
788 3300009553 Ga0105249_10469918 Ga0105249_104699182 202
789 3300010159 Ga0099796_10071689 Ga0099796_100716892 202
790 3300010375 Ga0105239_10108782 Ga0105239_101087824 202
791 3300010375 Ga0105239_10120100 Ga0105239_101201002 202
792 3300010375 Ga0105239_10153972 Ga0105239_101539724 202
793 3300010375 Ga0105239_10156020 Ga0105239_101560202 202
794 3300010375 Ga0105239_10280756 Ga0105239_102807563 202
795 3300010375 Ga0105239_10461170 Ga0105239_104611701 202
796 3300011119 Ga0105246_10560833 Ga0105246_105608331 202
797 3300011119 Ga0105246_10909824 Ga0105246_109098241 202
798 3300013104 Ga0157370_10089058 Ga0157370_100890584 202
799 3300013104 Ga0157370_10420330 Ga0157370_104203302 202
800 3300013104 Ga0157370_10587125 Ga0157370_105871252 202
801 3300013105 Ga0157369_10006882 Ga0157369_100068828 202
802 3300013105 Ga0157369_10013624 Ga0157369_100136244 202
803 3300013105 Ga0157369_10017710 Ga0157369_1001771012 202
804 3300013105 Ga0157369_10019891 Ga0157369_100198916 202
805 3300013105 Ga0157369_10138690 Ga0157369_101386904 202
806 3300013105 Ga0157369_10308334 Ga0157369_103083343 202
807 3300013296 Ga0157374_10027074 Ga0157374_100270745 202
808 3300013296 Ga0157374_10115651 Ga0157374_101156512 202
809 3300013297 Ga0157378_10704316 Ga0157378_107043161 202
810 3300013297 Ga0157378_10728754 Ga0157378_107287542 202
811 3300013306 Ga0163162_10504021 Ga0163162_105040212 202
812 3300013306 Ga0163162_10535489 Ga0163162_105354892 202
813 3300013306 Ga0163162_10664411 Ga0163162_106644112 202
814 3300013307 Ga0157372_10105216 Ga0157372_101052163 202
815 3300013307 Ga0157372_10139170 Ga0157372_101391704 202
816 3300013307 Ga0157372_10836217 Ga0157372_108362172 202
817 3300013308 Ga0157375_10050933 Ga0157375_100509335 202
818 3300013308 Ga0157375_10184288 Ga0157375_101842884 202
819 3300013308 Ga0157375_10612499 Ga0157375_106124992 202
820 3300013308 Ga0157375_11390319 Ga0157375_113903192 202
821 3300014325 Ga0163163_10048228 Ga0163163_100482284 202
822 3300014325 Ga0163163_10084099 Ga0163163_100840992 202
823 3300014325 Ga0163163_10263106 Ga0163163_102631062 202
824 3300014325 Ga0163163_11151625 Ga0163163_111516252 202
825 3300014326 Ga0157380_10047987 Ga0157380_100479874 202
826 3300014326 Ga0157380_10108355 Ga0157380_101083553 202
827 3300014745 Ga0157377_10224725 Ga0157377_102247252 202
828 3300014745 Ga0157377_10711719 Ga0157377_107117191 202
829 3300014968 Ga0157379_10732692 Ga0157379_107326921 202
830 3300014968 Ga0157379_10949244 Ga0157379_109492442 202
831 3300014969 Ga0157376_10045781 Ga0157376_100457815 202
832 3300014969 Ga0157376_10061068 Ga0157376_100610682 202
833 3300014969 Ga0157376_10745838 Ga0157376_107458382 202
834 3300017792 Ga0163161_10113065 Ga0163161_101130652 202
835 3300017792 Ga0163161_10705126 Ga0163161_107051262 202
836 3300020069 Ga0197907_10676022 Ga0197907_106760222 202
837 3300020082 Ga0206353_10395622 Ga0206353_103956222 202
838 3300021358 Ga0213873_10026699 Ga0213873_100266992 202
839 3300021361 Ga0213872_10034455 Ga0213872_100344552 202
840 3300021384 Ga0213876_10001864 Ga0213876_100018647 202
841 3300021388 Ga0213875_10222050 Ga0213875_102220501 202
842 3300021441 Ga0213871_10068335 Ga0213871_100683352 202
843 3300025253 Ga0209677_111450 Ga0209677_1114502 202
844 3300025261 Ga0209233_1001922 Ga0209233_10019224 202
845 3300025261 Ga0209233_1007747 Ga0209233_10077474 202
846 3300025272 Ga0209455_1001948 Ga0209455_10019487 202
847 3300025272 Ga0209455_1002229 Ga0209455_10022292 202
848 3300025273 Ga0209673_1038670 Ga0209673_10386702 202
849 3300025295 Ga0209564_1009117 Ga0209564_10091172 202
850 3300025297 Ga0209758_1000553 Ga0209758_100055353 202
851 3300025297 Ga0209758_1001023 Ga0209758_100102326 202
852 3300025297 Ga0209758_1001046 Ga0209758_10010467 202
853 3300025297 Ga0209758_1003784 Ga0209758_10037845 202
854 3300025297 Ga0209758_1008833 Ga0209758_10088336 202
855 3300025297 Ga0209758_1011625 Ga0209758_10116255 202
856 3300025302 Ga0207426_1001204 Ga0207426_100120420 202
857 3300025302 Ga0207426_1017074 Ga0207426_10170744 202
858 3300025302 Ga0207426_1021401 Ga0207426_10214014 202
859 3300025315 Ga0207697_10109282 Ga0207697_101092821 202
860 3300025321 Ga0207656_10005805 Ga0207656_100058054 202
861 3300025885 Ga0207653_10029986 Ga0207653_100299861 202
862 3300025898 Ga0207692_10007163 Ga0207692_100071634 202
863 3300025898 Ga0207692_10010628 Ga0207692_100106282 202
864 3300025898 Ga0207692_10064716 Ga0207692_100647163 202
865 3300025898 Ga0207692_10097901 Ga0207692_100979012 202
866 3300025898 Ga0207692_10263305 Ga0207692_102633052 202
867 3300025899 Ga0207642_10021368 Ga0207642_100213684 202
868 3300025900 Ga0207710_10034146 Ga0207710_100341463 202
869 3300025900 Ga0207710_10069137 Ga0207710_100691373 202
870 3300025900 Ga0207710_10070484 Ga0207710_100704842 202
871 3300025900 Ga0207710_10185343 Ga0207710_101853432 202
872 3300025901 Ga0207688_10031462 Ga0207688_100314622 202
873 3300025901 Ga0207688_10077352 Ga0207688_100773522 202
874 3300025901 Ga0207688_10266277 Ga0207688_102662772 202
875 3300025905 Ga0207685_10002827 Ga0207685_100028274 202
876 3300025906 Ga0207699_10005411 Ga0207699_100054114 202
877 3300025906 Ga0207699_10005881 Ga0207699_100058814 202
878 3300025906 Ga0207699_10149327 Ga0207699_101493272 202
879 3300025906 Ga0207699_10176370 Ga0207699_101763702 202
880 3300025906 Ga0207699_10366461 Ga0207699_103664612 202
881 3300025907 Ga0207645_10319812 Ga0207645_103198122 202
882 3300025908 Ga0207643_10204433 Ga0207643_102044331 202
883 3300025908 Ga0207643_10456875 Ga0207643_104568751 202
884 3300025909 Ga0207705_10138295 Ga0207705_101382951 202
885 3300025909 Ga0207705_10221110 Ga0207705_102211102 202
886 3300025909 Ga0207705_10236199 Ga0207705_102361992 202
887 3300025910 Ga0207684_10025940 Ga0207684_100259402 202
888 3300025910 Ga0207684_10636344 Ga0207684_106363441 202
889 3300025911 Ga0207654_10285808 Ga0207654_102858082 202
890 3300025911 Ga0207654_10497355 Ga0207654_104973551 202
891 3300025912 Ga0207707_10006172 Ga0207707_100061725 202
892 3300025912 Ga0207707_10006273 Ga0207707_100062731 202
893 3300025912 Ga0207707_10012016 Ga0207707_100120164 202
894 3300025913 Ga0207695_10000278 Ga0207695_10000278120 202
895 3300025913 Ga0207695_10141279 Ga0207695_101412792 202
896 3300025913 Ga0207695_10209769 Ga0207695_102097692 202
897 3300025913 Ga0207695_10236300 Ga0207695_102363002 202
898 3300025913 Ga0207695_10583249 Ga0207695_105832492 202
899 3300025914 Ga0207671_10005180 Ga0207671_1000518014 202
900 3300025914 Ga0207671_10130000 Ga0207671_101300002 202
901 3300025914 Ga0207671_10186497 Ga0207671_101864972 202
902 3300025914 Ga0207671_10281246 Ga0207671_102812462 202
903 3300025914 Ga0207671_10434343 Ga0207671_104343431 202
904 3300025914 Ga0207671_10542992 Ga0207671_105429921 202
905 3300025914 Ga0207671_10819323 Ga0207671_108193231 202
906 3300025915 Ga0207693_10003588 Ga0207693_100035882 202
907 3300025915 Ga0207693_10023940 Ga0207693_100239403 202
908 3300025915 Ga0207693_10024035 Ga0207693_100240353 202
909 3300025915 Ga0207693_10038146 Ga0207693_100381462 202
910 3300025915 Ga0207693_10059166 Ga0207693_100591664 202
911 3300025915 Ga0207693_10445504 Ga0207693_104455042 202
912 3300025915 Ga0207693_10679342 Ga0207693_106793421 202
913 3300025916 Ga0207663_10008155 Ga0207663_100081551 202
914 3300025916 Ga0207663_10042572 Ga0207663_100425724 202
915 3300025916 Ga0207663_10097560 Ga0207663_100975602 202
916 3300025916 Ga0207663_10224527 Ga0207663_102245272 202
917 3300025917 Ga0207660_10023387 Ga0207660_100233872 202
918 3300025917 Ga0207660_10207222 Ga0207660_102072222 202
919 3300025919 Ga0207657_10038725 Ga0207657_100387252 202
920 3300025919 Ga0207657_10093540 Ga0207657_100935403 202
921 3300025919 Ga0207657_10104232 Ga0207657_101042323 202
922 3300025920 Ga0207649_10122966 Ga0207649_101229662 202
923 3300025920 Ga0207649_10190311 Ga0207649_101903112 202
924 3300025920 Ga0207649_10207207 Ga0207649_102072071 202
925 3300025921 Ga0207652_10151762 Ga0207652_101517622 202
926 3300025921 Ga0207652_10195357 Ga0207652_101953572 202
927 3300025921 Ga0207652_10443119 Ga0207652_104431192 202
928 3300025922 Ga0207646_10088363 Ga0207646_100883632 202
929 3300025922 Ga0207646_10137564 Ga0207646_101375642 202
930 3300025924 Ga0207694_10118745 Ga0207694_101187452 202
931 3300025924 Ga0207694_10552015 Ga0207694_105520151 202
932 3300025925 Ga0207650_10338947 Ga0207650_103389472 202
933 3300025926 Ga0207659_10207142 Ga0207659_102071422 202
934 3300025927 Ga0207687_10061269 Ga0207687_100612693 202
935 3300025927 Ga0207687_10102736 Ga0207687_101027362 202
936 3300025927 Ga0207687_10134168 Ga0207687_101341682 202
937 3300025928 Ga0207700_10012637 Ga0207700_100126374 202
938 3300025928 Ga0207700_10013045 Ga0207700_100130454 202
939 3300025928 Ga0207700_10024634 Ga0207700_100246342 202
940 3300025928 Ga0207700_10136332 Ga0207700_101363323 202
941 3300025928 Ga0207700_10589089 Ga0207700_105890892 202
942 3300025928 Ga0207700_10737261 Ga0207700_107372612 202
943 3300025929 Ga0207664_10010024 Ga0207664_100100247 202
944 3300025929 Ga0207664_10010714 Ga0207664_100107144 202
945 3300025929 Ga0207664_10012723 Ga0207664_100127234 202
946 3300025929 Ga0207664_10036726 Ga0207664_100367264 202
947 3300025929 Ga0207664_10091770 Ga0207664_100917702 202
948 3300025929 Ga0207664_10220208 Ga0207664_102202083 202
949 3300025929 Ga0207664_10474432 Ga0207664_104744322 202
950 3300025931 Ga0207644_10491082 Ga0207644_104910821 202
951 3300025932 Ga0207690_10130772 Ga0207690_101307721 202
952 3300025932 Ga0207690_10383840 Ga0207690_103838401 202
953 3300025933 Ga0207706_10032287 Ga0207706_100322875 202
954 3300025933 Ga0207706_10214775 Ga0207706_102147751 202
955 3300025934 Ga0207686_10385976 Ga0207686_103859762 202
956 3300025935 Ga0207709_10197750 Ga0207709_101977502 202
957 3300025937 Ga0207669_10047613 Ga0207669_100476132 202
958 3300025938 Ga0207704_10160116 Ga0207704_101601162 202
959 3300025938 Ga0207704_10189900 Ga0207704_101899003 202
960 3300025938 Ga0207704_11046845 Ga0207704_110468451 202
961 3300025939 Ga0207665_10000769 Ga0207665_1000076922 202
962 3300025939 Ga0207665_10085029 Ga0207665_100850291 202
963 3300025939 Ga0207665_10153073 Ga0207665_101530732 202
964 3300025939 Ga0207665_10423561 Ga0207665_104235612 202
965 3300025939 Ga0207665_10628424 Ga0207665_106284241 202
966 3300025940 Ga0207691_10062447 Ga0207691_100624474 202
967 3300025940 Ga0207691_10097698 Ga0207691_100976983 202
968 3300025940 Ga0207691_10701322 Ga0207691_107013221 202
969 3300025940 Ga0207691_10713431 Ga0207691_107134311 202
970 3300025941 Ga0207711_10145437 Ga0207711_101454371 202
971 3300025941 Ga0207711_10215888 Ga0207711_102158883 202
972 3300025941 Ga0207711_10497986 Ga0207711_104979862 202
973 3300025941 Ga0207711_11103518 Ga0207711_111035181 202
974 3300025942 Ga0207689_10220515 Ga0207689_102205152 202
975 3300025942 Ga0207689_10313827 Ga0207689_103138271 202
976 3300025944 Ga0207661_10004791 Ga0207661_1000479113 202
977 3300025944 Ga0207661_10215204 Ga0207661_102152041 202
978 3300025945 Ga0207679_10061962 Ga0207679_100619623 202
979 3300025945 Ga0207679_10181413 Ga0207679_101814131 202
980 3300025949 Ga0207667_10076656 Ga0207667_100766563 202
981 3300025949 Ga0207667_10107196 Ga0207667_101071964 202
982 3300025949 Ga0207667_10170162 Ga0207667_101701623 202
983 3300025949 Ga0207667_10669824 Ga0207667_106698242 202
984 3300025949 Ga0207667_11000431 Ga0207667_110004311 202
985 3300025949 Ga0207667_11301347 Ga0207667_113013471 202
986 3300025960 Ga0207651_10190326 Ga0207651_101903262 202
987 3300025972 Ga0207668_10082949 Ga0207668_100829492 202
988 3300025972 Ga0207668_10381508 Ga0207668_103815082 202
989 3300025981 Ga0207640_10125252 Ga0207640_101252523 202
990 3300025981 Ga0207640_11092107 Ga0207640_110921071 202
991 3300025986 Ga0207658_10055153 Ga0207658_100551534 202
992 3300025986 Ga0207658_10743099 Ga0207658_107430991 202
993 3300026023 Ga0207677_10023509 Ga0207677_100235092 202
994 3300026035 Ga0207703_10132857 Ga0207703_101328572 202
995 3300026035 Ga0207703_10340107 Ga0207703_103401072 202
996 3300026035 Ga0207703_10407882 Ga0207703_104078821 202
997 3300026041 Ga0207639_10137502 Ga0207639_101375022 202
998 3300026041 Ga0207639_10170572 Ga0207639_101705722 202
999 3300026041 Ga0207639_10197449 Ga0207639_101974493 202
1000 3300026041 Ga0207639_10686397 Ga0207639_106863972 202
1001 3300026067 Ga0207678_10034089 Ga0207678_100340893 202
1002 3300026067 Ga0207678_10054617 Ga0207678_100546173 202
1003 3300026067 Ga0207678_10092892 Ga0207678_100928922 202
1004 3300026067 Ga0207678_10103333 Ga0207678_101033334 202
1005 3300026067 Ga0207678_10246770 Ga0207678_102467702 202
1006 3300026067 Ga0207678_10250966 Ga0207678_102509662 202
1007 3300026067 Ga0207678_10721723 Ga0207678_107217232 202
1008 3300026075 Ga0207708_10087380 Ga0207708_100873802 202
1009 3300026075 Ga0207708_10152061 Ga0207708_101520612 202
1010 3300026078 Ga0207702_10000178 Ga0207702_1000017847 202
1011 3300026078 Ga0207702_10386681 Ga0207702_103866812 202
1012 3300026078 Ga0207702_10531139 Ga0207702_105311392 202
1013 3300026078 Ga0207702_10857098 Ga0207702_108570981 202
1014 3300026089 Ga0207648_10242045 Ga0207648_102420452 202
1015 3300026095 Ga0207676_10056087 Ga0207676_100560872 202
1016 3300026116 Ga0207674_11172463 Ga0207674_111724631 202
1017 3300026118 Ga0207675_100155253 Ga0207675_1001552533 202
1018 3300026118 Ga0207675_100360695 Ga0207675_1003606952 202
1019 3300026118 Ga0207675_100390859 Ga0207675_1003908592 202
1020 3300026121 Ga0207683_10110138 Ga0207683_101101383 202
1021 3300026121 Ga0207683_10202212 Ga0207683_102022122 202
1022 3300026142 Ga0207698_10057556 Ga0207698_100575564 202
1023 3300026142 Ga0207698_10148368 Ga0207698_101483683 202
1024 3300026142 Ga0207698_10318817 Ga0207698_103188172 202
1025 3300026142 Ga0207698_10636859 Ga0207698_106368592 202
1026 3300027296 Ga0209389_1000084 Ga0209389_100008445 202
1027 3300027357 Ga0209589_1000023 Ga0209589_100002384 202
1028 3300027357 Ga0209589_1000041 Ga0209589_100004184 202
1029 3300027361 Ga0209489_100032 Ga0209489_10003284 202
1030 3300027361 Ga0209489_100070 Ga0209489_10007044 202
1031 3300027363 Ga0209700_100040 Ga0209700_10004084 202
1032 3300027512 Ga0209179_1026462 Ga0209179_10264622 202
1033 3300027866 Ga0209813_10020675 Ga0209813_100206752 202
1034 3300027866 Ga0209813_10130088 Ga0209813_101300882 202
1035 3300027907 Ga0207428_10664932 Ga0207428_106649321 202
1036 3300028379 Ga0268266_10011621 Ga0268266_100116216 202
1037 3300028379 Ga0268266_10022797 Ga0268266_100227975 202
1038 3300028379 Ga0268266_10049379 Ga0268266_100493792 202
1039 3300028379 Ga0268266_10071394 Ga0268266_100713944 202
1040 3300028379 Ga0268266_10243638 Ga0268266_102436382 202
1041 3300028379 Ga0268266_10291782 Ga0268266_102917822 202
1042 3300028379 Ga0268266_10391775 Ga0268266_103917751 202
1043 3300028379 Ga0268266_10858790 Ga0268266_108587901 202
1044 3300028380 Ga0268265_10385049 Ga0268265_103850492 202
1045 3300028381 Ga0268264_10000022 Ga0268264_10000022433 202
1046 3300028381 Ga0268264_10168366 Ga0268264_101683661 202
1047 3300028381 Ga0268264_10297397 Ga0268264_102973971 202
1048 3300028381 Ga0268264_10554374 Ga0268264_105543741 202
1049 3300028381 Ga0268264_10622776 Ga0268264_106227762 202
1050 3300028381 Ga0268264_10769601 Ga0268264_107696012 202
1051 3300028563 Ga0265319_1004069 Ga0265319_10040699 202
1052 3300028573 Ga0265334_10022785 Ga0265334_100227853 202
1053 3300028577 Ga0265318_10047421 Ga0265318_100474212 202
1054 3300028653 Ga0265323_10007731 Ga0265323_100077312 202
1055 3300028666 Ga0265336_10001715 Ga0265336_100017152 202
1056 3300028786 Ga0307517_10005009 Ga0307517_100050094 202
1057 3300028786 Ga0307517_10222716 Ga0307517_102227162 202
1058 3300028794 Ga0307515_10053817 Ga0307515_100538174 202
1059 3300028794 Ga0307515_10171893 Ga0307515_101718931 202
1060 3300028800 Ga0265338_10000393 Ga0265338_100003936 202
1061 3300029957 Ga0265324_10058423 Ga0265324_100584232 202
1062 3300030760 Ga0265762_1032733 Ga0265762_10327332 202
1063 3300030763 Ga0265763_1008241 Ga0265763_10082412 202
1064 3300031235 Ga0265330_10037631 Ga0265330_100376312 202
1065 3300031235 Ga0265330_10060272 Ga0265330_100602721 202
1066 3300031235 Ga0265330_10084965 Ga0265330_100849652 202
1067 3300031238 Ga0265332_10043871 Ga0265332_100438712 202
1068 3300031239 Ga0265328_10000237 Ga0265328_1000023712 202
1069 3300031241 Ga0265325_10015936 Ga0265325_100159361 202
1070 3300031247 Ga0265340_10028458 Ga0265340_100284582 202
1071 3300031249 Ga0265339_10020763 Ga0265339_100207635 202
1072 3300031250 Ga0265331_10098531 Ga0265331_100985312 202
1073 3300031344 Ga0265316_10352581 Ga0265316_103525811 202
1074 3300031456 Ga0307513_10377835 Ga0307513_103778352 202
1075 3300031456 Ga0307513_10415164 Ga0307513_104151643 202
1076 3300031548 Ga0307408_100482767 Ga0307408_1004827672 202
1077 3300031616 Ga0307508_10000009 Ga0307508_10000009195 202
1078 3300031616 Ga0307508_10032585 Ga0307508_100325854 202
1079 3300031616 Ga0307508_10033482 Ga0307508_100334823 202
1080 3300031616 Ga0307508_10169929 Ga0307508_101699292 202
1081 3300031616 Ga0307508_10265713 Ga0307508_102657131 202
1082 3300031616 Ga0307508_10364572 Ga0307508_103645721 202
1083 3300031616 Ga0307508_10400317 Ga0307508_104003172 202
1084 3300031711 Ga0265314_10047708 Ga0265314_100477083 202
1085 3300031711 Ga0265314_10049680 Ga0265314_100496802 202
1086 3300031712 Ga0265342_10006351 Ga0265342_100063515 202
1087 3300031712 Ga0265342_10024669 Ga0265342_100246692 202
1088 3300031712 Ga0265342_10128330 Ga0265342_101283302 202
1089 3300031730 Ga0307516_10012009 Ga0307516_1001200910 202
1090 3300031730 Ga0307516_10030323 Ga0307516_100303235 202
1091 3300031730 Ga0307516_10110701 Ga0307516_101107012 202
1092 3300031731 Ga0307405_10262830 Ga0307405_102628302 202
1093 3300031824 Ga0307413_10066597 Ga0307413_100665974 202
1094 3300031824 Ga0307413_10573640 Ga0307413_105736402 202
1095 3300031852 Ga0307410_10249163 Ga0307410_102491632 202
1096 3300031903 Ga0307407_10276134 Ga0307407_102761341 202
1097 3300031911 Ga0307412_10093254 Ga0307412_100932542 202
1098 3300031911 Ga0307412_10117337 Ga0307412_101173372 202
1099 3300031995 Ga0307409_100527222 Ga0307409_1005272222 202
1100 3300031995 Ga0307409_100547312 Ga0307409_1005473122 202
1101 3300032002 Ga0307416_100220992 Ga0307416_1002209922 202
1102 3300032002 Ga0307416_100230819 Ga0307416_1002308191 202
1103 3300032004 Ga0307414_10436064 Ga0307414_104360642 202
1104 3300032005 Ga0307411_10405452 Ga0307411_104054521 202
1105 3300032126 Ga0307415_100161327 Ga0307415_1001613272 202
1106 3300032126 Ga0307415_101405925 Ga0307415_1014059251 202
1107 3300033179 Ga0307507_10090137 Ga0307507_100901373 202
1108 3300033180 Ga0307510_10104938 Ga0307510_101049383 202
1109 3300033442 Ga0315911_1000001 Ga0315911_10000011158 202
1110 3300033544 Ga0316215_1007286 Ga0316215_10072862 202
1111 3300034816 Ga0373930_0028134 Ga0373930_0028134_328_936 202
1112 3300035084 Ga0373928_0010459 Ga0373928_0010459_512_1120 202
1113 3300035086 Ga0373934_0013574 Ga0373934_0013574_1536_2159 202
1114 3300035086 Ga0373934_0033430 Ga0373934_0033430_866_1474 202
1115 3300035086 Ga0373934_0218016 Ga0373934_0218016_29_637 202
1116 3300035092 Ga0373952_0019158 Ga0373952_0019158_433_1041 202
1117 3300035111 Ga0373923_0016358 Ga0373923_0016358_1997_2605 202
1118 3300035113 Ga0373936_0044158 Ga0373936_0044158_283_891 202
1119 3300035115 Ga0373941_0122683 Ga0373941_0122683_47_655 202
1120 3300035115 Ga0373941_0130218 Ga0373941_0130218_239_847 202
1121 3300035117 Ga0373953_0034417 Ga0373953_0034417_1197_1805 202
1122 3300035117 Ga0373953_0169588 Ga0373953_0169588_197_805 202
1123 3300035118 Ga0373954_0006961 Ga0373954_0006961_871_1479 202
1124 3300035119 Ga0373956_0015711 Ga0373956_0015711_1830_2438 202
1125 3300035120 Ga0373957_0001164 Ga0373957_0001164_2838_3446 202
1126 3300035120 Ga0373957_0016123 Ga0373957_0016123_145_753 202
1127 3300035170 Ga0373943_0031471 Ga0373943_0031471_835_1458 202
1128 3300035170 Ga0373943_0070961 Ga0373943_0070961_341_949 202
1129 3300035171 Ga0373946_0060990 Ga0373946_0060990_486_1094 202
1130 3300035172 Ga0373955_0001365 Ga0373955_0001365_5565_6173 202
1131 3300035172 Ga0373955_0055151 Ga0373955_0055151_501_1109 202
1132 3300035172 Ga0373955_0091256 Ga0373955_0091256_854_1477 202
1133 3300035172 Ga0373955_0365679 Ga0373955_0365679_164_772 202
1134 3300035241 Ga0373961_0193945 Ga0373961_0193945_34_642 202
1135 3300035410 Ga0373924_0043356 Ga0373924_0043356_1111_1734 202
1136 3300035410 Ga0373924_0049841 Ga0373924_0049841_365_973 202
1137 3300035695 Ga0373927_0010050 Ga0373927_0010050_1366_1974 202
1138 3300035695 Ga0373927_0014565 Ga0373927_0014565_1784_2392 202
1139 3300035695 Ga0373927_0036575 Ga0373927_0036575_1548_2171 202
1140 3300035695 Ga0373927_0050269 Ga0373927_0050269_798_1406 202
1141 3300035695 Ga0373927_0057991 Ga0373927_0057991_1681_2289 202
1142 3300035724 Ga0373933_0045513 Ga0373933_0045513_1388_1996 202
1143 3300035724 Ga0373933_0123734 Ga0373933_0123734_397_1020 202
1144 3300035724 Ga0373933_0130761 Ga0373933_0130761_309_917 202
1145 3300035725 Ga0373947_0001838 Ga0373947_0001838_9948_10571 202
1146 3300035725 Ga0373947_0015569 Ga0373947_0015569_806_1414 202
1147 3300035725 Ga0373947_0181014 Ga0373947_0181014_723_1331 202
1148 3300036401 Ga0373937_0118954 Ga0373937_0118954_1752_2375 202
1149 3300036401 Ga0373937_0374282 Ga0373937_0374282_126_749 202
1150 3300036401 Ga0373937_0443253 Ga0373937_0443253_21_629 202
1151 3300036401 Ga0373937_0512407 Ga0373937_0512407_124_732 202
1152 3300036401 Ga0373937_0779722 Ga0373937_0779722_25_633 202
1153 3300036401 Ga0373937_0803575 Ga0373937_0803575_264_872 202
1154 3300036401 Ga0373937_0935470 Ga0373937_0935470_117_725 202
1155 3300036459 Ga0372808_004102 Ga0372808_004102_433_1071 202
1156 3300037068 Ga0373925_0004119 Ga0373925_0004119_2205_2828 202
1157 3300037068 Ga0373925_0039837 Ga0373925_0039837_1199_1807 202
1158 3300037068 Ga0373925_0325909 Ga0373925_0325909_593_1201 202
1159 3300037068 Ga0373925_0792716 Ga0373925_0792716_84_692 202
1160 3300037418 Ga0395900_0362802 Ga0395900_0362802_173_781 202
1161 3300037418 Ga0395900_0412637 Ga0395900_0412637_162_770 202
1162 3300037466 Ga0395898_0201492 Ga0395898_0201492_432_1040 202
1163 3300037466 Ga0395898_0818500 Ga0395898_0818500_70_678 202
1164 3300037471 Ga0395905_0056247 Ga0395905_0056247_1788_2396 202
1165 3300037853 Ga0436364_0782971 Ga0436364_0782971_1434_2042 202
1166 3300038443 Ga0395901_0230676 Ga0395901_0230676_360_983 202
1167 3300038443 Ga0395901_0248799 Ga0395901_0248799_1157_1765 202
1168 3300038443 Ga0395901_0351911 Ga0395901_0351911_75_686 202
1169 3300039437 Ga0436365_0096763 Ga0436365_0096763_5825_6433 202
1170 3300039437 Ga0436365_1277930 Ga0436365_1277930_1163_1771 202
1171 3300039438 Ga0436360_0091466 Ga0436360_0091466_1224_1832 202
1172 3300039447 Ga0436361_0037185 Ga0436361_0037185_1044_1652 202
1173 3300039447 Ga0436361_0384206 Ga0436361_0384206_325_933 202
1174 3300039447 Ga0436361_1169507 Ga0436361_1169507_116_724 202
1175 3300039450 Ga0436363_0297092 Ga0436363_0297092_60_668 202
1176 3300039450 Ga0436363_0686784 Ga0436363_0686784_3409_4017 202
1177 3300039453 Ga0436362_1265351 Ga0436362_1265351_632_1240 202
1178 3300041452 Ga0451793_0862873 Ga0451793_0862873_90_713 202
1179 3300041486 Ga0451807_2207588 Ga0451807_2207588_24_632 202
1180 3300041507 Ga0451851_1090162 Ga0451851_1090162_225_833 202
1181 3300044658 Ga0466972_0005541 Ga0466972_0005541_3057_3680 202
1182 3300044684 Ga0466966_0000464 Ga0466966_0000464_24554_25165 202
1183 3300044684 Ga0466966_0031011 Ga0466966_0031011_913_1521 202
1184 3300044684 Ga0466966_0311449 Ga0466966_0311449_287_898 202
1185 3300044693 Ga0466961_0000064 Ga0466961_0000064_26877_27488 202
1186 3300044694 Ga0466963_0266635 Ga0466963_0266635_187_810 202
1187 3300044735 Ga0466968_0009497 Ga0466968_0009497_1953_2576 202
1188 3300044735 Ga0466968_0319393 Ga0466968_0319393_97_705 202
1189 3300044765 Ga0466970_0505669 Ga0466970_0505669_40_648 202
1190 3300044842 Ga0466957_0198939 Ga0466957_0198939_632_1240 202
1191 3300044901 Ga0466960_0033351 Ga0466960_0033351_994_1617 202
1192 3300044901 Ga0466960_0320922 Ga0466960_0320922_64_675 202
1193 3300044901 Ga0466960_0394260 Ga0466960_0394260_104_712 202
1194 3300045049 Ga0466959_0076469 Ga0466959_0076469_502_1113 202
1195 3300045836 Ga0466958_0139855 Ga0466958_0139855_745_1356 202
1196 3300045836 Ga0466958_0275603 Ga0466958_0275603_438_1046 202
1197 3300045976 Ga0466967_0255813 Ga0466967_0255813_442_1050 202
1198 3300046454 Ga0495592_0034221 Ga0495592_0034221_607_1215 202
1199 3300046454 Ga0495592_0064790 Ga0495592_0064790_78_701 202
1200 3300046454 Ga0495592_0118340 Ga0495592_0118340_358_966 202
1201 3300046455 Ga0495603_0018102 Ga0495603_0018102_624_1232 202
1202 3300046455 Ga0495603_0116820 Ga0495603_0116820_562_1170 202
1203 3300046457 Ga0495590_0054853 Ga0495590_0054853_450_1058 202
1204 3300046459 Ga0495629_0005721 Ga0495629_0005721_6704_7315 202
1205 3300046459 Ga0495629_0048353 Ga0495629_0048353_1291_1899 202
1206 3300046459 Ga0495629_0140682 Ga0495629_0140682_488_1096 202
1207 3300046459 Ga0495629_0144033 Ga0495629_0144033_612_1220 202
1208 3300046459 Ga0495629_0188943 Ga0495629_0188943_783_1406 202
1209 3300046459 Ga0495629_0211175 Ga0495629_0211175_98_706 202
1210 3300046459 Ga0495629_0265725 Ga0495629_0265725_220_828 202
1211 3300046460 Ga0495638_0009058 Ga0495638_0009058_4621_5244 202
1212 3300046460 Ga0495638_0050021 Ga0495638_0050021_1857_2465 202
1213 3300046460 Ga0495638_0193666 Ga0495638_0193666_146_754 202
1214 3300046462 Ga0495651_0011064 Ga0495651_0011064_5026_5649 202
1215 3300046462 Ga0495651_0024124 Ga0495651_0024124_1949_2557 202
1216 3300046462 Ga0495651_0079859 Ga0495651_0079859_1104_1712 202
1217 3300046463 Ga0495653_0022712 Ga0495653_0022712_760_1368 202
1218 3300046463 Ga0495653_0049003 Ga0495653_0049003_996_1619 202
1219 3300046463 Ga0495653_0050712 Ga0495653_0050712_2187_2795 202
1220 3300046472 Ga0495580_0036011 Ga0495580_0036011_1021_1644 202
1221 3300046472 Ga0495580_0231499 Ga0495580_0231499_228_836 202
1222 3300046472 Ga0495580_0525176 Ga0495580_0525176_148_756 202
1223 3300046475 Ga0495639_0055239 Ga0495639_0055239_195_803 202
1224 3300046475 Ga0495639_0280182 Ga0495639_0280182_86_694 202
1225 3300046476 Ga0495662_0034386 Ga0495662_0034386_1042_1665 202
1226 3300046476 Ga0495662_0123779 Ga0495662_0123779_18_629 202
1227 3300046477 Ga0495664_0012724 Ga0495664_0012724_517_1125 202
1228 3300046477 Ga0495664_0018663 Ga0495664_0018663_3234_3857 202
1229 3300046477 Ga0495664_0336805 Ga0495664_0336805_129_737 202
1230 3300046491 Ga0495584_0156258 Ga0495584_0156258_363_971 202
1231 3300046491 Ga0495584_0240223 Ga0495584_0240223_244_852 202
1232 3300046492 Ga0495585_0264847 Ga0495585_0264847_49_657 202
1233 3300046492 Ga0495585_0286303 Ga0495585_0286303_143_751 202
1234 3300046499 Ga0495594_0071310 Ga0495594_0071310_503_1111 202
1235 3300046499 Ga0495594_0077609 Ga0495594_0077609_685_1293 202
1236 3300046499 Ga0495594_0156437 Ga0495594_0156437_160_768 202
1237 3300046500 Ga0495596_0114156 Ga0495596_0114156_68_676 202
1238 3300046500 Ga0495596_0120013 Ga0495596_0120013_388_996 202
1239 3300046501 Ga0495607_0240220 Ga0495607_0240220_222_830 202
1240 3300046506 Ga0495583_0023388 Ga0495583_0023388_1439_2050 202
1241 3300046506 Ga0495583_0181034 Ga0495583_0181034_163_771 202
1242 3300046507 Ga0495606_0013321 Ga0495606_0013321_3172_3783 202
1243 3300046507 Ga0495606_0147726 Ga0495606_0147726_575_1183 202
1244 3300046507 Ga0495606_0200167 Ga0495606_0200167_389_997 202
1245 3300046507 Ga0495606_0336950 Ga0495606_0336950_67_675 202
1246 3300046511 Ga0495608_0014244 Ga0495608_0014244_2300_2908 202
1247 3300046511 Ga0495608_0043738 Ga0495608_0043738_931_1542 202
1248 3300046511 Ga0495608_0219913 Ga0495608_0219913_546_1169 202
1249 3300046513 Ga0495616_0103911 Ga0495616_0103911_689_1300 202
1250 3300046513 Ga0495616_0192138 Ga0495616_0192138_16_624 202
1251 3300046514 Ga0495618_0090739 Ga0495618_0090739_387_995 202
1252 3300046514 Ga0495618_0167354 Ga0495618_0167354_685_1308 202
1253 3300046514 Ga0495618_0489630 Ga0495618_0489630_110_718 202
1254 3300046516 Ga0495628_0031146 Ga0495628_0031146_2740_3348 202
1255 3300046516 Ga0495628_0062492 Ga0495628_0062492_594_1217 202
1256 3300046516 Ga0495628_0062821 Ga0495628_0062821_72_695 202
1257 3300046517 Ga0495630_0086736 Ga0495630_0086736_888_1496 202
1258 3300046520 Ga0495637_0141151 Ga0495637_0141151_282_890 202
1259 3300046523 Ga0495644_0090277 Ga0495644_0090277_311_919 202
1260 3300046524 Ga0495648_0000160 Ga0495648_0000160_62643_63251 202
1261 3300046524 Ga0495648_0087412 Ga0495648_0087412_978_1589 202
1262 3300046524 Ga0495648_0240366 Ga0495648_0240366_134_757 202
1263 3300046524 Ga0495648_0276545 Ga0495648_0276545_135_758 202
1264 3300046526 Ga0495666_0092882 Ga0495666_0092882_765_1373 202
1265 3300046529 Ga0495652_0006710 Ga0495652_0006710_9972_10580 202
1266 3300046529 Ga0495652_0025125 Ga0495652_0025125_523_1146 202
1267 3300046529 Ga0495652_0161489 Ga0495652_0161489_13_639 202
1268 3300046530 Ga0495654_0114097 Ga0495654_0114097_447_1058 202
1269 3300046531 Ga0495665_0023581 Ga0495665_0023581_1716_2339 202
1270 3300046531 Ga0495665_0157072 Ga0495665_0157072_225_833 202
1271 3300046533 Ga0495640_0002380 Ga0495640_0002380_11924_12532 202
1272 3300046533 Ga0495640_0050947 Ga0495640_0050947_1340_1963 202
1273 3300046533 Ga0495640_0061307 Ga0495640_0061307_1016_1624 202
1274 3300046535 Ga0495586_0165054 Ga0495586_0165054_430_1038 202
1275 3300046535 Ga0495586_0316969 Ga0495586_0316969_254_877 202
1276 3300046536 Ga0495587_0001761 Ga0495587_0001761_13239_13847 202
1277 3300046536 Ga0495587_0050231 Ga0495587_0050231_598_1206 202
1278 3300046536 Ga0495587_0428295 Ga0495587_0428295_15_623 202
1279 3300046537 Ga0495598_0019152 Ga0495598_0019152_1141_1749 202
1280 3300046542 Ga0495597_0255275 Ga0495597_0255275_22_633 202
1281 3300046543 Ga0495645_0034702 Ga0495645_0034702_2016_2624 202
1282 3300046543 Ga0495645_0041758 Ga0495645_0041758_2228_2836 202
1283 3300046543 Ga0495645_0427287 Ga0495645_0427287_121_729 202
1284 3300046557 Ga0495622_0009591 Ga0495622_0009591_816_1424 202
1285 3300046557 Ga0495622_0051568 Ga0495622_0051568_519_1127 202
1286 3300046557 Ga0495622_0053225 Ga0495622_0053225_199_807 202
1287 3300046557 Ga0495622_0152231 Ga0495622_0152231_405_1016 202
1288 3300046557 Ga0495622_0164768 Ga0495622_0164768_26_637 202
1289 3300046559 Ga0495667_0017344 Ga0495667_0017344_2880_3503 202
1290 3300046559 Ga0495667_0017845 Ga0495667_0017845_3454_4062 202
1291 3300046559 Ga0495667_0052678 Ga0495667_0052678_1389_1997 202
1292 3300046615 Ga0495656_0007281 Ga0495656_0007281_1114_1722 202
1293 3300046615 Ga0495656_0023685 Ga0495656_0023685_627_1235 202
1294 3300046615 Ga0495656_0044509 Ga0495656_0044509_105_713 202
1295 3300046616 Ga0495668_0040069 Ga0495668_0040069_420_1028 202
1296 3300046616 Ga0495668_0120946 Ga0495668_0120946_137_745 202
1297 3300046642 Ga0495634_0028911 Ga0495634_0028911_2127_2735 202
1298 3300046642 Ga0495634_0065642 Ga0495634_0065642_164_775 202
1299 3300046660 Ga0495625_0067965 Ga0495625_0067965_701_1312 202
1300 3300046660 Ga0495625_0215103 Ga0495625_0215103_520_1128 202
1301 3300046660 Ga0495625_0383243 Ga0495625_0383243_243_851 202
1302 3300046663 Ga0495635_0004122 Ga0495635_0004122_1457_2065 202
1303 3300046663 Ga0495635_0009798 Ga0495635_0009798_3990_4601 202
1304 3300046663 Ga0495635_0318259 Ga0495635_0318259_56_664 202
1305 3300046663 Ga0495635_0422567 Ga0495635_0422567_156_779 202
1306 3300046665 Ga0495661_0268252 Ga0495661_0268252_65_673 202
1307 3300046674 Ga0495588_0022459 Ga0495588_0022459_1403_2011 202
1308 3300046674 Ga0495588_0138774 Ga0495588_0138774_655_1263 202
1309 3300046674 Ga0495588_0161946 Ga0495588_0161946_78_686 202
1310 3300046675 Ga0495657_0010159 Ga0495657_0010159_3923_4546 202
1311 3300046675 Ga0495657_0024479 Ga0495657_0024479_3031_3639 202
1312 3300046675 Ga0495657_0075779 Ga0495657_0075779_1335_1943 202
1313 3300046678 Ga0495599_0019035 Ga0495599_0019035_43_666 202
1314 3300046678 Ga0495599_0045885 Ga0495599_0045885_1000_1608 202
1315 3300046678 Ga0495599_0067560 Ga0495599_0067560_696_1319 202
1316 3300046679 Ga0495623_0027908 Ga0495623_0027908_1389_1997 202
1317 3300046679 Ga0495623_0070485 Ga0495623_0070485_1427_2050 202
1318 3300046680 Ga0495646_0081318 Ga0495646_0081318_538_1146 202
1319 3300046681 Ga0495647_0072848 Ga0495647_0072848_439_1047 202
1320 3300046681 Ga0495647_0321061 Ga0495647_0321061_20_628 202
1321 3300046683 Ga0495658_0019454 Ga0495658_0019454_2626_3249 202
1322 3300046684 Ga0495669_0010576 Ga0495669_0010576_2729_3337 202
1323 3300046684 Ga0495669_0067456 Ga0495669_0067456_423_1031 202
1324 3300046684 Ga0495669_0159761 Ga0495669_0159761_267_875 202
1325 3300046689 Ga0495613_0088328 Ga0495613_0088328_1220_1831 202
1326 3300046689 Ga0495613_0139782 Ga0495613_0139782_307_915 202
1327 3300046690 Ga0495624_0103178 Ga0495624_0103178_276_899 202
1328 3300046690 Ga0495624_0114147 Ga0495624_0114147_201_812 202
1329 3300046690 Ga0495624_0198671 Ga0495624_0198671_303_911 202
1330 3300046691 Ga0495670_0126905 Ga0495670_0126905_532_1140 202
1331 3300046692 Ga0495671_0212219 Ga0495671_0212219_180_803 202
1332 3300046694 Ga0495649_0010963 Ga0495649_0010963_279_890 202
1333 3300046794 Ga0495589_0113172 Ga0495589_0113172_57_665 202
1334 3300046809 Ga0495600_0021127 Ga0495600_0021127_1794_2417 202
1335 3300046809 Ga0495600_0064610 Ga0495600_0064610_762_1373 202
1336 3300046809 Ga0495600_0092483 Ga0495600_0092483_1238_1846 202
1337 3300046809 Ga0495600_0094882 Ga0495600_0094882_609_1217 202
1338 3300046809 Ga0495600_0130415 Ga0495600_0130415_900_1508 202
1339 3300046809 Ga0495600_0216297 Ga0495600_0216297_474_1082 202
1340 3300046810 Ga0495660_0196459 Ga0495660_0196459_175_783 202
1341 3300047315 Ga0495581_0020721 Ga0495581_0020721_612_1223 202
1342 3300047315 Ga0495581_0052270 Ga0495581_0052270_268_876 202
1343 3300047315 Ga0495581_0187593 Ga0495581_0187593_256_864 202
1344 3300047315 Ga0495581_0194330 Ga0495581_0194330_182_790 202
1345 3300047317 Ga0495604_0008901 Ga0495604_0008901_3948_4556 202
1346 3300047317 Ga0495604_0038851 Ga0495604_0038851_1695_2306 202
1347 3300047317 Ga0495604_0240146 Ga0495604_0240146_492_1115 202
1348 3300047318 Ga0495636_0123915 Ga0495636_0123915_246_854 202
1349 3300047319 Ga0495674_0050033 Ga0495674_0050033_2560_3183 202
1350 3300047319 Ga0495674_0152144 Ga0495674_0152144_598_1206 202
1351 3300047319 Ga0495674_0353797 Ga0495674_0353797_448_1059 202
1352 3300047320 Ga0495672_0024038 Ga0495672_0024038_1108_1716 202
1353 3300047320 Ga0495672_0065112 Ga0495672_0065112_1457_2065 202
1354 3300047320 Ga0495672_0082292 Ga0495672_0082292_53_661 202
1355 3300047321 Ga0495676_0039532 Ga0495676_0039532_85_696 202
1356 3300047321 Ga0495676_0126783 Ga0495676_0126783_879_1487 202
1357 3300047321 Ga0495676_0200008 Ga0495676_0200008_415_1023 202
1358 3300047322 Ga0495680_0001163 Ga0495680_0001163_25934_26557 202
1359 3300047322 Ga0495680_0251130 Ga0495680_0251130_519_1127 202
1360 3300047322 Ga0495680_0449552 Ga0495680_0449552_104_712 202
1361 3300047323 Ga0495683_0055378 Ga0495683_0055378_280_891 202
1362 3300047323 Ga0495683_0127368 Ga0495683_0127368_164_772 202
1363 3300047323 Ga0495683_0189377 Ga0495683_0189377_264_872 202
1364 3300047444 Ga0495675_0026164 Ga0495675_0026164_1123_1731 202
1365 3300047444 Ga0495675_0032440 Ga0495675_0032440_2691_3314 202
1366 3300047444 Ga0495675_0051848 Ga0495675_0051848_1238_1846 202
1367 3300047444 Ga0495675_0390170 Ga0495675_0390170_121_729 202
1368 3300047447 Ga0495685_084558 Ga0495685_084558_68_676 202
1369 3300047469 Ga0495673_0080324 Ga0495673_0080324_575_1198 202
1370 3300047469 Ga0495673_0091207 Ga0495673_0091207_258_866 202
1371 3300047469 Ga0495673_0120971 Ga0495673_0120971_282_893 202
1372 3300047470 Ga0495681_0215680 Ga0495681_0215680_75_683 202
1373 3300047471 Ga0495684_0000942 Ga0495684_0000942_22908_23516 202
1374 3300047471 Ga0495684_0017663 Ga0495684_0017663_1387_1995 202
1375 3300047472 Ga0495686_0067551 Ga0495686_0067551_1131_1754 202
1376 3300047472 Ga0495686_0147415 Ga0495686_0147415_503_1114 202
1377 3300047472 Ga0495686_0275891 Ga0495686_0275891_154_762 202
1378 3300047673 Ga0495593_0013019 Ga0495593_0013019_3481_4089 202
1379 3300047673 Ga0495593_0018979 Ga0495593_0018979_1183_1806 202
1380 3300047673 Ga0495593_0268935 Ga0495593_0268935_165_788 202
1381 3300047673 Ga0495593_0383695 Ga0495593_0383695_68_676 202
1382 3300048088 Ga0495602_0021297 Ga0495602_0021297_1198_1806 202
1383 3300048088 Ga0495602_0067114 Ga0495602_0067114_1987_2610 202
1384 3300048088 Ga0495602_0094093 Ga0495602_0094093_632_1240 202
1385 3300048088 Ga0495602_0198154 Ga0495602_0198154_749_1360 202
1386 3300048089 Ga0495614_0034558 Ga0495614_0034558_794_1417 202
1387 3300048090 Ga0495615_0057302 Ga0495615_0057302_86_694 202
1388 3300048903 Ga0496100_0006862 Ga0496100_0006862_5067_5675 202
1389 3300048903 Ga0496100_0030017 Ga0496100_0030017_1567_2175 202
1390 3300048903 Ga0496100_0067081 Ga0496100_0067081_581_1189 202
1391 3300048903 Ga0496100_0193582 Ga0496100_0193582_195_803 202
1392 3300048903 Ga0496100_0551566 Ga0496100_0551566_129_737 202
1393 3300048904 Ga0496101_0019446 Ga0496101_0019446_724_1332 202
1394 3300048904 Ga0496101_0033539 Ga0496101_0033539_2228_2836 202
1395 3300048905 Ga0496102_0001926 Ga0496102_0001926_11666_12274 202
1396 3300048905 Ga0496102_0060654 Ga0496102_0060654_2227_2835 202
1397 3300048905 Ga0496102_0139743 Ga0496102_0139743_475_1083 202
1398 3300048905 Ga0496102_0148795 Ga0496102_0148795_1185_1793 202
1399 3300048906 Ga0496103_0014496 Ga0496103_0014496_915_1523 202
1400 3300048906 Ga0496103_0219533 Ga0496103_0219533_603_1211 202
1401 3300048906 Ga0496103_0222744 Ga0496103_0222744_124_732 202
1402 3300048906 Ga0496103_0246223 Ga0496103_0246223_239_847 202
1403 3300048906 Ga0496103_0408644 Ga0496103_0408644_37_645 202
1404 3300048906 Ga0496103_0489627 Ga0496103_0489627_47_655 202
1405 3300048907 Ga0496104_0020064 Ga0496104_0020064_3364_3972 202
1406 3300048907 Ga0496104_0064265 Ga0496104_0064265_1103_1711 202
1407 3300048907 Ga0496104_0100802 Ga0496104_0100802_1609_2217 202
1408 3300048907 Ga0496104_0137467 Ga0496104_0137467_1484_2095 202
1409 3300048907 Ga0496104_0791599 Ga0496104_0791599_218_826 202
1410 3300048907 Ga0496104_1197137 Ga0496104_1197137_13_621 202
1411 3300048908 Ga0496105_0035128 Ga0496105_0035128_1852_2460 202
1412 3300048908 Ga0496105_0101150 Ga0496105_0101150_1107_1715 202
1413 3300048908 Ga0496105_0288934 Ga0496105_0288934_22_630 202
1414 3300048908 Ga0496105_0327819 Ga0496105_0327819_574_1197 202
1415 3300048908 Ga0496105_0706675 Ga0496105_0706675_60_668 202
1416 3300048909 Ga0496106_0000540 Ga0496106_0000540_4280_4888 202
1417 3300048909 Ga0496106_0034172 Ga0496106_0034172_65_673 202
1418 3300048909 Ga0496106_0036470 Ga0496106_0036470_1111_1719 202
1419 3300048909 Ga0496106_0046945 Ga0496106_0046945_2092_2700 202
1420 3300048909 Ga0496106_0090658 Ga0496106_0090658_529_1137 202
1421 3300048910 Ga0496107_0010385 Ga0496107_0010385_949_1557 202
1422 3300048910 Ga0496107_0041442 Ga0496107_0041442_2603_3211 202
1423 3300048910 Ga0496107_0073122 Ga0496107_0073122_1532_2140 202
1424 3300048910 Ga0496107_0099120 Ga0496107_0099120_1186_1794 202
1425 3300048910 Ga0496107_0452242 Ga0496107_0452242_61_669 202
1426 3300048910 Ga0496107_0486083 Ga0496107_0486083_223_831 202
1427 3300048910 Ga0496107_0530016 Ga0496107_0530016_14_622 202
1428 3300048911 Ga0496108_0024248 Ga0496108_0024248_1501_2109 202
1429 3300048911 Ga0496108_0037119 Ga0496108_0037119_2136_2744 202
1430 3300048911 Ga0496108_0372702 Ga0496108_0372702_160_768 202
1431 3300048911 Ga0496108_0375281 Ga0496108_0375281_544_1152 202
1432 3300048911 Ga0496108_0420830 Ga0496108_0420830_261_869 202
1433 3300048912 Ga0496109_0047773 Ga0496109_0047773_232_840 202
1434 3300048912 Ga0496109_0072134 Ga0496109_0072134_699_1322 202
1435 3300048912 Ga0496109_0084984 Ga0496109_0084984_195_803 202
1436 3300048912 Ga0496109_0276554 Ga0496109_0276554_267_875 202
1437 3300048912 Ga0496109_0480948 Ga0496109_0480948_411_1019 202
1438 3300048912 Ga0496109_0907620 Ga0496109_0907620_25_633 202
1439 3300048913 Ga0496110_0062468 Ga0496110_0062468_2636_3244 202
1440 3300048913 Ga0496110_0108416 Ga0496110_0108416_575_1183 202
1441 3300048913 Ga0496110_0222310 Ga0496110_0222310_88_696 202
1442 3300048913 Ga0496110_0335604 Ga0496110_0335604_495_1103 202
1443 3300048913 Ga0496110_0598562 Ga0496110_0598562_134_742 202
1444 3300048913 Ga0496110_0910499 Ga0496110_0910499_165_776 202
1445 3300048914 Ga0496111_0211286 Ga0496111_0211286_67_675 202
1446 3300048914 Ga0496111_0243776 Ga0496111_0243776_646_1254 202
1447 3300048914 Ga0496111_0280536 Ga0496111_0280536_366_974 202
1448 3300048915 Ga0496112_0000079 Ga0496112_0000079_63409_64017 202
1449 3300048915 Ga0496112_0002172 Ga0496112_0002172_14071_14679 202
1450 3300048915 Ga0496112_0030477 Ga0496112_0030477_2369_2977 202
1451 3300048915 Ga0496112_0033894 Ga0496112_0033894_2280_2888 202
1452 3300048915 Ga0496112_0065781 Ga0496112_0065781_236_844 202
1453 3300048915 Ga0496112_0113520 Ga0496112_0113520_1126_1734 202
1454 3300048915 Ga0496112_0532323 Ga0496112_0532323_50_658 202
1455 3300048915 Ga0496112_0543156 Ga0496112_0543156_102_710 202
1456 3300048915 Ga0496112_0627653 Ga0496112_0627653_176_784 202
1457 3300048916 Ga0496113_0091280 Ga0496113_0091280_1082_1690 202
1458 3300048916 Ga0496113_0096003 Ga0496113_0096003_1409_2017 202
1459 3300048916 Ga0496113_0141941 Ga0496113_0141941_904_1515 202
1460 3300048916 Ga0496113_0353452 Ga0496113_0353452_495_1103 202
1461 3300048916 Ga0496113_0821986 Ga0496113_0821986_109_717 202
1462 3300048917 Ga0496114_0006304 Ga0496114_0006304_5750_6358 202
1463 3300048917 Ga0496114_0040317 Ga0496114_0040317_2245_2856 202
1464 3300048917 Ga0496114_0151995 Ga0496114_0151995_1315_1923 202
1465 3300048917 Ga0496114_0154034 Ga0496114_0154034_1092_1700 202
1466 3300048917 Ga0496114_0253949 Ga0496114_0253949_17_625 202
1467 3300048917 Ga0496114_0313920 Ga0496114_0313920_85_693 202
1468 3300048917 Ga0496114_0941435 Ga0496114_0941435_116_724 202
1469 3300048917 Ga0496114_0968738 Ga0496114_0968738_26_634 202
1470 3300048917 Ga0496114_0996471 Ga0496114_0996471_20_628 202
1471 3300048918 Ga0496115_0001660 Ga0496115_0001660_6250_6858 202
1472 3300048918 Ga0496115_0018998 Ga0496115_0018998_3462_4070 202
1473 3300048918 Ga0496115_0036183 Ga0496115_0036183_2287_2898 202
1474 3300048918 Ga0496115_0081579 Ga0496115_0081579_238_846 202
1475 3300048918 Ga0496115_0085600 Ga0496115_0085600_159_866 202
1476 3300048918 Ga0496115_0103181 Ga0496115_0103181_1323_1931 202
1477 3300048918 Ga0496115_0217968 Ga0496115_0217968_34_642 202
1478 3300048919 Ga0496116_0008457 Ga0496116_0008457_3530_4141 202
1479 3300048919 Ga0496116_0013474 Ga0496116_0013474_3153_3761 202
1480 3300048919 Ga0496116_0208315 Ga0496116_0208315_180_788 202
1481 3300048919 Ga0496116_0301033 Ga0496116_0301033_73_681 202
1482 3300048920 Ga0496117_0042403 Ga0496117_0042403_341_949 202
1483 3300048920 Ga0496117_0064814 Ga0496117_0064814_1423_2031 202
1484 3300048920 Ga0496117_0065415 Ga0496117_0065415_1801_2418 202
1485 3300048921 Ga0496118_0014293 Ga0496118_0014293_6333_6941 202
1486 3300048921 Ga0496118_0046314 Ga0496118_0046314_669_1277 202
1487 3300048921 Ga0496118_0054074 Ga0496118_0054074_968_1576 202
1488 3300048921 Ga0496118_0085058 Ga0496118_0085058_1482_2093 202
1489 3300048921 Ga0496118_0093097 Ga0496118_0093097_1018_1626 202
1490 3300048921 Ga0496118_0157644 Ga0496118_0157644_772_1398 202
1491 3300048921 Ga0496118_0245060 Ga0496118_0245060_65_673 202
1492 3300048921 Ga0496118_0383565 Ga0496118_0383565_116_724 202
1493 3300048921 Ga0496118_0449724 Ga0496118_0449724_36_644 202
1494 3300048922 Ga0496119_0010284 Ga0496119_0010284_4300_4911 202
1495 3300048922 Ga0496119_0076545 Ga0496119_0076545_99_722 202
1496 3300048922 Ga0496119_0148565 Ga0496119_0148565_528_1136 202
1497 3300048922 Ga0496119_0173111 Ga0496119_0173111_79_687 202
1498 3300048922 Ga0496119_0291313 Ga0496119_0291313_121_729 202
1499 3300048923 Ga0496120_0010513 Ga0496120_0010513_3370_3981 202
1500 3300048924 Ga0496121_0000456 Ga0496121_0000456_19918_20526 202
1501 3300048924 Ga0496121_0000495 Ga0496121_0000495_54001_54609 202
1502 3300048924 Ga0496121_0009589 Ga0496121_0009589_1356_1964 202
1503 3300048924 Ga0496121_0015647 Ga0496121_0015647_5698_6306 202
1504 3300048924 Ga0496121_0051494 Ga0496121_0051494_1573_2181 202
1505 3300048924 Ga0496121_0092235 Ga0496121_0092235_246_854 202
1506 3300048924 Ga0496121_0116831 Ga0496121_0116831_1167_1775 202
1507 3300048924 Ga0496121_0181720 Ga0496121_0181720_510_1121 202
1508 3300048924 Ga0496121_0202572 Ga0496121_0202572_227_835 202
1509 3300048924 Ga0496121_0343105 Ga0496121_0343105_65_673 202
1510 3300048924 Ga0496121_0387285 Ga0496121_0387285_177_830 202
1511 3300048925 Ga0496122_0029991 Ga0496122_0029991_1567_2178 202
1512 3300048925 Ga0496122_0031920 Ga0496122_0031920_1183_1791 202
1513 3300048925 Ga0496122_0211868 Ga0496122_0211868_148_759 202
1514 3300048927 Ga0496124_0001010 Ga0496124_0001010_15608_16216 202
1515 3300048927 Ga0496124_0036927 Ga0496124_0036927_2640_3248 202
1516 3300048927 Ga0496124_0059856 Ga0496124_0059856_1365_1973 202
1517 3300048927 Ga0496124_0215043 Ga0496124_0215043_743_1354 202
1518 3300048928 Ga0496125_0000756 Ga0496125_0000756_14294_14902 202
1519 3300048928 Ga0496125_0004034 Ga0496125_0004034_5525_6133 202
1520 3300048928 Ga0496125_0006620 Ga0496125_0006620_9777_10388 202
1521 3300048928 Ga0496125_0038020 Ga0496125_0038020_2069_2677 202
1522 3300048928 Ga0496125_0042591 Ga0496125_0042591_82_705 202
1523 3300048928 Ga0496125_0073181 Ga0496125_0073181_679_1287 202
1524 3300048928 Ga0496125_0104432 Ga0496125_0104432_238_864 202
1525 3300048928 Ga0496125_0112928 Ga0496125_0112928_738_1346 202
1526 3300048928 Ga0496125_0235786 Ga0496125_0235786_396_1004 202
1527 3300048928 Ga0496125_0262857 Ga0496125_0262857_71_682 202
1528 3300048929 Ga0496126_0002797 Ga0496126_0002797_9409_10017 202
1529 3300048929 Ga0496126_0015157 Ga0496126_0015157_65_673 202
1530 3300048929 Ga0496126_0027082 Ga0496126_0027082_652_1260 202
1531 3300048929 Ga0496126_0048536 Ga0496126_0048536_1674_2282 202
1532 3300048929 Ga0496126_0065928 Ga0496126_0065928_376_984 202
1533 3300048929 Ga0496126_0068643 Ga0496126_0068643_2193_2801 202
1534 3300048929 Ga0496126_0087978 Ga0496126_0087978_1782_2393 202
1535 3300048929 Ga0496126_0093838 Ga0496126_0093838_1877_2485 202
1536 3300048929 Ga0496126_0095321 Ga0496126_0095321_688_1296 202
1537 3300048929 Ga0496126_0137681 Ga0496126_0137681_1342_1950 202
1538 3300048929 Ga0496126_0214560 Ga0496126_0214560_971_1579 202
1539 3300048929 Ga0496126_0237224 Ga0496126_0237224_31_639 202
1540 3300048929 Ga0496126_0245084 Ga0496126_0245084_388_996 202
1541 3300048929 Ga0496126_0267588 Ga0496126_0267588_117_725 202
1542 3300048929 Ga0496126_0277742 Ga0496126_0277742_50_658 202
1543 3300048929 Ga0496126_0401194 Ga0496126_0401194_366_974 202
1544 3300048929 Ga0496126_0456779 Ga0496126_0456779_192_800 202
1545 3300048929 Ga0496126_0482999 Ga0496126_0482999_193_804 202
1546 3300048929 Ga0496126_0558388 Ga0496126_0558388_235_843 202
1547 3300049460 Ga0495682_0127049 Ga0495682_0127049_100_711 202
1548 3300049569 Ga0501032_0000087 Ga0501032_0000087_54774_55382 202
1549 3300049569 Ga0501032_0010672 Ga0501032_0010672_2452_3060 202
1550 3300049569 Ga0501032_0055989 Ga0501032_0055989_759_1367 202
1551 3300049570 Ga0501033_0000181 Ga0501033_0000181_29816_30424 202
1552 3300049570 Ga0501033_0034556 Ga0501033_0034556_622_1230 202
1553 3300049570 Ga0501033_0049110 Ga0501033_0049110_633_1241 202
1554 3300049570 Ga0501033_0065114 Ga0501033_0065114_1981_2589 202
1555 3300049571 Ga0501034_0000021 Ga0501034_0000021_192379_192987 202
1556 3300049571 Ga0501034_0037311 Ga0501034_0037311_3096_3704 202
1557 3300049572 Ga0501036_0000069 Ga0501036_0000069_54202_54810 202
1558 3300049572 Ga0501036_0016792 Ga0501036_0016792_4756_5364 202
1559 3300049572 Ga0501036_0156882 Ga0501036_0156882_1045_1653 202
1560 3300049572 Ga0501036_0876661 Ga0501036_0876661_29_640 202
1561 3300049573 Ga0501037_0000495 Ga0501037_0000495_7974_8582 202
1562 3300049573 Ga0501037_0274837 Ga0501037_0274837_477_1085 202
1563 3300049573 Ga0501037_0526896 Ga0501037_0526896_181_789 202
1564 3300049574 Ga0501038_0000213 Ga0501038_0000213_41987_42595 202
1565 3300049574 Ga0501038_0072164 Ga0501038_0072164_1108_1716 202
1566 3300049574 Ga0501038_0462939 Ga0501038_0462939_174_782 202
1567 3300049575 Ga0501039_0000179 Ga0501039_0000179_37359_37967 202
1568 3300049575 Ga0501039_0256428 Ga0501039_0256428_411_1019 202
1569 3300049578 Ga0501042_0084778 Ga0501042_0084778_1384_1992 202
1570 3300049579 Ga0501043_0000033 Ga0501043_0000033_111502_112110 202
1571 3300049579 Ga0501043_0013892 Ga0501043_0013892_4913_5521 202
1572 3300049579 Ga0501043_0025162 Ga0501043_0025162_2844_3452 202
1573 3300049580 Ga0501046_0000412 Ga0501046_0000412_26328_26936 202
1574 3300049580 Ga0501046_0294958 Ga0501046_0294958_116_727 202
1575 3300049580 Ga0501046_0586252 Ga0501046_0586252_121_729 202
1576 3300049581 Ga0501047_0000434 Ga0501047_0000434_32521_33129 202
1577 3300049581 Ga0501047_0008542 Ga0501047_0008542_2804_3412 202
1578 3300049581 Ga0501047_0062036 Ga0501047_0062036_1835_2443 202
1579 3300049581 Ga0501047_0071390 Ga0501047_0071390_86_694 202
1580 3300049581 Ga0501047_0082155 Ga0501047_0082155_827_1438 202
1581 3300049581 Ga0501047_0919688 Ga0501047_0919688_60_668 202
1582 3300049582 Ga0501048_0000290 Ga0501048_0000290_23696_24304 202
1583 3300049582 Ga0501048_0174646 Ga0501048_0174646_844_1452 202
1584 3300049583 Ga0501067_0000067 Ga0501067_0000067_25380_25988 202
1585 3300049583 Ga0501067_0126029 Ga0501067_0126029_223_831 202
1586 3300049583 Ga0501067_0138328 Ga0501067_0138328_725_1333 202
1587 3300049584 Ga0501068_0013955 Ga0501068_0013955_2882_3490 202
1588 3300049585 Ga0501069_0000881 Ga0501069_0000881_5767_6375 202
1589 3300049585 Ga0501069_0364810 Ga0501069_0364810_105_713 202
1590 3300049585 Ga0501069_0431827 Ga0501069_0431827_108_716 202
1591 3300049586 Ga0501070_0022361 Ga0501070_0022361_3172_3780 202
1592 3300049586 Ga0501070_0027930 Ga0501070_0027930_219_830 202
1593 3300049586 Ga0501070_0029702 Ga0501070_0029702_754_1362 202
1594 3300049586 Ga0501070_0210106 Ga0501070_0210106_581_1189 202
1595 3300049587 Ga0501071_0319655 Ga0501071_0319655_424_1032 202
1596 3300049588 Ga0501072_0000515 Ga0501072_0000515_19235_19843 202
1597 3300049589 Ga0501073_0000144 Ga0501073_0000144_1582_2190 202
1598 3300049589 Ga0501073_0024963 Ga0501073_0024963_1647_2258 202
1599 3300049590 Ga0501074_0001865 Ga0501074_0001865_8264_8872 202
1600 3300049590 Ga0501074_0146378 Ga0501074_0146378_317_928 202
1601 3300049592 Ga0501076_0172129 Ga0501076_0172129_1001_1609 202
1602 3300049741 Ga0501079_0002688 Ga0501079_0002688_6610_7218 202
1603 3300049742 Ga0501080_0038126 Ga0501080_0038126_1088_1699 202
1604 3300049742 Ga0501080_0064726 Ga0501080_0064726_1052_1660 202
1605 3300049744 Ga0501083_0000192 Ga0501083_0000192_31022_31630 202
1606 3300049822 Ga0501035_0000323 Ga0501035_0000323_30980_31588 202
1607 3300049822 Ga0501035_0016979 Ga0501035_0016979_4811_5419 202
1608 3300049822 Ga0501035_0035821 Ga0501035_0035821_2188_2796 202
1609 3300049823 Ga0501044_0000181 Ga0501044_0000181_43948_44556 202
1610 3300049823 Ga0501044_0024928 Ga0501044_0024928_3204_3815 202
1611 3300049823 Ga0501044_0035861 Ga0501044_0035861_3237_3845 202
1612 3300050489 nmdc:mga03683_81382_c1 nmdc:mga03683_81382_c1_423_1031 202
1613 3300050490 nmdc:mga03n38_122309_c1 nmdc:mga03n38_122309_c1_596_1204 202
1614 3300050491 nmdc:mga00v17_128961_c1 nmdc:mga00v17_128961_c1_407_1030 202
1615 3300050491 nmdc:mga00v17_27050_c1 nmdc:mga00v17_27050_c1_1328_1936 202
1616 3300050491 nmdc:mga00v17_314761_c1 nmdc:mga00v17_314761_c1_346_954 202
1617 3300050491 nmdc:mga00v17_81779_c2 nmdc:mga00v17_81779_c2_148_756 202
1618 3300050492 nmdc:mga0yw44_10077_c1 nmdc:mga0yw44_10077_c1_716_1324 202
1619 3300050492 nmdc:mga0yw44_104673_c1 nmdc:mga0yw44_104673_c1_522_1145 202
1620 3300050492 nmdc:mga0yw44_2399_c1 nmdc:mga0yw44_2399_c1_5723_6331 202
1621 3300050492 nmdc:mga0yw44_5976_c1 nmdc:mga0yw44_5976_c1_2341_2964 202
1622 3300050492 nmdc:mga0yw44_60640_c1 nmdc:mga0yw44_60640_c1_1077_1685 202
1623 3300050492 nmdc:mga0yw44_64408_c1 nmdc:mga0yw44_64408_c1_751_1359 202
1624 3300050493 nmdc:mga0k408_114975_c1 nmdc:mga0k408_114975_c1_790_1398 202
1625 3300050493 nmdc:mga0k408_143534_c1 nmdc:mga0k408_143534_c1_139_747 202
1626 3300050493 nmdc:mga0k408_237458_c1 nmdc:mga0k408_237458_c1_209_817 202
1627 3300050494 nmdc:mga06z11_53261_c1 nmdc:mga06z11_53261_c1_79_687 202
1628 3300050494 nmdc:mga06z11_59373_c1 nmdc:mga06z11_59373_c1_1169_1777 202
1629 3300050495 nmdc:mga04h51_193241_c1 nmdc:mga04h51_193241_c1_83_691 202
1630 3300050495 nmdc:mga04h51_24653_c1 nmdc:mga04h51_24653_c1_1032_1640 202
1631 3300050496 nmdc:mga07m45_41318_c1 nmdc:mga07m45_41318_c1_626_1234 202
1632 3300050496 nmdc:mga07m45_457544_c1 nmdc:mga07m45_457544_c1_53_676 202
1633 3300050496 nmdc:mga07m45_52157_c1 nmdc:mga07m45_52157_c1_510_1118 202
1634 3300050507 nmdc:mga05p37_124774_c1 nmdc:mga05p37_124774_c1_1776_2384 202
1635 3300050510 nmdc:mga06r32_487432_c1 nmdc:mga06r32_487432_c1_295_903 202
1636 3300050511 nmdc:mga08y16_1145489_c1 nmdc:mga08y16_1145489_c1_56_664 202
1637 3300050511 nmdc:mga08y16_553336_c1 nmdc:mga08y16_553336_c1_74_682 202
1638 3300050512 nmdc:mga0n895_498138_c1 nmdc:mga0n895_498138_c1_593_1201 202
1639 3300050512 nmdc:mga0n895_59739_c1 nmdc:mga0n895_59739_c1_1458_2066 202
1640 3300050513 nmdc:mga0rr50_46931_c1 nmdc:mga0rr50_46931_c1_1381_1989 202
1641 3300050516 nmdc:mga0sz30_186597_c1 nmdc:mga0sz30_186597_c1_209_817 202
1642 3300050516 nmdc:mga0sz30_32650_c1 nmdc:mga0sz30_32650_c1_886_1509 202
1643 3300050516 nmdc:mga0sz30_70903_c1 nmdc:mga0sz30_70903_c1_773_1399 202
1644 3300053077 Ga0495601_0047178 Ga0495601_0047178_1134_1742 202
1645 3300053077 Ga0495601_0088907 Ga0495601_0088907_783_1406 202
1646 3300053077 Ga0495601_0135041 Ga0495601_0135041_29_637 202
1647 3300053077 Ga0495601_0174912 Ga0495601_0174912_39_647 202
1648 3300053077 Ga0495601_0201795 Ga0495601_0201795_609_1217 202
1649 3300053077 Ga0495601_0469424 Ga0495601_0469424_18_626 202
1650 3300053078 Ga0495612_0014050 Ga0495612_0014050_1033_1641 202
1651 3300053079 Ga0500610_0032201 Ga0500610_0032201_974_1585 202
1652 3300053080 Ga0500635_0058429 Ga0500635_0058429_115_747 202
1653 3300053083 Ga0495655_0169856 Ga0495655_0169856_15_626 202
1654 3300053084 Ga0495595_0007593 Ga0495595_0007593_322_930 202
1655 3300053084 Ga0495595_0025490 Ga0495595_0025490_1639_2247 202
1656 3300053084 Ga0495595_0095194 Ga0495595_0095194_219_827 202
1657 3300053085 Ga0495619_0001717 Ga0495619_0001717_10461_11069 202
1658 3300053085 Ga0495619_0009953 Ga0495619_0009953_4492_5100 202
1659 3300053085 Ga0495619_0088328 Ga0495619_0088328_685_1293 202
1660 3300053085 Ga0495619_0160289 Ga0495619_0160289_849_1457 202
1661 3300053085 Ga0495619_0296567 Ga0495619_0296567_346_957 202
1662 3300053086 Ga0500578_0236728 Ga0500578_0236728_77_688 202
1663 3300053086 Ga0500578_0264321 Ga0500578_0264321_193_801 202
1664 3300053086 Ga0500578_0282221 Ga0500578_0282221_52_675 202
1665 3300053086 Ga0500578_0335867 Ga0500578_0335867_127_738 202
1666 3300053088 Ga0500644_0098389 Ga0500644_0098389_295_906 202
1667 3300053090 Ga0500646_0100135 Ga0500646_0100135_182_790 202
1668 3300053093 Ga0500651_0003265 Ga0500651_0003265_1628_2236 202
1669 3300053093 Ga0500651_0070720 Ga0500651_0070720_911_1522 202
1670 3300053094 Ga0500566_0001145 Ga0500566_0001145_5225_5833 202
1671 3300053094 Ga0500566_0003188 Ga0500566_0003188_6624_7235 202
1672 3300053094 Ga0500566_0009562 Ga0500566_0009562_4143_4751 202
1673 3300053094 Ga0500566_0119576 Ga0500566_0119576_285_893 202
1674 3300053094 Ga0500566_0378062 Ga0500566_0378062_18_626 202
1675 3300053095 Ga0500640_000608 Ga0500640_000608_3235_3843 202
1676 3300053096 Ga0500641_0002048 Ga0500641_0002048_3690_4298 202
1677 3300053096 Ga0500641_0034580 Ga0500641_0034580_77_685 202
1678 3300053096 Ga0500641_0205815 Ga0500641_0205815_195_803 202
1679 3300053097 Ga0500648_067107 Ga0500648_067107_96_704 202
1680 3300053098 Ga0500650_0113435 Ga0500650_0113435_492_1100 202
1681 3300053102 Ga0500554_040844 Ga0500554_040844_781_1404 202
1682 3300053102 Ga0500554_042612 Ga0500554_042612_524_1132 202
1683 3300053108 Ga0500562_002772 Ga0500562_002772_1969_2592 202
1684 3300053111 Ga0500572_001706 Ga0500572_001706_1808_2416 202
1685 3300053115 Ga0500591_107444 Ga0500591_107444_244_852 202
1686 3300053118 Ga0500594_0037346 Ga0500594_0037346_350_958 202
1687 3300053119 Ga0500595_000659 Ga0500595_000659_3587_4195 202
1688 3300053119 Ga0500595_001827 Ga0500595_001827_4060_4668 202
1689 3300053119 Ga0500595_003263 Ga0500595_003263_3943_4551 202
1690 3300053119 Ga0500595_003336 Ga0500595_003336_2687_3295 202
1691 3300053119 Ga0500595_003366 Ga0500595_003366_6833_7441 202
1692 3300053119 Ga0500595_015590 Ga0500595_015590_1380_1991 202
1693 3300053119 Ga0500595_024767 Ga0500595_024767_827_1435 202
1694 3300053119 Ga0500595_025947 Ga0500595_025947_909_1517 202
1695 3300053122 Ga0500608_031005 Ga0500608_031005_307_915 202
1696 3300053122 Ga0500608_060325 Ga0500608_060325_495_1106 202
1697 3300053123 Ga0500614_003114 Ga0500614_003114_1749_2357 202
1698 3300053130 Ga0500642_0142689 Ga0500642_0142689_374_982 202
1699 3300053133 Ga0500655_009798 Ga0500655_009798_1087_1698 202
1700 3300053136 Ga0500559_0000850 Ga0500559_0000850_17917_18528 202
1701 3300053136 Ga0500559_0005859 Ga0500559_0005859_4428_5036 202
1702 3300053136 Ga0500559_0022200 Ga0500559_0022200_315_926 202
1703 3300053138 Ga0500564_156748 Ga0500564_156748_83_694 202
1704 3300053139 Ga0500568_0071594 Ga0500568_0071594_343_951 202
1705 3300053139 Ga0500568_0085520 Ga0500568_0085520_531_1139 202
1706 3300053142 Ga0500577_0001615 Ga0500577_0001615_2719_3330 202
1707 3300053146 Ga0500588_0021920 Ga0500588_0021920_208_816 202
1708 3300053146 Ga0500588_0257947 Ga0500588_0257947_36_644 202
1709 3300053148 Ga0500590_061269 Ga0500590_061269_457_1068 202
1710 3300053148 Ga0500590_088806 Ga0500590_088806_103_711 202
1711 3300053150 Ga0500603_151280 Ga0500603_151280_87_695 202
1712 3300053153 Ga0500616_0000139 Ga0500616_0000139_23656_24264 202
1713 3300053155 Ga0500620_136204 Ga0500620_136204_157_765 202
1714 3300053156 Ga0500622_0004010 Ga0500622_0004010_2173_2784 202
1715 3300053161 Ga0500634_0043922 Ga0500634_0043922_1786_2397 202
1716 3300053162 Ga0500638_004624 Ga0500638_004624_3398_4006 202
1717 3300053162 Ga0500638_031941 Ga0500638_031941_577_1185 202
1718 3300053162 Ga0500638_109952 Ga0500638_109952_582_1190 202
1719 3300053163 Ga0500639_000004 Ga0500639_000004_210840_211448 202
1720 3300053163 Ga0500639_063822 Ga0500639_063822_1094_1726 202
1721 3300053177 Ga0500636_0006547 Ga0500636_0006547_3656_4264 202
1722 3300053177 Ga0500636_0129063 Ga0500636_0129063_673_1284 202
1723 3300053177 Ga0500636_0153438 Ga0500636_0153438_289_897 202
1724 3300053177 Ga0500636_0166198 Ga0500636_0166198_230_838 202
1725 3300053178 Ga0500637_0000766 Ga0500637_0000766_7535_8143 202
1726 3300053178 Ga0500637_0109979 Ga0500637_0109979_932_1564 202
1727 3300053727 Ga0500611_100619 Ga0500611_100619_38_646 202
1728 3300053730 Ga0500645_024198 Ga0500645_024198_599_1207 202
1729 3300053731 Ga0500609_002539 Ga0500609_002539_837_1448 202
1730 3300053731 Ga0500609_032520 Ga0500609_032520_51_659 202
1731 3300053735 Ga0500596_006374 Ga0500596_006374_1088_1696 202
1732 3300053735 Ga0500596_032856 Ga0500596_032856_147_755 202
1733 3300053736 Ga0500599_000240 Ga0500599_000240_347_970 202
1734 3300053737 Ga0500601_002035 Ga0500601_002035_1418_2026 202
1735 3300053737 Ga0500601_011442 Ga0500601_011442_373_981 202
1736 3300054114 Ga0501084_0000303 Ga0501084_0000303_8073_8681 202
1737 3300055283 Ga0500661_000388 Ga0500661_000388_3393_4001 202
1738 3300060353 Ga0501082_0005482 Ga0501082_0005482_7385_7993 202
1739 3300060353 Ga0501082_0415729 Ga0501082_0415729_94_702 202
1740 3300060353 Ga0501082_0949045 Ga0501082_0949045_66_674 202
1741 iso_pu_bacteria 2906635258 2906640891 202
1742 iso_pu_bacteria 2906660503 2906667870 202
1743 iso_pu_bacteria 2935630451 2935634113 202
1744 iso_pu_bacteria 2941507105 2941511004 202
1745 iso_pu_bacteria 2941515067 2941518388 202
1746 iso_pu_bacteria 2941523033 2941527349 202
1747 3300005455 Ga0070663_100213722 Ga0070663_1002137221 203
1748 3300005614 Ga0068856_101152857 Ga0068856_1011528571 203
1749 3300007265 Ga0099794_10019131 Ga0099794_100191312 203
1750 3300009545 Ga0105237_10618201 Ga0105237_106182012 203
1751 3300009551 Ga0105238_10321515 Ga0105238_103215152 203
1752 3300010159 Ga0099796_10004735 Ga0099796_100047352 203
1753 3300013296 Ga0157374_11175257 Ga0157374_111752572 203
1754 3300014968 Ga0157379_10327866 Ga0157379_103278662 203
1755 3300025904 Ga0207647_10390199 Ga0207647_103901991 203
1756 3300025914 Ga0207671_10434810 Ga0207671_104348102 203
1757 3300025924 Ga0207694_10329132 Ga0207694_103291321 203
1758 3300025928 Ga0207700_10439216 Ga0207700_104392162 203
1759 3300025986 Ga0207658_10850175 Ga0207658_108501751 203
1760 3300026078 Ga0207702_10786227 Ga0207702_107862271 203
1761 3300027671 Ga0209588_1029962 Ga0209588_10299622 203
1762 3300028379 Ga0268266_10895323 Ga0268266_108953232 203
1763 3300033180 Ga0307510_10064843 Ga0307510_100648432 203
1764 3300035089 Ga0373944_0027389 Ga0373944_0027389_95_706 203
1765 3300035111 Ga0373923_0017798 Ga0373923_0017798_1128_1739 203
1766 3300035113 Ga0373936_0010808 Ga0373936_0010808_750_1361 203
1767 3300035118 Ga0373954_0039643 Ga0373954_0039643_555_1166 203
1768 3300035170 Ga0373943_0006623 Ga0373943_0006623_4189_4800 203
1769 3300035692 Ga0373935_0000146 Ga0373935_0000146_6758_7369 203
1770 3300035695 Ga0373927_0000069 Ga0373927_0000069_12360_12971 203
1771 3300035725 Ga0373947_0003617 Ga0373947_0003617_4020_4631 203
1772 3300036401 Ga0373937_0131845 Ga0373937_0131845_37_648 203
1773 3300037068 Ga0373925_0003396 Ga0373925_0003396_9788_10399 203
1774 3300037068 Ga0373925_0278150 Ga0373925_0278150_260_871 203
1775 3300037471 Ga0395905_0016873 Ga0395905_0016873_5037_5663 203
1776 3300037853 Ga0436364_0372345 Ga0436364_0372345_2323_2934 203
1777 3300037853 Ga0436364_0968132 Ga0436364_0968132_58_669 203
1778 3300039437 Ga0436365_0324877 Ga0436365_0324877_939_1559 203
1779 3300039437 Ga0436365_0811160 Ga0436365_0811160_960_1571 203
1780 3300039437 Ga0436365_1028631 Ga0436365_1028631_2562_3173 203
1781 3300039447 Ga0436361_0421378 Ga0436361_0421378_569_1180 203
1782 3300039450 Ga0436363_0529094 Ga0436363_0529094_1624_2235 203
1783 3300044694 Ga0466963_0026671 Ga0466963_0026671_2173_2787 203
1784 3300046455 Ga0495603_0001909 Ga0495603_0001909_11652_12263 203
1785 3300046459 Ga0495629_0000083 Ga0495629_0000083_21296_21907 203
1786 3300046460 Ga0495638_0033022 Ga0495638_0033022_2537_3151 203
1787 3300046460 Ga0495638_0127253 Ga0495638_0127253_14_628 203
1788 3300046460 Ga0495638_0140928 Ga0495638_0140928_780_1394 203
1789 3300046472 Ga0495580_0001769 Ga0495580_0001769_5522_6133 203
1790 3300046473 Ga0495582_0000206 Ga0495582_0000206_7441_8052 203
1791 3300046475 Ga0495639_0000167 Ga0495639_0000167_11854_12465 203
1792 3300046476 Ga0495662_0001226 Ga0495662_0001226_9052_9663 203
1793 3300046476 Ga0495662_0209044 Ga0495662_0209044_298_909 203
1794 3300046477 Ga0495664_0028540 Ga0495664_0028540_2513_3124 203
1795 3300046477 Ga0495664_0233359 Ga0495664_0233359_432_1043 203
1796 3300046499 Ga0495594_0019970 Ga0495594_0019970_2838_3449 203
1797 3300046501 Ga0495607_0066347 Ga0495607_0066347_355_969 203
1798 3300046507 Ga0495606_0091259 Ga0495606_0091259_1069_1683 203
1799 3300046511 Ga0495608_0079609 Ga0495608_0079609_897_1508 203
1800 3300046512 Ga0495610_0150542 Ga0495610_0150542_298_912 203
1801 3300046514 Ga0495618_0025681 Ga0495618_0025681_2995_3606 203
1802 3300046515 Ga0495620_0043544 Ga0495620_0043544_12_626 203
1803 3300046516 Ga0495628_0014653 Ga0495628_0014653_5750_6361 203
1804 3300046517 Ga0495630_0013263 Ga0495630_0013263_3714_4325 203
1805 3300046520 Ga0495637_0113703 Ga0495637_0113703_68_682 203
1806 3300046522 Ga0495643_0028445 Ga0495643_0028445_1190_1804 203
1807 3300046526 Ga0495666_0009182 Ga0495666_0009182_4135_4746 203
1808 3300046531 Ga0495665_0000399 Ga0495665_0000399_157_768 203
1809 3300046533 Ga0495640_0028028 Ga0495640_0028028_215_826 203
1810 3300046535 Ga0495586_0077715 Ga0495586_0077715_1113_1724 203
1811 3300046542 Ga0495597_0119787 Ga0495597_0119787_346_960 203
1812 3300046557 Ga0495622_0031815 Ga0495622_0031815_865_1476 203
1813 3300046559 Ga0495667_0019890 Ga0495667_0019890_1928_2539 203
1814 3300046559 Ga0495667_0058587 Ga0495667_0058587_107_718 203
1815 3300046642 Ga0495634_0001116 Ga0495634_0001116_12099_12710 203
1816 3300046642 Ga0495634_0061319 Ga0495634_0061319_1486_2097 203
1817 3300046660 Ga0495625_0096654 Ga0495625_0096654_993_1607 203
1818 3300046663 Ga0495635_0072250 Ga0495635_0072250_168_779 203
1819 3300046665 Ga0495661_0239166 Ga0495661_0239166_252_866 203
1820 3300046674 Ga0495588_0015755 Ga0495588_0015755_2853_3464 203
1821 3300046680 Ga0495646_0041026 Ga0495646_0041026_1973_2584 203
1822 3300046681 Ga0495647_0006697 Ga0495647_0006697_70_681 203
1823 3300046683 Ga0495658_0002678 Ga0495658_0002678_5274_5885 203
1824 3300046689 Ga0495613_0005847 Ga0495613_0005847_2652_3263 203
1825 3300046689 Ga0495613_0075641 Ga0495613_0075641_1627_2238 203
1826 3300046690 Ga0495624_0000096 Ga0495624_0000096_37076_37687 203
1827 3300046691 Ga0495670_0005402 Ga0495670_0005402_3125_3739 203
1828 3300047315 Ga0495581_0000311 Ga0495581_0000311_14861_15472 203
1829 3300047317 Ga0495604_0260149 Ga0495604_0260149_297_908 203
1830 3300047319 Ga0495674_0058805 Ga0495674_0058805_757_1368 203
1831 3300047319 Ga0495674_0065294 Ga0495674_0065294_1244_1855 203
1832 3300047321 Ga0495676_0089239 Ga0495676_0089239_1672_2283 203
1833 3300047322 Ga0495680_0035984 Ga0495680_0035984_1956_2567 203
1834 3300047322 Ga0495680_0327252 Ga0495680_0327252_68_679 203
1835 3300047469 Ga0495673_0026040 Ga0495673_0026040_1384_1995 203
1836 3300047471 Ga0495684_0058325 Ga0495684_0058325_2183_2794 203
1837 3300047673 Ga0495593_0000071 Ga0495593_0000071_12251_12862 203
1838 3300048089 Ga0495614_0008727 Ga0495614_0008727_202_813 203
1839 3300048904 Ga0496101_0210252 Ga0496101_0210252_637_1248 203
1840 3300048907 Ga0496104_0415737 Ga0496104_0415737_122_733 203
1841 3300048909 Ga0496106_0104600 Ga0496106_0104600_55_666 203
1842 3300048912 Ga0496109_0131657 Ga0496109_0131657_503_1114 203
1843 3300048913 Ga0496110_0764082 Ga0496110_0764082_116_727 203
1844 3300048915 Ga0496112_0033389 Ga0496112_0033389_3033_3644 203
1845 3300048915 Ga0496112_0400071 Ga0496112_0400071_529_1140 203
1846 3300048917 Ga0496114_0214888 Ga0496114_0214888_720_1331 203
1847 3300048921 Ga0496118_0068550 Ga0496118_0068550_301_915 203
1848 3300048922 Ga0496119_0040732 Ga0496119_0040732_2241_2855 203
1849 3300048924 Ga0496121_0015286 Ga0496121_0015286_7374_7985 203
1850 3300048924 Ga0496121_0043716 Ga0496121_0043716_737_1351 203
1851 3300048924 Ga0496121_0458639 Ga0496121_0458639_37_651 203
1852 3300048929 Ga0496126_0008043 Ga0496126_0008043_5035_5646 203
1853 3300048929 Ga0496126_0051250 Ga0496126_0051250_114_728 203
1854 3300048929 Ga0496126_0064624 Ga0496126_0064624_614_1228 203
1855 3300048929 Ga0496126_0168852 Ga0496126_0168852_134_748 203
1856 3300048929 Ga0496126_0370328 Ga0496126_0370328_196_822 203
1857 3300050492 nmdc:mga0yw44_6626_c2 nmdc:mga0yw44_6626_c2_1415_2029 203
1858 3300053077 Ga0495601_0000703 Ga0495601_0000703_17027_17638 203
1859 3300053080 Ga0500635_0003137 Ga0500635_0003137_1150_1761 203
1860 3300053088 Ga0500644_0039104 Ga0500644_0039104_232_846 203
1861 3300053093 Ga0500651_0078441 Ga0500651_0078441_92_706 203
1862 3300053093 Ga0500651_0290623 Ga0500651_0290623_252_866 203
1863 3300053094 Ga0500566_0000406 Ga0500566_0000406_1503_2129 203
1864 3300053096 Ga0500641_0027801 Ga0500641_0027801_276_890 203
1865 3300053098 Ga0500650_0000714 Ga0500650_0000714_5629_6243 203
1866 3300053104 Ga0500556_0000030 Ga0500556_0000030_22614_23228 203
1867 3300053104 Ga0500556_0187565 Ga0500556_0187565_80_691 203
1868 3300053109 Ga0500569_009762 Ga0500569_009762_817_1431 203
1869 3300053116 Ga0500592_008131 Ga0500592_008131_997_1611 203
1870 3300053118 Ga0500594_0031374 Ga0500594_0031374_559_1173 203
1871 3300053121 Ga0500607_056328 Ga0500607_056328_1215_1826 203
1872 3300053130 Ga0500642_0000514 Ga0500642_0000514_5113_5727 203
1873 3300053131 Ga0500652_000786 Ga0500652_000786_8630_9244 203
1874 3300053139 Ga0500568_0001244 Ga0500568_0001244_13978_14592 203
1875 3300053145 Ga0500586_000987 Ga0500586_000987_1905_2516 203
1876 3300053150 Ga0500603_001799 Ga0500603_001799_4150_4761 203
1877 3300053151 Ga0500604_0010382 Ga0500604_0010382_1005_1619 203
1878 3300053153 Ga0500616_0000252 Ga0500616_0000252_21761_22375 203
1879 3300053153 Ga0500616_0214026 Ga0500616_0214026_12_623 203
1880 3300053178 Ga0500637_0138599 Ga0500637_0138599_38_649 203
1881 3300001979 JGI24740J21852_10010207 JGI24740J21852_100102074 204
1882 3300002067 JGI24735J21928_10065329 JGI24735J21928_100653292 204
1883 3300005339 Ga0070660_100470405 Ga0070660_1004704052 204
1884 3300005455 Ga0070663_100033456 Ga0070663_1000334564 204
1885 3300005539 Ga0068853_100110502 Ga0068853_1001105023 204
1886 3300005563 Ga0068855_100025913 Ga0068855_1000259135 204
1887 3300005563 Ga0068855_100286657 Ga0068855_1002866572 204
1888 3300005577 Ga0068857_100026301 Ga0068857_1000263014 204
1889 3300005578 Ga0068854_100021850 Ga0068854_1000218504 204
1890 3300005614 Ga0068856_100006948 Ga0068856_1000069483 204
1891 3300005614 Ga0068856_100069122 Ga0068856_1000691224 204
1892 3300005616 Ga0068852_100053814 Ga0068852_1000538144 204
1893 3300005616 Ga0068852_100336686 Ga0068852_1003366862 204
1894 3300005834 Ga0068851_10004612 Ga0068851_100046125 204
1895 3300005937 Ga0081455_10001410 Ga0081455_100014105 204
1896 3300005985 Ga0081539_10024192 Ga0081539_100241924 204
1897 3300005985 Ga0081539_10071580 Ga0081539_100715802 204
1898 3300009093 Ga0105240_10069625 Ga0105240_100696251 204
1899 3300009174 Ga0105241_10000269 Ga0105241_100002695 204
1900 3300009545 Ga0105237_10056235 Ga0105237_100562354 204
1901 3300009551 Ga0105238_10002811 Ga0105238_1000281118 204
1902 3300009551 Ga0105238_10140850 Ga0105238_101408504 204
1903 3300010375 Ga0105239_10062146 Ga0105239_100621464 204
1904 3300021320 Ga0214544_1000009 Ga0214544_1000009100 204
1905 3300021321 Ga0214542_1000002 Ga0214542_1000002542 204
1906 3300021324 Ga0214545_1000002 Ga0214545_1000002178 204
1907 3300021327 Ga0214543_1000013 Ga0214543_1000013144 204
1908 3300025904 Ga0207647_10164731 Ga0207647_101647312 204
1909 3300025911 Ga0207654_10000968 Ga0207654_1000096818 204
1910 3300025913 Ga0207695_10003702 Ga0207695_100037025 204
1911 3300025913 Ga0207695_10022178 Ga0207695_100221784 204
1912 3300025914 Ga0207671_10144947 Ga0207671_101449472 204
1913 3300025914 Ga0207671_10553097 Ga0207671_105530971 204
1914 3300025924 Ga0207694_10000787 Ga0207694_100007874 204
1915 3300025949 Ga0207667_10717422 Ga0207667_107174222 204
1916 3300025981 Ga0207640_10063901 Ga0207640_100639012 204
1917 3300025981 Ga0207640_10064935 Ga0207640_100649353 204
1918 3300026067 Ga0207678_10147245 Ga0207678_101472452 204
1919 3300026078 Ga0207702_10000005 Ga0207702_1000000524 204
1920 3300026078 Ga0207702_10005949 Ga0207702_100059494 204
1921 3300026116 Ga0207674_10009555 Ga0207674_100095558 204
1922 3300026116 Ga0207674_10019980 Ga0207674_100199803 204
1923 3300026142 Ga0207698_10128273 Ga0207698_101282732 204
1924 3300026142 Ga0207698_10279237 Ga0207698_102792372 204
1925 3300031247 Ga0265340_10051033 Ga0265340_100510332 204
1926 3300031249 Ga0265339_10001342 Ga0265339_1000134212 204
1927 3300031903 Ga0307407_10505450 Ga0307407_105054502 204
1928 3300037418 Ga0395900_1067987 Ga0395900_1067987_30_647 204
1929 3300037466 Ga0395898_0080332 Ga0395898_0080332_1459_2076 204
1930 3300039453 Ga0436362_1129828 Ga0436362_1129828_51_665 204
1931 3300044658 Ga0466972_0065101 Ga0466972_0065101_121_750 204
1932 3300045976 Ga0466967_0191918 Ga0466967_0191918_947_1573 204
1933 3300046684 Ga0495669_0160453 Ga0495669_0160453_168_836 204
1934 3300048917 Ga0496114_0160505 Ga0496114_0160505_1150_1764 204
1935 3300048925 Ga0496122_0152066 Ga0496122_0152066_294_908 204
1936 3300048926 Ga0496123_0065727 Ga0496123_0065727_1633_2247 204
1937 3300048929 Ga0496126_0003586 Ga0496126_0003586_2742_3356 204
1938 3300049571 Ga0501034_0300822 Ga0501034_0300822_327_941 204
1939 3300049571 Ga0501034_0434731 Ga0501034_0434731_404_1018 204
1940 3300049573 Ga0501037_0103338 Ga0501037_0103338_173_790 204
1941 3300049574 Ga0501038_0118899 Ga0501038_0118899_690_1307 204
1942 3300049575 Ga0501039_0188218 Ga0501039_0188218_221_838 204
1943 3300049581 Ga0501047_0747041 Ga0501047_0747041_11_628 204
1944 3300049586 Ga0501070_0394879 Ga0501070_0394879_361_978 204
1945 3300049742 Ga0501080_0339730 Ga0501080_0339730_47_664 204
1946 3300049822 Ga0501035_0155616 Ga0501035_0155616_250_867 204
1947 3300049822 Ga0501035_0649093 Ga0501035_0649093_18_632 204
1948 3300049823 Ga0501044_0145931 Ga0501044_0145931_1307_1921 204
1949 3300049824 Ga0501045_0284937 Ga0501045_0284937_496_1113 204
1950 3300053111 Ga0500572_002385 Ga0500572_002385_1593_2207 204
1951 3300053136 Ga0500559_0004009 Ga0500559_0004009_2459_3073 204
1952 3300053163 Ga0500639_008750 Ga0500639_008750_3895_4509 204
1953 3300053735 Ga0500596_000135 Ga0500596_000135_8039_8653 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

145

229

0.97

PF00677

Lum_binding

Lumazine binding domain

43

132

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.8913 103 192
1hze-assembly1.cif.gz_A solution structure of the n-terminal domain of riboflavin synthase from e. coli 0.8836 104 186
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.8776 1 200
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.869 1 200
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.8686 1 202
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9034 103 190 2.40.30.20
4fxuA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8918 1 94 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8869 104 197 2.40.30.20
3a35A01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8868 103 190 2.40.30.20
af_A0A1D8PP67_110_218_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8823 111 201 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A6G8IXD5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9114 11 186 GO:0004746
GO:0009231
AF-A0A1G1X1P5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9013 1 189 GO:0004746
GO:0005524
GO:0008531
GO:0009231
AF-A0A3D5ZIE6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.897 1 190 GO:0004746
GO:0009231
AF-A0A6G8IXD5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.8963 11 186 GO:0004746
GO:0009231
AF-A0A846S9F1-F1-model_v4 deleted 0.8856 1 190

Feature Viewer

pLDDT pTM Quality
86.59 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map