metagRoot

F496063

General Info

Members	Datasets	Scaffolds	Average Seq Length
1922	725	1702	267

Family's Representative Sequence

Representative Sequence	3300046615\|Ga0495656_0042493\|Ga0495656_0042493_945_1670
Length	241
Sequence	VSSFQNIGRMLLPVVVLAAGLGLWELVVRVNDIQPYVLPSPYLVFQTLVGDWPVLSESLGVTLLTTLEGFIAAAVGGVALALLFNQSKWLEYSLFPYAVILQVTPVIAIAPLLLIYLPQQTAGIVDRNLAGLFQLYGASRLQTLRYLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGTAGAGSGLAFRIAESGYRLNIPRMFAALLLLSVAGIVIYGLLALVSHLVLRRWHESALGKEN

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
5	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
6	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
7	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
8	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
9	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
10	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
11	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
12	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
13	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
14	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
15	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
16	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
17	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
18	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
19	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
20	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
21	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
22	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
23	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
24	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
25	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
26	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
27	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
28	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
29	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
30	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
31	2791355199
32	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
33	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
34	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
35	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
36	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
37	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
38	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
39	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
40	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
41	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
42	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
43	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
44	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
45	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
46	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
47	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
48	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
49	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
50	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
51	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
52	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
53	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
54	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
55	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
56	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
57	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
58	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
59	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
60	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
61	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
62	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
63	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
64	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
65	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
66	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
67	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
68	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
69	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
70	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
71	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
72	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
73	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
74	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
75	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
76	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
77	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
78	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
79	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
80	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
81	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
82	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
83	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
84	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
85	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
86	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
87	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
88	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
89	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
90	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
91	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
92	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
93	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
94	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
95	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
96	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
97	2904699407
98	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
99	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
100	2906610324
101	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
102	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
103	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
104	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
105	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
106	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
107	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
108	2922368715
109	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
110	2922425934
111	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
112	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
113	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
114	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
115	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
116	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
117	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
118	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
119	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
120	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
121	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
122	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
123	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
124	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
125	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
126	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
127	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
128	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
129	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
130	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
131	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
132	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
133	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
134	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
135	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
136	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
137	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
138	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
139	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
140	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
141	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
142	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
143	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
144	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
145	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
146	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
147	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
148	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
149	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
150	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
151	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
152	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
153	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
154	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
155	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
156	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
157	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
158	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
159	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
160	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
161	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
162	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
163	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
164	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
165	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
166	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
167	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
168	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
169	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
170	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
171	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
172	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
173	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
174	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
175	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
176	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
177	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
178	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
179	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
180	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
181	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
182	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
183	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
184	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
185	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
186	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
187	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
188	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
189	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
190	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
191	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
192	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
193	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
194	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
195	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
196	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
197	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
198	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
199	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
200	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
201	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
202	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
203	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
204	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
205	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
206	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
207	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
208	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
209	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
210	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
211	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
212	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
213	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
214	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
215	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
216	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
217	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
218	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
219	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
220	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
221	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
222	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
223	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
224	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
225	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
226	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
227	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
228	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
229	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
230	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
231	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
232	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
233	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
234	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
235	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
236	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
237	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
238	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
239	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
240	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
241	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
242	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
243	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
244	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
245	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
246	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
247	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
248	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
249	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
250	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
251	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
252	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
253	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
254	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
255	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
256	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
257	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
258	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
259	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
260	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
261	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
262	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
263	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
264	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
265	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
266	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
267	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
268	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
269	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
270	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
271	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
272	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
273	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
274	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
275	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
276	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
277	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
278	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
279	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
280	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
281	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
282	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
283	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
284	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
285	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
286	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
287	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
288	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
289	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
290	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
291	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
292	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
293	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
294	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
295	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
296	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
297	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
298	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
299	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
300	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
301	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
302	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
303	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
304	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
305	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
306	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
307	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
308	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
309	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
310	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
311	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
312	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
313	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
314	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
315	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
316	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
317	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
318	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
319	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
321	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
324	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
325	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
327	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
388	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
389	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
390	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
391	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
393	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
394	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
398	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
399	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
400	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
401	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
402	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
403	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
404	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
405	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
406	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
407	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
408	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
409	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
410	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
411	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
412	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
413	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
414	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
415	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
416	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
417	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
418	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
419	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
420	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
421	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
422	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
423	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
424	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
425	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
426	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
427	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
428	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
429	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
430	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
431	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
432	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
433	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
434	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
435	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
436	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
437	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
438	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
439	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
440	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
441	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
442	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
443	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
444	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
445	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
446	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
447	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
448	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
449	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
450	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
451	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
452	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
453	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
454	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
455	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
456	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
457	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
458	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
459	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
460	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
461	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
462	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
463	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
464	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
465	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
466	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
467	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
468	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
469	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
470	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
471	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
472	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
473	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
474	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
475	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
476	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
477	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
478	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
479	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
480	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
481	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
482	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
483	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
484	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
485	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
486	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
487	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
488	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
489	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
490	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
491	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
492	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
493	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
494	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
495	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
496	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
497	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
498	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
499	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
500	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
501	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
502	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
503	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
504	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
505	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
506	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
507	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
508	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
509	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
510	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
511	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
512	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
513	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
514	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
515	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
516	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
517	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
518	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
519	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
520	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
521	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
522	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
523	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
524	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
525	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
526	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
527	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
528	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
529	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
530	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
531	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
532	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
533	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
534	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
535	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
536	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
537	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
538	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
539	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
540	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
541	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
542	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
543	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
544	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
545	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
546	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
547	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
548	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
549	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
550	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
551	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
552	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
553	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
554	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
555	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
556	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
557	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
558	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
559	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
560	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
561	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
562	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
563	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
564	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
565	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
566	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
567	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
568	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
569	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
570	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
571	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
572	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
573	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
574	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
575	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
576	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
577	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
578	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
579	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
580	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
581	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
582	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
583	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
584	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
585	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
586	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
587	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
588	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
589	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
590	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
591	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
592	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
593	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
594	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
595	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
596	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
597	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
598	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
599	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
600	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
601	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
602	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
603	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
604	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
605	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
606	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
607	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
608	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
609	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
610	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
611	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
612	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
613	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
614	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
615	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
616	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
617	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
618	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
619	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
620	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
621	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
622	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
623	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
624	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
625	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
626	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
627	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
628	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
629	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
630	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
631	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
632	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
633	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
634	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
635	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
636	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
637	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
638	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
639	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
640	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
641	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
642	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
643	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
644	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
645	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
646	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
647	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
648	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
649	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
650	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
651	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
652	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
653	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
654	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
655	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
656	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
657	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
658	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
659	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
660	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
661	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
662	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
663	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
664	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
665	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
666	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
667	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
668	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
669	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
670	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
671	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
672	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
673	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
674	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
675	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
676	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
677	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
678	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
679	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
680	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
681	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
682	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
683	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
684	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
685	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
686	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
687	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
688	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
689	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
690	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
691	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
692	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
693	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
694	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
695	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
696	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
697	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
698	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
699	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
700	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
701	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
702	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
703	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
704	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
705	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
706	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
707	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
708	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
709	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
710	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
711	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
712	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
713	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
714	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
715	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
716	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
717	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
718	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
719	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
720	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
721	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
722	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
723	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
724	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
725	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.78
Metatranscriptomes	0
Isolates	11.22

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.47
Nodule	9
Rhizoplane	5.72
Rhizosphere	68.11
Stem	0
Stem Tuber	0
Unclassified	7.7

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10032334	3300001989	Bacteria	1801
2	JGI24737J22298_10000208	3300001990	Bacteria	19118
3	JGI24735J21928_10004541	3300002067	Bacteria	4666
4	JGI25153J46596_10005452	3300003215	Bacteria	6674
5	JGI25153J46596_10009654	3300003215	Bacteria	4447
6	JGI25153J46596_10017974	3300003215	Bacteria	2764
7	rootH1_10081384	3300003316	Bacteria	1517
8	JGI25160J50197_1026917	3300003354	Bacteria	1575
9	JGI25404J52841_10012054	3300003659	Bacteria	1869
10	Ga0055531_10001969	3300003794	Bacteria	14324
11	Ga0055543_1007718	3300004625	Bacteria	2456
12	Ga0065165_1002418	3300005262	Bacteria	15912
13	Ga0065165_1002477	3300005262	Bacteria	15526
14	Ga0065165_1004254	3300005262	Bacteria	9053
15	Ga0070658_10022210	3300005327	Bacteria	5092
16	Ga0070658_10138983	3300005327	Bacteria	2028
17	Ga0070676_10007989	3300005328	Bacteria	5689
18	Ga0070676_10224228	3300005328	Bacteria	1243
19	Ga0070683_100050728	3300005329	Bacteria	3842
20	Ga0070683_100110068	3300005329	Bacteria	2598
21	Ga0070690_100071901	3300005330	Bacteria	2248
22	Ga0070690_100079786	3300005330	Bacteria	2140
23	Ga0070670_100049785	3300005331	Bacteria	3602
24	Ga0070677_10020850	3300005333	Bacteria	2395
25	Ga0068869_100151733	3300005334	Bacteria	1797
26	Ga0068869_100175557	3300005334	Bacteria	1676
27	Ga0068869_100251000	3300005334	Bacteria	1413
28	Ga0070680_100008654	3300005336	Bacteria	7800
29	Ga0070680_100067985	3300005336	Bacteria	2924
30	Ga0070680_100245781	3300005336	Bacteria	1513
31	Ga0070682_100021490	3300005337	Bacteria	3808
32	Ga0068868_100350804	3300005338	Bacteria	1264
33	Ga0068868_100402374	3300005338	Bacteria	1182
34	Ga0070660_100019868	3300005339	Bacteria	4928
35	Ga0070660_100163282	3300005339	Bacteria	1796
36	Ga0070660_100233536	3300005339	Bacteria	1496
37	Ga0070660_100499619	3300005339	Bacteria	1012
38	Ga0070689_100006692	3300005340	Bacteria	8009
39	Ga0070689_100153757	3300005340	Bacteria	1857
40	Ga0070689_100459467	3300005340	Bacteria	1085
41	Ga0070691_10064474	3300005341	Bacteria	1768
42	Ga0070691_10126572	3300005341	Bacteria	1291
43	Ga0070687_100072336	3300005343	Bacteria	1855
44	Ga0070687_100156066	3300005343	Bacteria	1345
45	Ga0070687_100161895	3300005343	Bacteria	1323
46	Ga0070661_100133431	3300005344	Bacteria	1866
47	Ga0070661_100168062	3300005344	Bacteria	1664
48	Ga0070668_100015166	3300005347	Bacteria	5758
49	Ga0070668_100016551	3300005347	Bacteria	5512
50	Ga0070668_100203002	3300005347	Bacteria	1628
51	Ga0070668_100306427	3300005347	Bacteria	1333
52	Ga0070669_100060927	3300005353	Bacteria	2772
53	Ga0070669_100065099	3300005353	Bacteria	2685
54	Ga0070669_100280263	3300005353	Bacteria	1335
55	Ga0070671_100013043	3300005355	Bacteria	6698
56	Ga0070671_100014641	3300005355	Bacteria	6341
57	Ga0070674_100027828	3300005356	Bacteria	3707
58	Ga0070674_100038335	3300005356	Bacteria	3229
59	Ga0070674_100052473	3300005356	Bacteria	2813
60	Ga0070674_100092327	3300005356	Bacteria	2188
61	Ga0070674_100171952	3300005356	Bacteria	1652
62	Ga0070673_100029733	3300005364	Bacteria	4077
63	Ga0070673_100404252	3300005364	Bacteria	1222
64	Ga0070673_100442221	3300005364	Bacteria	1168
65	Ga0070688_100019543	3300005365	Bacteria	3926
66	Ga0070659_100060018	3300005366	Bacteria	3004
67	Ga0070659_100066837	3300005366	Bacteria	2850
68	Ga0070659_100138772	3300005366	Bacteria	1978
69	Ga0070659_100215318	3300005366	Bacteria	1584
70	Ga0070667_100025504	3300005367	Bacteria	4914
71	Ga0070709_10015634	3300005434	Bacteria	4321
72	Ga0070709_10033865	3300005434	Bacteria	3093
73	Ga0070709_10187161	3300005434	Bacteria	1458
74	Ga0070714_100003521	3300005435	Bacteria	11689
75	Ga0070714_100004001	3300005435	Bacteria	11083
76	Ga0070714_100012654	3300005435	Bacteria	6739
77	Ga0070714_100061329	3300005435	Bacteria	3230
78	Ga0070714_100145972	3300005435	Bacteria	2128
79	Ga0070714_100155992	3300005435	Bacteria	2061
80	Ga0070714_100331167	3300005435	Bacteria	1426
81	Ga0070714_100404577	3300005435	Bacteria	1291
82	Ga0070713_100005267	3300005436	Bacteria	8822
83	Ga0070713_100006580	3300005436	Bacteria	8075
84	Ga0070713_100006616	3300005436	Bacteria	8057
85	Ga0070713_100055790	3300005436	Bacteria	3285
86	Ga0070713_100080610	3300005436	Bacteria	2776
87	Ga0070713_100137998	3300005436	Bacteria	2157
88	Ga0070713_100169750	3300005436	Bacteria	1954
89	Ga0070713_100467276	3300005436	Bacteria	1187
90	Ga0070710_10000219	3300005437	Bacteria	26539
91	Ga0070710_10015416	3300005437	Bacteria	3868
92	Ga0070710_10078820	3300005437	Bacteria	1918
93	Ga0070710_10131115	3300005437	Bacteria	1528
94	Ga0070701_10097051	3300005438	Bacteria	1626
95	Ga0070701_10105281	3300005438	Bacteria	1568
96	Ga0070701_10145415	3300005438	Bacteria	1360
97	Ga0070701_10250179	3300005438	Bacteria	1070
98	Ga0070711_100002404	3300005439	Bacteria	10676
99	Ga0070711_100007523	3300005439	Bacteria	6631
100	Ga0070711_100023994	3300005439	Bacteria	3974
101	Ga0070711_100033520	3300005439	Bacteria	3419
102	Ga0070711_100661968	3300005439	Unclassified	876
103	Ga0070705_100040255	3300005440	Bacteria	2657
104	Ga0070705_100068495	3300005440	Bacteria	2136
105	Ga0070700_100190472	3300005441	Bacteria	1434
106	Ga0070663_100003302	3300005455	Bacteria	9291
107	Ga0070663_100088155	3300005455	Bacteria	2294
108	Ga0070663_100115370	3300005455	Bacteria	2023
109	Ga0070663_100300828	3300005455	Bacteria	1284
110	Ga0070678_100166359	3300005456	Bacteria	1792
111	Ga0070678_100281307	3300005456	Bacteria	1407
112	Ga0070678_100320464	3300005456	Bacteria	1323
113	Ga0070662_100043500	3300005457	Bacteria	3214
114	Ga0070681_10009562	3300005458	Bacteria	9537
115	Ga0070681_10050978	3300005458	Bacteria	4129
116	Ga0070681_10058567	3300005458	Bacteria	3831
117	Ga0070681_10159687	3300005458	Bacteria	2178
118	Ga0070681_10178933	3300005458	Bacteria	2042
119	Ga0068867_100182624	3300005459	Bacteria	1669
120	Ga0070707_100039062	3300005468	Bacteria	4536
121	Ga0070698_100210881	3300005471	Bacteria	1877
122	Ga0070699_100208678	3300005518	Bacteria	1738
123	Ga0070679_100021585	3300005530	Bacteria	6287
124	Ga0070679_100022307	3300005530	Bacteria	6188
125	Ga0070679_100083660	3300005530	Bacteria	3179
126	Ga0070679_100102147	3300005530	Bacteria	2853
127	Ga0070679_100106676	3300005530	Bacteria	2787
128	Ga0070679_100110452	3300005530	Bacteria	2735
129	Ga0070684_100011463	3300005535	Bacteria	7061
130	Ga0070684_100112861	3300005535	Bacteria	2438
131	Ga0070684_100144922	3300005535	Bacteria	2149
132	Ga0070684_100439476	3300005535	Bacteria	1205
133	Ga0070697_100189382	3300005536	Bacteria	1746
134	Ga0070697_100212460	3300005536	Bacteria	1647
135	Ga0068853_100036694	3300005539	Bacteria	4169
136	Ga0068853_100038220	3300005539	Bacteria	4087
137	Ga0068853_100054249	3300005539	Bacteria	3454
138	Ga0068853_100156671	3300005539	Bacteria	2052
139	Ga0068853_100339928	3300005539	Bacteria	1394
140	Ga0068853_100394294	3300005539	Bacteria	1295
141	Ga0070686_100292381	3300005544	Bacteria	1205
142	Ga0070686_100366596	3300005544	Bacteria	1087
143	Ga0070693_100012010	3300005547	Bacteria	4374
144	Ga0070665_100063100	3300005548	Bacteria	3715
145	Ga0070665_100071766	3300005548	Bacteria	3469
146	Ga0070665_100080102	3300005548	Bacteria	3271
147	Ga0070665_100128038	3300005548	Bacteria	2541
148	Ga0070665_100153142	3300005548	Bacteria	2308
149	Ga0070665_100426623	3300005548	Bacteria	1335
150	Ga0070665_100451801	3300005548	Bacteria	1295
151	Ga0070704_100136830	3300005549	Bacteria	1907
152	Ga0070704_100484462	3300005549	Bacteria	1071
153	Ga0068855_100025942	3300005563	Bacteria	7011
154	Ga0068855_100105181	3300005563	Bacteria	3245
155	Ga0068855_100121183	3300005563	Bacteria	2993
156	Ga0068855_100179330	3300005563	Bacteria	2395
157	Ga0068855_100266989	3300005563	Bacteria	1904
158	Ga0068855_100303900	3300005563	Bacteria	1766
159	Ga0068855_100313046	3300005563	Bacteria	1736
160	Ga0068855_100518989	3300005563	Bacteria	1293
161	Ga0068857_100014108	3300005577	Bacteria	6957
162	Ga0068857_100141128	3300005577	Bacteria	2178
163	Ga0068854_100004314	3300005578	Bacteria	8961
164	Ga0068854_100537028	3300005578	Bacteria	990
165	Ga0068856_100002788	3300005614	Bacteria	17883
166	Ga0068856_100109711	3300005614	Bacteria	2756
167	Ga0068856_100235434	3300005614	Bacteria	1846
168	Ga0068856_100384658	3300005614	Bacteria	1423
169	Ga0068856_100488225	3300005614	Bacteria	1253
170	Ga0068856_100547261	3300005614	Bacteria	1178
171	Ga0068856_100596106	3300005614	Bacteria	1126
172	Ga0070702_100022487	3300005615	Bacteria	3334
173	Ga0068852_100027985	3300005616	Bacteria	4605
174	Ga0068852_100031928	3300005616	Bacteria	4354
175	Ga0068852_100032230	3300005616	Bacteria	4336
176	Ga0068852_100107132	3300005616	Bacteria	2535
177	Ga0068852_100125142	3300005616	Bacteria	2359
178	Ga0068852_100461752	3300005616	Bacteria	1259
179	Ga0068859_100074561	3300005617	Bacteria	3432
180	Ga0068859_100160315	3300005617	Bacteria	2328
181	Ga0068864_100041943	3300005618	Bacteria	3915
182	Ga0068864_100177651	3300005618	Bacteria	1944
183	Ga0068864_100192038	3300005618	Bacteria	1872
184	Ga0068864_100780671	3300005618	Bacteria	938
185	Ga0068861_100201588	3300005719	Bacteria	1670
186	Ga0068851_10003007	3300005834	Bacteria	7445
187	Ga0068851_10028747	3300005834	Bacteria	2747
188	Ga0068851_10072828	3300005834	Bacteria	1781
189	Ga0068863_100404598	3300005841	Bacteria	1335
190	Ga0068863_100590181	3300005841	Bacteria	1099
191	Ga0068858_100115183	3300005842	Bacteria	2511
192	Ga0068860_100001070	3300005843	Bacteria	30180
193	Ga0068860_100415052	3300005843	Bacteria	1333
194	Ga0068862_100123022	3300005844	Bacteria	2288
195	Ga0068862_100144378	3300005844	Bacteria	2114
196	Ga0081455_10003639	3300005937	Bacteria	17660
197	Ga0081455_10011035	3300005937	Bacteria	9099
198	Ga0081455_10016498	3300005937	Bacteria	7128
199	Ga0081455_10018914	3300005937	Bacteria	6535
200	Ga0081455_10023899	3300005937	Bacteria	5676
201	Ga0081455_10026478	3300005937	Bacteria	5332
202	Ga0081455_10064204	3300005937	Bacteria	3076
203	Ga0081538_10005451	3300005981	Bacteria	11423
204	Ga0081538_10122368	3300005981	Bacteria	1247
205	Ga0081540_1001561	3300005983	Bacteria	19619
206	Ga0081540_1002615	3300005983	Bacteria	14634
207	Ga0081540_1003198	3300005983	Bacteria	13049
208	Ga0081540_1003591	3300005983	Bacteria	12180
209	Ga0081540_1011508	3300005983	Bacteria	5911
210	Ga0081540_1016877	3300005983	Bacteria	4546
211	Ga0081540_1022611	3300005983	Bacteria	3710
212	Ga0081540_1026817	3300005983	Bacteria	3278
213	Ga0081540_1050244	3300005983	Bacteria	2073
214	Ga0081540_1093189	3300005983	Bacteria	1320
215	Ga0081539_10000629	3300005985	Bacteria	71410
216	Ga0081539_10070600	3300005985	Bacteria	1874
217	Ga0081539_10125918	3300005985	Bacteria	1266
218	Ga0070717_10002774	3300006028	Bacteria	12393
219	Ga0070717_10038393	3300006028	Bacteria	3892
220	Ga0070717_10055904	3300006028	Bacteria	3258
221	Ga0070717_10079796	3300006028	Bacteria	2744
222	Ga0070717_10098678	3300006028	Bacteria	2477
223	Ga0070717_10312000	3300006028	Bacteria	1400
224	Ga0075365_10043037	3300006038	Bacteria	2955
225	Ga0075365_10044433	3300006038	Bacteria	2911
226	Ga0075365_10160489	3300006038	Bacteria	1566
227	Ga0075365_10197966	3300006038	Bacteria	1407
228	Ga0075365_10271474	3300006038	Bacteria	1193
229	Ga0075368_10027236	3300006042	Bacteria	2203
230	Ga0075363_100002768	3300006048	Bacteria	7271
231	Ga0075363_100013835	3300006048	Bacteria	3927
232	Ga0075363_100026974	3300006048	Bacteria	2942
233	Ga0075363_100059602	3300006048	Bacteria	2053
234	Ga0075363_100175536	3300006048	Bacteria	1218
235	Ga0075363_100180628	3300006048	Bacteria	1200
236	Ga0075432_10001003	3300006058	Bacteria	8938
237	Ga0070715_10047131	3300006163	Bacteria	1835
238	Ga0070715_10081201	3300006163	Bacteria	1472
239	Ga0070716_100094518	3300006173	Bacteria	1817
240	Ga0070716_100272375	3300006173	Bacteria	1164
241	Ga0070712_100000205	3300006175	Bacteria	33282
242	Ga0070712_100015320	3300006175	Bacteria	4933
243	Ga0070712_100024020	3300006175	Bacteria	4033
244	Ga0070712_100261447	3300006175	Bacteria	1387
245	Ga0075362_10011146	3300006177	Bacteria	3535
246	Ga0075362_10207613	3300006177	Bacteria	955
247	Ga0075367_10001993	3300006178	Bacteria	9098
248	Ga0075367_10091455	3300006178	Bacteria	1851
249	Ga0075369_10001014	3300006186	Bacteria	9373
250	Ga0075369_10008977	3300006186	Bacteria	3867
251	Ga0075369_10040975	3300006186	Bacteria	1981
252	Ga0075369_10051331	3300006186	Bacteria	1785
253	Ga0075366_10019382	3300006195	Bacteria	3935
254	Ga0075366_10138724	3300006195	Bacteria	1469
255	Ga0075366_10193279	3300006195	Bacteria	1237
256	Ga0075370_10049006	3300006353	Bacteria	2394
257	Ga0075370_10126918	3300006353	Bacteria	1487
258	Ga0075370_10146604	3300006353	Bacteria	1382
259	Ga0075370_10186997	3300006353	Bacteria	1220
260	Ga0075370_10277507	3300006353	Bacteria	995
261	Ga0068871_100064908	3300006358	Bacteria	2989
262	Ga0075428_100002668	3300006844	Bacteria	19383
263	Ga0075428_100428258	3300006844	Bacteria	1418
264	Ga0075428_100489839	3300006844	Bacteria	1316
265	Ga0075430_100034038	3300006846	Bacteria	4323
266	Ga0075431_100117836	3300006847	Bacteria	2740
267	Ga0075431_100588204	3300006847	Bacteria	1098
268	Ga0075433_10000867	3300006852	Bacteria	21175
269	Ga0075434_100000212	3300006871	Bacteria	39628
270	Ga0075434_100029198	3300006871	Bacteria	5423
271	Ga0075434_100152473	3300006871	Bacteria	2331
272	Ga0075434_100196284	3300006871	Bacteria	2038
273	Ga0075434_100289485	3300006871	Bacteria	1658
274	Ga0075429_100000347	3300006880	Bacteria	33776
275	Ga0075429_100341066	3300006880	Bacteria	1312
276	Ga0075436_100002520	3300006914	Bacteria	12602
277	Ga0075436_100185719	3300006914	Bacteria	1470
278	Ga0075436_100201759	3300006914	Bacteria	1409
279	Ga0097620_100074564	3300006931	Bacteria	3432
280	Ga0097620_100160321	3300006931	Bacteria	2328
281	Ga0099825_1022030	3300006941	Bacteria	4198
282	Ga0099824_1010813	3300006942	Bacteria	10575
283	Ga0099824_1016377	3300006942	Bacteria	6735
284	Ga0099822_1002332	3300006943	Bacteria	23535
285	Ga0075435_100030598	3300007076	Bacteria	4235
286	Ga0075435_100380272	3300007076	Bacteria	1213
287	Ga0099794_10023536	3300007265	Bacteria	2819
288	Ga0099794_10084903	3300007265	Bacteria	1565
289	Ga0099794_10158523	3300007265	Bacteria	1151
290	Ga0099795_10057526	3300007788	Bacteria	1434
291	Ga0105240_10007716	3300009093	Bacteria	15569
292	Ga0105240_10034054	3300009093	Bacteria	6575
293	Ga0105240_10046615	3300009093	Bacteria	5491
294	Ga0105240_10061416	3300009093	Bacteria	4683
295	Ga0105240_10090182	3300009093	Bacteria	3747
296	Ga0105240_10350022	3300009093	Bacteria	1676
297	Ga0105240_10350956	3300009093	Bacteria	1674
298	Ga0105240_10697420	3300009093	Bacteria	1108
299	Ga0105240_10708709	3300009093	Bacteria	1098
300	Ga0111539_10000138	3300009094	Bacteria	82968
301	Ga0111539_10024504	3300009094	Bacteria	7400
302	Ga0105245_10058528	3300009098	Bacteria	3469
303	Ga0105245_10231669	3300009098	Bacteria	1787
304	Ga0105245_10592625	3300009098	Bacteria	1134
305	Ga0105247_10110641	3300009101	Bacteria	1768
306	Ga0105247_10158394	3300009101	Bacteria	1497
307	Ga0114129_10001559	3300009147	Bacteria	31121
308	Ga0114129_10010376	3300009147	Bacteria	13285
309	Ga0114129_10089335	3300009147	Bacteria	4271
310	Ga0114129_10584854	3300009147	Bacteria	1448
311	Ga0114129_10600402	3300009147	Bacteria	1426
312	Ga0105243_10474368	3300009148	Bacteria	1179
313	Ga0105243_10745938	3300009148	Bacteria	959
314	Ga0105241_10009598	3300009174	Bacteria	7115
315	Ga0105241_10054713	3300009174	Bacteria	3056
316	Ga0105241_10057150	3300009174	Bacteria	2992
317	Ga0105241_10074950	3300009174	Bacteria	2636
318	Ga0105241_10281633	3300009174	Bacteria	1420
319	Ga0105248_10014049	3300009177	Bacteria	8812
320	Ga0105248_10026944	3300009177	Bacteria	6392
321	Ga0105248_10259572	3300009177	Bacteria	1956
322	Ga0105248_10303618	3300009177	Bacteria	1797
323	Ga0105248_10343325	3300009177	Bacteria	1681
324	Ga0105248_10574894	3300009177	Bacteria	1271
325	Ga0105248_10696872	3300009177	Bacteria	1146
326	Ga0105237_10002092	3300009545	Bacteria	25220
327	Ga0105237_10036215	3300009545	Bacteria	4992
328	Ga0105237_10074303	3300009545	Bacteria	3391
329	Ga0105237_10103849	3300009545	Bacteria	2834
330	Ga0105237_10116288	3300009545	Bacteria	2668
331	Ga0105237_10139508	3300009545	Bacteria	2418
332	Ga0105237_10158666	3300009545	Bacteria	2260
333	Ga0105237_10236004	3300009545	Bacteria	1830
334	Ga0105237_10256974	3300009545	Bacteria	1749
335	Ga0105237_10544777	3300009545	Bacteria	1167
336	Ga0105238_10026085	3300009551	Bacteria	5956
337	Ga0105238_10029551	3300009551	Bacteria	5583
338	Ga0105238_10043421	3300009551	Bacteria	4549
339	Ga0105238_10067329	3300009551	Bacteria	3583
340	Ga0105238_10081054	3300009551	Bacteria	3234
341	Ga0105238_10209494	3300009551	Bacteria	1925
342	Ga0105238_10395989	3300009551	Bacteria	1374
343	Ga0105238_10414571	3300009551	Bacteria	1341
344	Ga0105249_10041299	3300009553	Bacteria	4192
345	Ga0105249_10121599	3300009553	Bacteria	2481
346	Ga0105249_10129426	3300009553	Bacteria	2408
347	Ga0105249_10547077	3300009553	Bacteria	1208
348	Ga0105249_10568681	3300009553	Bacteria	1186
349	Ga0105249_10649842	3300009553	Bacteria	1112
350	Ga0099796_10092113	3300010159	Bacteria	1128
351	Ga0105239_10021610	3300010375	Bacteria	7095
352	Ga0105239_10044865	3300010375	Bacteria	4845
353	Ga0105239_10053186	3300010375	Bacteria	4442
354	Ga0105239_10065469	3300010375	Bacteria	3991
355	Ga0105239_10075985	3300010375	Bacteria	3694
356	Ga0105239_10079128	3300010375	Bacteria	3618
357	Ga0105239_10110805	3300010375	Bacteria	3042
358	Ga0105239_10320927	3300010375	Bacteria	1746
359	Ga0105239_10565929	3300010375	Bacteria	1295
360	Ga0105239_10799727	3300010375	Bacteria	1080
361	Ga0105246_10235177	3300011119	Bacteria	1445
362	Ga0105246_10319229	3300011119	Bacteria	1261
363	Ga0105246_10473961	3300011119	Bacteria	1057
364	Ga0157373_10099706	3300013100	Bacteria	2044
365	Ga0157370_10029759	3300013104	Bacteria	5356
366	Ga0157370_10047158	3300013104	Bacteria	4131
367	Ga0157370_10273606	3300013104	Bacteria	1560
368	Ga0157369_10014863	3300013105	Bacteria	8787
369	Ga0157369_10015000	3300013105	Bacteria	8746
370	Ga0157369_10180171	3300013105	Bacteria	2223
371	Ga0157378_10106557	3300013297	Bacteria	2564
372	Ga0157378_10856029	3300013297	Bacteria	938
373	Ga0163162_10101474	3300013306	Bacteria	2969
374	Ga0163162_10536148	3300013306	Bacteria	1299
375	Ga0163162_10589798	3300013306	Bacteria	1238
376	Ga0157372_10132015	3300013307	Bacteria	2874
377	Ga0157372_10540593	3300013307	Bacteria	1358
378	Ga0157375_10174307	3300013308	Bacteria	2299
379	Ga0157375_10181037	3300013308	Bacteria	2259
380	Ga0157375_10288388	3300013308	Bacteria	1804
381	Ga0157375_10966388	3300013308	Bacteria	993
382	Ga0163163_10032478	3300014325	Bacteria	5040
383	Ga0163163_10035303	3300014325	Bacteria	4849
384	Ga0163163_10112864	3300014325	Bacteria	2747
385	Ga0163163_10427621	3300014325	Bacteria	1383
386	Ga0157380_10194590	3300014326	Bacteria	1793
387	Ga0182008_10136502	3300014497	Bacteria	1225
388	Ga0157377_10100924	3300014745	Bacteria	1719
389	Ga0157379_10233306	3300014968	Bacteria	1668
390	Ga0157379_10295675	3300014968	Bacteria	1475
391	Ga0157379_10375273	3300014968	Bacteria	1304
392	Ga0157376_10025781	3300014969	Bacteria	4635
393	Ga0157376_10099907	3300014969	Bacteria	2532
394	Ga0157376_10293019	3300014969	Bacteria	1537
395	Ga0163161_10083267	3300017792	Bacteria	2358
396	Ga0214544_1000007	3300021320	Bacteria	379989
397	Ga0214542_1000216	3300021321	Bacteria	92614
398	Ga0214545_1000118	3300021324	Bacteria	92737
399	Ga0214543_1000009	3300021327	Bacteria	384302
400	Ga0213872_10022262	3300021361	Bacteria	2919
401	Ga0213876_10073562	3300021384	Bacteria	1805
402	Ga0213876_10078860	3300021384	Bacteria	1740
403	Ga0209563_101733	3300025230	Bacteria	5500
404	Ga0209677_100395	3300025253	Bacteria	26466
405	Ga0209148_1000388	3300025254	Bacteria	52495
406	Ga0209148_1007027	3300025254	Bacteria	2376
407	Ga0209148_1013660	3300025254	Bacteria	1455
408	Ga0209233_1000949	3300025261	Bacteria	12587
409	Ga0209233_1002242	3300025261	Bacteria	7224
410	Ga0209233_1002405	3300025261	Bacteria	6911
411	Ga0209455_1007359	3300025272	Bacteria	3119
412	Ga0209455_1011518	3300025272	Bacteria	2171
413	Ga0209564_1001154	3300025295	Bacteria	30904
414	Ga0209564_1018635	3300025295	Bacteria	2635
415	Ga0209564_1042893	3300025295	Bacteria	1193
416	Ga0209758_1000030	3300025297	Bacteria	509217
417	Ga0209758_1000244	3300025297	Bacteria	112497
418	Ga0209758_1000429	3300025297	Bacteria	71157
419	Ga0209758_1001015	3300025297	Bacteria	37162
420	Ga0209758_1002652	3300025297	Bacteria	17708
421	Ga0209758_1003562	3300025297	Bacteria	14000
422	Ga0209758_1009019	3300025297	Bacteria	6302
423	Ga0209758_1026000	3300025297	Bacteria	2549
424	Ga0209758_1028037	3300025297	Bacteria	2392
425	Ga0209758_1059515	3300025297	Bacteria	1270
426	Ga0209256_1003190	3300025299	Bacteria	11867
427	Ga0209256_1038858	3300025299	Bacteria	1229
428	Ga0207426_1000347	3300025302	Bacteria	85420
429	Ga0207426_1001408	3300025302	Bacteria	20164
430	Ga0207426_1003607	3300025302	Bacteria	8216
431	Ga0207426_1033328	3300025302	Bacteria	1661
432	Ga0207426_1045021	3300025302	Bacteria	1345
433	Ga0209257_1004526	3300025304	Bacteria	10674
434	Ga0209257_1021877	3300025304	Bacteria	2303
435	Ga0207697_10013891	3300025315	Bacteria	3353
436	Ga0207656_10009178	3300025321	Bacteria	3668
437	Ga0207656_10024823	3300025321	Bacteria	2428
438	Ga0207656_10050211	3300025321	Bacteria	1800
439	Ga0207656_10064532	3300025321	Bacteria	1614
440	Ga0207696_1025943	3300025711	Bacteria	1819
441	Ga0207692_10000213	3300025898	Bacteria	19497
442	Ga0207692_10014346	3300025898	Bacteria	3461
443	Ga0207692_10041308	3300025898	Bacteria	2282
444	Ga0207692_10041845	3300025898	Bacteria	2271
445	Ga0207710_10076199	3300025900	Bacteria	1547
446	Ga0207688_10038692	3300025901	Bacteria	2648
447	Ga0207688_10053300	3300025901	Bacteria	2268
448	Ga0207688_10155497	3300025901	Bacteria	1353
449	Ga0207647_10001412	3300025904	Bacteria	18439
450	Ga0207647_10181563	3300025904	Bacteria	1222
451	Ga0207685_10037724	3300025905	Bacteria	1782
452	Ga0207685_10071066	3300025905	Bacteria	1411
453	Ga0207685_10110502	3300025905	Bacteria	1191
454	Ga0207699_10022158	3300025906	Bacteria	3438
455	Ga0207699_10035469	3300025906	Bacteria	2838
456	Ga0207699_10035638	3300025906	Bacteria	2832
457	Ga0207699_10072028	3300025906	Bacteria	2115
458	Ga0207699_10093553	3300025906	Bacteria	1892
459	Ga0207645_10013680	3300025907	Bacteria	5458
460	Ga0207645_10016597	3300025907	Bacteria	4871
461	Ga0207705_10034575	3300025909	Bacteria	3614
462	Ga0207705_10066688	3300025909	Bacteria	2603
463	Ga0207705_10159708	3300025909	Bacteria	1693
464	Ga0207684_10217473	3300025910	Bacteria	1649
465	Ga0207684_10250135	3300025910	Bacteria	1529
466	Ga0207654_10000073	3300025911	Bacteria	66148
467	Ga0207654_10015682	3300025911	Bacteria	3937
468	Ga0207654_10111218	3300025911	Bacteria	1705
469	Ga0207707_10000398	3300025912	Bacteria	45384
470	Ga0207707_10024840	3300025912	Bacteria	5241
471	Ga0207707_10074339	3300025912	Bacteria	2964
472	Ga0207707_10081956	3300025912	Bacteria	2816
473	Ga0207707_10465165	3300025912	Bacteria	1081
474	Ga0207695_10000006	3300025913	Bacteria	1135309
475	Ga0207695_10000366	3300025913	Bacteria	103345
476	Ga0207695_10141453	3300025913	Bacteria	2354
477	Ga0207695_10225317	3300025913	Bacteria	1781
478	Ga0207695_10421609	3300025913	Bacteria	1219
479	Ga0207671_10018633	3300025914	Bacteria	5320
480	Ga0207671_10022715	3300025914	Bacteria	4739
481	Ga0207671_10040175	3300025914	Bacteria	3463
482	Ga0207671_10064637	3300025914	Bacteria	2720
483	Ga0207671_10104325	3300025914	Bacteria	2150
484	Ga0207671_10163379	3300025914	Bacteria	1725
485	Ga0207671_10199258	3300025914	Bacteria	1563
486	Ga0207693_10000988	3300025915	Bacteria	25527
487	Ga0207693_10002485	3300025915	Bacteria	16030
488	Ga0207693_10015350	3300025915	Bacteria	6146
489	Ga0207693_10025307	3300025915	Bacteria	4706
490	Ga0207693_10058273	3300025915	Bacteria	3026
491	Ga0207663_10000167	3300025916	Bacteria	29694
492	Ga0207663_10009487	3300025916	Bacteria	5142
493	Ga0207663_10018460	3300025916	Bacteria	3909
494	Ga0207663_10031494	3300025916	Bacteria	3140
495	Ga0207663_10080238	3300025916	Bacteria	2133
496	Ga0207663_10280014	3300025916	Bacteria	1238
497	Ga0207663_10371905	3300025916	Bacteria	1087
498	Ga0207663_10660007	3300025916	Unclassified	826
499	Ga0207660_10071421	3300025917	Bacteria	2526
500	Ga0207660_10095433	3300025917	Bacteria	2213
501	Ga0207660_10110346	3300025917	Bacteria	2069
502	Ga0207660_10606324	3300025917	Bacteria	892
503	Ga0207662_10098936	3300025918	Bacteria	1805
504	Ga0207662_10173765	3300025918	Bacteria	1383
505	Ga0207657_10020195	3300025919	Bacteria	6302
506	Ga0207657_10025649	3300025919	Bacteria	5431
507	Ga0207657_10102062	3300025919	Bacteria	2380
508	Ga0207649_10207496	3300025920	Bacteria	1388
509	Ga0207652_10020573	3300025921	Bacteria	5437
510	Ga0207652_10041401	3300025921	Bacteria	3916
511	Ga0207652_10074840	3300025921	Bacteria	2949
512	Ga0207652_10108192	3300025921	Bacteria	2463
513	Ga0207652_10269290	3300025921	Bacteria	1536
514	Ga0207652_10278511	3300025921	Bacteria	1509
515	Ga0207652_10572921	3300025921	Bacteria	1014
516	Ga0207646_10038053	3300025922	Bacteria	4335
517	Ga0207694_10000139	3300025924	Bacteria	74561
518	Ga0207694_10000268	3300025924	Bacteria	49480
519	Ga0207694_10012864	3300025924	Bacteria	6302
520	Ga0207694_10047790	3300025924	Bacteria	3309
521	Ga0207694_10069942	3300025924	Bacteria	2742
522	Ga0207694_10092521	3300025924	Bacteria	2387
523	Ga0207694_10137548	3300025924	Bacteria	1963
524	Ga0207694_10297542	3300025924	Bacteria	1328
525	Ga0207650_10007124	3300025925	Bacteria	7619
526	Ga0207650_10354078	3300025925	Bacteria	1208
527	Ga0207659_10239360	3300025926	Bacteria	1467
528	Ga0207659_10256029	3300025926	Bacteria	1422
529	Ga0207687_10261685	3300025927	Bacteria	1379
530	Ga0207700_10012800	3300025928	Bacteria	5426
531	Ga0207700_10047186	3300025928	Bacteria	3191
532	Ga0207700_10219765	3300025928	Bacteria	1610
533	Ga0207664_10004015	3300025929	Bacteria	9921
534	Ga0207664_10030499	3300025929	Bacteria	4118
535	Ga0207664_10031795	3300025929	Bacteria	4041
536	Ga0207664_10242529	3300025929	Bacteria	1570
537	Ga0207664_10341243	3300025929	Bacteria	1324
538	Ga0207644_10027851	3300025931	Bacteria	3906
539	Ga0207644_10168820	3300025931	Bacteria	1706
540	Ga0207690_10042002	3300025932	Bacteria	3000
541	Ga0207690_10173769	3300025932	Bacteria	1616
542	Ga0207690_10223202	3300025932	Bacteria	1443
543	Ga0207690_10391846	3300025932	Bacteria	1106
544	Ga0207706_10034285	3300025933	Bacteria	4516
545	Ga0207706_10037506	3300025933	Bacteria	4303
546	Ga0207706_10042290	3300025933	Bacteria	4039
547	Ga0207706_10299216	3300025933	Bacteria	1402
548	Ga0207709_10240492	3300025935	Bacteria	1317
549	Ga0207709_10315345	3300025935	Bacteria	1168
550	Ga0207670_10001179	3300025936	Bacteria	13801
551	Ga0207669_10054912	3300025937	Bacteria	2409
552	Ga0207665_10001098	3300025939	Bacteria	18235
553	Ga0207665_10020658	3300025939	Bacteria	4328
554	Ga0207665_10095577	3300025939	Bacteria	2065
555	Ga0207691_10126014	3300025940	Bacteria	2266
556	Ga0207691_10248522	3300025940	Bacteria	1536
557	Ga0207691_10307161	3300025940	Bacteria	1362
558	Ga0207711_10063867	3300025941	Bacteria	3179
559	Ga0207711_10348779	3300025941	Bacteria	1370
560	Ga0207711_10437715	3300025941	Bacteria	1217
561	Ga0207689_10046448	3300025942	Bacteria	3589
562	Ga0207689_10059449	3300025942	Bacteria	3144
563	Ga0207689_10378252	3300025942	Bacteria	1179
564	Ga0207689_10557055	3300025942	Bacteria	963
565	Ga0207661_10010897	3300025944	Bacteria	6562
566	Ga0207661_10025129	3300025944	Bacteria	4525
567	Ga0207661_10077750	3300025944	Bacteria	2730
568	Ga0207661_10214548	3300025944	Bacteria	1698
569	Ga0207661_10464035	3300025944	Bacteria	1155
570	Ga0207667_10015832	3300025949	Bacteria	8547
571	Ga0207667_10020820	3300025949	Bacteria	7283
572	Ga0207667_10027659	3300025949	Bacteria	6169
573	Ga0207667_10193848	3300025949	Bacteria	2085
574	Ga0207667_10240719	3300025949	Bacteria	1852
575	Ga0207667_10241536	3300025949	Bacteria	1848
576	Ga0207651_10077236	3300025960	Bacteria	2383
577	Ga0207712_10026052	3300025961	Bacteria	3892
578	Ga0207712_10247087	3300025961	Bacteria	1440
579	Ga0207712_10278130	3300025961	Bacteria	1365
580	Ga0207668_10168527	3300025972	Bacteria	1715
581	Ga0207640_10006813	3300025981	Bacteria	6283
582	Ga0207640_10009040	3300025981	Bacteria	5559
583	Ga0207640_10188839	3300025981	Bacteria	1551
584	Ga0207658_10254264	3300025986	Bacteria	1494
585	Ga0207703_10431582	3300026035	Bacteria	1228
586	Ga0207639_10007864	3300026041	Bacteria	7282
587	Ga0207639_10031296	3300026041	Bacteria	3909
588	Ga0207639_10038411	3300026041	Bacteria	3560
589	Ga0207639_10553146	3300026041	Bacteria	1057
590	Ga0207678_10022674	3300026067	Bacteria	5498
591	Ga0207678_10065204	3300026067	Bacteria	3128
592	Ga0207678_10161549	3300026067	Bacteria	1913
593	Ga0207678_10203241	3300026067	Bacteria	1694
594	Ga0207678_10315737	3300026067	Bacteria	1344
595	Ga0207678_10423358	3300026067	Bacteria	1155
596	Ga0207708_10026796	3300026075	Bacteria	4364
597	Ga0207708_10088023	3300026075	Bacteria	2392
598	Ga0207708_10121651	3300026075	Bacteria	2034
599	Ga0207702_10000491	3300026078	Bacteria	44501
600	Ga0207702_10000623	3300026078	Bacteria	38970
601	Ga0207702_10012083	3300026078	Bacteria	7181
602	Ga0207648_10066672	3300026089	Bacteria	3139
603	Ga0207648_10089470	3300026089	Bacteria	2689
604	Ga0207648_10168517	3300026089	Bacteria	1935
605	Ga0207676_10241379	3300026095	Bacteria	1621
606	Ga0207676_10264546	3300026095	Bacteria	1554
607	Ga0207674_10008730	3300026116	Bacteria	11666
608	Ga0207674_10008835	3300026116	Bacteria	11595
609	Ga0207674_10104282	3300026116	Bacteria	2814
610	Ga0207675_100049103	3300026118	Bacteria	3939
611	Ga0207675_100051860	3300026118	Bacteria	3828
612	Ga0207683_10057950	3300026121	Bacteria	3400
613	Ga0207683_10152762	3300026121	Bacteria	2084
614	Ga0207683_10189387	3300026121	Bacteria	1867
615	Ga0207683_10227508	3300026121	Bacteria	1700
616	Ga0207683_10332020	3300026121	Bacteria	1394
617	Ga0207683_10370364	3300026121	Bacteria	1316
618	Ga0207683_10543238	3300026121	Bacteria	1074
619	Ga0207698_10037777	3300026142	Bacteria	3560
620	Ga0207698_10071940	3300026142	Bacteria	2746
621	Ga0207698_10102378	3300026142	Bacteria	2377
622	Ga0207698_10357754	3300026142	Bacteria	1381
623	Ga0207698_10359651	3300026142	Bacteria	1378
624	Ga0209389_1000015	3300027296	Bacteria	188311
625	Ga0209389_1000035	3300027296	Bacteria	127089
626	Ga0209589_1000015	3300027357	Bacteria	225913
627	Ga0209589_1000039	3300027357	Bacteria	127084
628	Ga0209489_100015	3300027361	Bacteria	225913
629	Ga0209489_100072	3300027361	Bacteria	138111
630	Ga0209489_100084	3300027361	Bacteria	127094
631	Ga0209700_100025	3300027363	Bacteria	225913
632	Ga0209700_100034	3300027363	Bacteria	197276
633	Ga0209588_1040375	3300027671	Bacteria	1506
634	Ga0209813_10006026	3300027866	Bacteria	2974
635	Ga0209813_10031087	3300027866	Bacteria	1574
636	Ga0209813_10039005	3300027866	Bacteria	1438
637	Ga0207428_10000075	3300027907	Bacteria	137887
638	Ga0268266_10007778	3300028379	Bacteria	9611
639	Ga0268266_10008893	3300028379	Bacteria	8891
640	Ga0268266_10028190	3300028379	Bacteria	4775
641	Ga0268266_10031660	3300028379	Bacteria	4492
642	Ga0268266_10138212	3300028379	Bacteria	2184
643	Ga0268266_10157078	3300028379	Bacteria	2055
644	Ga0268266_10629203	3300028379	Bacteria	1032
645	Ga0268265_10092645	3300028380	Bacteria	2419
646	Ga0268265_10347269	3300028380	Bacteria	1353
647	Ga0268265_10433165	3300028380	Bacteria	1224
648	Ga0268264_10000107	3300028381	Bacteria	209105
649	Ga0265326_10037323	3300028558	Bacteria	1381
650	Ga0265334_10001242	3300028573	Bacteria	12451
651	Ga0265334_10048093	3300028573	Bacteria	1644
652	Ga0265318_10009393	3300028577	Bacteria	4302
653	Ga0265323_10001035	3300028653	Bacteria	14454
654	Ga0265336_10000363	3300028666	Bacteria	29266
655	Ga0307517_10001780	3300028786	Bacteria	35475
656	Ga0307517_10066118	3300028786	Bacteria	3333
657	Ga0307515_10054512	3300028794	Bacteria	5868
658	Ga0265338_10000155	3300028800	Bacteria	125121
659	Ga0265338_10056737	3300028800	Bacteria	3469
660	Ga0265338_10137204	3300028800	Bacteria	1921
661	Ga0265324_10021334	3300029957	Bacteria	2323
662	Ga0265330_10031674	3300031235	Bacteria	2370
663	Ga0265332_10000310	3300031238	Bacteria	37390
664	Ga0265332_10006675	3300031238	Bacteria	5226
665	Ga0265328_10085880	3300031239	Bacteria	1161
666	Ga0265325_10001027	3300031241	Bacteria	20100
667	Ga0265325_10052001	3300031241	Bacteria	2104
668	Ga0265325_10121447	3300031241	Bacteria	1259
669	Ga0265340_10006782	3300031247	Bacteria	6268
670	Ga0265340_10081324	3300031247	Bacteria	1525
671	Ga0265339_10001481	3300031249	Bacteria	17344
672	Ga0265339_10002695	3300031249	Bacteria	12629
673	Ga0265339_10007467	3300031249	Bacteria	7065
674	Ga0265339_10048991	3300031249	Bacteria	2315
675	Ga0265316_10036469	3300031344	Bacteria	3976
676	Ga0265316_10058717	3300031344	Bacteria	2995
677	Ga0265316_10410645	3300031344	Bacteria	974
678	Ga0307513_10175747	3300031456	Bacteria	2012
679	Ga0265313_10010197	3300031595	Bacteria	5988
680	Ga0265313_10021808	3300031595	Bacteria	3493
681	Ga0307508_10000088	3300031616	Bacteria	107883
682	Ga0307508_10033626	3300031616	Bacteria	4628
683	Ga0307508_10070792	3300031616	Bacteria	3061
684	Ga0265314_10001108	3300031711	Bacteria	31108
685	Ga0265314_10005031	3300031711	Bacteria	12046
686	Ga0265314_10012625	3300031711	Bacteria	6877
687	Ga0265314_10013803	3300031711	Bacteria	6506
688	Ga0265314_10059605	3300031711	Bacteria	2610
689	Ga0265314_10102993	3300031711	Bacteria	1830
690	Ga0265342_10000175	3300031712	Bacteria	71083
691	Ga0265342_10010995	3300031712	Bacteria	6217
692	Ga0265342_10061698	3300031712	Bacteria	2208
693	Ga0307516_10042852	3300031730	Bacteria	4487
694	Ga0307516_10112713	3300031730	Bacteria	2519
695	Ga0307516_10134300	3300031730	Bacteria	2251
696	Ga0307516_10297534	3300031730	Bacteria	1290
697	Ga0307405_10205624	3300031731	Bacteria	1433
698	Ga0307413_10201762	3300031824	Bacteria	1437
699	Ga0307412_10018506	3300031911	Bacteria	4194
700	Ga0307416_100928346	3300032002	Bacteria	971
701	Ga0307411_10317668	3300032005	Bacteria	1256
702	Ga0307415_100069402	3300032126	Bacteria	2471
703	Ga0307507_10068020	3300033179	Bacteria	3253
704	Ga0307507_10188468	3300033179	Bacteria	1456
705	Ga0307510_10017889	3300033180	Bacteria	8351
706	Ga0307510_10076564	3300033180	Bacteria	3290
707	Ga0307510_10109954	3300033180	Bacteria	2503
708	Ga0307510_10112752	3300033180	Bacteria	2455
709	Ga0315911_1000021	3300033442	Bacteria	124874
710	Ga0373930_0013343	3300034816	Bacteria	1513
711	Ga0373926_0004478	3300035083	Bacteria	4583
712	Ga0373926_0006042	3300035083	Bacteria	4009
713	Ga0373929_0006342	3300035085	Bacteria	2137
714	Ga0373934_0010050	3300035086	Bacteria	3552
715	Ga0373934_0156353	3300035086	Bacteria	935
716	Ga0373944_0058617	3300035089	Bacteria	1230
717	Ga0373952_0018253	3300035092	Bacteria	1450
718	Ga0373923_0000546	3300035111	Bacteria	9199
719	Ga0373923_0003227	3300035111	Bacteria	5189
720	Ga0373923_0127209	3300035111	Bacteria	1142
721	Ga0373936_0001304	3300035113	Bacteria	9034
722	Ga0373936_0018861	3300035113	Bacteria	2668
723	Ga0373936_0020991	3300035113	Bacteria	2539
724	Ga0373936_0028659	3300035113	Bacteria	2190
725	Ga0373936_0050938	3300035113	Bacteria	1675
726	Ga0373936_0188336	3300035113	Bacteria	907
727	Ga0373939_0098764	3300035114	Bacteria	999
728	Ga0373945_0001809	3300035116	Bacteria	6605
729	Ga0373945_0019921	3300035116	Bacteria	2293
730	Ga0373945_0149220	3300035116	Bacteria	947
731	Ga0373953_0003851	3300035117	Bacteria	4724
732	Ga0373953_0063189	3300035117	Bacteria	1517
733	Ga0373953_0115928	3300035117	Bacteria	1135
734	Ga0373954_0000782	3300035118	Bacteria	12269
735	Ga0373954_0002635	3300035118	Bacteria	7550
736	Ga0373954_0007817	3300035118	Bacteria	4683
737	Ga0373956_0002869	3300035119	Bacteria	6980
738	Ga0373956_0033694	3300035119	Bacteria	2253
739	Ga0373956_0227759	3300035119	Bacteria	885
740	Ga0373957_0006132	3300035120	Bacteria	3772
741	Ga0373957_0048821	3300035120	Bacteria	1614
742	Ga0373957_0073112	3300035120	Bacteria	1344
743	Ga0373960_0131149	3300035121	Bacteria	841
744	Ga0373943_0001276	3300035170	Bacteria	11264
745	Ga0373943_0014965	3300035170	Bacteria	3521
746	Ga0373943_0030259	3300035170	Bacteria	2561
747	Ga0373943_0034911	3300035170	Bacteria	2401
748	Ga0373943_0043817	3300035170	Bacteria	2175
749	Ga0373943_0079949	3300035170	Bacteria	1674
750	Ga0373943_0108014	3300035170	Bacteria	1464
751	Ga0373943_0142425	3300035170	Bacteria	1293
752	Ga0373943_0150205	3300035170	Bacteria	1262
753	Ga0373946_0002908	3300035171	Bacteria	6078
754	Ga0373946_0012215	3300035171	Bacteria	3211
755	Ga0373955_0000562	3300035172	Bacteria	15770
756	Ga0373955_0002870	3300035172	Bacteria	7557
757	Ga0373955_0003607	3300035172	Bacteria	6807
758	Ga0373955_0010158	3300035172	Bacteria	4437
759	Ga0373955_0034153	3300035172	Bacteria	2683
760	Ga0373955_0043913	3300035172	Bacteria	2405
761	Ga0373955_0090941	3300035172	Bacteria	1739
762	Ga0373955_0201302	3300035172	Bacteria	1185
763	Ga0373924_0001544	3300035410	Bacteria	7518
764	Ga0373924_0020006	3300035410	Bacteria	2598
765	Ga0373924_0041563	3300035410	Bacteria	1884
766	Ga0373924_0080650	3300035410	Bacteria	1384
767	Ga0373924_0106856	3300035410	Bacteria	1207
768	Ga0373931_0001270	3300035691	Bacteria	10778
769	Ga0373931_0009933	3300035691	Bacteria	4560
770	Ga0373931_0009956	3300035691	Bacteria	4556
771	Ga0373931_0218425	3300035691	Bacteria	1147
772	Ga0373935_0000370	3300035692	Bacteria	23018
773	Ga0373935_0006141	3300035692	Bacteria	7147
774	Ga0373935_0009509	3300035692	Bacteria	5816
775	Ga0373935_0022721	3300035692	Bacteria	3850
776	Ga0373935_0032233	3300035692	Bacteria	3255
777	Ga0373935_0196992	3300035692	Bacteria	1390
778	Ga0373935_0211475	3300035692	Bacteria	1344
779	Ga0373927_0000136	3300035695	Bacteria	56656
780	Ga0373927_0012415	3300035695	Bacteria	5671
781	Ga0373927_0017519	3300035695	Bacteria	4712
782	Ga0373927_0024841	3300035695	Bacteria	3916
783	Ga0373927_0110246	3300035695	Bacteria	1793
784	Ga0373927_0114074	3300035695	Bacteria	1761
785	Ga0373927_0114441	3300035695	Bacteria	1758
786	Ga0373927_0227065	3300035695	Bacteria	1226
787	Ga0373927_0305928	3300035695	Bacteria	1046
788	Ga0373933_0001268	3300035724	Bacteria	14904
789	Ga0373933_0003564	3300035724	Bacteria	8646
790	Ga0373933_0006680	3300035724	Bacteria	6286
791	Ga0373933_0020526	3300035724	Bacteria	3746
792	Ga0373933_0026697	3300035724	Bacteria	3318
793	Ga0373933_0031740	3300035724	Bacteria	3065
794	Ga0373933_0475054	3300035724	Bacteria	818
795	Ga0373947_0000476	3300035725	Bacteria	22980
796	Ga0373947_0006037	3300035725	Bacteria	7061
797	Ga0373947_0008188	3300035725	Bacteria	6028
798	Ga0373947_0008868	3300035725	Bacteria	5788
799	Ga0373947_0009170	3300035725	Bacteria	5688
800	Ga0373947_0017246	3300035725	Bacteria	4152
801	Ga0373947_0044456	3300035725	Bacteria	2655
802	Ga0373947_0046999	3300035725	Bacteria	2586
803	Ga0373947_0120506	3300035725	Bacteria	1666
804	Ga0373947_0123863	3300035725	Bacteria	1644
805	Ga0373947_0235397	3300035725	Bacteria	1207
806	Ga0373937_0000009	3300036401	Bacteria	169521
807	Ga0373937_0002423	3300036401	Bacteria	15512
808	Ga0373937_0007853	3300036401	Bacteria	9249
809	Ga0373937_0010217	3300036401	Bacteria	8189
810	Ga0373937_0014444	3300036401	Bacteria	6973
811	Ga0373937_0025760	3300036401	Bacteria	5311
812	Ga0373937_0050181	3300036401	Bacteria	3821
813	Ga0373937_0055730	3300036401	Bacteria	3630
814	Ga0373937_0138012	3300036401	Bacteria	2280
815	Ga0373937_0529525	3300036401	Bacteria	1119
816	Ga0373937_0645839	3300036401	Bacteria	1003
817	Ga0373925_0000194	3300037068	Bacteria	66124
818	Ga0373925_0000712	3300037068	Bacteria	31050
819	Ga0373925_0001167	3300037068	Bacteria	23303
820	Ga0373925_0026045	3300037068	Bacteria	4276
821	Ga0373925_0040364	3300037068	Bacteria	3455
822	Ga0373925_0041393	3300037068	Bacteria	3415
823	Ga0373925_0042312	3300037068	Bacteria	3379
824	Ga0373925_0047998	3300037068	Bacteria	3180
825	Ga0373925_0063889	3300037068	Bacteria	2770
826	Ga0373925_0113552	3300037068	Bacteria	2095
827	Ga0373925_0180363	3300037068	Bacteria	1671
828	Ga0373925_0402976	3300037068	Bacteria	1116
829	Ga0373925_0607095	3300037068	Bacteria	901
830	Ga0395899_0003623	3300037312	Bacteria	12223
831	Ga0395899_0256156	3300037312	Bacteria	1199
832	Ga0395899_0385853	3300037312	Bacteria	930
833	Ga0395900_0001546	3300037418	Bacteria	27342
834	Ga0395900_0005902	3300037418	Bacteria	12789
835	Ga0395900_0021796	3300037418	Bacteria	6550
836	Ga0395900_0028894	3300037418	Bacteria	5684
837	Ga0395900_0059304	3300037418	Bacteria	3940
838	Ga0395898_0002015	3300037466	Bacteria	25472
839	Ga0395898_0003151	3300037466	Bacteria	18627
840	Ga0395898_0004247	3300037466	Bacteria	15708
841	Ga0395898_0049408	3300037466	Bacteria	4121
842	Ga0395898_0073225	3300037466	Bacteria	3309
843	Ga0395898_0078628	3300037466	Bacteria	3182
844	Ga0395898_0132975	3300037466	Bacteria	2382
845	Ga0395898_0195890	3300037466	Bacteria	1930
846	Ga0395898_0220224	3300037466	Bacteria	1810
847	Ga0395898_0688599	3300037466	Bacteria	964
848	Ga0395905_0003722	3300037471	Bacteria	16157
849	Ga0395905_0051982	3300037471	Bacteria	3837
850	Ga0395905_0182380	3300037471	Bacteria	1971
851	Ga0395905_0348730	3300037471	Bacteria	1372
852	Ga0436364_0739712	3300037853	Bacteria	1174
853	Ga0395901_0001501	3300038443	Bacteria	24244
854	Ga0395901_0013616	3300038443	Bacteria	8270
855	Ga0395901_0083638	3300038443	Bacteria	3336
856	Ga0395901_0132019	3300038443	Bacteria	2624
857	Ga0395901_0212553	3300038443	Bacteria	2024
858	Ga0395901_0555051	3300038443	Bacteria	1164
859	Ga0395901_0565796	3300038443	Bacteria	1150
860	Ga0436365_0074749	3300039437	Bacteria	1955
861	Ga0436365_0613718	3300039437	Bacteria	818
862	Ga0436365_1137755	3300039437	Bacteria	1207
863	Ga0436365_1355613	3300039437	Bacteria	1054
864	Ga0436365_1613453	3300039437	Bacteria	24235
865	Ga0436360_0781541	3300039438	Bacteria	1077
866	Ga0436361_0935166	3300039447	Bacteria	5677
867	Ga0436361_1163319	3300039447	Bacteria	2335
868	Ga0436363_0101344	3300039450	Bacteria	4293
869	Ga0436363_1407757	3300039450	Bacteria	15958
870	Ga0436363_1616350	3300039450	Bacteria	1276
871	Ga0436362_1096840	3300039453	Bacteria	2272
872	Ga0439465_0132101	3300041413	Bacteria	882
873	Ga0451795_1261016	3300041456	Bacteria	1108
874	Ga0451837_0749707	3300041494	Bacteria	995
875	Ga0451853_0202872	3300041512	Bacteria	1261
876	Ga0439434_0059350	3300042435	Bacteria	1194
877	Ga0439459_0030294	3300042438	Bacteria	1097
878	Ga0439459_0042053	3300042438	Bacteria	975
879	Ga0466972_0000048	3300044658	Bacteria	119165
880	Ga0466972_0005127	3300044658	Bacteria	6561
881	Ga0466965_0053207	3300044683	Bacteria	2012
882	Ga0466966_0000542	3300044684	Bacteria	24049
883	Ga0466966_0088054	3300044684	Bacteria	1930
884	Ga0466966_0120118	3300044684	Bacteria	1615
885	Ga0466961_0000018	3300044693	Bacteria	109837
886	Ga0466961_0270924	3300044693	Bacteria	1040
887	Ga0466963_0091736	3300044694	Bacteria	2069
888	Ga0466963_0103933	3300044694	Bacteria	1946
889	Ga0466963_0156078	3300044694	Bacteria	1587
890	Ga0466963_0292157	3300044694	Bacteria	1146
891	Ga0466964_0068768	3300044706	Bacteria	1492
892	Ga0466964_0074500	3300044706	Bacteria	1443
893	Ga0466957_0023546	3300044842	Bacteria	3641
894	Ga0466957_0107617	3300044842	Bacteria	1765
895	Ga0466957_0132101	3300044842	Bacteria	1600
896	Ga0466957_0159328	3300044842	Bacteria	1465
897	Ga0466960_0008711	3300044901	Bacteria	4162
898	Ga0466960_0058540	3300044901	Bacteria	1882
899	Ga0466959_0017920	3300045049	Bacteria	5195
900	Ga0466959_0089033	3300045049	Bacteria	2218
901	Ga0451576_0921308	3300045051	Bacteria	917
902	Ga0466967_0087856	3300045976	Bacteria	2819
903	Ga0466967_0108572	3300045976	Bacteria	2546
904	Ga0466967_0155489	3300045976	Bacteria	2141
905	Ga0466967_0240157	3300045976	Bacteria	1728
906	Ga0495617_024087	3300046452	Bacteria	2055
907	Ga0495617_033375	3300046452	Bacteria	1727
908	Ga0495592_0000018	3300046454	Bacteria	140962
909	Ga0495592_0001707	3300046454	Bacteria	15427
910	Ga0495592_0012511	3300046454	Bacteria	6448
911	Ga0495592_0012614	3300046454	Bacteria	6424
912	Ga0495592_0021768	3300046454	Bacteria	4878
913	Ga0495592_0093013	3300046454	Bacteria	2160
914	Ga0495592_0158342	3300046454	Bacteria	1560
915	Ga0495603_0000019	3300046455	Bacteria	65316
916	Ga0495603_0019786	3300046455	Bacteria	4075
917	Ga0495603_0020915	3300046455	Bacteria	3961
918	Ga0495603_0073031	3300046455	Bacteria	2016
919	Ga0495603_0095347	3300046455	Bacteria	1738
920	Ga0495603_0097223	3300046455	Bacteria	1720
921	Ga0495603_0139598	3300046455	Bacteria	1410
922	Ga0495590_0097283	3300046457	Bacteria	1044
923	Ga0495629_0000151	3300046459	Bacteria	60632
924	Ga0495629_0002944	3300046459	Bacteria	12975
925	Ga0495629_0004511	3300046459	Bacteria	10415
926	Ga0495629_0004909	3300046459	Bacteria	10038
927	Ga0495629_0007816	3300046459	Bacteria	7866
928	Ga0495629_0067242	3300046459	Bacteria	2501
929	Ga0495629_0099921	3300046459	Bacteria	2025
930	Ga0495629_0123681	3300046459	Bacteria	1802
931	Ga0495638_0037800	3300046460	Bacteria	3070
932	Ga0495638_0041794	3300046460	Bacteria	2898
933	Ga0495641_0096739	3300046461	Bacteria	1318
934	Ga0495651_0001421	3300046462	Bacteria	18588
935	Ga0495651_0002271	3300046462	Bacteria	14833
936	Ga0495651_0003743	3300046462	Bacteria	11639
937	Ga0495651_0043692	3300046462	Bacteria	3476
938	Ga0495653_0000032	3300046463	Bacteria	132763
939	Ga0495653_0002496	3300046463	Bacteria	14645
940	Ga0495653_0004360	3300046463	Bacteria	11448
941	Ga0495653_0054417	3300046463	Bacteria	3058
942	Ga0495653_0110823	3300046463	Bacteria	1972
943	Ga0495653_0117920	3300046463	Bacteria	1896
944	Ga0495653_0182379	3300046463	Bacteria	1439
945	Ga0495580_0001229	3300046472	Bacteria	22603
946	Ga0495580_0007090	3300046472	Bacteria	9031
947	Ga0495580_0101222	3300046472	Bacteria	2004
948	Ga0495580_0205628	3300046472	Bacteria	1356
949	Ga0495582_0000019	3300046473	Bacteria	91143
950	Ga0495582_0004005	3300046473	Bacteria	8272
951	Ga0495582_0045379	3300046473	Bacteria	2420
952	Ga0495582_0062134	3300046473	Bacteria	2063
953	Ga0495639_0000159	3300046475	Bacteria	34872
954	Ga0495639_0008336	3300046475	Bacteria	4446
955	Ga0495639_0106261	3300046475	Bacteria	1329
956	Ga0495639_0124351	3300046475	Bacteria	1232
957	Ga0495639_0157614	3300046475	Bacteria	1097
958	Ga0495639_0199968	3300046475	Bacteria	978
959	Ga0495662_0000798	3300046476	Bacteria	15288
960	Ga0495662_0007510	3300046476	Bacteria	5385
961	Ga0495662_0024614	3300046476	Bacteria	2905
962	Ga0495662_0042144	3300046476	Bacteria	2203
963	Ga0495662_0054571	3300046476	Bacteria	1931
964	Ga0495662_0094274	3300046476	Bacteria	1462
965	Ga0495664_0000010	3300046477	Bacteria	268381
966	Ga0495664_0001526	3300046477	Bacteria	12255
967	Ga0495664_0004893	3300046477	Bacteria	7329
968	Ga0495664_0040201	3300046477	Bacteria	2764
969	Ga0495664_0253965	3300046477	Bacteria	1063
970	Ga0495585_0113711	3300046492	Bacteria	1437
971	Ga0495594_0000235	3300046499	Bacteria	26790
972	Ga0495594_0015471	3300046499	Bacteria	4008
973	Ga0495594_0049014	3300046499	Bacteria	2321
974	Ga0495594_0101590	3300046499	Bacteria	1618
975	Ga0495607_0135642	3300046501	Bacteria	1275
976	Ga0495607_0248124	3300046501	Bacteria	858
977	Ga0495607_0271467	3300046501	Bacteria	808
978	Ga0495583_0054928	3300046506	Bacteria	1802
979	Ga0495606_0018376	3300046507	Bacteria	5244
980	Ga0495608_0000008	3300046511	Bacteria	268629
981	Ga0495608_0009086	3300046511	Bacteria	6949
982	Ga0495608_0010956	3300046511	Bacteria	6320
983	Ga0495608_0042345	3300046511	Bacteria	3045
984	Ga0495608_0066128	3300046511	Bacteria	2367
985	Ga0495608_0085652	3300046511	Bacteria	2042
986	Ga0495608_0135589	3300046511	Bacteria	1573
987	Ga0495608_0277069	3300046511	Bacteria	1042
988	Ga0495610_0066012	3300046512	Bacteria	1706
989	Ga0495616_0138859	3300046513	Bacteria	1108
990	Ga0495618_0000002	3300046514	Bacteria	271353
991	Ga0495618_0006484	3300046514	Bacteria	7105
992	Ga0495618_0011411	3300046514	Bacteria	5387
993	Ga0495618_0024952	3300046514	Bacteria	3708
994	Ga0495618_0028607	3300046514	Bacteria	3475
995	Ga0495618_0033917	3300046514	Bacteria	3200
996	Ga0495618_0071081	3300046514	Bacteria	2214
997	Ga0495620_0041698	3300046515	Bacteria	2011
998	Ga0495620_0103999	3300046515	Bacteria	1130
999	Ga0495620_0124738	3300046515	Bacteria	1013
1000	Ga0495628_0000009	3300046516	Bacteria	237611
1001	Ga0495628_0017439	3300046516	Bacteria	5978
1002	Ga0495628_0030614	3300046516	Bacteria	4357
1003	Ga0495628_0034223	3300046516	Bacteria	4088
1004	Ga0495628_0085481	3300046516	Bacteria	2447
1005	Ga0495628_0112659	3300046516	Bacteria	2091
1006	Ga0495628_0117915	3300046516	Bacteria	2038
1007	Ga0495628_0124343	3300046516	Bacteria	1977
1008	Ga0495628_0379038	3300046516	Bacteria	1036
1009	Ga0495630_0012646	3300046517	Bacteria	6133
1010	Ga0495630_0034537	3300046517	Bacteria	3776
1011	Ga0495630_0036438	3300046517	Bacteria	3677
1012	Ga0495630_0090128	3300046517	Bacteria	2317
1013	Ga0495632_0038844	3300046519	Bacteria	2407
1014	Ga0495632_0057732	3300046519	Bacteria	1894
1015	Ga0495643_0056419	3300046522	Bacteria	2097
1016	Ga0495648_0008002	3300046524	Bacteria	8382
1017	Ga0495648_0032290	3300046524	Bacteria	3437
1018	Ga0495648_0110531	3300046524	Bacteria	1497
1019	Ga0495663_0037551	3300046525	Bacteria	1461
1020	Ga0495666_0015247	3300046526	Bacteria	3828
1021	Ga0495666_0015834	3300046526	Bacteria	3757
1022	Ga0495666_0023817	3300046526	Bacteria	3028
1023	Ga0495666_0035197	3300046526	Bacteria	2442
1024	Ga0495666_0082792	3300046526	Bacteria	1517
1025	Ga0495652_0000011	3300046529	Bacteria	255329
1026	Ga0495652_0005932	3300046529	Bacteria	11427
1027	Ga0495652_0013238	3300046529	Bacteria	7425
1028	Ga0495652_0031261	3300046529	Bacteria	4663
1029	Ga0495652_0059519	3300046529	Bacteria	3232
1030	Ga0495652_0079112	3300046529	Bacteria	2719
1031	Ga0495652_0081149	3300046529	Bacteria	2676
1032	Ga0495652_0095084	3300046529	Bacteria	2429
1033	Ga0495652_0151908	3300046529	Bacteria	1808
1034	Ga0495652_0239640	3300046529	Bacteria	1351
1035	Ga0495652_0261358	3300046529	Bacteria	1278
1036	Ga0495652_0347961	3300046529	Bacteria	1063
1037	Ga0495665_0000093	3300046531	Bacteria	40936
1038	Ga0495665_0014223	3300046531	Bacteria	4293
1039	Ga0495665_0074081	3300046531	Bacteria	1793
1040	Ga0495665_0154737	3300046531	Bacteria	1196
1041	Ga0495665_0296919	3300046531	Bacteria	828
1042	Ga0495640_0000009	3300046533	Bacteria	217086
1043	Ga0495640_0005573	3300046533	Bacteria	10012
1044	Ga0495640_0016246	3300046533	Bacteria	5572
1045	Ga0495640_0028396	3300046533	Bacteria	4029
1046	Ga0495640_0030012	3300046533	Bacteria	3897
1047	Ga0495640_0047463	3300046533	Bacteria	2972
1048	Ga0495640_0053002	3300046533	Bacteria	2783
1049	Ga0495640_0055706	3300046533	Bacteria	2704
1050	Ga0495640_0071352	3300046533	Bacteria	2331
1051	Ga0495586_0008408	3300046535	Bacteria	5492
1052	Ga0495586_0327115	3300046535	Bacteria	879
1053	Ga0495587_0000006	3300046536	Bacteria	310070
1054	Ga0495587_0000506	3300046536	Bacteria	27235
1055	Ga0495587_0002440	3300046536	Bacteria	12404
1056	Ga0495587_0007877	3300046536	Bacteria	6883
1057	Ga0495587_0037295	3300046536	Bacteria	2919
1058	Ga0495587_0084226	3300046536	Bacteria	1841
1059	Ga0495609_0033713	3300046538	Bacteria	2324
1060	Ga0495645_0000010	3300046543	Bacteria	238337
1061	Ga0495645_0021985	3300046543	Bacteria	4613
1062	Ga0495645_0061565	3300046543	Bacteria	2719
1063	Ga0495645_0204252	3300046543	Bacteria	1338
1064	Ga0495622_0000571	3300046557	Bacteria	22078
1065	Ga0495622_0019879	3300046557	Bacteria	3125
1066	Ga0495622_0023862	3300046557	Bacteria	2853
1067	Ga0495622_0091959	3300046557	Bacteria	1393
1068	Ga0495667_0000005	3300046559	Bacteria	268252
1069	Ga0495667_0003140	3300046559	Bacteria	11081
1070	Ga0495667_0009574	3300046559	Bacteria	6567
1071	Ga0495667_0013469	3300046559	Bacteria	5536
1072	Ga0495667_0043495	3300046559	Bacteria	2976
1073	Ga0495667_0052181	3300046559	Bacteria	2695
1074	Ga0495667_0059712	3300046559	Bacteria	2502
1075	Ga0495667_0153881	3300046559	Bacteria	1480
1076	Ga0495656_0042493	3300046615	Bacteria	1903
1077	Ga0495656_0084530	3300046615	Bacteria	1439
1078	Ga0495668_0033637	3300046616	Bacteria	2878
1079	Ga0495668_0036159	3300046616	Bacteria	2768
1080	Ga0495634_0000223	3300046642	Bacteria	53103
1081	Ga0495634_0003979	3300046642	Bacteria	11723
1082	Ga0495634_0004199	3300046642	Bacteria	11374
1083	Ga0495634_0007380	3300046642	Bacteria	8271
1084	Ga0495634_0108273	3300046642	Bacteria	1789
1085	Ga0495634_0238770	3300046642	Bacteria	1115
1086	Ga0495611_0056145	3300046648	Bacteria	1782
1087	Ga0495635_0000008	3300046663	Bacteria	268349
1088	Ga0495635_0000322	3300046663	Bacteria	30913
1089	Ga0495635_0001817	3300046663	Bacteria	14418
1090	Ga0495635_0002995	3300046663	Bacteria	11592
1091	Ga0495635_0007866	3300046663	Bacteria	7445
1092	Ga0495635_0016971	3300046663	Bacteria	5085
1093	Ga0495635_0030948	3300046663	Bacteria	3717
1094	Ga0495635_0046009	3300046663	Bacteria	3010
1095	Ga0495635_0088770	3300046663	Bacteria	2115
1096	Ga0495635_0176123	3300046663	Bacteria	1454
1097	Ga0495635_0195046	3300046663	Bacteria	1374
1098	Ga0495659_0085848	3300046664	Bacteria	1201
1099	Ga0495661_0086635	3300046665	Bacteria	1792
1100	Ga0495588_0010061	3300046674	Bacteria	4385
1101	Ga0495588_0021433	3300046674	Bacteria	3184
1102	Ga0495588_0047660	3300046674	Bacteria	2200
1103	Ga0495588_0117824	3300046674	Bacteria	1399
1104	Ga0495657_0000058	3300046675	Bacteria	97827
1105	Ga0495657_0005003	3300046675	Bacteria	10533
1106	Ga0495657_0008039	3300046675	Bacteria	8087
1107	Ga0495657_0016257	3300046675	Bacteria	5424
1108	Ga0495657_0041298	3300046675	Bacteria	3157
1109	Ga0495657_0113284	3300046675	Bacteria	1716
1110	Ga0495599_0000007	3300046678	Bacteria	236638
1111	Ga0495599_0010948	3300046678	Bacteria	5562
1112	Ga0495599_0014770	3300046678	Bacteria	4834
1113	Ga0495599_0037298	3300046678	Bacteria	3053
1114	Ga0495599_0039264	3300046678	Bacteria	2974
1115	Ga0495599_0068418	3300046678	Bacteria	2217
1116	Ga0495599_0106999	3300046678	Bacteria	1742
1117	Ga0495599_0116770	3300046678	Bacteria	1660
1118	Ga0495599_0149989	3300046678	Bacteria	1444
1119	Ga0495623_0000085	3300046679	Bacteria	55527
1120	Ga0495623_0003225	3300046679	Bacteria	10770
1121	Ga0495623_0003342	3300046679	Bacteria	10604
1122	Ga0495623_0003554	3300046679	Bacteria	10313
1123	Ga0495623_0026492	3300046679	Bacteria	3732
1124	Ga0495646_0000021	3300046680	Bacteria	115358
1125	Ga0495646_0001883	3300046680	Bacteria	12611
1126	Ga0495646_0018133	3300046680	Bacteria	4458
1127	Ga0495646_0057797	3300046680	Bacteria	2320
1128	Ga0495646_0070591	3300046680	Bacteria	2057
1129	Ga0495647_0000250	3300046681	Bacteria	14710
1130	Ga0495647_0015774	3300046681	Bacteria	2651
1131	Ga0495647_0146379	3300046681	Bacteria	1010
1132	Ga0495658_0000054	3300046683	Bacteria	57414
1133	Ga0495658_0023308	3300046683	Bacteria	3285
1134	Ga0495658_0049156	3300046683	Bacteria	2381
1135	Ga0495658_0106935	3300046683	Bacteria	1677
1136	Ga0495658_0128357	3300046683	Bacteria	1541
1137	Ga0495658_0133840	3300046683	Bacteria	1511
1138	Ga0495658_0166900	3300046683	Bacteria	1360
1139	Ga0495669_0014235	3300046684	Bacteria	3401
1140	Ga0495613_0002331	3300046689	Bacteria	14372
1141	Ga0495613_0024630	3300046689	Bacteria	4485
1142	Ga0495613_0036558	3300046689	Bacteria	3642
1143	Ga0495613_0060566	3300046689	Bacteria	2772
1144	Ga0495613_0085459	3300046689	Bacteria	2289
1145	Ga0495613_0090682	3300046689	Bacteria	2214
1146	Ga0495613_0099756	3300046689	Bacteria	2098
1147	Ga0495624_0004090	3300046690	Bacteria	10731
1148	Ga0495624_0007986	3300046690	Bacteria	7417
1149	Ga0495624_0035811	3300046690	Bacteria	3203
1150	Ga0495624_0052926	3300046690	Bacteria	2564
1151	Ga0495624_0114319	3300046690	Bacteria	1659
1152	Ga0495624_0258244	3300046690	Bacteria	1053
1153	Ga0495670_0045696	3300046691	Bacteria	2186
1154	Ga0495671_0231274	3300046692	Bacteria	894
1155	Ga0495649_0333192	3300046694	Bacteria	769
1156	Ga0495589_0136838	3300046794	Bacteria	1174
1157	Ga0495600_0000001	3300046809	Bacteria	214870
1158	Ga0495600_0001578	3300046809	Bacteria	12679
1159	Ga0495600_0003823	3300046809	Bacteria	8919
1160	Ga0495600_0006006	3300046809	Bacteria	7351
1161	Ga0495600_0006664	3300046809	Bacteria	7038
1162	Ga0495600_0022633	3300046809	Bacteria	4037
1163	Ga0495600_0210188	3300046809	Bacteria	1247
1164	Ga0495660_0108082	3300046810	Bacteria	1423
1165	Ga0495581_0000247	3300047315	Bacteria	25790
1166	Ga0495581_0012658	3300047315	Bacteria	4889
1167	Ga0495581_0013564	3300047315	Bacteria	4726
1168	Ga0495581_0044765	3300047315	Bacteria	2559
1169	Ga0495581_0047513	3300047315	Bacteria	2480
1170	Ga0495581_0070132	3300047315	Bacteria	2027
1171	Ga0495581_0083016	3300047315	Bacteria	1856
1172	Ga0495581_0097202	3300047315	Bacteria	1710
1173	Ga0495581_0147629	3300047315	Bacteria	1373
1174	Ga0495604_0000012	3300047317	Bacteria	268341
1175	Ga0495604_0001719	3300047317	Bacteria	17960
1176	Ga0495604_0004125	3300047317	Bacteria	11539
1177	Ga0495604_0018942	3300047317	Bacteria	5513
1178	Ga0495604_0031190	3300047317	Bacteria	4229
1179	Ga0495604_0122244	3300047317	Bacteria	1883
1180	Ga0495604_0165314	3300047317	Bacteria	1560
1181	Ga0495604_0178569	3300047317	Bacteria	1486
1182	Ga0495674_0000011	3300047319	Bacteria	270911
1183	Ga0495674_0000871	3300047319	Bacteria	28857
1184	Ga0495674_0008389	3300047319	Bacteria	9846
1185	Ga0495674_0228876	3300047319	Bacteria	1535
1186	Ga0495674_0312796	3300047319	Bacteria	1281
1187	Ga0495674_0322764	3300047319	Bacteria	1257
1188	Ga0495674_0444505	3300047319	Bacteria	1042
1189	Ga0495672_0018857	3300047320	Bacteria	4570
1190	Ga0495672_0032698	3300047320	Bacteria	3232
1191	Ga0495672_0196573	3300047320	Bacteria	1011
1192	Ga0495676_0038513	3300047321	Bacteria	3970
1193	Ga0495676_0041253	3300047321	Bacteria	3801
1194	Ga0495676_0085176	3300047321	Bacteria	2382
1195	Ga0495676_0131518	3300047321	Bacteria	1805
1196	Ga0495680_0001188	3300047322	Bacteria	28564
1197	Ga0495680_0001281	3300047322	Bacteria	27427
1198	Ga0495680_0006451	3300047322	Bacteria	10899
1199	Ga0495680_0007673	3300047322	Bacteria	9850
1200	Ga0495680_0017173	3300047322	Bacteria	6190
1201	Ga0495680_0027894	3300047322	Bacteria	4633
1202	Ga0495680_0117205	3300047322	Bacteria	1969
1203	Ga0495680_0220916	3300047322	Bacteria	1352
1204	Ga0495683_0037869	3300047323	Bacteria	2443
1205	Ga0495687_012431	3300047443	Bacteria	4502
1206	Ga0495687_044085	3300047443	Bacteria	1941
1207	Ga0495675_0000096	3300047444	Bacteria	62617
1208	Ga0495675_0001145	3300047444	Bacteria	16119
1209	Ga0495675_0005025	3300047444	Bacteria	8045
1210	Ga0495675_0005708	3300047444	Bacteria	7610
1211	Ga0495675_0033954	3300047444	Bacteria	3257
1212	Ga0495673_0087062	3300047469	Bacteria	1283
1213	Ga0495684_0000084	3300047471	Bacteria	65600
1214	Ga0495684_0001840	3300047471	Bacteria	17040
1215	Ga0495684_0021795	3300047471	Bacteria	4931
1216	Ga0495684_0024950	3300047471	Bacteria	4598
1217	Ga0495684_0026702	3300047471	Bacteria	4437
1218	Ga0495684_0041304	3300047471	Bacteria	3534
1219	Ga0495684_0138550	3300047471	Bacteria	1825
1220	Ga0495684_0204942	3300047471	Bacteria	1453
1221	Ga0495684_0261796	3300047471	Bacteria	1254
1222	Ga0495686_0053491	3300047472	Bacteria	2530
1223	Ga0495686_0148332	3300047472	Bacteria	1379
1224	Ga0495686_0170656	3300047472	Bacteria	1265
1225	Ga0495593_0000063	3300047673	Bacteria	45066
1226	Ga0495593_0000727	3300047673	Bacteria	19074
1227	Ga0495593_0002843	3300047673	Bacteria	10428
1228	Ga0495593_0007999	3300047673	Bacteria	6154
1229	Ga0495593_0052682	3300047673	Bacteria	2150
1230	Ga0495593_0068004	3300047673	Bacteria	1854
1231	Ga0495602_0000073	3300048088	Bacteria	98745
1232	Ga0495602_0009382	3300048088	Bacteria	10180
1233	Ga0495602_0010028	3300048088	Bacteria	9833
1234	Ga0495602_0016924	3300048088	Bacteria	7316
1235	Ga0495602_0017200	3300048088	Bacteria	7251
1236	Ga0495602_0051263	3300048088	Bacteria	3677
1237	Ga0495602_0104793	3300048088	Bacteria	2313
1238	Ga0495602_0236440	3300048088	Bacteria	1369
1239	Ga0495602_0339751	3300048088	Bacteria	1086
1240	Ga0496100_0023926	3300048903	Bacteria	3718
1241	Ga0496100_0048959	3300048903	Bacteria	2730
1242	Ga0496100_0057472	3300048903	Bacteria	2548
1243	Ga0496100_0201625	3300048903	Bacteria	1450
1244	Ga0496100_0269961	3300048903	Bacteria	1264
1245	Ga0496100_0312649	3300048903	Bacteria	1178
1246	Ga0496101_0033278	3300048904	Bacteria	3634
1247	Ga0496101_0105062	3300048904	Bacteria	2119
1248	Ga0496101_0171960	3300048904	Bacteria	1665
1249	Ga0496102_0015035	3300048905	Bacteria	6736
1250	Ga0496102_0035246	3300048905	Bacteria	4503
1251	Ga0496102_0087479	3300048905	Bacteria	2879
1252	Ga0496102_0257552	3300048905	Bacteria	1645
1253	Ga0496102_0283665	3300048905	Bacteria	1561
1254	Ga0496102_0301310	3300048905	Bacteria	1511
1255	Ga0496102_0750661	3300048905	Bacteria	899
1256	Ga0496103_0021916	3300048906	Bacteria	3845
1257	Ga0496103_0078723	3300048906	Bacteria	2070
1258	Ga0496103_0087378	3300048906	Bacteria	1965
1259	Ga0496104_0000079	3300048907	Bacteria	98874
1260	Ga0496104_0000445	3300048907	Bacteria	35921
1261	Ga0496104_0008588	3300048907	Bacteria	9085
1262	Ga0496104_0009097	3300048907	Bacteria	8834
1263	Ga0496104_0021540	3300048907	Bacteria	5919
1264	Ga0496104_0037334	3300048907	Bacteria	4544
1265	Ga0496104_0331111	3300048907	Bacteria	1436
1266	Ga0496104_0683744	3300048907	Bacteria	934
1267	Ga0496105_0000225	3300048908	Bacteria	38002
1268	Ga0496105_0002404	3300048908	Bacteria	13551
1269	Ga0496105_0021408	3300048908	Bacteria	5232
1270	Ga0496105_0022649	3300048908	Bacteria	5089
1271	Ga0496105_0070475	3300048908	Bacteria	2890
1272	Ga0496105_0077643	3300048908	Bacteria	2742
1273	Ga0496105_0091585	3300048908	Bacteria	2510
1274	Ga0496105_0093708	3300048908	Bacteria	2480
1275	Ga0496105_0121946	3300048908	Bacteria	2149
1276	Ga0496105_0173542	3300048908	Bacteria	1767
1277	Ga0496105_0507819	3300048908	Bacteria	945
1278	Ga0496106_0001271	3300048909	Bacteria	18905
1279	Ga0496106_0049101	3300048909	Bacteria	3178
1280	Ga0496106_0051559	3300048909	Bacteria	3103
1281	Ga0496106_0192889	3300048909	Bacteria	1620
1282	Ga0496106_0193267	3300048909	Bacteria	1618
1283	Ga0496107_0006383	3300048910	Bacteria	8104
1284	Ga0496107_0020256	3300048910	Bacteria	4696
1285	Ga0496107_0025796	3300048910	Bacteria	4164
1286	Ga0496107_0026598	3300048910	Bacteria	4102
1287	Ga0496107_0061520	3300048910	Bacteria	2718
1288	Ga0496107_0162791	3300048910	Bacteria	1654
1289	Ga0496108_0000507	3300048911	Bacteria	30629
1290	Ga0496108_0036968	3300048911	Bacteria	4065
1291	Ga0496108_0042694	3300048911	Bacteria	3786
1292	Ga0496108_0048820	3300048911	Bacteria	3540
1293	Ga0496108_0120157	3300048911	Bacteria	2253
1294	Ga0496108_0144702	3300048911	Bacteria	2049
1295	Ga0496108_0252538	3300048911	Bacteria	1534
1296	Ga0496108_0645086	3300048911	Bacteria	921
1297	Ga0496109_0006041	3300048912	Bacteria	10175
1298	Ga0496109_0015980	3300048912	Bacteria	6558
1299	Ga0496109_0024123	3300048912	Bacteria	5404
1300	Ga0496109_0069946	3300048912	Bacteria	3220
1301	Ga0496109_0101111	3300048912	Bacteria	2675
1302	Ga0496109_0769757	3300048912	Bacteria	900
1303	Ga0496110_0002891	3300048913	Bacteria	12991
1304	Ga0496110_0021898	3300048913	Bacteria	5420
1305	Ga0496110_0029273	3300048913	Bacteria	4738
1306	Ga0496110_0120504	3300048913	Bacteria	2363
1307	Ga0496110_0140867	3300048913	Bacteria	2180
1308	Ga0496110_0164050	3300048913	Bacteria	2014
1309	Ga0496110_0510667	3300048913	Bacteria	1094
1310	Ga0496110_0554504	3300048913	Bacteria	1044
1311	Ga0496111_0011478	3300048914	Bacteria	5969
1312	Ga0496111_0013376	3300048914	Bacteria	5582
1313	Ga0496111_0028844	3300048914	Bacteria	3936
1314	Ga0496111_0047402	3300048914	Bacteria	3095
1315	Ga0496111_0078813	3300048914	Bacteria	2402
1316	Ga0496112_0007653	3300048915	Bacteria	9607
1317	Ga0496112_0018304	3300048915	Bacteria	6594
1318	Ga0496112_0018992	3300048915	Bacteria	6479
1319	Ga0496112_0027083	3300048915	Bacteria	5525
1320	Ga0496112_0035913	3300048915	Bacteria	4830
1321	Ga0496112_0047644	3300048915	Bacteria	4205
1322	Ga0496112_0069445	3300048915	Bacteria	3480
1323	Ga0496112_0076116	3300048915	Bacteria	3319
1324	Ga0496112_0107858	3300048915	Bacteria	2755
1325	Ga0496112_0463524	3300048915	Bacteria	1204
1326	Ga0496113_0019566	3300048916	Bacteria	4739
1327	Ga0496113_0047589	3300048916	Bacteria	3187
1328	Ga0496113_0057049	3300048916	Bacteria	2933
1329	Ga0496113_0110589	3300048916	Bacteria	2138
1330	Ga0496113_0134258	3300048916	Bacteria	1944
1331	Ga0496113_0232154	3300048916	Bacteria	1471
1332	Ga0496113_0280674	3300048916	Bacteria	1332
1333	Ga0496114_0027338	3300048917	Bacteria	4672
1334	Ga0496114_0032827	3300048917	Bacteria	4275
1335	Ga0496114_0081821	3300048917	Bacteria	2728
1336	Ga0496114_0282994	3300048917	Bacteria	1462
1337	Ga0496114_0356400	3300048917	Bacteria	1294
1338	Ga0496114_0560305	3300048917	Bacteria	1009
1339	Ga0496115_0017793	3300048918	Bacteria	5442
1340	Ga0496115_0021747	3300048918	Bacteria	4959
1341	Ga0496115_0047288	3300048918	Bacteria	3440
1342	Ga0496115_0064292	3300048918	Bacteria	2961
1343	Ga0496115_0074754	3300048918	Bacteria	2752
1344	Ga0496115_0242621	3300048918	Bacteria	1485
1345	Ga0496115_0345001	3300048918	Bacteria	1215
1346	Ga0496115_0377078	3300048918	Bacteria	1154
1347	Ga0496116_0020888	3300048919	Bacteria	4955
1348	Ga0496116_0080857	3300048919	Bacteria	2017
1349	Ga0496117_0022107	3300048920	Bacteria	5110
1350	Ga0496117_0022795	3300048920	Bacteria	5015
1351	Ga0496117_0031029	3300048920	Bacteria	4088
1352	Ga0496117_0149383	3300048920	Bacteria	1385
1353	Ga0496118_0007700	3300048921	Bacteria	11325
1354	Ga0496118_0021560	3300048921	Bacteria	5666
1355	Ga0496118_0032916	3300048921	Bacteria	4261
1356	Ga0496118_0045268	3300048921	Bacteria	3437
1357	Ga0496118_0107932	3300048921	Bacteria	1857
1358	Ga0496119_0033954	3300048922	Bacteria	3370
1359	Ga0496119_0043451	3300048922	Bacteria	2838
1360	Ga0496119_0044654	3300048922	Bacteria	2787
1361	Ga0496119_0142450	3300048922	Bacteria	1293
1362	Ga0496119_0197870	3300048922	Bacteria	1042
1363	Ga0496120_0042488	3300048923	Bacteria	2654
1364	Ga0496121_0000091	3300048924	Bacteria	216685
1365	Ga0496121_0000451	3300048924	Bacteria	80840
1366	Ga0496121_0004123	3300048924	Bacteria	19914
1367	Ga0496121_0004300	3300048924	Bacteria	19302
1368	Ga0496121_0007759	3300048924	Bacteria	12856
1369	Ga0496121_0064130	3300048924	Bacteria	2997
1370	Ga0496121_0071544	3300048924	Bacteria	2789
1371	Ga0496121_0072706	3300048924	Bacteria	2760
1372	Ga0496121_0079491	3300048924	Bacteria	2603
1373	Ga0496121_0093052	3300048924	Bacteria	2348
1374	Ga0496121_0115304	3300048924	Bacteria	2040
1375	Ga0496122_0014770	3300048925	Bacteria	7527
1376	Ga0496123_0056676	3300048926	Bacteria	2558
1377	Ga0496123_0115835	3300048926	Bacteria	1520
1378	Ga0496124_0002796	3300048927	Bacteria	22105
1379	Ga0496124_0048273	3300048927	Bacteria	3639
1380	Ga0496124_0056207	3300048927	Bacteria	3320
1381	Ga0496124_0075008	3300048927	Bacteria	2795
1382	Ga0496124_0202919	3300048927	Bacteria	1506
1383	Ga0496125_0004112	3300048928	Bacteria	16995
1384	Ga0496125_0040920	3300048928	Bacteria	3968
1385	Ga0496125_0068010	3300048928	Bacteria	2804
1386	Ga0496125_0102211	3300048928	Bacteria	2107
1387	Ga0496125_0117757	3300048928	Bacteria	1904
1388	Ga0496125_0131748	3300048928	Bacteria	1758
1389	Ga0496126_0002876	3300048929	Bacteria	22465
1390	Ga0496126_0007845	3300048929	Bacteria	11635
1391	Ga0496126_0012693	3300048929	Bacteria	8618
1392	Ga0496126_0013193	3300048929	Bacteria	8428
1393	Ga0496126_0023656	3300048929	Bacteria	5950
1394	Ga0496126_0027035	3300048929	Bacteria	5489
1395	Ga0496126_0053184	3300048929	Bacteria	3675
1396	Ga0496126_0065754	3300048929	Bacteria	3244
1397	Ga0496126_0078080	3300048929	Bacteria	2934
1398	Ga0496126_0100995	3300048929	Bacteria	2524
1399	Ga0496126_0129236	3300048929	Bacteria	2184
1400	Ga0496126_0264080	3300048929	Bacteria	1431
1401	Ga0496126_0327316	3300048929	Bacteria	1258
1402	Ga0495682_0074492	3300049460	Bacteria	1221
1403	Ga0501031_0001202	3300049568	Bacteria	15788
1404	Ga0501032_0003544	3300049569	Bacteria	11911
1405	Ga0501032_0045915	3300049569	Bacteria	2953
1406	Ga0501032_0299570	3300049569	Bacteria	1039
1407	Ga0501033_0001519	3300049570	Bacteria	20512
1408	Ga0501033_0002722	3300049570	Bacteria	14822
1409	Ga0501033_0006530	3300049570	Bacteria	9124
1410	Ga0501033_0044786	3300049570	Bacteria	3293
1411	Ga0501033_0055688	3300049570	Bacteria	2923
1412	Ga0501034_0009885	3300049571	Bacteria	9972
1413	Ga0501034_0065930	3300049571	Bacteria	3635
1414	Ga0501034_0106842	3300049571	Bacteria	2791
1415	Ga0501034_0143650	3300049571	Bacteria	2365
1416	Ga0501034_0209919	3300049571	Bacteria	1903
1417	Ga0501034_0245798	3300049571	Bacteria	1734
1418	Ga0501034_0257536	3300049571	Bacteria	1688
1419	Ga0501034_0545971	3300049571	Bacteria	1069
1420	Ga0501036_0000559	3300049572	Bacteria	26726
1421	Ga0501036_0003800	3300049572	Bacteria	12108
1422	Ga0501036_0010203	3300049572	Bacteria	7742
1423	Ga0501036_0062741	3300049572	Bacteria	3147
1424	Ga0501036_0097217	3300049572	Bacteria	2489
1425	Ga0501036_0504152	3300049572	Bacteria	1007
1426	Ga0501037_0000618	3300049573	Bacteria	27557
1427	Ga0501037_0010785	3300049573	Bacteria	6716
1428	Ga0501037_0020898	3300049573	Bacteria	4833
1429	Ga0501037_0021756	3300049573	Bacteria	4744
1430	Ga0501037_0023269	3300049573	Bacteria	4581
1431	Ga0501037_0217810	3300049573	Bacteria	1344
1432	Ga0501037_0302981	3300049573	Bacteria	1109
1433	Ga0501038_0001243	3300049574	Bacteria	23113
1434	Ga0501038_0002129	3300049574	Bacteria	18373
1435	Ga0501038_0003386	3300049574	Bacteria	14866
1436	Ga0501038_0009070	3300049574	Bacteria	9132
1437	Ga0501038_0058855	3300049574	Bacteria	3292
1438	Ga0501038_0072677	3300049574	Bacteria	2914
1439	Ga0501038_0120013	3300049574	Bacteria	2169
1440	Ga0501038_0138196	3300049574	Bacteria	1995
1441	Ga0501038_0242527	3300049574	Bacteria	1430
1442	Ga0501039_0006912	3300049575	Bacteria	8634
1443	Ga0501039_0021781	3300049575	Bacteria	4916
1444	Ga0501039_0026119	3300049575	Bacteria	4487
1445	Ga0501039_0036146	3300049575	Bacteria	3811
1446	Ga0501039_0400286	3300049575	Bacteria	1078
1447	Ga0501040_0047771	3300049576	Bacteria	2923
1448	Ga0501043_0003811	3300049579	Bacteria	12407
1449	Ga0501043_0009163	3300049579	Bacteria	7783
1450	Ga0501043_0022608	3300049579	Bacteria	4929
1451	Ga0501043_0059965	3300049579	Bacteria	2986
1452	Ga0501043_0061611	3300049579	Bacteria	2946
1453	Ga0501046_0009686	3300049580	Bacteria	8309
1454	Ga0501046_0015885	3300049580	Bacteria	6315
1455	Ga0501046_0021034	3300049580	Bacteria	5387
1456	Ga0501046_0213553	3300049580	Bacteria	1431
1457	Ga0501047_0011344	3300049581	Bacteria	8437
1458	Ga0501047_0050383	3300049581	Bacteria	4021
1459	Ga0501047_0124385	3300049581	Bacteria	2459
1460	Ga0501047_0134823	3300049581	Bacteria	2349
1461	Ga0501047_0174105	3300049581	Bacteria	2020
1462	Ga0501047_0275628	3300049581	Bacteria	1527
1463	Ga0501048_0010341	3300049582	Bacteria	6973
1464	Ga0501048_0027660	3300049582	Bacteria	4118
1465	Ga0501067_0007710	3300049583	Bacteria	5987
1466	Ga0501067_0012443	3300049583	Bacteria	4720
1467	Ga0501068_0011020	3300049584	Bacteria	5088
1468	Ga0501068_0165225	3300049584	Bacteria	1396
1469	Ga0501069_0031229	3300049585	Bacteria	2928
1470	Ga0501069_0213675	3300049585	Bacteria	1120
1471	Ga0501070_0003459	3300049586	Bacteria	13696
1472	Ga0501070_0099434	3300049586	Bacteria	2407
1473	Ga0501070_0100759	3300049586	Bacteria	2389
1474	Ga0501070_0332508	3300049586	Bacteria	1235
1475	Ga0501071_0021211	3300049587	Bacteria	4523
1476	Ga0501071_0094550	3300049587	Bacteria	2199
1477	Ga0501072_0025801	3300049588	Bacteria	4579
1478	Ga0501072_0195826	3300049588	Bacteria	1612
1479	Ga0501073_0074421	3300049589	Bacteria	2364
1480	Ga0501074_0004738	3300049590	Bacteria	9749
1481	Ga0501074_0019241	3300049590	Bacteria	4959
1482	Ga0501076_0091494	3300049592	Bacteria	2447
1483	Ga0501076_0744634	3300049592	Bacteria	809
1484	Ga0501077_0037552	3300049593	Bacteria	3085
1485	Ga0501079_0011556	3300049741	Bacteria	6740
1486	Ga0501079_0429717	3300049741	Bacteria	1037
1487	Ga0501080_0033924	3300049742	Bacteria	4764
1488	Ga0501080_0042927	3300049742	Bacteria	4210
1489	Ga0501080_0168257	3300049742	Bacteria	2022
1490	Ga0501080_0190420	3300049742	Bacteria	1885
1491	Ga0501080_0564312	3300049742	Bacteria	1013
1492	Ga0501081_0384396	3300049743	Bacteria	1038
1493	Ga0501083_0005759	3300049744	Bacteria	8767
1494	Ga0501083_0022246	3300049744	Bacteria	4399
1495	Ga0501083_0032813	3300049744	Bacteria	3558
1496	Ga0501083_0074561	3300049744	Bacteria	2254
1497	Ga0501083_0080108	3300049744	Bacteria	2166
1498	Ga0501035_0003212	3300049822	Bacteria	15662
1499	Ga0501035_0015169	3300049822	Bacteria	7112
1500	Ga0501035_0035666	3300049822	Bacteria	4513
1501	Ga0501035_0047729	3300049822	Bacteria	3842
1502	Ga0501035_0333785	3300049822	Bacteria	1272
1503	Ga0501035_0460209	3300049822	Bacteria	1051
1504	Ga0501044_0000057	3300049823	Bacteria	136472
1505	Ga0501044_0006768	3300049823	Bacteria	12633
1506	Ga0501044_0014205	3300049823	Bacteria	8600
1507	Ga0501044_0039705	3300049823	Bacteria	4908
1508	Ga0501044_0054727	3300049823	Bacteria	4100
1509	Ga0501044_0056673	3300049823	Bacteria	4023
1510	Ga0501044_0083357	3300049823	Bacteria	3233
1511	Ga0501044_0094455	3300049823	Bacteria	3015
1512	Ga0501044_0108063	3300049823	Bacteria	2792
1513	Ga0501045_0003166	3300049824	Bacteria	11244
1514	nmdc:mga03683_26995_c1	3300050489	Bacteria	2270
1515	nmdc:mga03683_79666_c1	3300050489	Bacteria	1412
1516	nmdc:mga03683_98222_c1	3300050489	Bacteria	1284
1517	nmdc:mga03n38_15385_c1	3300050490	Bacteria	2953
1518	nmdc:mga03n38_16088_c1	3300050490	Bacteria	2904
1519	nmdc:mga03n38_25648_c1	3300050490	Bacteria	2424
1520	nmdc:mga00v17_149421_c1	3300050491	Bacteria	1501
1521	nmdc:mga00v17_261480_c1	3300050491	Bacteria	1123
1522	nmdc:mga00v17_355353_c1	3300050491	Bacteria	953
1523	nmdc:mga0yw44_125918_c1	3300050492	Bacteria	1655
1524	nmdc:mga0yw44_141039_c1	3300050492	Bacteria	1566
1525	nmdc:mga0yw44_244450_c1	3300050492	Bacteria	1193
1526	nmdc:mga0yw44_386852_c1	3300050492	Bacteria	945
1527	nmdc:mga0k408_174930_c1	3300050493	Bacteria	1280
1528	nmdc:mga0k408_5798_c1	3300050493	Bacteria	5577
1529	nmdc:mga0k408_73151_c1	3300050493	Bacteria	2002
1530	nmdc:mga0k408_95725_c1	3300050493	Bacteria	1747
1531	nmdc:mga06z11_286585_c1	3300050494	Bacteria	977
1532	nmdc:mga06z11_37840_c1	3300050494	Bacteria	2392
1533	nmdc:mga06z11_47495_c1	3300050494	Bacteria	2181
1534	nmdc:mga04h51_18956_c1	3300050495	Bacteria	2034
1535	nmdc:mga04h51_5425_c1	3300050495	Bacteria	3252
1536	nmdc:mga07m45_117681_c1	3300050496	Bacteria	1533
1537	nmdc:mga07m45_13488_c1	3300050496	Bacteria	4337
1538	nmdc:mga07m45_141264_c1	3300050496	Bacteria	1395
1539	nmdc:mga07m45_31507_c1	3300050496	Bacteria	2939
1540	nmdc:mga05p37_1895_c1	3300050507	Bacteria	24373
1541	nmdc:mga05p37_32_c1	3300050507	Bacteria	112982
1542	nmdc:mga05p37_425828_c1	3300050507	Bacteria	1543
1543	nmdc:mga05p37_615293_c1	3300050507	Bacteria	1223
1544	nmdc:mga09592_379111_c1	3300050508	Bacteria	1223
1545	nmdc:mga0qj67_355_c1	3300050509	Bacteria	31660
1546	nmdc:mga0qj67_58358_c1	3300050509	Bacteria	3060
1547	nmdc:mga06r32_428152_c1	3300050510	Bacteria	1304
1548	nmdc:mga06r32_448_c1	3300050510	Bacteria	34999
1549	nmdc:mga06r32_484929_c1	3300050510	Bacteria	1214
1550	nmdc:mga08y16_2557_c1	3300050511	Bacteria	18712
1551	nmdc:mga0n895_296625_c1	3300050512	Bacteria	1639
1552	nmdc:mga0n895_298276_c1	3300050512	Bacteria	1634
1553	nmdc:mga0n895_568_c1	3300050512	Bacteria	25310
1554	nmdc:mga0n895_71083_c1	3300050512	Bacteria	3450
1555	nmdc:mga0rr50_104377_c1	3300050513	Bacteria	2232
1556	nmdc:mga0rr50_167580_c1	3300050513	Bacteria	1787
1557	nmdc:mga0rr50_23412_c1	3300050513	Bacteria	4259
1558	nmdc:mga0rr50_65960_c1	3300050513	Bacteria	2744
1559	nmdc:mga08x19_128218_c1	3300050514	Bacteria	1705
1560	nmdc:mga08x19_132202_c1	3300050514	Bacteria	1679
1561	nmdc:mga08x19_433217_c1	3300050514	Bacteria	924
1562	nmdc:mga08x19_65652_c1	3300050514	Bacteria	2357
1563	nmdc:mga08x19_75626_c1	3300050514	Bacteria	2202
1564	nmdc:mga0a205_466_c1	3300050515	Bacteria	31480
1565	nmdc:mga0sz30_18533_c1	3300050516	Bacteria	2787
1566	nmdc:mga0sz30_71746_c1	3300050516	Bacteria	1491
1567	Ga0495601_0000009	3300053077	Bacteria	270622
1568	Ga0495601_0002455	3300053077	Bacteria	10529
1569	Ga0495601_0003073	3300053077	Bacteria	9519
1570	Ga0495601_0010039	3300053077	Bacteria	5618
1571	Ga0495601_0025744	3300053077	Bacteria	3629
1572	Ga0495601_0035637	3300053077	Bacteria	3107
1573	Ga0495601_0096735	3300053077	Bacteria	1904
1574	Ga0495601_0112152	3300053077	Bacteria	1766
1575	Ga0495601_0196081	3300053077	Bacteria	1320
1576	Ga0495612_0000019	3300053078	Bacteria	137844
1577	Ga0495612_0001365	3300053078	Bacteria	10064
1578	Ga0495612_0016661	3300053078	Bacteria	2944
1579	Ga0495612_0020905	3300053078	Bacteria	2624
1580	Ga0495612_0022878	3300053078	Bacteria	2505
1581	Ga0495612_0040782	3300053078	Bacteria	1892
1582	Ga0495612_0043014	3300053078	Bacteria	1845
1583	Ga0495612_0070087	3300053078	Bacteria	1461
1584	Ga0500610_0146235	3300053079	Bacteria	1189
1585	Ga0495595_0000015	3300053084	Bacteria	144946
1586	Ga0495595_0000585	3300053084	Bacteria	13949
1587	Ga0495595_0001738	3300053084	Bacteria	8515
1588	Ga0495595_0001995	3300053084	Bacteria	7943
1589	Ga0495595_0003599	3300053084	Bacteria	6156
1590	Ga0495595_0004533	3300053084	Bacteria	5589
1591	Ga0495595_0008990	3300053084	Bacteria	4122
1592	Ga0495595_0013998	3300053084	Bacteria	3396
1593	Ga0495595_0051986	3300053084	Bacteria	1900
1594	Ga0495595_0071049	3300053084	Bacteria	1645
1595	Ga0495595_0164785	3300053084	Bacteria	1095
1596	Ga0495619_0000012	3300053085	Bacteria	268349
1597	Ga0495619_0000016	3300053085	Bacteria	231442
1598	Ga0495619_0001285	3300053085	Bacteria	16486
1599	Ga0495619_0002388	3300053085	Bacteria	12328
1600	Ga0495619_0003397	3300053085	Bacteria	10285
1601	Ga0495619_0008487	3300053085	Bacteria	6497
1602	Ga0495619_0015857	3300053085	Bacteria	4770
1603	Ga0495619_0021537	3300053085	Bacteria	4117
1604	Ga0495619_0028250	3300053085	Bacteria	3618
1605	Ga0495619_0030366	3300053085	Bacteria	3499
1606	Ga0495619_0076886	3300053085	Bacteria	2241
1607	Ga0495619_0124775	3300053085	Bacteria	1766
1608	Ga0495619_0191585	3300053085	Bacteria	1415
1609	Ga0500578_0044562	3300053086	Bacteria	2847
1610	Ga0500578_0300974	3300053086	Bacteria	951
1611	Ga0500643_000517	3300053087	Bacteria	27366
1612	Ga0500643_014994	3300053087	Bacteria	2671
1613	Ga0500644_0011722	3300053088	Bacteria	2404
1614	Ga0500646_0018567	3300053090	Bacteria	1833
1615	Ga0500647_0002370	3300053091	Bacteria	6991
1616	Ga0500647_0201946	3300053091	Bacteria	901
1617	Ga0500651_0048542	3300053093	Bacteria	2667
1618	Ga0500651_0175590	3300053093	Bacteria	1274
1619	Ga0500566_0000491	3300053094	Bacteria	22023
1620	Ga0500566_0006845	3300053094	Bacteria	6749
1621	Ga0500641_0006510	3300053096	Bacteria	4144
1622	Ga0500641_0037324	3300053096	Bacteria	1947
1623	Ga0500650_0002265	3300053098	Bacteria	6261
1624	Ga0500554_012904	3300053102	Bacteria	2114
1625	Ga0500554_027251	3300053102	Bacteria	1650
1626	Ga0500555_001517	3300053103	Bacteria	7030
1627	Ga0500555_031226	3300053103	Bacteria	1510
1628	Ga0500556_0000005	3300053104	Bacteria	581135
1629	Ga0500556_0015602	3300053104	Bacteria	2347
1630	Ga0500556_0083942	3300053104	Bacteria	1208
1631	Ga0500557_000019	3300053105	Bacteria	93216
1632	Ga0500569_003665	3300053109	Bacteria	3167
1633	Ga0500572_000144	3300053111	Bacteria	24401
1634	Ga0500595_001460	3300053119	Bacteria	12603
1635	Ga0500595_001845	3300053119	Bacteria	10967
1636	Ga0500595_001921	3300053119	Bacteria	10697
1637	Ga0500595_003368	3300053119	Bacteria	7488
1638	Ga0500595_004885	3300053119	Bacteria	5930
1639	Ga0500595_006596	3300053119	Bacteria	4903
1640	Ga0500595_022775	3300053119	Bacteria	2211
1641	Ga0500595_027108	3300053119	Bacteria	1966
1642	Ga0500597_162647	3300053120	Bacteria	954
1643	Ga0500608_000126	3300053122	Bacteria	31144
1644	Ga0500608_122226	3300053122	Bacteria	1179
1645	Ga0500608_199055	3300053122	Bacteria	830
1646	Ga0500642_0000009	3300053130	Bacteria	286829
1647	Ga0500642_0000835	3300053130	Bacteria	8983
1648	Ga0500642_0043760	3300053130	Bacteria	1946
1649	Ga0500652_000067	3300053131	Bacteria	45577
1650	Ga0500652_000259	3300053131	Bacteria	19823
1651	Ga0500655_017975	3300053133	Bacteria	1312
1652	Ga0500658_0021625	3300053134	Bacteria	2439
1653	Ga0500559_0000222	3300053136	Bacteria	45603
1654	Ga0500559_0000386	3300053136	Bacteria	32337
1655	Ga0500559_0082941	3300053136	Bacteria	1459
1656	Ga0500577_0044315	3300053142	Bacteria	1639
1657	Ga0500586_000081	3300053145	Bacteria	16471
1658	Ga0500589_072834	3300053147	Bacteria	1550
1659	Ga0500589_097334	3300053147	Bacteria	1284
1660	Ga0500603_000143	3300053150	Bacteria	17272
1661	Ga0500603_042196	3300053150	Bacteria	1221
1662	Ga0500603_044160	3300053150	Bacteria	1199
1663	Ga0500616_0000035	3300053153	Bacteria	394242
1664	Ga0500616_0026411	3300053153	Bacteria	3214
1665	Ga0500616_0051136	3300053153	Bacteria	2178
1666	Ga0500622_0000355	3300053156	Bacteria	44648
1667	Ga0500622_0009556	3300053156	Bacteria	5361
1668	Ga0500627_0066437	3300053158	Bacteria	1593
1669	Ga0500634_0104696	3300053161	Bacteria	1409
1670	Ga0500639_013425	3300053163	Bacteria	4308
1671	Ga0500636_0000168	3300053177	Bacteria	34492
1672	Ga0500636_0012018	3300053177	Bacteria	5071
1673	Ga0500636_0138788	3300053177	Bacteria	1347
1674	Ga0500636_0263910	3300053177	Bacteria	870
1675	Ga0500637_0000134	3300053178	Bacteria	27110
1676	Ga0500637_0010521	3300053178	Bacteria	4745
1677	Ga0500649_024644	3300053722	Bacteria	2483
1678	Ga0500567_065747	3300053723	Bacteria	1608
1679	Ga0500625_022425	3300053729	Bacteria	2981
1680	Ga0500645_074648	3300053730	Bacteria	971
1681	Ga0500645_078355	3300053730	Bacteria	944
1682	Ga0500645_091879	3300053730	Bacteria	860
1683	Ga0500609_013082	3300053731	Bacteria	1123
1684	Ga0500656_002178	3300053732	Bacteria	1760
1685	Ga0500596_003208	3300053735	Bacteria	3137
1686	Ga0500599_001897	3300053736	Bacteria	2468
1687	Ga0500601_000190	3300053737	Bacteria	12544
1688	Ga0501084_0024903	3300054114	Bacteria	4994
1689	Ga0501084_0036311	3300054114	Bacteria	4116
1690	Ga0501084_0076287	3300054114	Bacteria	2810
1691	Ga0501084_0087201	3300054114	Bacteria	2621
1692	Ga0501084_0250311	3300054114	Bacteria	1496
1693	Ga0501084_0289993	3300054114	Bacteria	1382
1694	Ga0501084_0334533	3300054114	Bacteria	1279
1695	Ga0500661_000037	3300055283	Bacteria	19843
1696	Ga0500661_005930	3300055283	Bacteria	2278
1697	Ga0501082_0003083	3300060353	Bacteria	14539
1698	Ga0501082_0086841	3300060353	Bacteria	2698
1699	Ga0501082_0263288	3300060353	Bacteria	1500
1700	Ga0501082_0307216	3300060353	Bacteria	1381
1701	Ga0530510_0021284	3300061734	Bacteria	4614
1702	Ga0530510_0243640	3300061734	Bacteria	1339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046615	Ga0495656_0084530	Ga0495656_0084530_15_695	214
2	3300046683	Ga0495658_0128357	Ga0495658_0128357_453_1133	214
3	3300046694	Ga0495649_0333192	Ga0495649_0333192_79_759	214
4	3300053091	Ga0500647_0201946	Ga0500647_0201946_15_695	214
5	iso_pu_bacteria	2876808645	2876813475	216
6	3300046664	Ga0495659_0085848	Ga0495659_0085848_77_802	218
7	3300026067	Ga0207678_10423358	Ga0207678_104233582	219
8	iso_pu_bacteria	8019530166	8019530581	220
9	3300046501	Ga0495607_0135642	Ga0495607_0135642_556_1263	223
10	3300046501	Ga0495607_0248124	Ga0495607_0248124_10_720	224
11	3300046559	Ga0495667_0059712	Ga0495667_0059712_1777_2487	224
12	3300048912	Ga0496109_0769757	Ga0496109_0769757_179_889	224
13	3300053722	Ga0500649_024644	Ga0500649_024644_1754_2464	224
14	3300048924	Ga0496121_0004300	Ga0496121_0004300_19_732	225
15	3300049572	Ga0501036_0504152	Ga0501036_0504152_274_987	225
16	3300049573	Ga0501037_0023269	Ga0501037_0023269_19_732	225
17	3300050493	nmdc:mga0k408_95725_c1	nmdc:mga0k408_95725_c1_838_1566	227
18	3300046501	Ga0495607_0271467	Ga0495607_0271467_14_736	228
19	3300053730	Ga0500645_074648	Ga0500645_074648_212_955	228
20	3300039437	Ga0436365_0613718	Ga0436365_0613718_18_743	229
21	3300046511	Ga0495608_0042345	Ga0495608_0042345_18_743	229
22	3300046615	Ga0495656_0042493	Ga0495656_0042493_945_1670	229
23	3300048905	Ga0496102_0750661	Ga0496102_0750661_163_888	229
24	3300049592	Ga0501076_0744634	Ga0501076_0744634_14_739	229
25	3300053086	Ga0500578_0300974	Ga0500578_0300974_189_938	230
26	3300050514	nmdc:mga08x19_433217_c1	nmdc:mga08x19_433217_c1_11_742	231
27	3300046460	Ga0495638_0037800	Ga0495638_0037800_1139_1975	234
28	3300046674	Ga0495588_0021433	Ga0495588_0021433_1903_2739	234
29	3300053098	Ga0500650_0002265	Ga0500650_0002265_3520_4356	234
30	3300005336	Ga0070680_100008654	Ga0070680_1000086545	235
31	3300005339	Ga0070660_100019868	Ga0070660_1000198682	235
32	3300005530	Ga0070679_100021585	Ga0070679_1000215854	235
33	3300025919	Ga0207657_10025649	Ga0207657_100256496	235
34	3300025921	Ga0207652_10020573	Ga0207652_100205735	235
35	3300035724	Ga0373933_0475054	Ga0373933_0475054_39_782	235
36	3300046678	Ga0495599_0149989	Ga0495599_0149989_41_784	235
37	3300048088	Ga0495602_0051263	Ga0495602_0051263_2882_3625	235
38	3300048924	Ga0496121_0115304	Ga0496121_0115304_1283_2026	235
39	3300050513	nmdc:mga0rr50_65960_c1	nmdc:mga0rr50_65960_c1_70_813	235
40	3300053153	Ga0500616_0000035	Ga0500616_0000035_44089_44925	235
41	3300037068	Ga0373925_0607095	Ga0373925_0607095_133_879	236
42	3300053078	Ga0495612_0070087	Ga0495612_0070087_47_793	236
43	iso_pu_bacteria	8016566248	8016568992	237
44	iso_pu_bacteria	8016603502	8016607024	237
45	3300048920	Ga0496117_0022107	Ga0496117_0022107_3815_4573	238
46	3300009093	Ga0105240_10350956	Ga0105240_103509561	239
47	iso_pu_bacteria	2847939898	2847942788	239
48	iso_pu_bacteria	2881665667	2881666062	239
49	iso_pu_bacteria	8016613128	8016618928	239
50	3300011119	Ga0105246_10319229	Ga0105246_103192292	240
51	3300037466	Ga0395898_0078628	Ga0395898_0078628_1904_2665	240
52	3300044706	Ga0466964_0074500	Ga0466964_0074500_645_1403	240
53	3300046692	Ga0495671_0231274	Ga0495671_0231274_100_858	240
54	3300047315	Ga0495581_0044765	Ga0495581_0044765_21_779	240
55	3300053122	Ga0500608_000126	Ga0500608_000126_14722_15540	240
56	3300053136	Ga0500559_0000222	Ga0500559_0000222_14737_15555	240
57	3300053156	Ga0500622_0000355	Ga0500622_0000355_39125_39961	240
58	iso_pu_bacteria	8019547302	8019549608	240
59	3300005435	Ga0070714_100145972	Ga0070714_1001459721	241
60	3300005549	Ga0070704_100484462	Ga0070704_1004844622	241
61	3300025929	Ga0207664_10031795	Ga0207664_100317952	241
62	3300035725	Ga0373947_0235397	Ga0373947_0235397_23_784	241
63	3300042438	Ga0439459_0030294	Ga0439459_0030294_35_796	241
64	3300046492	Ga0495585_0113711	Ga0495585_0113711_53_814	241
65	3300009093	Ga0105240_10090182	Ga0105240_100901823	242
66	3300009545	Ga0105237_10116288	Ga0105237_101162882	242
67	3300010375	Ga0105239_10799727	Ga0105239_107997272	242
68	3300013105	Ga0157369_10015000	Ga0157369_100150004	242
69	3300013307	Ga0157372_10132015	Ga0157372_101320153	242
70	3300035083	Ga0373926_0006042	Ga0373926_0006042_2610_3377	242
71	3300035086	Ga0373934_0010050	Ga0373934_0010050_1529_2296	242
72	3300035111	Ga0373923_0127209	Ga0373923_0127209_137_904	242
73	3300035113	Ga0373936_0018861	Ga0373936_0018861_285_1052	242
74	3300035117	Ga0373953_0063189	Ga0373953_0063189_163_930	242
75	3300035119	Ga0373956_0033694	Ga0373956_0033694_1466_2233	242
76	3300035170	Ga0373943_0034911	Ga0373943_0034911_1425_2192	242
77	3300035695	Ga0373927_0227065	Ga0373927_0227065_256_1023	242
78	3300035724	Ga0373933_0026697	Ga0373933_0026697_251_1018	242
79	3300036401	Ga0373937_0138012	Ga0373937_0138012_742_1509	242
80	3300037418	Ga0395900_0021796	Ga0395900_0021796_1779_2549	242
81	3300037466	Ga0395898_0003151	Ga0395898_0003151_3428_4198	242
82	3300038443	Ga0395901_0083638	Ga0395901_0083638_1370_2140	242
83	3300046459	Ga0495629_0067242	Ga0495629_0067242_79_846	242
84	3300046472	Ga0495580_0007090	Ga0495580_0007090_5476_6243	242
85	3300046473	Ga0495582_0004005	Ga0495582_0004005_109_876	242
86	3300046475	Ga0495639_0008336	Ga0495639_0008336_3543_4310	242
87	3300046476	Ga0495662_0024614	Ga0495662_0024614_605_1372	242
88	3300046477	Ga0495664_0040201	Ga0495664_0040201_1775_2542	242
89	3300046499	Ga0495594_0049014	Ga0495594_0049014_466_1233	242
90	3300046516	Ga0495628_0124343	Ga0495628_0124343_880_1647	242
91	3300046517	Ga0495630_0036438	Ga0495630_0036438_1718_2485	242
92	3300046526	Ga0495666_0023817	Ga0495666_0023817_891_1658	242
93	3300046529	Ga0495652_0095084	Ga0495652_0095084_526_1293	242
94	3300046533	Ga0495640_0030012	Ga0495640_0030012_1066_1833	242
95	3300046535	Ga0495586_0327115	Ga0495586_0327115_31_798	242
96	3300046559	Ga0495667_0153881	Ga0495667_0153881_546_1313	242
97	3300046663	Ga0495635_0088770	Ga0495635_0088770_193_960	242
98	3300046678	Ga0495599_0116770	Ga0495599_0116770_463_1230	242
99	3300046681	Ga0495647_0015774	Ga0495647_0015774_1415_2182	242
100	3300046683	Ga0495658_0023308	Ga0495658_0023308_1456_2223	242
101	3300046690	Ga0495624_0035811	Ga0495624_0035811_1022_1789	242
102	3300046809	Ga0495600_0210188	Ga0495600_0210188_255_1022	242
103	3300047315	Ga0495581_0047513	Ga0495581_0047513_642_1409	242
104	3300047321	Ga0495676_0085176	Ga0495676_0085176_513_1280	242
105	3300047471	Ga0495684_0041304	Ga0495684_0041304_1746_2513	242
106	3300053077	Ga0495601_0035637	Ga0495601_0035637_1054_1821	242
107	iso_pu_bacteria	2874604998	2874608531	242
108	3300005262	Ga0065165_1002418	Ga0065165_10024189	243
109	3300009093	Ga0105240_10697420	Ga0105240_106974201	243
110	3300009174	Ga0105241_10074950	Ga0105241_100749503	243
111	3300025297	Ga0209758_1028037	Ga0209758_10280372	243
112	3300035113	Ga0373936_0028659	Ga0373936_0028659_989_1756	243
113	3300035118	Ga0373954_0007817	Ga0373954_0007817_2745_3512	243
114	3300035170	Ga0373943_0043817	Ga0373943_0043817_1038_1805	243
115	3300035172	Ga0373955_0003607	Ga0373955_0003607_2557_3324	243
116	3300035692	Ga0373935_0022721	Ga0373935_0022721_1708_2475	243
117	3300035695	Ga0373927_0114441	Ga0373927_0114441_391_1158	243
118	3300035724	Ga0373933_0031740	Ga0373933_0031740_618_1385	243
119	3300035725	Ga0373947_0046999	Ga0373947_0046999_901_1668	243
120	3300036401	Ga0373937_0529525	Ga0373937_0529525_38_805	243
121	3300037068	Ga0373925_0042312	Ga0373925_0042312_11_778	243
122	3300037068	Ga0373925_0047998	Ga0373925_0047998_698_1465	243
123	3300046454	Ga0495592_0012614	Ga0495592_0012614_449_1216	243
124	3300046459	Ga0495629_0007816	Ga0495629_0007816_2549_3316	243
125	3300046462	Ga0495651_0003743	Ga0495651_0003743_9534_10301	243
126	3300046463	Ga0495653_0002496	Ga0495653_0002496_8198_8965	243
127	3300046511	Ga0495608_0009086	Ga0495608_0009086_5487_6254	243
128	3300046514	Ga0495618_0006484	Ga0495618_0006484_1739_2506	243
129	3300046529	Ga0495652_0079112	Ga0495652_0079112_695_1462	243
130	3300046533	Ga0495640_0016246	Ga0495640_0016246_1149_1916	243
131	3300046536	Ga0495587_0000506	Ga0495587_0000506_2614_3381	243
132	3300046559	Ga0495667_0013469	Ga0495667_0013469_1980_2747	243
133	3300046663	Ga0495635_0030948	Ga0495635_0030948_669_1436	243
134	3300046678	Ga0495599_0039264	Ga0495599_0039264_1480_2247	243
135	3300046679	Ga0495623_0003225	Ga0495623_0003225_7392_8159	243
136	3300046680	Ga0495646_0057797	Ga0495646_0057797_1224_1991	243
137	3300046683	Ga0495658_0106935	Ga0495658_0106935_611_1378	243
138	3300046689	Ga0495613_0036558	Ga0495613_0036558_1081_1848	243
139	3300046690	Ga0495624_0114319	Ga0495624_0114319_103_870	243
140	3300046794	Ga0495589_0136838	Ga0495589_0136838_17_784	243
141	3300046809	Ga0495600_0006006	Ga0495600_0006006_5231_5998	243
142	3300046810	Ga0495660_0108082	Ga0495660_0108082_20_808	243
143	3300047315	Ga0495581_0097202	Ga0495581_0097202_572_1339	243
144	3300047317	Ga0495604_0178569	Ga0495604_0178569_152_919	243
145	3300047319	Ga0495674_0008389	Ga0495674_0008389_5576_6343	243
146	3300047322	Ga0495680_0001188	Ga0495680_0001188_27602_28369	243
147	3300047444	Ga0495675_0001145	Ga0495675_0001145_10012_10779	243
148	3300047471	Ga0495684_0026702	Ga0495684_0026702_2667_3434	243
149	3300047673	Ga0495593_0007999	Ga0495593_0007999_728_1495	243
150	3300048905	Ga0496102_0283665	Ga0496102_0283665_220_987	243
151	3300053078	Ga0495612_0016661	Ga0495612_0016661_1449_2216	243
152	3300053084	Ga0495595_0000585	Ga0495595_0000585_9079_9846	243
153	3300053085	Ga0495619_0003397	Ga0495619_0003397_8951_9718	243
154	3300053122	Ga0500608_199055	Ga0500608_199055_14_781	243
155	3300053177	Ga0500636_0263910	Ga0500636_0263910_30_797	243
156	3300003215	JGI25153J46596_10005452	JGI25153J46596_100054524	244
157	3300005435	Ga0070714_100003521	Ga0070714_1000035212	244
158	3300005436	Ga0070713_100169750	Ga0070713_1001697502	244
159	3300005437	Ga0070710_10000219	Ga0070710_1000021915	244
160	3300025297	Ga0209758_1000244	Ga0209758_100024436	244
161	3300025898	Ga0207692_10041308	Ga0207692_100413082	244
162	3300025917	Ga0207660_10606324	Ga0207660_106063241	244
163	3300025928	Ga0207700_10012800	Ga0207700_100128002	244
164	3300025929	Ga0207664_10004015	Ga0207664_1000401511	244
165	3300039437	Ga0436365_1613453	Ga0436365_1613453_6267_7037	244
166	3300039453	Ga0436362_1096840	Ga0436362_1096840_48_818	244
167	3300042438	Ga0439459_0042053	Ga0439459_0042053_145_924	244
168	3300044694	Ga0466963_0091736	Ga0466963_0091736_1026_1805	244
169	3300044842	Ga0466957_0132101	Ga0466957_0132101_232_1011	244
170	3300044842	Ga0466957_0159328	Ga0466957_0159328_553_1323	244
171	3300045976	Ga0466967_0087856	Ga0466967_0087856_1619_2398	244
172	3300048924	Ga0496121_0064130	Ga0496121_0064130_1867_2691	244
173	3300053150	Ga0500603_044160	Ga0500603_044160_199_969	244
174	3300005327	Ga0070658_10138983	Ga0070658_101389832	245
175	3300005328	Ga0070676_10224228	Ga0070676_102242282	245
176	3300005330	Ga0070690_100079786	Ga0070690_1000797862	245
177	3300005333	Ga0070677_10020850	Ga0070677_100208501	245
178	3300005334	Ga0068869_100251000	Ga0068869_1002510002	245
179	3300005340	Ga0070689_100006692	Ga0070689_1000066922	245
180	3300005341	Ga0070691_10126572	Ga0070691_101265722	245
181	3300005343	Ga0070687_100072336	Ga0070687_1000723362	245
182	3300005347	Ga0070668_100203002	Ga0070668_1002030022	245
183	3300005353	Ga0070669_100065099	Ga0070669_1000650993	245
184	3300005356	Ga0070674_100027828	Ga0070674_1000278285	245
185	3300005356	Ga0070674_100092327	Ga0070674_1000923273	245
186	3300005356	Ga0070674_100171952	Ga0070674_1001719522	245
187	3300005365	Ga0070688_100019543	Ga0070688_1000195431	245
188	3300005436	Ga0070713_100005267	Ga0070713_1000052678	245
189	3300005438	Ga0070701_10145415	Ga0070701_101454152	245
190	3300005438	Ga0070701_10250179	Ga0070701_102501792	245
191	3300005439	Ga0070711_100033520	Ga0070711_1000335202	245
192	3300005439	Ga0070711_100661968	Ga0070711_1006619681	245
193	3300005458	Ga0070681_10050978	Ga0070681_100509785	245
194	3300005535	Ga0070684_100439476	Ga0070684_1004394762	245
195	3300005544	Ga0070686_100366596	Ga0070686_1003665961	245
196	3300005547	Ga0070693_100012010	Ga0070693_1000120104	245
197	3300005549	Ga0070704_100136830	Ga0070704_1001368302	245
198	3300005616	Ga0068852_100461752	Ga0068852_1004617522	245
199	3300005618	Ga0068864_100780671	Ga0068864_1007806712	245
200	3300005844	Ga0068862_100144378	Ga0068862_1001443782	245
201	3300005937	Ga0081455_10026478	Ga0081455_100264782	245
202	3300005983	Ga0081540_1026817	Ga0081540_10268172	245
203	3300005985	Ga0081539_10125918	Ga0081539_101259181	245
204	3300006028	Ga0070717_10079796	Ga0070717_100797962	245
205	3300006058	Ga0075432_10001003	Ga0075432_100010036	245
206	3300006195	Ga0075366_10019382	Ga0075366_100193823	245
207	3300006844	Ga0075428_100002668	Ga0075428_10000266813	245
208	3300006847	Ga0075431_100117836	Ga0075431_1001178363	245
209	3300006852	Ga0075433_10000867	Ga0075433_1000086717	245
210	3300006871	Ga0075434_100000212	Ga0075434_10000021213	245
211	3300006880	Ga0075429_100000347	Ga0075429_10000034718	245
212	3300009093	Ga0105240_10007716	Ga0105240_100077167	245
213	3300009094	Ga0111539_10000138	Ga0111539_1000013847	245
214	3300009094	Ga0111539_10024504	Ga0111539_100245046	245
215	3300009098	Ga0105245_10592625	Ga0105245_105926251	245
216	3300009101	Ga0105247_10158394	Ga0105247_101583943	245
217	3300009147	Ga0114129_10010376	Ga0114129_1001037610	245
218	3300009147	Ga0114129_10584854	Ga0114129_105848542	245
219	3300009177	Ga0105248_10014049	Ga0105248_100140497	245
220	3300009553	Ga0105249_10547077	Ga0105249_105470772	245
221	3300009553	Ga0105249_10568681	Ga0105249_105686812	245
222	3300011119	Ga0105246_10235177	Ga0105246_102351773	245
223	3300013104	Ga0157370_10047158	Ga0157370_100471583	245
224	3300013306	Ga0163162_10589798	Ga0163162_105897981	245
225	3300013308	Ga0157375_10174307	Ga0157375_101743073	245
226	3300014325	Ga0163163_10035303	Ga0163163_100353032	245
227	3300014326	Ga0157380_10194590	Ga0157380_101945903	245
228	3300025302	Ga0207426_1045021	Ga0207426_10450213	245
229	3300025898	Ga0207692_10014346	Ga0207692_100143461	245
230	3300025905	Ga0207685_10110502	Ga0207685_101105021	245
231	3300025907	Ga0207645_10013680	Ga0207645_100136803	245
232	3300025912	Ga0207707_10465165	Ga0207707_104651651	245
233	3300025916	Ga0207663_10031494	Ga0207663_100314942	245
234	3300025916	Ga0207663_10660007	Ga0207663_106600071	245
235	3300025918	Ga0207662_10173765	Ga0207662_101737652	245
236	3300025921	Ga0207652_10278511	Ga0207652_102785112	245
237	3300025921	Ga0207652_10572921	Ga0207652_105729212	245
238	3300025936	Ga0207670_10001179	Ga0207670_100011798	245
239	3300025937	Ga0207669_10054912	Ga0207669_100549122	245
240	3300025941	Ga0207711_10063867	Ga0207711_100638673	245
241	3300025942	Ga0207689_10557055	Ga0207689_105570551	245
242	3300025961	Ga0207712_10026052	Ga0207712_100260522	245
243	3300025972	Ga0207668_10168527	Ga0207668_101685273	245
244	3300025981	Ga0207640_10188839	Ga0207640_101888392	245
245	3300026089	Ga0207648_10066672	Ga0207648_100666723	245
246	3300026142	Ga0207698_10357754	Ga0207698_103577542	245
247	3300027907	Ga0207428_10000075	Ga0207428_1000007585	245
248	3300028380	Ga0268265_10092645	Ga0268265_100926453	245
249	3300028573	Ga0265334_10048093	Ga0265334_100480932	245
250	3300028800	Ga0265338_10056737	Ga0265338_100567372	245
251	3300028800	Ga0265338_10137204	Ga0265338_101372042	245
252	3300031241	Ga0265325_10001027	Ga0265325_100010278	245
253	3300031241	Ga0265325_10052001	Ga0265325_100520012	245
254	3300031241	Ga0265325_10121447	Ga0265325_101214472	245
255	3300031247	Ga0265340_10081324	Ga0265340_100813242	245
256	3300031249	Ga0265339_10002695	Ga0265339_100026953	245
257	3300031249	Ga0265339_10007467	Ga0265339_100074677	245
258	3300031249	Ga0265339_10048991	Ga0265339_100489912	245
259	3300031344	Ga0265316_10058717	Ga0265316_100587173	245
260	3300031595	Ga0265313_10010197	Ga0265313_100101973	245
261	3300031595	Ga0265313_10021808	Ga0265313_100218083	245
262	3300031711	Ga0265314_10001108	Ga0265314_1000110811	245
263	3300031711	Ga0265314_10005031	Ga0265314_100050313	245
264	3300035085	Ga0373929_0006342	Ga0373929_0006342_812_1594	245
265	3300035086	Ga0373934_0156353	Ga0373934_0156353_51_833	245
266	3300035114	Ga0373939_0098764	Ga0373939_0098764_86_868	245
267	3300035172	Ga0373955_0010158	Ga0373955_0010158_1256_2038	245
268	3300035172	Ga0373955_0043913	Ga0373955_0043913_1388_2170	245
269	3300035410	Ga0373924_0020006	Ga0373924_0020006_1449_2231	245
270	3300035410	Ga0373924_0106856	Ga0373924_0106856_274_1056	245
271	3300035691	Ga0373931_0001270	Ga0373931_0001270_3742_4524	245
272	3300035691	Ga0373931_0009933	Ga0373931_0009933_2873_3655	245
273	3300035724	Ga0373933_0006680	Ga0373933_0006680_4846_5628	245
274	3300035724	Ga0373933_0020526	Ga0373933_0020526_581_1363	245
275	3300035725	Ga0373947_0123863	Ga0373947_0123863_322_1104	245
276	3300036401	Ga0373937_0010217	Ga0373937_0010217_6924_7706	245
277	3300036401	Ga0373937_0014444	Ga0373937_0014444_4533_5315	245
278	3300036401	Ga0373937_0025760	Ga0373937_0025760_3004_3786	245
279	3300036401	Ga0373937_0055730	Ga0373937_0055730_2785_3567	245
280	3300037312	Ga0395899_0003623	Ga0395899_0003623_5628_6410	245
281	3300037312	Ga0395899_0385853	Ga0395899_0385853_130_912	245
282	3300037418	Ga0395900_0005902	Ga0395900_0005902_379_1161	245
283	3300037418	Ga0395900_0028894	Ga0395900_0028894_2866_3648	245
284	3300037466	Ga0395898_0004247	Ga0395898_0004247_976_1758	245
285	3300037466	Ga0395898_0049408	Ga0395898_0049408_2774_3556	245
286	3300037466	Ga0395898_0073225	Ga0395898_0073225_1034_1816	245
287	3300037466	Ga0395898_0688599	Ga0395898_0688599_15_797	245
288	3300038443	Ga0395901_0013616	Ga0395901_0013616_1617_2399	245
289	3300038443	Ga0395901_0132019	Ga0395901_0132019_1045_1827	245
290	3300038443	Ga0395901_0212553	Ga0395901_0212553_562_1344	245
291	3300038443	Ga0395901_0565796	Ga0395901_0565796_198_980	245
292	3300039437	Ga0436365_1137755	Ga0436365_1137755_229_1011	245
293	3300042435	Ga0439434_0059350	Ga0439434_0059350_336_1118	245
294	3300046454	Ga0495592_0021768	Ga0495592_0021768_2374_3156	245
295	3300046463	Ga0495653_0110823	Ga0495653_0110823_458_1240	245
296	3300046473	Ga0495582_0045379	Ga0495582_0045379_374_1156	245
297	3300046475	Ga0495639_0199968	Ga0495639_0199968_105_887	245
298	3300046511	Ga0495608_0066128	Ga0495608_0066128_340_1122	245
299	3300046514	Ga0495618_0028607	Ga0495618_0028607_466_1248	245
300	3300046514	Ga0495618_0071081	Ga0495618_0071081_69_851	245
301	3300046516	Ga0495628_0017439	Ga0495628_0017439_2815_3597	245
302	3300046516	Ga0495628_0030614	Ga0495628_0030614_1680_2462	245
303	3300046516	Ga0495628_0085481	Ga0495628_0085481_1346_2128	245
304	3300046529	Ga0495652_0005932	Ga0495652_0005932_10196_10978	245
305	3300046529	Ga0495652_0059519	Ga0495652_0059519_2370_3152	245
306	3300046533	Ga0495640_0071352	Ga0495640_0071352_1392_2174	245
307	3300046536	Ga0495587_0007877	Ga0495587_0007877_4482_5264	245
308	3300046536	Ga0495587_0037295	Ga0495587_0037295_1287_2069	245
309	3300046543	Ga0495645_0021985	Ga0495645_0021985_1742_2524	245
310	3300046559	Ga0495667_0003140	Ga0495667_0003140_3308_4090	245
311	3300046559	Ga0495667_0052181	Ga0495667_0052181_1789_2571	245
312	3300046675	Ga0495657_0016257	Ga0495657_0016257_3849_4631	245
313	3300046675	Ga0495657_0113284	Ga0495657_0113284_214_996	245
314	3300046678	Ga0495599_0037298	Ga0495599_0037298_1210_1992	245
315	3300046683	Ga0495658_0049156	Ga0495658_0049156_293_1075	245
316	3300046690	Ga0495624_0258244	Ga0495624_0258244_127_909	245
317	3300046809	Ga0495600_0022633	Ga0495600_0022633_273_1055	245
318	3300047317	Ga0495604_0018942	Ga0495604_0018942_385_1167	245
319	3300047317	Ga0495604_0122244	Ga0495604_0122244_796_1578	245
320	3300047322	Ga0495680_0017173	Ga0495680_0017173_2275_3057	245
321	3300047322	Ga0495680_0027894	Ga0495680_0027894_2106_2888	245
322	3300047673	Ga0495593_0052682	Ga0495593_0052682_207_989	245
323	3300048088	Ga0495602_0010028	Ga0495602_0010028_4264_5046	245
324	3300048088	Ga0495602_0017200	Ga0495602_0017200_4141_4923	245
325	3300048088	Ga0495602_0104793	Ga0495602_0104793_370_1152	245
326	3300048903	Ga0496100_0269961	Ga0496100_0269961_147_929	245
327	3300048905	Ga0496102_0087479	Ga0496102_0087479_522_1304	245
328	3300048907	Ga0496104_0000079	Ga0496104_0000079_9711_10493	245
329	3300048907	Ga0496104_0037334	Ga0496104_0037334_1719_2501	245
330	3300048908	Ga0496105_0000225	Ga0496105_0000225_4988_5770	245
331	3300048908	Ga0496105_0077643	Ga0496105_0077643_1629_2411	245
332	3300048909	Ga0496106_0193267	Ga0496106_0193267_279_1061	245
333	3300048910	Ga0496107_0061520	Ga0496107_0061520_1434_2216	245
334	3300048911	Ga0496108_0036968	Ga0496108_0036968_1221_2003	245
335	3300048912	Ga0496109_0101111	Ga0496109_0101111_1458_2240	245
336	3300048913	Ga0496110_0021898	Ga0496110_0021898_2450_3232	245
337	3300048914	Ga0496111_0078813	Ga0496111_0078813_118_900	245
338	3300048915	Ga0496112_0047644	Ga0496112_0047644_1556_2338	245
339	3300048915	Ga0496112_0076116	Ga0496112_0076116_1510_2292	245
340	3300048915	Ga0496112_0107858	Ga0496112_0107858_1639_2421	245
341	3300048916	Ga0496113_0057049	Ga0496113_0057049_385_1167	245
342	3300048917	Ga0496114_0027338	Ga0496114_0027338_3431_4213	245
343	3300048917	Ga0496114_0356400	Ga0496114_0356400_426_1208	245
344	3300048918	Ga0496115_0021747	Ga0496115_0021747_2337_3119	245
345	3300048918	Ga0496115_0064292	Ga0496115_0064292_1971_2753	245
346	3300048918	Ga0496115_0345001	Ga0496115_0345001_88_870	245
347	3300049568	Ga0501031_0001202	Ga0501031_0001202_10153_10932	245
348	3300049569	Ga0501032_0003544	Ga0501032_0003544_4018_4797	245
349	3300049570	Ga0501033_0002722	Ga0501033_0002722_7356_8135	245
350	3300049571	Ga0501034_0009885	Ga0501034_0009885_4615_5394	245
351	3300049571	Ga0501034_0143650	Ga0501034_0143650_115_897	245
352	3300049571	Ga0501034_0245798	Ga0501034_0245798_754_1536	245
353	3300049571	Ga0501034_0257536	Ga0501034_0257536_402_1184	245
354	3300049572	Ga0501036_0000559	Ga0501036_0000559_15430_16209	245
355	3300049572	Ga0501036_0003800	Ga0501036_0003800_4996_5778	245
356	3300049573	Ga0501037_0020898	Ga0501037_0020898_1719_2498	245
357	3300049574	Ga0501038_0003386	Ga0501038_0003386_6609_7388	245
358	3300049574	Ga0501038_0120013	Ga0501038_0120013_1103_1885	245
359	3300049575	Ga0501039_0006912	Ga0501039_0006912_3917_4696	245
360	3300049579	Ga0501043_0009163	Ga0501043_0009163_623_1402	245
361	3300049579	Ga0501043_0022608	Ga0501043_0022608_276_1058	245
362	3300049580	Ga0501046_0009686	Ga0501046_0009686_3444_4226	245
363	3300049581	Ga0501047_0011344	Ga0501047_0011344_2460_3239	245
364	3300049581	Ga0501047_0134823	Ga0501047_0134823_1193_1975	245
365	3300049581	Ga0501047_0275628	Ga0501047_0275628_402_1184	245
366	3300049582	Ga0501048_0010341	Ga0501048_0010341_1103_1885	245
367	3300049583	Ga0501067_0007710	Ga0501067_0007710_4793_5575	245
368	3300049584	Ga0501068_0011020	Ga0501068_0011020_4035_4817	245
369	3300049586	Ga0501070_0003459	Ga0501070_0003459_6114_6893	245
370	3300049590	Ga0501074_0019241	Ga0501074_0019241_3844_4626	245
371	3300049741	Ga0501079_0011556	Ga0501079_0011556_3435_4217	245
372	3300049744	Ga0501083_0022246	Ga0501083_0022246_31_813	245
373	3300049744	Ga0501083_0032813	Ga0501083_0032813_2323_3105	245
374	3300049822	Ga0501035_0003212	Ga0501035_0003212_2460_3239	245
375	3300049823	Ga0501044_0000057	Ga0501044_0000057_107467_108249	245
376	3300049823	Ga0501044_0006768	Ga0501044_0006768_5861_6640	245
377	3300049823	Ga0501044_0014205	Ga0501044_0014205_4505_5287	245
378	3300050489	nmdc:mga03683_79666_c1	nmdc:mga03683_79666_c1_218_1000	245
379	3300050493	nmdc:mga0k408_5798_c1	nmdc:mga0k408_5798_c1_612_1394	245
380	3300050496	nmdc:mga07m45_117681_c1	nmdc:mga07m45_117681_c1_319_1101	245
381	3300050507	nmdc:mga05p37_32_c1	nmdc:mga05p37_32_c1_34606_35388	245
382	3300050509	nmdc:mga0qj67_355_c1	nmdc:mga0qj67_355_c1_24486_25268	245
383	3300050510	nmdc:mga06r32_428152_c1	nmdc:mga06r32_428152_c1_274_1056	245
384	3300050510	nmdc:mga06r32_448_c1	nmdc:mga06r32_448_c1_22680_23462	245
385	3300050511	nmdc:mga08y16_2557_c1	nmdc:mga08y16_2557_c1_11538_12320	245
386	3300050512	nmdc:mga0n895_568_c1	nmdc:mga0n895_568_c1_15782_16564	245
387	3300050513	nmdc:mga0rr50_23412_c1	nmdc:mga0rr50_23412_c1_2660_3442	245
388	3300050514	nmdc:mga08x19_65652_c1	nmdc:mga08x19_65652_c1_206_988	245
389	3300050515	nmdc:mga0a205_466_c1	nmdc:mga0a205_466_c1_13553_14335	245
390	3300053077	Ga0495601_0002455	Ga0495601_0002455_2568_3350	245
391	3300053077	Ga0495601_0003073	Ga0495601_0003073_1945_2727	245
392	3300053077	Ga0495601_0025744	Ga0495601_0025744_595_1377	245
393	3300053078	Ga0495612_0040782	Ga0495612_0040782_161_943	245
394	3300053078	Ga0495612_0043014	Ga0495612_0043014_947_1729	245
395	3300053084	Ga0495595_0001738	Ga0495595_0001738_3092_3874	245
396	3300053084	Ga0495595_0001995	Ga0495595_0001995_1635_2417	245
397	3300053084	Ga0495595_0003599	Ga0495595_0003599_1983_2765	245
398	3300053084	Ga0495595_0008990	Ga0495595_0008990_901_1683	245
399	3300053085	Ga0495619_0000016	Ga0495619_0000016_78619_79401	245
400	3300053085	Ga0495619_0008487	Ga0495619_0008487_1071_1853	245
401	3300053085	Ga0495619_0028250	Ga0495619_0028250_2423_3205	245
402	3300053096	Ga0500641_0006510	Ga0500641_0006510_3322_4104	245
403	3300054114	Ga0501084_0024903	Ga0501084_0024903_3707_4489	245
404	3300054114	Ga0501084_0250311	Ga0501084_0250311_258_1040	245
405	3300060353	Ga0501082_0003083	Ga0501082_0003083_8027_8809	245
406	3300060353	Ga0501082_0086841	Ga0501082_0086841_1453_2235	245
407	3300060353	Ga0501082_0263288	Ga0501082_0263288_358_1140	245
408	3300006844	Ga0075428_100489839	Ga0075428_1004898392	246
409	3300037466	Ga0395898_0220224	Ga0395898_0220224_49_846	246
410	3300038443	Ga0395901_0001501	Ga0395901_0001501_21201_21998	246
411	3300048929	Ga0496126_0100995	Ga0496126_0100995_944_1756	246
412	3300049569	Ga0501032_0045915	Ga0501032_0045915_2129_2926	246
413	3300049570	Ga0501033_0044786	Ga0501033_0044786_105_902	246
414	3300049571	Ga0501034_0106842	Ga0501034_0106842_1676_2473	246
415	3300049572	Ga0501036_0097217	Ga0501036_0097217_17_814	246
416	3300049573	Ga0501037_0217810	Ga0501037_0217810_256_1053	246
417	3300049574	Ga0501038_0072677	Ga0501038_0072677_32_829	246
418	3300049575	Ga0501039_0400286	Ga0501039_0400286_110_907	246
419	3300049579	Ga0501043_0061611	Ga0501043_0061611_2129_2926	246
420	3300049580	Ga0501046_0021034	Ga0501046_0021034_4185_4982	246
421	3300049581	Ga0501047_0174105	Ga0501047_0174105_1187_1984	246
422	3300049582	Ga0501048_0027660	Ga0501048_0027660_2932_3729	246
423	3300049586	Ga0501070_0099434	Ga0501070_0099434_32_829	246
424	3300049744	Ga0501083_0080108	Ga0501083_0080108_1158_1955	246
425	3300049822	Ga0501035_0047729	Ga0501035_0047729_657_1454	246
426	iso_pu_bacteria	2513237096	2513661055	246
427	iso_pu_bacteria	2513237098	2513672951	246
428	iso_pu_bacteria	2513237101	2513698185	246
429	iso_pu_bacteria	2513237137	2513860574	246
430	iso_pu_bacteria	2513237145	2513918981	246
431	iso_pu_bacteria	2517572143	2517888302	246
432	iso_pu_bacteria	2524023210	2524466433	246
433	iso_pu_bacteria	2524023228	2524539885	246
434	iso_pu_bacteria	2667528175	2671123348	246
435	iso_pu_bacteria	2721755755	2723849236	246
436	iso_pu_bacteria	2791355197	2793067119	246
437	iso_pu_bacteria	2791355199	2793078397	246
438	iso_pu_bacteria	2879110137	2879112688	246
439	iso_pu_bacteria	2885374607	2885378996	246
440	iso_pu_bacteria	2885383462	2885385649	246
441	iso_pu_bacteria	2889033259	2889035987	246
442	iso_pu_bacteria	2903768456	2903770456	246
443	iso_pu_bacteria	2904699407	2904709777	246
444	iso_pu_bacteria	2906610324	2906614342	246
445	iso_pu_bacteria	2906635258	2906639161	246
446	iso_pu_bacteria	2906660503	2906666728	246
447	iso_pu_bacteria	2908739725	2908746833	246
448	iso_pu_bacteria	2922361189	2922364456	246
449	iso_pu_bacteria	2922425934	2922426171	246
450	iso_pu_bacteria	2935630451	2935632560	246
451	iso_pu_bacteria	2941507105	2941508776	246
452	iso_pu_bacteria	2941515067	2941516606	246
453	iso_pu_bacteria	2941523033	2941524378	246
454	iso_pu_bacteria	3005474847	3005483372	246
455	iso_pu_bacteria	8006933436	8006936874	246
456	iso_pu_bacteria	8006964411	8006967770	246
457	iso_pu_bacteria	8006973647	8006976844	246
458	iso_pu_bacteria	8006984368	8006992561	246
459	iso_pu_bacteria	8006994254	8006998441	246
460	iso_pu_bacteria	8019555841	8019561814	246
461	iso_pu_bacteria	8019565922	8019571884	246
462	iso_pu_bacteria	8056673599	8056678486	246
463	iso_pu_bacteria	8056681323	8056683073	246
464	3300005435	Ga0070714_100404577	Ga0070714_1004045772	247
465	3300031911	Ga0307412_10018506	Ga0307412_100185064	247
466	3300005981	Ga0081538_10005451	Ga0081538_1000545110	248
467	3300006177	Ga0075362_10011146	Ga0075362_100111465	248
468	3300006178	Ga0075367_10001993	Ga0075367_100019937	248
469	3300006186	Ga0075369_10001014	Ga0075369_100010148	248
470	3300027866	Ga0209813_10006026	Ga0209813_100060263	248
471	3300050489	nmdc:mga03683_26995_c1	nmdc:mga03683_26995_c1_701_1489	248
472	3300050491	nmdc:mga00v17_355353_c1	nmdc:mga00v17_355353_c1_108_896	248
473	3300050494	nmdc:mga06z11_37840_c1	nmdc:mga06z11_37840_c1_582_1370	248
474	3300050495	nmdc:mga04h51_5425_c1	nmdc:mga04h51_5425_c1_2149_2937	248
475	3300050512	nmdc:mga0n895_71083_c1	nmdc:mga0n895_71083_c1_2379_3182	248
476	3300006048	Ga0075363_100059602	Ga0075363_1000596022	249
477	3300006353	Ga0075370_10146604	Ga0075370_101466042	249
478	3300010375	Ga0105239_10320927	Ga0105239_103209272	249
479	3300035083	Ga0373926_0004478	Ga0373926_0004478_1713_2504	249
480	3300035113	Ga0373936_0050938	Ga0373936_0050938_405_1196	249
481	3300035116	Ga0373945_0001809	Ga0373945_0001809_3572_4363	249
482	3300035171	Ga0373946_0002908	Ga0373946_0002908_541_1332	249
483	3300035410	Ga0373924_0080650	Ga0373924_0080650_368_1159	249
484	3300035692	Ga0373935_0006141	Ga0373935_0006141_1320_2111	249
485	3300035695	Ga0373927_0017519	Ga0373927_0017519_2868_3659	249
486	3300035725	Ga0373947_0006037	Ga0373947_0006037_2876_3667	249
487	3300037068	Ga0373925_0000712	Ga0373925_0000712_29424_30215	249
488	3300046476	Ga0495662_0042144	Ga0495662_0042144_1384_2175	249
489	3300046526	Ga0495666_0015834	Ga0495666_0015834_1416_2207	249
490	3300046663	Ga0495635_0016971	Ga0495635_0016971_1042_1833	249
491	3300046683	Ga0495658_0133840	Ga0495658_0133840_287_1078	249
492	3300046689	Ga0495613_0024630	Ga0495613_0024630_3600_4391	249
493	3300046689	Ga0495613_0090682	Ga0495613_0090682_974_1765	249
494	3300046690	Ga0495624_0004090	Ga0495624_0004090_6637_7428	249
495	3300047315	Ga0495581_0013564	Ga0495581_0013564_843_1634	249
496	3300047321	Ga0495676_0038513	Ga0495676_0038513_2750_3541	249
497	3300047471	Ga0495684_0021795	Ga0495684_0021795_2896_3687	249
498	3300048910	Ga0496107_0006383	Ga0496107_0006383_1537_2331	249
499	3300053723	Ga0500567_065747	Ga0500567_065747_481_1317	249
500	3300003659	JGI25404J52841_10012054	JGI25404J52841_100120542	250
501	3300005327	Ga0070658_10022210	Ga0070658_100222103	250
502	3300005328	Ga0070676_10007989	Ga0070676_100079895	250
503	3300005330	Ga0070690_100071901	Ga0070690_1000719011	250
504	3300005334	Ga0068869_100151733	Ga0068869_1001517332	250
505	3300005334	Ga0068869_100175557	Ga0068869_1001755572	250
506	3300005339	Ga0070660_100499619	Ga0070660_1004996192	250
507	3300005340	Ga0070689_100153757	Ga0070689_1001537572	250
508	3300005340	Ga0070689_100459467	Ga0070689_1004594671	250
509	3300005343	Ga0070687_100156066	Ga0070687_1001560662	250
510	3300005343	Ga0070687_100161895	Ga0070687_1001618952	250
511	3300005344	Ga0070661_100133431	Ga0070661_1001334312	250
512	3300005347	Ga0070668_100016551	Ga0070668_1000165516	250
513	3300005347	Ga0070668_100306427	Ga0070668_1003064272	250
514	3300005353	Ga0070669_100280263	Ga0070669_1002802632	250
515	3300005356	Ga0070674_100038335	Ga0070674_1000383354	250
516	3300005356	Ga0070674_100052473	Ga0070674_1000524732	250
517	3300005364	Ga0070673_100404252	Ga0070673_1004042522	250
518	3300005364	Ga0070673_100442221	Ga0070673_1004422212	250
519	3300005366	Ga0070659_100066837	Ga0070659_1000668372	250
520	3300005436	Ga0070713_100137998	Ga0070713_1001379982	250
521	3300005438	Ga0070701_10097051	Ga0070701_100970512	250
522	3300005438	Ga0070701_10105281	Ga0070701_101052812	250
523	3300005439	Ga0070711_100007523	Ga0070711_1000075232	250
524	3300005440	Ga0070705_100040255	Ga0070705_1000402553	250
525	3300005441	Ga0070700_100190472	Ga0070700_1001904722	250
526	3300005455	Ga0070663_100003302	Ga0070663_10000330213	250
527	3300005455	Ga0070663_100088155	Ga0070663_1000881551	250
528	3300005456	Ga0070678_100320464	Ga0070678_1003204642	250
529	3300005458	Ga0070681_10058567	Ga0070681_100585673	250
530	3300005459	Ga0068867_100182624	Ga0068867_1001826241	250
531	3300005518	Ga0070699_100208678	Ga0070699_1002086782	250
532	3300005530	Ga0070679_100022307	Ga0070679_1000223076	250
533	3300005539	Ga0068853_100054249	Ga0068853_1000542494	250
534	3300005539	Ga0068853_100156671	Ga0068853_1001566713	250
535	3300005539	Ga0068853_100394294	Ga0068853_1003942942	250
536	3300005544	Ga0070686_100292381	Ga0070686_1002923812	250
537	3300005548	Ga0070665_100063100	Ga0070665_1000631003	250
538	3300005548	Ga0070665_100071766	Ga0070665_1000717664	250
539	3300005548	Ga0070665_100080102	Ga0070665_1000801022	250
540	3300005548	Ga0070665_100426623	Ga0070665_1004266232	250
541	3300005548	Ga0070665_100451801	Ga0070665_1004518012	250
542	3300005563	Ga0068855_100025942	Ga0068855_1000259425	250
543	3300005563	Ga0068855_100518989	Ga0068855_1005189892	250
544	3300005614	Ga0068856_100109711	Ga0068856_1001097113	250
545	3300005615	Ga0070702_100022487	Ga0070702_1000224872	250
546	3300005616	Ga0068852_100107132	Ga0068852_1001071323	250
547	3300005617	Ga0068859_100160315	Ga0068859_1001603153	250
548	3300005618	Ga0068864_100177651	Ga0068864_1001776512	250
549	3300005719	Ga0068861_100201588	Ga0068861_1002015882	250
550	3300005841	Ga0068863_100404598	Ga0068863_1004045982	250
551	3300005842	Ga0068858_100115183	Ga0068858_1001151833	250
552	3300005843	Ga0068860_100415052	Ga0068860_1004150522	250
553	3300005844	Ga0068862_100123022	Ga0068862_1001230222	250
554	3300005937	Ga0081455_10003639	Ga0081455_1000363910	250
555	3300005981	Ga0081538_10122368	Ga0081538_101223681	250
556	3300005983	Ga0081540_1002615	Ga0081540_10026156	250
557	3300005983	Ga0081540_1003198	Ga0081540_10031983	250
558	3300005983	Ga0081540_1003591	Ga0081540_100359114	250
559	3300005983	Ga0081540_1016877	Ga0081540_10168773	250
560	3300005985	Ga0081539_10070600	Ga0081539_100706001	250
561	3300006038	Ga0075365_10043037	Ga0075365_100430374	250
562	3300006048	Ga0075363_100002768	Ga0075363_1000027689	250
563	3300006048	Ga0075363_100013835	Ga0075363_1000138352	250
564	3300006048	Ga0075363_100175536	Ga0075363_1001755362	250
565	3300006048	Ga0075363_100180628	Ga0075363_1001806282	250
566	3300006173	Ga0070716_100094518	Ga0070716_1000945182	250
567	3300006177	Ga0075362_10207613	Ga0075362_102076132	250
568	3300006178	Ga0075367_10091455	Ga0075367_100914552	250
569	3300006186	Ga0075369_10051331	Ga0075369_100513312	250
570	3300006358	Ga0068871_100064908	Ga0068871_1000649082	250
571	3300006931	Ga0097620_100160321	Ga0097620_1001603212	250
572	3300006942	Ga0099824_1010813	Ga0099824_10108137	250
573	3300006943	Ga0099822_1002332	Ga0099822_100233216	250
574	3300009101	Ga0105247_10110641	Ga0105247_101106412	250
575	3300009147	Ga0114129_10089335	Ga0114129_100893353	250
576	3300009148	Ga0105243_10474368	Ga0105243_104743682	250
577	3300009148	Ga0105243_10745938	Ga0105243_107459382	250
578	3300009174	Ga0105241_10054713	Ga0105241_100547134	250
579	3300009177	Ga0105248_10026944	Ga0105248_100269445	250
580	3300009177	Ga0105248_10259572	Ga0105248_102595722	250
581	3300009177	Ga0105248_10303618	Ga0105248_103036182	250
582	3300009177	Ga0105248_10696872	Ga0105248_106968721	250
583	3300009545	Ga0105237_10103849	Ga0105237_101038492	250
584	3300009551	Ga0105238_10209494	Ga0105238_102094942	250
585	3300009553	Ga0105249_10041299	Ga0105249_100412993	250
586	3300009553	Ga0105249_10121599	Ga0105249_101215993	250
587	3300010375	Ga0105239_10044865	Ga0105239_100448652	250
588	3300010375	Ga0105239_10053186	Ga0105239_100531863	250
589	3300013104	Ga0157370_10029759	Ga0157370_100297593	250
590	3300013297	Ga0157378_10106557	Ga0157378_101065573	250
591	3300013306	Ga0163162_10536148	Ga0163162_105361482	250
592	3300013308	Ga0157375_10181037	Ga0157375_101810373	250
593	3300013308	Ga0157375_10966388	Ga0157375_109663882	250
594	3300014325	Ga0163163_10427621	Ga0163163_104276212	250
595	3300014969	Ga0157376_10099907	Ga0157376_100999072	250
596	3300017792	Ga0163161_10083267	Ga0163161_100832672	250
597	3300025261	Ga0209233_1002405	Ga0209233_10024053	250
598	3300025297	Ga0209758_1002652	Ga0209758_100265213	250
599	3300025297	Ga0209758_1026000	Ga0209758_10260002	250
600	3300025711	Ga0207696_1025943	Ga0207696_10259432	250
601	3300025901	Ga0207688_10053300	Ga0207688_100533003	250
602	3300025901	Ga0207688_10155497	Ga0207688_101554972	250
603	3300025904	Ga0207647_10181563	Ga0207647_101815632	250
604	3300025907	Ga0207645_10016597	Ga0207645_100165975	250
605	3300025910	Ga0207684_10217473	Ga0207684_102174732	250
606	3300025911	Ga0207654_10015682	Ga0207654_100156822	250
607	3300025912	Ga0207707_10081956	Ga0207707_100819563	250
608	3300025915	Ga0207693_10025307	Ga0207693_100253075	250
609	3300025916	Ga0207663_10018460	Ga0207663_100184604	250
610	3300025916	Ga0207663_10371905	Ga0207663_103719052	250
611	3300025918	Ga0207662_10098936	Ga0207662_100989362	250
612	3300025920	Ga0207649_10207496	Ga0207649_102074962	250
613	3300025921	Ga0207652_10108192	Ga0207652_101081922	250
614	3300025924	Ga0207694_10137548	Ga0207694_101375482	250
615	3300025925	Ga0207650_10354078	Ga0207650_103540782	250
616	3300025927	Ga0207687_10261685	Ga0207687_102616852	250
617	3300025933	Ga0207706_10034285	Ga0207706_100342856	250
618	3300025933	Ga0207706_10037506	Ga0207706_100375064	250
619	3300025935	Ga0207709_10240492	Ga0207709_102404922	250
620	3300025935	Ga0207709_10315345	Ga0207709_103153452	250
621	3300025939	Ga0207665_10020658	Ga0207665_100206582	250
622	3300025940	Ga0207691_10307161	Ga0207691_103071612	250
623	3300025941	Ga0207711_10348779	Ga0207711_103487792	250
624	3300025942	Ga0207689_10046448	Ga0207689_100464485	250
625	3300025942	Ga0207689_10059449	Ga0207689_100594492	250
626	3300025942	Ga0207689_10378252	Ga0207689_103782522	250
627	3300025944	Ga0207661_10464035	Ga0207661_104640352	250
628	3300025949	Ga0207667_10027659	Ga0207667_100276596	250
629	3300025949	Ga0207667_10240719	Ga0207667_102407192	250
630	3300025961	Ga0207712_10278130	Ga0207712_102781302	250
631	3300026041	Ga0207639_10553146	Ga0207639_105531462	250
632	3300026067	Ga0207678_10065204	Ga0207678_100652042	250
633	3300026075	Ga0207708_10026796	Ga0207708_100267962	250
634	3300026075	Ga0207708_10088023	Ga0207708_100880233	250
635	3300026089	Ga0207648_10089470	Ga0207648_100894702	250
636	3300026089	Ga0207648_10168517	Ga0207648_101685172	250
637	3300026095	Ga0207676_10264546	Ga0207676_102645462	250
638	3300026118	Ga0207675_100051860	Ga0207675_1000518604	250
639	3300026121	Ga0207683_10227508	Ga0207683_102275082	250
640	3300026121	Ga0207683_10370364	Ga0207683_103703642	250
641	3300026121	Ga0207683_10543238	Ga0207683_105432381	250
642	3300027357	Ga0209589_1000015	Ga0209589_100001540	250
643	3300027361	Ga0209489_100015	Ga0209489_10001540	250
644	3300027363	Ga0209700_100025	Ga0209700_10002540	250
645	3300027866	Ga0209813_10039005	Ga0209813_100390052	250
646	3300028379	Ga0268266_10007778	Ga0268266_100077783	250
647	3300028379	Ga0268266_10008893	Ga0268266_100088936	250
648	3300028379	Ga0268266_10031660	Ga0268266_100316605	250
649	3300028379	Ga0268266_10157078	Ga0268266_101570783	250
650	3300028380	Ga0268265_10347269	Ga0268265_103472691	250
651	3300028786	Ga0307517_10001780	Ga0307517_1000178018	250
652	3300028786	Ga0307517_10066118	Ga0307517_100661183	250
653	3300028794	Ga0307515_10054512	Ga0307515_100545123	250
654	3300031456	Ga0307513_10175747	Ga0307513_101757473	250
655	3300031616	Ga0307508_10033626	Ga0307508_100336264	250
656	3300031711	Ga0265314_10102993	Ga0265314_101029932	250
657	3300031730	Ga0307516_10042852	Ga0307516_100428524	250
658	3300031730	Ga0307516_10112713	Ga0307516_101127133	250
659	3300031730	Ga0307516_10134300	Ga0307516_101343002	250
660	3300031731	Ga0307405_10205624	Ga0307405_102056242	250
661	3300031824	Ga0307413_10201762	Ga0307413_102017622	250
662	3300032002	Ga0307416_100928346	Ga0307416_1009283461	250
663	3300032005	Ga0307411_10317668	Ga0307411_103176682	250
664	3300032126	Ga0307415_100069402	Ga0307415_1000694023	250
665	3300033180	Ga0307510_10017889	Ga0307510_100178895	250
666	3300033180	Ga0307510_10109954	Ga0307510_101099541	250
667	3300033442	Ga0315911_1000021	Ga0315911_10000218	250
668	3300034816	Ga0373930_0013343	Ga0373930_0013343_253_1041	250
669	3300035092	Ga0373952_0018253	Ga0373952_0018253_151_939	250
670	3300035116	Ga0373945_0149220	Ga0373945_0149220_133_921	250
671	3300035121	Ga0373960_0131149	Ga0373960_0131149_16_804	250
672	3300035170	Ga0373943_0030259	Ga0373943_0030259_400_1188	250
673	3300035170	Ga0373943_0142425	Ga0373943_0142425_444_1232	250
674	3300035691	Ga0373931_0009956	Ga0373931_0009956_2746_3534	250
675	3300035691	Ga0373931_0218425	Ga0373931_0218425_326_1114	250
676	3300035695	Ga0373927_0024841	Ga0373927_0024841_2884_3672	250
677	3300037068	Ga0373925_0041393	Ga0373925_0041393_2202_2990	250
678	3300037068	Ga0373925_0063889	Ga0373925_0063889_830_1618	250
679	3300041413	Ga0439465_0132101	Ga0439465_0132101_33_821	250
680	3300041494	Ga0451837_0749707	Ga0451837_0749707_38_826	250
681	3300045051	Ga0451576_0921308	Ga0451576_0921308_114_902	250
682	3300046452	Ga0495617_024087	Ga0495617_024087_383_1171	250
683	3300046455	Ga0495603_0020915	Ga0495603_0020915_375_1163	250
684	3300046455	Ga0495603_0095347	Ga0495603_0095347_781_1569	250
685	3300046455	Ga0495603_0097223	Ga0495603_0097223_568_1356	250
686	3300046457	Ga0495590_0097283	Ga0495590_0097283_144_932	250
687	3300046459	Ga0495629_0099921	Ga0495629_0099921_906_1694	250
688	3300046472	Ga0495580_0101222	Ga0495580_0101222_732_1520	250
689	3300046472	Ga0495580_0205628	Ga0495580_0205628_35_823	250
690	3300046473	Ga0495582_0062134	Ga0495582_0062134_337_1125	250
691	3300046475	Ga0495639_0157614	Ga0495639_0157614_117_905	250
692	3300046499	Ga0495594_0015471	Ga0495594_0015471_1691_2479	250
693	3300046515	Ga0495620_0103999	Ga0495620_0103999_130_918	250
694	3300046515	Ga0495620_0124738	Ga0495620_0124738_17_805	250
695	3300046516	Ga0495628_0379038	Ga0495628_0379038_183_971	250
696	3300046517	Ga0495630_0090128	Ga0495630_0090128_1504_2292	250
697	3300046519	Ga0495632_0038844	Ga0495632_0038844_157_945	250
698	3300046524	Ga0495648_0110531	Ga0495648_0110531_640_1428	250
699	3300046525	Ga0495663_0037551	Ga0495663_0037551_437_1225	250
700	3300046529	Ga0495652_0261358	Ga0495652_0261358_228_1016	250
701	3300046531	Ga0495665_0074081	Ga0495665_0074081_537_1325	250
702	3300046531	Ga0495665_0296919	Ga0495665_0296919_22_810	250
703	3300046557	Ga0495622_0091959	Ga0495622_0091959_297_1085	250
704	3300046616	Ga0495668_0033637	Ga0495668_0033637_1796_2584	250
705	3300046648	Ga0495611_0056145	Ga0495611_0056145_165_953	250
706	3300046663	Ga0495635_0176123	Ga0495635_0176123_70_858	250
707	3300046674	Ga0495588_0117824	Ga0495588_0117824_53_841	250
708	3300046681	Ga0495647_0146379	Ga0495647_0146379_160_948	250
709	3300046684	Ga0495669_0014235	Ga0495669_0014235_625_1413	250
710	3300046691	Ga0495670_0045696	Ga0495670_0045696_745_1533	250
711	3300047321	Ga0495676_0131518	Ga0495676_0131518_979_1767	250
712	3300047322	Ga0495680_0117205	Ga0495680_0117205_733_1521	250
713	3300047323	Ga0495683_0037869	Ga0495683_0037869_935_1723	250
714	3300047469	Ga0495673_0087062	Ga0495673_0087062_463_1251	250
715	3300048088	Ga0495602_0236440	Ga0495602_0236440_554_1342	250
716	3300048903	Ga0496100_0048959	Ga0496100_0048959_1252_2040	250
717	3300048903	Ga0496100_0201625	Ga0496100_0201625_451_1239	250
718	3300048904	Ga0496101_0033278	Ga0496101_0033278_1429_2217	250
719	3300048904	Ga0496101_0171960	Ga0496101_0171960_132_920	250
720	3300048905	Ga0496102_0035246	Ga0496102_0035246_1412_2200	250
721	3300048905	Ga0496102_0301310	Ga0496102_0301310_537_1325	250
722	3300048906	Ga0496103_0021916	Ga0496103_0021916_2677_3465	250
723	3300048907	Ga0496104_0021540	Ga0496104_0021540_3551_4339	250
724	3300048907	Ga0496104_0683744	Ga0496104_0683744_95_883	250
725	3300048908	Ga0496105_0021408	Ga0496105_0021408_1239_2027	250
726	3300048909	Ga0496106_0049101	Ga0496106_0049101_514_1302	250
727	3300048910	Ga0496107_0026598	Ga0496107_0026598_1899_2687	250
728	3300048910	Ga0496107_0162791	Ga0496107_0162791_546_1334	250
729	3300048911	Ga0496108_0042694	Ga0496108_0042694_1381_2169	250
730	3300048911	Ga0496108_0120157	Ga0496108_0120157_997_1785	250
731	3300048911	Ga0496108_0252538	Ga0496108_0252538_182_970	250
732	3300048912	Ga0496109_0024123	Ga0496109_0024123_3043_3831	250
733	3300048913	Ga0496110_0029273	Ga0496110_0029273_750_1538	250
734	3300048914	Ga0496111_0013376	Ga0496111_0013376_2686_3474	250
735	3300048915	Ga0496112_0018992	Ga0496112_0018992_683_1471	250
736	3300048915	Ga0496112_0027083	Ga0496112_0027083_3237_4025	250
737	3300048916	Ga0496113_0019566	Ga0496113_0019566_2808_3596	250
738	3300048917	Ga0496114_0032827	Ga0496114_0032827_908_1696	250
739	3300048918	Ga0496115_0074754	Ga0496115_0074754_1239_2027	250
740	3300048922	Ga0496119_0142450	Ga0496119_0142450_390_1178	250
741	3300048924	Ga0496121_0072706	Ga0496121_0072706_921_1709	250
742	3300048924	Ga0496121_0079491	Ga0496121_0079491_1036_1824	250
743	3300048929	Ga0496126_0012693	Ga0496126_0012693_7452_8240	250
744	3300048929	Ga0496126_0013193	Ga0496126_0013193_7119_7907	250
745	3300048929	Ga0496126_0264080	Ga0496126_0264080_610_1398	250
746	3300049570	Ga0501033_0001519	Ga0501033_0001519_9911_10747	250
747	3300049572	Ga0501036_0010203	Ga0501036_0010203_638_1474	250
748	3300049573	Ga0501037_0000618	Ga0501037_0000618_7443_8279	250
749	3300049574	Ga0501038_0009070	Ga0501038_0009070_1681_2517	250
750	3300049575	Ga0501039_0026119	Ga0501039_0026119_1622_2458	250
751	3300049579	Ga0501043_0003811	Ga0501043_0003811_9105_9941	250
752	3300049580	Ga0501046_0015885	Ga0501046_0015885_2030_2866	250
753	3300049586	Ga0501070_0332508	Ga0501070_0332508_367_1155	250
754	3300049592	Ga0501076_0091494	Ga0501076_0091494_743_1531	250
755	3300049742	Ga0501080_0042927	Ga0501080_0042927_2296_3132	250
756	3300049822	Ga0501035_0015169	Ga0501035_0015169_1801_2637	250
757	3300049823	Ga0501044_0039705	Ga0501044_0039705_2043_2879	250
758	3300050490	nmdc:mga03n38_15385_c1	nmdc:mga03n38_15385_c1_1302_2090	250
759	3300050490	nmdc:mga03n38_16088_c1	nmdc:mga03n38_16088_c1_1239_2027	250
760	3300050492	nmdc:mga0yw44_125918_c1	nmdc:mga0yw44_125918_c1_494_1282	250
761	3300050492	nmdc:mga0yw44_386852_c1	nmdc:mga0yw44_386852_c1_13_801	250
762	3300050494	nmdc:mga06z11_47495_c1	nmdc:mga06z11_47495_c1_947_1735	250
763	3300050496	nmdc:mga07m45_31507_c1	nmdc:mga07m45_31507_c1_164_952	250
764	3300050516	nmdc:mga0sz30_18533_c1	nmdc:mga0sz30_18533_c1_1837_2625	250
765	3300053077	Ga0495601_0112152	Ga0495601_0112152_418_1206	250
766	3300053084	Ga0495595_0013998	Ga0495595_0013998_680_1468	250
767	3300053085	Ga0495619_0021537	Ga0495619_0021537_1662_2450	250
768	3300053085	Ga0495619_0191585	Ga0495619_0191585_440_1228	250
769	3300053094	Ga0500566_0006845	Ga0500566_0006845_2516_3304	250
770	3300053096	Ga0500641_0037324	Ga0500641_0037324_101_889	250
771	3300053103	Ga0500555_031226	Ga0500555_031226_387_1175	250
772	3300053119	Ga0500595_003368	Ga0500595_003368_893_1681	250
773	3300053119	Ga0500595_006596	Ga0500595_006596_3705_4493	250
774	3300053142	Ga0500577_0044315	Ga0500577_0044315_597_1385	250
775	3300053147	Ga0500589_072834	Ga0500589_072834_738_1526	250
776	3300053150	Ga0500603_042196	Ga0500603_042196_200_988	250
777	3300053177	Ga0500636_0138788	Ga0500636_0138788_352_1140	250
778	3300053178	Ga0500637_0000134	Ga0500637_0000134_20203_20991	250
779	3300053730	Ga0500645_078355	Ga0500645_078355_79_867	250
780	3300053730	Ga0500645_091879	Ga0500645_091879_20_808	250
781	3300053731	Ga0500609_013082	Ga0500609_013082_114_902	250
782	3300055283	Ga0500661_000037	Ga0500661_000037_6556_7344	250
783	3300039450	Ga0436363_1407757	Ga0436363_1407757_12291_13082	251
784	3300046475	Ga0495639_0106261	Ga0495639_0106261_426_1229	252
785	3300048920	Ga0496117_0022795	Ga0496117_0022795_3677_4471	252
786	3300048921	Ga0496118_0021560	Ga0496118_0021560_3573_4367	252
787	3300054114	Ga0501084_0289993	Ga0501084_0289993_252_1055	252
788	3300005435	Ga0070714_100331167	Ga0070714_1003311672	253
789	3300005937	Ga0081455_10064204	Ga0081455_100642044	253
790	3300006042	Ga0075368_10027236	Ga0075368_100272362	253
791	3300006173	Ga0070716_100272375	Ga0070716_1002723752	253
792	3300006175	Ga0070712_100024020	Ga0070712_1000240202	253
793	3300006353	Ga0075370_10126918	Ga0075370_101269182	253
794	3300006846	Ga0075430_100034038	Ga0075430_1000340382	253
795	3300006847	Ga0075431_100588204	Ga0075431_1005882042	253
796	3300006880	Ga0075429_100341066	Ga0075429_1003410662	253
797	3300006914	Ga0075436_100002520	Ga0075436_10000252012	253
798	3300007076	Ga0075435_100380272	Ga0075435_1003802722	253
799	3300007788	Ga0099795_10057526	Ga0099795_100575262	253
800	3300025906	Ga0207699_10035469	Ga0207699_100354693	253
801	3300025906	Ga0207699_10072028	Ga0207699_100720282	253
802	3300025915	Ga0207693_10015350	Ga0207693_100153504	253
803	3300025916	Ga0207663_10280014	Ga0207663_102800142	253
804	3300025928	Ga0207700_10219765	Ga0207700_102197652	253
805	3300025929	Ga0207664_10242529	Ga0207664_102425292	253
806	3300025929	Ga0207664_10341243	Ga0207664_103412432	253
807	3300025939	Ga0207665_10095577	Ga0207665_100955772	253
808	3300027866	Ga0209813_10031087	Ga0209813_100310872	253
809	3300035089	Ga0373944_0058617	Ga0373944_0058617_353_1159	253
810	3300035111	Ga0373923_0003227	Ga0373923_0003227_2686_3492	253
811	3300035113	Ga0373936_0001304	Ga0373936_0001304_282_1088	253
812	3300035113	Ga0373936_0188336	Ga0373936_0188336_44_871	253
813	3300035116	Ga0373945_0019921	Ga0373945_0019921_609_1415	253
814	3300035117	Ga0373953_0115928	Ga0373953_0115928_298_1104	253
815	3300035118	Ga0373954_0002635	Ga0373954_0002635_2524_3330	253
816	3300035120	Ga0373957_0006132	Ga0373957_0006132_616_1422	253
817	3300035170	Ga0373943_0079949	Ga0373943_0079949_656_1462	253
818	3300035171	Ga0373946_0012215	Ga0373946_0012215_903_1709	253
819	3300035172	Ga0373955_0000562	Ga0373955_0000562_2895_3701	253
820	3300035692	Ga0373935_0000370	Ga0373935_0000370_21022_21828	253
821	3300035692	Ga0373935_0009509	Ga0373935_0009509_1253_2080	253
822	3300035695	Ga0373927_0110246	Ga0373927_0110246_292_1119	253
823	3300035724	Ga0373933_0003564	Ga0373933_0003564_4102_4908	253
824	3300035725	Ga0373947_0000476	Ga0373947_0000476_17045_17851	253
825	3300035725	Ga0373947_0044456	Ga0373947_0044456_738_1565	253
826	3300035725	Ga0373947_0120506	Ga0373947_0120506_410_1216	253
827	3300036401	Ga0373937_0000009	Ga0373937_0000009_81853_82659	253
828	3300037068	Ga0373925_0000194	Ga0373925_0000194_29539_30345	253
829	3300037068	Ga0373925_0113552	Ga0373925_0113552_810_1637	253
830	3300039437	Ga0436365_1355613	Ga0436365_1355613_168_965	253
831	3300044694	Ga0466963_0292157	Ga0466963_0292157_105_911	253
832	3300044842	Ga0466957_0107617	Ga0466957_0107617_659_1456	253
833	3300045976	Ga0466967_0155489	Ga0466967_0155489_187_984	253
834	3300046454	Ga0495592_0000018	Ga0495592_0000018_18944_19750	253
835	3300046459	Ga0495629_0004511	Ga0495629_0004511_9326_10132	253
836	3300046462	Ga0495651_0002271	Ga0495651_0002271_4446_5252	253
837	3300046463	Ga0495653_0000032	Ga0495653_0000032_51054_51860	253
838	3300046476	Ga0495662_0094274	Ga0495662_0094274_132_959	253
839	3300046477	Ga0495664_0000010	Ga0495664_0000010_185852_186658	253
840	3300046511	Ga0495608_0000008	Ga0495608_0000008_81991_82797	253
841	3300046514	Ga0495618_0000002	Ga0495618_0000002_188125_188931	253
842	3300046516	Ga0495628_0000009	Ga0495628_0000009_185880_186686	253
843	3300046517	Ga0495630_0012646	Ga0495630_0012646_2930_3736	253
844	3300046529	Ga0495652_0000011	Ga0495652_0000011_81681_82487	253
845	3300046531	Ga0495665_0154737	Ga0495665_0154737_187_993	253
846	3300046533	Ga0495640_0000009	Ga0495640_0000009_30433_31239	253
847	3300046533	Ga0495640_0047463	Ga0495640_0047463_1262_2089	253
848	3300046536	Ga0495587_0000006	Ga0495587_0000006_299598_300404	253
849	3300046543	Ga0495645_0000010	Ga0495645_0000010_51054_51860	253
850	3300046559	Ga0495667_0000005	Ga0495667_0000005_185880_186686	253
851	3300046642	Ga0495634_0000223	Ga0495634_0000223_37323_38129	253
852	3300046663	Ga0495635_0000008	Ga0495635_0000008_81664_82470	253
853	3300046675	Ga0495657_0000058	Ga0495657_0000058_36417_37223	253
854	3300046678	Ga0495599_0000007	Ga0495599_0000007_81681_82487	253
855	3300046679	Ga0495623_0000085	Ga0495623_0000085_6952_7758	253
856	3300046680	Ga0495646_0000021	Ga0495646_0000021_81636_82442	253
857	3300046689	Ga0495613_0060566	Ga0495613_0060566_1277_2083	253
858	3300046809	Ga0495600_0000001	Ga0495600_0000001_81681_82487	253
859	3300047315	Ga0495581_0012658	Ga0495581_0012658_2346_3152	253
860	3300047315	Ga0495581_0147629	Ga0495581_0147629_411_1217	253
861	3300047317	Ga0495604_0000012	Ga0495604_0000012_185867_186673	253
862	3300047319	Ga0495674_0000011	Ga0495674_0000011_188153_188959	253
863	3300047319	Ga0495674_0228876	Ga0495674_0228876_282_1109	253
864	3300047322	Ga0495680_0001281	Ga0495680_0001281_16895_17701	253
865	3300047444	Ga0495675_0000096	Ga0495675_0000096_32337_33143	253
866	3300047471	Ga0495684_0000084	Ga0495684_0000084_13741_14547	253
867	3300047673	Ga0495593_0000727	Ga0495593_0000727_13030_13836	253
868	3300048088	Ga0495602_0000073	Ga0495602_0000073_81664_82470	253
869	3300048914	Ga0496111_0011478	Ga0496111_0011478_2287_3093	253
870	3300050489	nmdc:mga03683_98222_c1	nmdc:mga03683_98222_c1_327_1133	253
871	3300050491	nmdc:mga00v17_149421_c1	nmdc:mga00v17_149421_c1_101_907	253
872	3300050494	nmdc:mga06z11_286585_c1	nmdc:mga06z11_286585_c1_96_902	253
873	3300050496	nmdc:mga07m45_13488_c1	nmdc:mga07m45_13488_c1_2222_3028	253
874	3300050496	nmdc:mga07m45_141264_c1	nmdc:mga07m45_141264_c1_491_1297	253
875	3300050508	nmdc:mga09592_379111_c1	nmdc:mga09592_379111_c1_175_981	253
876	3300050509	nmdc:mga0qj67_58358_c1	nmdc:mga0qj67_58358_c1_1399_2205	253
877	3300050510	nmdc:mga06r32_484929_c1	nmdc:mga06r32_484929_c1_66_872	253
878	3300050514	nmdc:mga08x19_75626_c1	nmdc:mga08x19_75626_c1_1109_1912	253
879	3300053077	Ga0495601_0000009	Ga0495601_0000009_81664_82470	253
880	3300053078	Ga0495612_0000019	Ga0495612_0000019_55358_56164	253
881	3300053084	Ga0495595_0000015	Ga0495595_0000015_62919_63725	253
882	3300053085	Ga0495619_0000012	Ga0495619_0000012_81664_82470	253
883	3300053119	Ga0500595_001921	Ga0500595_001921_532_1338	253
884	iso_pu_bacteria	2842038055	2842041506	253
885	iso_pu_bacteria	2842045827	2842049548	253
886	3300006871	Ga0075434_100029198	Ga0075434_1000291987	254
887	3300007076	Ga0075435_100030598	Ga0075435_1000305984	254
888	3300010375	Ga0105239_10565929	Ga0105239_105659291	254
889	3300026121	Ga0207683_10057950	Ga0207683_100579502	254
890	3300031238	Ga0265332_10000310	Ga0265332_1000031024	254
891	3300031247	Ga0265340_10006782	Ga0265340_100067823	254
892	3300031249	Ga0265339_10001481	Ga0265339_1000148113	254
893	3300031711	Ga0265314_10012625	Ga0265314_100126255	254
894	3300031712	Ga0265342_10000175	Ga0265342_1000017547	254
895	3300031730	Ga0307516_10297534	Ga0307516_102975342	254
896	3300035692	Ga0373935_0196992	Ga0373935_0196992_511_1317	254
897	3300046455	Ga0495603_0073031	Ga0495603_0073031_459_1265	254
898	3300046511	Ga0495608_0277069	Ga0495608_0277069_219_1025	254
899	3300046683	Ga0495658_0166900	Ga0495658_0166900_473_1285	254
900	3300047471	Ga0495684_0204942	Ga0495684_0204942_101_907	254
901	3300047472	Ga0495686_0148332	Ga0495686_0148332_15_815	254
902	3300047472	Ga0495686_0170656	Ga0495686_0170656_417_1217	254
903	3300048909	Ga0496106_0001271	Ga0496106_0001271_3949_4755	254
904	3300048919	Ga0496116_0080857	Ga0496116_0080857_70_876	254
905	3300048921	Ga0496118_0032916	Ga0496118_0032916_474_1280	254
906	3300048924	Ga0496121_0000451	Ga0496121_0000451_24513_25319	254
907	3300048927	Ga0496124_0002796	Ga0496124_0002796_12965_13771	254
908	3300048928	Ga0496125_0117757	Ga0496125_0117757_805_1611	254
909	3300048929	Ga0496126_0002876	Ga0496126_0002876_12671_13477	254
910	3300048929	Ga0496126_0065754	Ga0496126_0065754_586_1386	254
911	3300049571	Ga0501034_0209919	Ga0501034_0209919_257_1066	254
912	3300049573	Ga0501037_0302981	Ga0501037_0302981_258_1067	254
913	3300049574	Ga0501038_0242527	Ga0501038_0242527_588_1397	254
914	3300049822	Ga0501035_0035666	Ga0501035_0035666_2917_3726	254
915	3300049823	Ga0501044_0094455	Ga0501044_0094455_1876_2685	254
916	3300050513	nmdc:mga0rr50_104377_c1	nmdc:mga0rr50_104377_c1_64_876	254
917	3300050513	nmdc:mga0rr50_167580_c1	nmdc:mga0rr50_167580_c1_691_1497	254
918	3300053119	Ga0500595_001845	Ga0500595_001845_9614_10414	254
919	3300053119	Ga0500595_004885	Ga0500595_004885_3523_4335	254
920	3300053131	Ga0500652_000067	Ga0500652_000067_29719_30531	254
921	iso_pu_bacteria	2893066018	2893071907	254
922	3300005437	Ga0070710_10078820	Ga0070710_100788202	255
923	3300006175	Ga0070712_100000205	Ga0070712_10000020524	255
924	3300006175	Ga0070712_100015320	Ga0070712_1000153202	255
925	3300009147	Ga0114129_10001559	Ga0114129_1000155917	255
926	3300025898	Ga0207692_10041845	Ga0207692_100418452	255
927	3300025915	Ga0207693_10000988	Ga0207693_100009889	255
928	3300025915	Ga0207693_10002485	Ga0207693_1000248510	255
929	3300025916	Ga0207663_10080238	Ga0207663_100802381	255
930	3300035170	Ga0373943_0014965	Ga0373943_0014965_511_1320	255
931	3300035725	Ga0373947_0017246	Ga0373947_0017246_2240_3049	255
932	3300037068	Ga0373925_0040364	Ga0373925_0040364_1329_2138	255
933	3300045976	Ga0466967_0108572	Ga0466967_0108572_795_1598	255
934	3300046454	Ga0495592_0093013	Ga0495592_0093013_803_1612	255
935	3300046476	Ga0495662_0007510	Ga0495662_0007510_4290_5099	255
936	3300046477	Ga0495664_0001526	Ga0495664_0001526_7517_8326	255
937	3300046514	Ga0495618_0011411	Ga0495618_0011411_406_1215	255
938	3300046517	Ga0495630_0034537	Ga0495630_0034537_1365_2174	255
939	3300046526	Ga0495666_0082792	Ga0495666_0082792_424_1233	255
940	3300046529	Ga0495652_0081149	Ga0495652_0081149_853_1662	255
941	3300046531	Ga0495665_0014223	Ga0495665_0014223_993_1802	255
942	3300046533	Ga0495640_0028396	Ga0495640_0028396_1978_2787	255
943	3300046535	Ga0495586_0008408	Ga0495586_0008408_2986_3795	255
944	3300046642	Ga0495634_0007380	Ga0495634_0007380_993_1802	255
945	3300046663	Ga0495635_0007866	Ga0495635_0007866_1122_1931	255
946	3300046678	Ga0495599_0106999	Ga0495599_0106999_517_1326	255
947	3300047319	Ga0495674_0322764	Ga0495674_0322764_425_1234	255
948	3300048903	Ga0496100_0023926	Ga0496100_0023926_615_1427	255
949	3300048904	Ga0496101_0105062	Ga0496101_0105062_1095_1907	255
950	3300048908	Ga0496105_0093708	Ga0496105_0093708_354_1166	255
951	3300048911	Ga0496108_0048820	Ga0496108_0048820_108_920	255
952	3300048917	Ga0496114_0282994	Ga0496114_0282994_613_1425	255
953	3300050507	nmdc:mga05p37_1895_c1	nmdc:mga05p37_1895_c1_9231_10049	255
954	3300053077	Ga0495601_0010039	Ga0495601_0010039_2710_3519	255
955	3300053077	Ga0495601_0196081	Ga0495601_0196081_124_936	255
956	3300053078	Ga0495612_0001365	Ga0495612_0001365_6028_6837	255
957	3300053078	Ga0495612_0020905	Ga0495612_0020905_795_1613	255
958	3300053084	Ga0495595_0051986	Ga0495595_0051986_421_1233	255
959	3300053085	Ga0495619_0002388	Ga0495619_0002388_3139_3948	255
960	3300053085	Ga0495619_0015857	Ga0495619_0015857_587_1399	255
961	iso_pu_bacteria	2513237141	2513889695	255
962	iso_pu_bacteria	8006926726	8006932909	255
963	3300005614	Ga0068856_100596106	Ga0068856_1005961062	256
964	3300005983	Ga0081540_1050244	Ga0081540_10502442	256
965	3300006844	Ga0075428_100428258	Ga0075428_1004282582	256
966	3300009147	Ga0114129_10600402	Ga0114129_106004022	256
967	3300048910	Ga0496107_0025796	Ga0496107_0025796_1938_2744	256
968	3300048911	Ga0496108_0000507	Ga0496108_0000507_27839_28645	256
969	3300048912	Ga0496109_0006041	Ga0496109_0006041_965_1771	256
970	3300048913	Ga0496110_0002891	Ga0496110_0002891_10975_11781	256
971	3300048915	Ga0496112_0007653	Ga0496112_0007653_7394_8200	256
972	3300048922	Ga0496119_0044654	Ga0496119_0044654_496_1356	256
973	3300049571	Ga0501034_0065930	Ga0501034_0065930_2230_3048	256
974	3300050507	nmdc:mga05p37_425828_c1	nmdc:mga05p37_425828_c1_40_858	256
975	3300050507	nmdc:mga05p37_615293_c1	nmdc:mga05p37_615293_c1_129_947	256
976	iso_pu_bacteria	2507262055	2507504721	256
977	iso_pu_bacteria	2508501009	2508539862	256
978	iso_pu_bacteria	2508501042	2508695006	256
979	iso_pu_bacteria	2511231028	2511394947	256
980	iso_pu_bacteria	2513237094	2513640757	256
981	iso_pu_bacteria	2513237095	2513651737	256
982	iso_pu_bacteria	2513237102	2513705651	256
983	iso_pu_bacteria	2513237139	2513879219	256
984	iso_pu_bacteria	2513237161	2514010231	256
985	iso_pu_bacteria	2515154112	2515627805	256
986	iso_pu_bacteria	2517093001	2517106514	256
987	iso_pu_bacteria	2524023205	2524440167	256
988	iso_pu_bacteria	2528768022	2528850646	256
989	iso_pu_bacteria	2617270735	2617350130	256
990	iso_pu_bacteria	2617270741	2617377180	256
991	iso_pu_bacteria	2744054633	2745077723	256
992	iso_pu_bacteria	2791355196	2793065740	256
993	iso_pu_bacteria	2802429603	2805920357	256
994	iso_pu_bacteria	2816332527	2818239359	256
995	iso_pu_bacteria	2824600985	2824605857	256
996	iso_pu_bacteria	2824609381	2824611929	256
997	iso_pu_bacteria	2824617872	2824622805	256
998	iso_pu_bacteria	2824626560	2824631893	256
999	iso_pu_bacteria	2824635225	2824639159	256
1000	iso_pu_bacteria	2824644064	2824650403	256
1001	iso_pu_bacteria	2824653114	2824660232	256
1002	iso_pu_bacteria	2824661429	2824664259	256
1003	iso_pu_bacteria	2824671348	2824676076	256
1004	iso_pu_bacteria	2824679649	2824681964	256
1005	iso_pu_bacteria	2824687955	2824692504	256
1006	iso_pu_bacteria	2824696289	2824699805	256
1007	iso_pu_bacteria	2824704595	2824711044	256
1008	iso_pu_bacteria	2824714736	2824720282	256
1009	iso_pu_bacteria	2824723954	2824730689	256
1010	iso_pu_bacteria	2824732956	2824734159	256
1011	iso_pu_bacteria	2824746037	2824749569	256
1012	iso_pu_bacteria	2824753945	2824762800	256
1013	iso_pu_bacteria	2824763712	2824772850	256
1014	iso_pu_bacteria	2824773399	2824780980	256
1015	iso_pu_bacteria	2838122688	2838125853	256
1016	iso_pu_bacteria	2841941048	2841948446	256
1017	iso_pu_bacteria	2841949485	2841952893	256
1018	iso_pu_bacteria	2841957949	2841963493	256
1019	iso_pu_bacteria	2841966195	2841971075	256
1020	iso_pu_bacteria	2841974524	2841977666	256
1021	iso_pu_bacteria	2841983080	2841984773	256
1022	iso_pu_bacteria	2844315083	2844315951	256
1023	iso_pu_bacteria	2847930680	2847939813	256
1024	iso_pu_bacteria	2849076700	2849076786	256
1025	iso_pu_bacteria	2857509624	2857515741	256
1026	iso_pu_bacteria	2874590934	2874593682	256
1027	iso_pu_bacteria	2874620515	2874622050	256
1028	iso_pu_bacteria	2874628541	2874629279	256
1029	iso_pu_bacteria	2874645413	2874647946	256
1030	iso_pu_bacteria	2876761206	2876769780	256
1031	iso_pu_bacteria	2876771140	2876772773	256
1032	iso_pu_bacteria	2876818435	2876826498	256
1033	iso_pu_bacteria	2879074833	2879077469	256
1034	iso_pu_bacteria	2879083081	2879088248	256
1035	iso_pu_bacteria	2879099564	2879105558	256
1036	iso_pu_bacteria	2879127579	2879134426	256
1037	iso_pu_bacteria	2879142872	2879147385	256
1038	iso_pu_bacteria	2885366525	2885369038	256
1039	iso_pu_bacteria	2885409591	2885415477	256
1040	iso_pu_bacteria	2888378607	2888379008	256
1041	iso_pu_bacteria	2888388044	2888390178	256
1042	iso_pu_bacteria	2888419890	2888427317	256
1043	iso_pu_bacteria	2903727486	2903731900	256
1044	iso_pu_bacteria	2904666416	2904669358	256
1045	iso_pu_bacteria	2904711408	2904716109	256
1046	iso_pu_bacteria	2906602504	2906606159	256
1047	iso_pu_bacteria	2906643746	2906649340	256
1048	iso_pu_bacteria	2908775508	2908775695	256
1049	iso_pu_bacteria	2922368715	2922377888	256
1050	iso_pu_bacteria	2922393267	2922400873	256
1051	iso_pu_bacteria	2929615660	2929623905	256
1052	iso_pu_bacteria	2929624759	2929633061	256
1053	iso_pu_bacteria	2932784394	2932789154	256
1054	iso_pu_bacteria	2932794094	2932800117	256
1055	iso_pu_bacteria	2932801729	2932808299	256
1056	iso_pu_bacteria	2932809354	2932814209	256
1057	iso_pu_bacteria	2932818245	2932820335	256
1058	iso_pu_bacteria	2932828146	2932834403	256
1059	iso_pu_bacteria	2933577622	2933585808	256
1060	iso_pu_bacteria	2935608549	2935615086	256
1061	iso_pu_bacteria	2935616580	2935620088	256
1062	iso_pu_bacteria	2935638405	2935640406	256
1063	iso_pu_bacteria	2935648319	2935651564	256
1064	iso_pu_bacteria	2935656913	2935659668	256
1065	iso_pu_bacteria	2935665750	2935668600	256
1066	iso_pu_bacteria	2935675223	2935681902	256
1067	iso_pu_bacteria	2935684952	2935686909	256
1068	iso_pu_bacteria	2935694250	2935702053	256
1069	iso_pu_bacteria	2935703347	2935709890	256
1070	iso_pu_bacteria	2935713505	2935716597	256
1071	iso_pu_bacteria	2935722832	2935723278	256
1072	iso_pu_bacteria	2935732158	2935734835	256
1073	iso_pu_bacteria	2935741537	2935744374	256
1074	iso_pu_bacteria	2935750917	2935752875	256
1075	iso_pu_bacteria	2935760218	2935769267	256
1076	iso_pu_bacteria	2935769743	2935774770	256
1077	iso_pu_bacteria	2935777560	2935779663	256
1078	iso_pu_bacteria	2935785616	2935789715	256
1079	iso_pu_bacteria	2935793552	2935797917	256
1080	iso_pu_bacteria	2935801545	2935806306	256
1081	iso_pu_bacteria	2935810662	2935818161	256
1082	iso_pu_bacteria	2935819856	2935825876	256
1083	iso_pu_bacteria	2935827899	2935831912	256
1084	iso_pu_bacteria	2935837841	2935841257	256
1085	iso_pu_bacteria	2935847175	2935851495	256
1086	iso_pu_bacteria	2935855204	2935858974	256
1087	iso_pu_bacteria	2935864058	2935864155	256
1088	iso_pu_bacteria	2935873716	2935875493	256
1089	iso_pu_bacteria	2935883170	2935883405	256
1090	iso_pu_bacteria	2935908558	2935910481	256
1091	iso_pu_bacteria	2935916978	2935918117	256
1092	iso_pu_bacteria	2935926038	2935927608	256
1093	iso_pu_bacteria	2935934488	2935936520	256
1094	iso_pu_bacteria	2935942939	2935943927	256
1095	iso_pu_bacteria	2935951376	2935952364	256
1096	iso_pu_bacteria	2935959822	2935964045	256
1097	iso_pu_bacteria	2935967501	2935969204	256
1098	iso_pu_bacteria	2935975950	2935978034	256
1099	iso_pu_bacteria	2935984226	2935984665	256
1100	iso_pu_bacteria	2935992306	2935995527	256
1101	iso_pu_bacteria	2936002035	2936007949	256
1102	iso_pu_bacteria	2936011229	2936014084	256
1103	iso_pu_bacteria	2936019824	2936023007	256
1104	iso_pu_bacteria	2936028420	2936031143	256
1105	iso_pu_bacteria	2936037263	2936044771	256
1106	iso_pu_bacteria	2936046547	2936049265	256
1107	iso_pu_bacteria	2936055302	2936055808	256
1108	iso_pu_bacteria	2940556831	2940558788	256
1109	iso_pu_bacteria	2941531003	2941535817	256
1110	iso_pu_bacteria	2941538514	2941543483	256
1111	iso_pu_bacteria	3005483717	3005490587	256
1112	iso_pu_bacteria	3005506211	3005506403	256
1113	iso_pu_bacteria	3005587118	3005588953	256
1114	iso_pu_bacteria	3005594810	3005595544	256
1115	iso_pu_bacteria	3005710791	3005711531	256
1116	iso_pu_bacteria	3005718088	3005718769	256
1117	iso_pu_bacteria	8016511872	8016517642	256
1118	iso_pu_bacteria	8016522445	8016525705	256
1119	iso_pu_bacteria	8016530956	8016539301	256
1120	iso_pu_bacteria	8016539877	8016543588	256
1121	iso_pu_bacteria	8016548790	8016549703	256
1122	iso_pu_bacteria	8016557553	8016558120	256
1123	iso_pu_bacteria	8016575299	8016581633	256
1124	iso_pu_bacteria	8016595262	8016596128	256
1125	iso_pu_bacteria	8016622563	8016622618	256
1126	iso_pu_bacteria	8016630954	8016636430	256
1127	iso_pu_bacteria	8017057580	8017058983	256
1128	iso_pu_bacteria	8019538911	8019541013	256
1129	iso_pu_bacteria	8019576017	8019576658	256
1130	iso_pu_bacteria	8019597564	8019607027	256
1131	iso_pu_bacteria	8019608314	8019611483	256
1132	iso_pu_bacteria	8019619141	8019622413	256
1133	iso_pu_bacteria	8019629233	8019630868	256
1134	iso_pu_bacteria	8019648815	8019653085	256
1135	iso_pu_bacteria	8019659431	8019667883	256
1136	iso_pu_bacteria	8019668869	8019677298	256
1137	iso_pu_bacteria	8019678201	8019678680	256
1138	iso_pu_bacteria	8019687851	8019696833	256
1139	iso_pu_bacteria	8055742211	8055742960	256
1140	iso_pu_bacteria	8056967851	8056970745	256
1141	3300006186	Ga0075369_10040975	Ga0075369_100409752	257
1142	3300006353	Ga0075370_10277507	Ga0075370_102775072	257
1143	3300013307	Ga0157372_10540593	Ga0157372_105405932	257
1144	3300026067	Ga0207678_10022674	Ga0207678_100226746	257
1145	3300046515	Ga0495620_0041698	Ga0495620_0041698_895_1731	257
1146	3300046519	Ga0495632_0057732	Ga0495632_0057732_603_1439	257
1147	3300046522	Ga0495643_0056419	Ga0495643_0056419_160_996	257
1148	3300048919	Ga0496116_0020888	Ga0496116_0020888_1170_2006	257
1149	3300048920	Ga0496117_0149383	Ga0496117_0149383_135_971	257
1150	3300048921	Ga0496118_0107932	Ga0496118_0107932_405_1241	257
1151	3300048922	Ga0496119_0197870	Ga0496119_0197870_167_1003	257
1152	3300048924	Ga0496121_0004123	Ga0496121_0004123_15073_15909	257
1153	3300048925	Ga0496122_0014770	Ga0496122_0014770_2735_3571	257
1154	3300048928	Ga0496125_0004112	Ga0496125_0004112_2392_3228	257
1155	3300048929	Ga0496126_0027035	Ga0496126_0027035_3664_4500	257
1156	3300049575	Ga0501039_0021781	Ga0501039_0021781_4012_4830	257
1157	3300049584	Ga0501068_0165225	Ga0501068_0165225_330_1148	257
1158	3300049587	Ga0501071_0021211	Ga0501071_0021211_813_1631	257
1159	3300049588	Ga0501072_0025801	Ga0501072_0025801_2658_3476	257
1160	3300049593	Ga0501077_0037552	Ga0501077_0037552_327_1145	257
1161	3300049742	Ga0501080_0564312	Ga0501080_0564312_163_981	257
1162	3300049744	Ga0501083_0074561	Ga0501083_0074561_542_1360	257
1163	3300050516	nmdc:mga0sz30_71746_c1	nmdc:mga0sz30_71746_c1_187_1023	257
1164	3300053087	Ga0500643_014994	Ga0500643_014994_513_1349	257
1165	3300053088	Ga0500644_0011722	Ga0500644_0011722_636_1472	257
1166	3300053093	Ga0500651_0048542	Ga0500651_0048542_744_1580	257
1167	3300053102	Ga0500554_027251	Ga0500554_027251_600_1436	257
1168	3300053104	Ga0500556_0000005	Ga0500556_0000005_455308_456144	257
1169	3300053161	Ga0500634_0104696	Ga0500634_0104696_84_920	257
1170	3300053177	Ga0500636_0012018	Ga0500636_0012018_1398_2234	257
1171	3300054114	Ga0501084_0334533	Ga0501084_0334533_442_1260	257
1172	3300061734	Ga0530510_0021284	Ga0530510_0021284_1029_1847	257
1173	3300005617	Ga0068859_100074561	Ga0068859_1000745614	258
1174	3300006038	Ga0075365_10044433	Ga0075365_100444332	258
1175	3300006931	Ga0097620_100074564	Ga0097620_1000745644	258
1176	3300025914	Ga0207671_10163379	Ga0207671_101633792	258
1177	3300039450	Ga0436363_1616350	Ga0436363_1616350_87_905	258
1178	3300044684	Ga0466966_0088054	Ga0466966_0088054_1042_1854	258
1179	3300046524	Ga0495648_0008002	Ga0495648_0008002_1096_1908	258
1180	3300048907	Ga0496104_0000445	Ga0496104_0000445_27553_28371	258
1181	3300048908	Ga0496105_0002404	Ga0496105_0002404_5934_6752	258
1182	3300048908	Ga0496105_0121946	Ga0496105_0121946_483_1301	258
1183	3300048911	Ga0496108_0144702	Ga0496108_0144702_828_1640	258
1184	3300048912	Ga0496109_0069946	Ga0496109_0069946_849_1667	258
1185	3300048916	Ga0496113_0134258	Ga0496113_0134258_1060_1878	258
1186	3300048918	Ga0496115_0047288	Ga0496115_0047288_672_1490	258
1187	3300049742	Ga0501080_0190420	Ga0501080_0190420_14_838	258
1188	3300050492	nmdc:mga0yw44_141039_c1	nmdc:mga0yw44_141039_c1_375_1196	258
1189	3300053111	Ga0500572_000144	Ga0500572_000144_10630_11442	258
1190	3300053136	Ga0500559_0000386	Ga0500559_0000386_18077_18889	258
1191	3300053153	Ga0500616_0051136	Ga0500616_0051136_932_1756	258
1192	3300053163	Ga0500639_013425	Ga0500639_013425_2978_3790	258
1193	3300053735	Ga0500596_003208	Ga0500596_003208_442_1254	258
1194	3300054114	Ga0501084_0076287	Ga0501084_0076287_1377_2201	258
1195	3300005436	Ga0070713_100055790	Ga0070713_1000557905	259
1196	3300005436	Ga0070713_100467276	Ga0070713_1004672762	259
1197	3300005437	Ga0070710_10131115	Ga0070710_101311152	259
1198	3300005439	Ga0070711_100023994	Ga0070711_1000239942	259
1199	3300005458	Ga0070681_10159687	Ga0070681_101596873	259
1200	3300006028	Ga0070717_10002774	Ga0070717_100027748	259
1201	3300006028	Ga0070717_10098678	Ga0070717_100986781	259
1202	3300009551	Ga0105238_10067329	Ga0105238_100673294	259
1203	3300010375	Ga0105239_10075985	Ga0105239_100759854	259
1204	3300021384	Ga0213876_10073562	Ga0213876_100735621	259
1205	3300025254	Ga0209148_1007027	Ga0209148_10070272	259
1206	3300025261	Ga0209233_1000949	Ga0209233_10009493	259
1207	3300025272	Ga0209455_1011518	Ga0209455_10115182	259
1208	3300025901	Ga0207688_10038692	Ga0207688_100386923	259
1209	3300025905	Ga0207685_10037724	Ga0207685_100377242	259
1210	3300025906	Ga0207699_10035638	Ga0207699_100356383	259
1211	3300025916	Ga0207663_10009487	Ga0207663_100094872	259
1212	3300025924	Ga0207694_10092521	Ga0207694_100925212	259
1213	3300026075	Ga0207708_10121651	Ga0207708_101216512	259
1214	3300028558	Ga0265326_10037323	Ga0265326_100373231	259
1215	3300028573	Ga0265334_10001242	Ga0265334_100012423	259
1216	3300028577	Ga0265318_10009393	Ga0265318_100093932	259
1217	3300028653	Ga0265323_10001035	Ga0265323_1000103511	259
1218	3300028666	Ga0265336_10000363	Ga0265336_1000036324	259
1219	3300028800	Ga0265338_10000155	Ga0265338_1000015584	259
1220	3300029957	Ga0265324_10021334	Ga0265324_100213341	259
1221	3300037853	Ga0436364_0739712	Ga0436364_0739712_304_1119	259
1222	3300041512	Ga0451853_0202872	Ga0451853_0202872_418_1233	259
1223	3300044694	Ga0466963_0103933	Ga0466963_0103933_927_1742	259
1224	3300044694	Ga0466963_0156078	Ga0466963_0156078_46_861	259
1225	3300048921	Ga0496118_0007700	Ga0496118_0007700_10096_10911	259
1226	3300048927	Ga0496124_0056207	Ga0496124_0056207_840_1655	259
1227	3300048928	Ga0496125_0102211	Ga0496125_0102211_340_1155	259
1228	3300048928	Ga0496125_0131748	Ga0496125_0131748_532_1347	259
1229	3300049742	Ga0501080_0033924	Ga0501080_0033924_51_893	259
1230	3300003215	JGI25153J46596_10009654	JGI25153J46596_100096544	260
1231	3300003215	JGI25153J46596_10017974	JGI25153J46596_100179743	260
1232	3300003316	rootH1_10081384	rootH1_100813842	260
1233	3300003354	JGI25160J50197_1026917	JGI25160J50197_10269172	260
1234	3300003794	Ga0055531_10001969	Ga0055531_100019695	260
1235	3300004625	Ga0055543_1007718	Ga0055543_10077183	260
1236	3300005262	Ga0065165_1002477	Ga0065165_10024772	260
1237	3300005262	Ga0065165_1004254	Ga0065165_10042544	260
1238	3300005338	Ga0068868_100350804	Ga0068868_1003508042	260
1239	3300005338	Ga0068868_100402374	Ga0068868_1004023742	260
1240	3300005347	Ga0070668_100015166	Ga0070668_1000151666	260
1241	3300005353	Ga0070669_100060927	Ga0070669_1000609273	260
1242	3300005355	Ga0070671_100013043	Ga0070671_1000130434	260
1243	3300005367	Ga0070667_100025504	Ga0070667_1000255043	260
1244	3300005471	Ga0070698_100210881	Ga0070698_1002108812	260
1245	3300005539	Ga0068853_100339928	Ga0068853_1003399282	260
1246	3300005548	Ga0070665_100153142	Ga0070665_1001531423	260
1247	3300005563	Ga0068855_100179330	Ga0068855_1001793303	260
1248	3300005614	Ga0068856_100235434	Ga0068856_1002354342	260
1249	3300005614	Ga0068856_100384658	Ga0068856_1003846582	260
1250	3300005616	Ga0068852_100031928	Ga0068852_1000319284	260
1251	3300005616	Ga0068852_100125142	Ga0068852_1001251422	260
1252	3300005618	Ga0068864_100192038	Ga0068864_1001920382	260
1253	3300005937	Ga0081455_10023899	Ga0081455_100238997	260
1254	3300005983	Ga0081540_1011508	Ga0081540_10115085	260
1255	3300006038	Ga0075365_10197966	Ga0075365_101979662	260
1256	3300006038	Ga0075365_10271474	Ga0075365_102714742	260
1257	3300006048	Ga0075363_100026974	Ga0075363_1000269743	260
1258	3300006186	Ga0075369_10008977	Ga0075369_100089774	260
1259	3300006195	Ga0075366_10138724	Ga0075366_101387242	260
1260	3300006195	Ga0075366_10193279	Ga0075366_101932792	260
1261	3300006353	Ga0075370_10049006	Ga0075370_100490063	260
1262	3300006353	Ga0075370_10186997	Ga0075370_101869972	260
1263	3300006941	Ga0099825_1022030	Ga0099825_10220304	260
1264	3300006942	Ga0099824_1016377	Ga0099824_10163775	260
1265	3300009093	Ga0105240_10034054	Ga0105240_100340544	260
1266	3300009093	Ga0105240_10350022	Ga0105240_103500222	260
1267	3300009098	Ga0105245_10231669	Ga0105245_102316692	260
1268	3300009174	Ga0105241_10057150	Ga0105241_100571503	260
1269	3300009177	Ga0105248_10343325	Ga0105248_103433251	260
1270	3300009545	Ga0105237_10002092	Ga0105237_1000209213	260
1271	3300009545	Ga0105237_10158666	Ga0105237_101586663	260
1272	3300009545	Ga0105237_10256974	Ga0105237_102569742	260
1273	3300009545	Ga0105237_10544777	Ga0105237_105447772	260
1274	3300009553	Ga0105249_10129426	Ga0105249_101294263	260
1275	3300010375	Ga0105239_10065469	Ga0105239_100654695	260
1276	3300013297	Ga0157378_10856029	Ga0157378_108560291	260
1277	3300014325	Ga0163163_10112864	Ga0163163_101128643	260
1278	3300014497	Ga0182008_10136502	Ga0182008_101365022	260
1279	3300014745	Ga0157377_10100924	Ga0157377_101009242	260
1280	3300014968	Ga0157379_10295675	Ga0157379_102956752	260
1281	3300014969	Ga0157376_10293019	Ga0157376_102930192	260
1282	3300021320	Ga0214544_1000007	Ga0214544_100000758	260
1283	3300021321	Ga0214542_1000216	Ga0214542_100021633	260
1284	3300021324	Ga0214545_1000118	Ga0214545_100011858	260
1285	3300021327	Ga0214543_1000009	Ga0214543_100000958	260
1286	3300025230	Ga0209563_101733	Ga0209563_1017334	260
1287	3300025253	Ga0209677_100395	Ga0209677_10039511	260
1288	3300025254	Ga0209148_1000388	Ga0209148_100038835	260
1289	3300025254	Ga0209148_1013660	Ga0209148_10136602	260
1290	3300025261	Ga0209233_1002242	Ga0209233_10022426	260
1291	3300025272	Ga0209455_1007359	Ga0209455_10073592	260
1292	3300025295	Ga0209564_1001154	Ga0209564_100115425	260
1293	3300025295	Ga0209564_1018635	Ga0209564_10186352	260
1294	3300025295	Ga0209564_1042893	Ga0209564_10428932	260
1295	3300025297	Ga0209758_1000030	Ga0209758_1000030277	260
1296	3300025297	Ga0209758_1000429	Ga0209758_100042920	260
1297	3300025297	Ga0209758_1001015	Ga0209758_100101536	260
1298	3300025297	Ga0209758_1003562	Ga0209758_10035623	260
1299	3300025297	Ga0209758_1009019	Ga0209758_10090196	260
1300	3300025297	Ga0209758_1059515	Ga0209758_10595152	260
1301	3300025299	Ga0209256_1003190	Ga0209256_10031903	260
1302	3300025299	Ga0209256_1038858	Ga0209256_10388582	260
1303	3300025302	Ga0207426_1000347	Ga0207426_100034750	260
1304	3300025302	Ga0207426_1001408	Ga0207426_10014083	260
1305	3300025302	Ga0207426_1003607	Ga0207426_10036073	260
1306	3300025302	Ga0207426_1033328	Ga0207426_10333282	260
1307	3300025304	Ga0209257_1004526	Ga0209257_10045267	260
1308	3300025304	Ga0209257_1021877	Ga0209257_10218771	260
1309	3300025315	Ga0207697_10013891	Ga0207697_100138913	260
1310	3300025321	Ga0207656_10024823	Ga0207656_100248232	260
1311	3300025900	Ga0207710_10076199	Ga0207710_100761992	260
1312	3300025909	Ga0207705_10066688	Ga0207705_100666882	260
1313	3300025911	Ga0207654_10111218	Ga0207654_101112182	260
1314	3300025913	Ga0207695_10000006	Ga0207695_1000000639	260
1315	3300025913	Ga0207695_10421609	Ga0207695_104216092	260
1316	3300025914	Ga0207671_10199258	Ga0207671_101992582	260
1317	3300025926	Ga0207659_10239360	Ga0207659_102393602	260
1318	3300025931	Ga0207644_10168820	Ga0207644_101688202	260
1319	3300025932	Ga0207690_10391846	Ga0207690_103918462	260
1320	3300025933	Ga0207706_10299216	Ga0207706_102992161	260
1321	3300025940	Ga0207691_10248522	Ga0207691_102485222	260
1322	3300025961	Ga0207712_10247087	Ga0207712_102470872	260
1323	3300025986	Ga0207658_10254264	Ga0207658_102542642	260
1324	3300026067	Ga0207678_10161549	Ga0207678_101615492	260
1325	3300026116	Ga0207674_10104282	Ga0207674_101042822	260
1326	3300026118	Ga0207675_100049103	Ga0207675_1000491033	260
1327	3300026121	Ga0207683_10152762	Ga0207683_101527622	260
1328	3300026142	Ga0207698_10359651	Ga0207698_103596512	260
1329	3300027296	Ga0209389_1000015	Ga0209389_100001579	260
1330	3300027296	Ga0209389_1000035	Ga0209389_100003590	260
1331	3300027357	Ga0209589_1000039	Ga0209589_100003990	260
1332	3300027361	Ga0209489_100072	Ga0209489_10007240	260
1333	3300027361	Ga0209489_100084	Ga0209489_10008490	260
1334	3300027363	Ga0209700_100034	Ga0209700_100034104	260
1335	3300028379	Ga0268266_10138212	Ga0268266_101382123	260
1336	3300028379	Ga0268266_10629203	Ga0268266_106292031	260
1337	3300028380	Ga0268265_10433165	Ga0268265_104331652	260
1338	3300033179	Ga0307507_10188468	Ga0307507_101884682	260
1339	3300033180	Ga0307510_10112752	Ga0307510_101127523	260
1340	3300037418	Ga0395900_0001546	Ga0395900_0001546_7807_8625	260
1341	3300037466	Ga0395898_0002015	Ga0395898_0002015_5833_6651	260
1342	3300037471	Ga0395905_0003722	Ga0395905_0003722_14789_15607	260
1343	3300037471	Ga0395905_0051982	Ga0395905_0051982_157_975	260
1344	3300037471	Ga0395905_0182380	Ga0395905_0182380_351_1169	260
1345	3300037471	Ga0395905_0348730	Ga0395905_0348730_473_1291	260
1346	3300041456	Ga0451795_1261016	Ga0451795_1261016_256_1080	260
1347	3300044658	Ga0466972_0000048	Ga0466972_0000048_60836_61654	260
1348	3300044658	Ga0466972_0005127	Ga0466972_0005127_3599_4417	260
1349	3300044683	Ga0466965_0053207	Ga0466965_0053207_149_967	260
1350	3300044684	Ga0466966_0000542	Ga0466966_0000542_8521_9339	260
1351	3300044693	Ga0466961_0000018	Ga0466961_0000018_57057_57875	260
1352	3300044693	Ga0466961_0270924	Ga0466961_0270924_35_853	260
1353	3300044706	Ga0466964_0068768	Ga0466964_0068768_202_1020	260
1354	3300044901	Ga0466960_0008711	Ga0466960_0008711_889_1707	260
1355	3300044901	Ga0466960_0058540	Ga0466960_0058540_1023_1841	260
1356	3300045049	Ga0466959_0017920	Ga0466959_0017920_1758_2576	260
1357	3300045976	Ga0466967_0240157	Ga0466967_0240157_802_1620	260
1358	3300046452	Ga0495617_033375	Ga0495617_033375_39_857	260
1359	3300046454	Ga0495592_0158342	Ga0495592_0158342_520_1338	260
1360	3300046455	Ga0495603_0139598	Ga0495603_0139598_204_1022	260
1361	3300046459	Ga0495629_0004909	Ga0495629_0004909_8162_8980	260
1362	3300046460	Ga0495638_0041794	Ga0495638_0041794_386_1204	260
1363	3300046462	Ga0495651_0001421	Ga0495651_0001421_9883_10701	260
1364	3300046462	Ga0495651_0043692	Ga0495651_0043692_2532_3338	260
1365	3300046463	Ga0495653_0054417	Ga0495653_0054417_1917_2735	260
1366	3300046463	Ga0495653_0117920	Ga0495653_0117920_90_908	260
1367	3300046477	Ga0495664_0004893	Ga0495664_0004893_3486_4304	260
1368	3300046506	Ga0495583_0054928	Ga0495583_0054928_369_1187	260
1369	3300046507	Ga0495606_0018376	Ga0495606_0018376_3146_3964	260
1370	3300046511	Ga0495608_0010956	Ga0495608_0010956_1037_1855	260
1371	3300046511	Ga0495608_0135589	Ga0495608_0135589_530_1348	260
1372	3300046512	Ga0495610_0066012	Ga0495610_0066012_142_960	260
1373	3300046513	Ga0495616_0138859	Ga0495616_0138859_45_863	260
1374	3300046514	Ga0495618_0024952	Ga0495618_0024952_1915_2733	260
1375	3300046516	Ga0495628_0034223	Ga0495628_0034223_1321_2139	260
1376	3300046524	Ga0495648_0032290	Ga0495648_0032290_1335_2153	260
1377	3300046526	Ga0495666_0035197	Ga0495666_0035197_521_1339	260
1378	3300046529	Ga0495652_0151908	Ga0495652_0151908_583_1401	260
1379	3300046533	Ga0495640_0055706	Ga0495640_0055706_244_1062	260
1380	3300046536	Ga0495587_0084226	Ga0495587_0084226_826_1644	260
1381	3300046538	Ga0495609_0033713	Ga0495609_0033713_304_1122	260
1382	3300046543	Ga0495645_0061565	Ga0495645_0061565_747_1565	260
1383	3300046557	Ga0495622_0019879	Ga0495622_0019879_423_1241	260
1384	3300046557	Ga0495622_0023862	Ga0495622_0023862_139_957	260
1385	3300046616	Ga0495668_0036159	Ga0495668_0036159_1498_2316	260
1386	3300046642	Ga0495634_0238770	Ga0495634_0238770_270_1088	260
1387	3300046663	Ga0495635_0001817	Ga0495635_0001817_4688_5506	260
1388	3300046663	Ga0495635_0046009	Ga0495635_0046009_158_976	260
1389	3300046665	Ga0495661_0086635	Ga0495661_0086635_141_959	260
1390	3300046674	Ga0495588_0047660	Ga0495588_0047660_477_1295	260
1391	3300046675	Ga0495657_0005003	Ga0495657_0005003_2306_3124	260
1392	3300046675	Ga0495657_0041298	Ga0495657_0041298_568_1386	260
1393	3300046678	Ga0495599_0010948	Ga0495599_0010948_1469_2287	260
1394	3300046679	Ga0495623_0003554	Ga0495623_0003554_8067_8885	260
1395	3300046689	Ga0495613_0085459	Ga0495613_0085459_292_1110	260
1396	3300046690	Ga0495624_0052926	Ga0495624_0052926_1615_2433	260
1397	3300046809	Ga0495600_0003823	Ga0495600_0003823_6108_6926	260
1398	3300046809	Ga0495600_0006664	Ga0495600_0006664_3007_3825	260
1399	3300047315	Ga0495581_0070132	Ga0495581_0070132_199_1017	260
1400	3300047317	Ga0495604_0001719	Ga0495604_0001719_17021_17839	260
1401	3300047317	Ga0495604_0165314	Ga0495604_0165314_579_1397	260
1402	3300047319	Ga0495674_0312796	Ga0495674_0312796_140_958	260
1403	3300047320	Ga0495672_0032698	Ga0495672_0032698_375_1199	260
1404	3300047320	Ga0495672_0196573	Ga0495672_0196573_46_864	260
1405	3300047321	Ga0495676_0041253	Ga0495676_0041253_1259_2077	260
1406	3300047322	Ga0495680_0006451	Ga0495680_0006451_6564_7382	260
1407	3300047443	Ga0495687_012431	Ga0495687_012431_3102_3920	260
1408	3300047443	Ga0495687_044085	Ga0495687_044085_992_1810	260
1409	3300047444	Ga0495675_0005708	Ga0495675_0005708_6008_6826	260
1410	3300047471	Ga0495684_0024950	Ga0495684_0024950_2896_3714	260
1411	3300047471	Ga0495684_0138550	Ga0495684_0138550_619_1437	260
1412	3300047673	Ga0495593_0068004	Ga0495593_0068004_226_1044	260
1413	3300048088	Ga0495602_0016924	Ga0495602_0016924_4417_5235	260
1414	3300048088	Ga0495602_0339751	Ga0495602_0339751_246_1064	260
1415	3300048903	Ga0496100_0057472	Ga0496100_0057472_391_1209	260
1416	3300048903	Ga0496100_0312649	Ga0496100_0312649_284_1102	260
1417	3300048905	Ga0496102_0015035	Ga0496102_0015035_3144_3962	260
1418	3300048906	Ga0496103_0078723	Ga0496103_0078723_669_1487	260
1419	3300048906	Ga0496103_0087378	Ga0496103_0087378_575_1393	260
1420	3300048907	Ga0496104_0008588	Ga0496104_0008588_30_848	260
1421	3300048908	Ga0496105_0022649	Ga0496105_0022649_1575_2393	260
1422	3300048908	Ga0496105_0091585	Ga0496105_0091585_971_1789	260
1423	3300048908	Ga0496105_0507819	Ga0496105_0507819_10_828	260
1424	3300048909	Ga0496106_0192889	Ga0496106_0192889_80_898	260
1425	3300048913	Ga0496110_0164050	Ga0496110_0164050_413_1231	260
1426	3300048913	Ga0496110_0554504	Ga0496110_0554504_34_852	260
1427	3300048914	Ga0496111_0047402	Ga0496111_0047402_547_1365	260
1428	3300048915	Ga0496112_0069445	Ga0496112_0069445_17_835	260
1429	3300048915	Ga0496112_0463524	Ga0496112_0463524_193_1011	260
1430	3300048916	Ga0496113_0047589	Ga0496113_0047589_1668_2486	260
1431	3300048916	Ga0496113_0110589	Ga0496113_0110589_860_1678	260
1432	3300048917	Ga0496114_0081821	Ga0496114_0081821_707_1525	260
1433	3300048918	Ga0496115_0017793	Ga0496115_0017793_1103_1921	260
1434	3300048922	Ga0496119_0033954	Ga0496119_0033954_2490_3308	260
1435	3300048922	Ga0496119_0043451	Ga0496119_0043451_116_934	260
1436	3300048923	Ga0496120_0042488	Ga0496120_0042488_185_1003	260
1437	3300048924	Ga0496121_0007759	Ga0496121_0007759_6938_7756	260
1438	3300048924	Ga0496121_0071544	Ga0496121_0071544_209_1027	260
1439	3300048926	Ga0496123_0056676	Ga0496123_0056676_1245_2069	260
1440	3300048926	Ga0496123_0115835	Ga0496123_0115835_139_957	260
1441	3300048927	Ga0496124_0048273	Ga0496124_0048273_2270_3088	260
1442	3300048927	Ga0496124_0075008	Ga0496124_0075008_1385_2209	260
1443	3300048927	Ga0496124_0202919	Ga0496124_0202919_139_957	260
1444	3300048928	Ga0496125_0040920	Ga0496125_0040920_3134_3952	260
1445	3300048928	Ga0496125_0068010	Ga0496125_0068010_886_1704	260
1446	3300048929	Ga0496126_0129236	Ga0496126_0129236_146_964	260
1447	3300049460	Ga0495682_0074492	Ga0495682_0074492_44_862	260
1448	3300049570	Ga0501033_0055688	Ga0501033_0055688_548_1366	260
1449	3300049574	Ga0501038_0138196	Ga0501038_0138196_748_1566	260
1450	3300049580	Ga0501046_0213553	Ga0501046_0213553_382_1200	260
1451	3300049585	Ga0501069_0213675	Ga0501069_0213675_75_893	260
1452	3300049588	Ga0501072_0195826	Ga0501072_0195826_313_1131	260
1453	3300049741	Ga0501079_0429717	Ga0501079_0429717_142_960	260
1454	3300049822	Ga0501035_0460209	Ga0501035_0460209_217_1035	260
1455	3300049823	Ga0501044_0083357	Ga0501044_0083357_1389_2207	260
1456	3300050490	nmdc:mga03n38_25648_c1	nmdc:mga03n38_25648_c1_1114_1932	260
1457	3300050491	nmdc:mga00v17_261480_c1	nmdc:mga00v17_261480_c1_140_958	260
1458	3300050492	nmdc:mga0yw44_244450_c1	nmdc:mga0yw44_244450_c1_189_1013	260
1459	3300050493	nmdc:mga0k408_174930_c1	nmdc:mga0k408_174930_c1_77_895	260
1460	3300050493	nmdc:mga0k408_73151_c1	nmdc:mga0k408_73151_c1_133_951	260
1461	3300050495	nmdc:mga04h51_18956_c1	nmdc:mga04h51_18956_c1_275_1093	260
1462	3300053079	Ga0500610_0146235	Ga0500610_0146235_233_1051	260
1463	3300053085	Ga0495619_0124775	Ga0495619_0124775_482_1300	260
1464	3300053086	Ga0500578_0044562	Ga0500578_0044562_1496_2314	260
1465	3300053087	Ga0500643_000517	Ga0500643_000517_12134_12952	260
1466	3300053090	Ga0500646_0018567	Ga0500646_0018567_733_1551	260
1467	3300053091	Ga0500647_0002370	Ga0500647_0002370_1204_2022	260
1468	3300053094	Ga0500566_0000491	Ga0500566_0000491_13461_14279	260
1469	3300053103	Ga0500555_001517	Ga0500555_001517_3387_4205	260
1470	3300053104	Ga0500556_0015602	Ga0500556_0015602_201_1019	260
1471	3300053105	Ga0500557_000019	Ga0500557_000019_54849_55667	260
1472	3300053109	Ga0500569_003665	Ga0500569_003665_875_1693	260
1473	3300053119	Ga0500595_027108	Ga0500595_027108_716_1534	260
1474	3300053120	Ga0500597_162647	Ga0500597_162647_45_863	260
1475	3300053122	Ga0500608_122226	Ga0500608_122226_118_936	260
1476	3300053130	Ga0500642_0000835	Ga0500642_0000835_751_1569	260
1477	3300053133	Ga0500655_017975	Ga0500655_017975_310_1128	260
1478	3300053134	Ga0500658_0021625	Ga0500658_0021625_740_1558	260
1479	3300053136	Ga0500559_0082941	Ga0500559_0082941_611_1429	260
1480	3300053147	Ga0500589_097334	Ga0500589_097334_35_853	260
1481	3300053153	Ga0500616_0026411	Ga0500616_0026411_724_1542	260
1482	3300053156	Ga0500622_0009556	Ga0500622_0009556_3593_4411	260
1483	3300053158	Ga0500627_0066437	Ga0500627_0066437_705_1523	260
1484	3300053177	Ga0500636_0000168	Ga0500636_0000168_28428_29246	260
1485	3300053729	Ga0500625_022425	Ga0500625_022425_1459_2277	260
1486	3300053732	Ga0500656_002178	Ga0500656_002178_477_1295	260
1487	3300053736	Ga0500599_001897	Ga0500599_001897_728_1546	260
1488	3300053737	Ga0500601_000190	Ga0500601_000190_213_1031	260
1489	3300054114	Ga0501084_0087201	Ga0501084_0087201_243_1085	260
1490	3300055283	Ga0500661_005930	Ga0500661_005930_836_1654	260
1491	3300060353	Ga0501082_0307216	Ga0501082_0307216_337_1179	260
1492	3300061734	Ga0530510_0243640	Ga0530510_0243640_286_1110	260
1493	iso_pu_bacteria	2602042107	2603857989	260
1494	iso_pu_bacteria	2857524615	2857527370	260
1495	iso_pu_bacteria	2919073203	2919078483	260
1496	3300005937	Ga0081455_10011035	Ga0081455_100110351	261
1497	3300005937	Ga0081455_10016498	Ga0081455_100164984	261
1498	3300005937	Ga0081455_10018914	Ga0081455_100189148	261
1499	3300005983	Ga0081540_1001561	Ga0081540_10015613	261
1500	3300005983	Ga0081540_1022611	Ga0081540_10226112	261
1501	3300005983	Ga0081540_1093189	Ga0081540_10931892	261
1502	3300005985	Ga0081539_10000629	Ga0081539_1000062925	261
1503	3300006914	Ga0075436_100185719	Ga0075436_1001857192	261
1504	3300021361	Ga0213872_10022262	Ga0213872_100222622	261
1505	3300031712	Ga0265342_10061698	Ga0265342_100616982	261
1506	3300035119	Ga0373956_0227759	Ga0373956_0227759_43_873	261
1507	3300035120	Ga0373957_0073112	Ga0373957_0073112_367_1197	261
1508	3300036401	Ga0373937_0002423	Ga0373937_0002423_1814_2644	261
1509	3300037466	Ga0395898_0132975	Ga0395898_0132975_535_1356	261
1510	3300038443	Ga0395901_0555051	Ga0395901_0555051_57_878	261
1511	3300039438	Ga0436360_0781541	Ga0436360_0781541_113_934	261
1512	3300039447	Ga0436361_0935166	Ga0436361_0935166_2149_2970	261
1513	3300044684	Ga0466966_0120118	Ga0466966_0120118_389_1210	261
1514	3300045049	Ga0466959_0089033	Ga0466959_0089033_821_1642	261
1515	3300046499	Ga0495594_0101590	Ga0495594_0101590_32_853	261
1516	3300050514	nmdc:mga08x19_132202_c1	nmdc:mga08x19_132202_c1_462_1283	261
1517	3300053084	Ga0495595_0164785	Ga0495595_0164785_67_897	261
1518	3300005456	Ga0070678_100166359	Ga0070678_1001663592	262
1519	3300006871	Ga0075434_100152473	Ga0075434_1001524732	262
1520	3300006871	Ga0075434_100289485	Ga0075434_1002894852	262
1521	3300026121	Ga0207683_10189387	Ga0207683_101893872	262
1522	3300039437	Ga0436365_0074749	Ga0436365_0074749_549_1382	262
1523	3300039450	Ga0436363_0101344	Ga0436363_0101344_1853_2686	262
1524	3300048929	Ga0496126_0327316	Ga0496126_0327316_140_964	262
1525	3300050512	nmdc:mga0n895_298276_c1	nmdc:mga0n895_298276_c1_559_1392	262
1526	3300005577	Ga0068857_100141128	Ga0068857_1001411282	263
1527	3300009545	Ga0105237_10074303	Ga0105237_100743032	263
1528	3300009551	Ga0105238_10043421	Ga0105238_100434213	263
1529	3300009551	Ga0105238_10414571	Ga0105238_104145712	263
1530	3300021384	Ga0213876_10078860	Ga0213876_100788602	263
1531	3300025909	Ga0207705_10034575	Ga0207705_100345752	263
1532	3300025914	Ga0207671_10040175	Ga0207671_100401754	263
1533	3300025914	Ga0207671_10104325	Ga0207671_101043252	263
1534	3300025924	Ga0207694_10047790	Ga0207694_100477902	263
1535	3300025924	Ga0207694_10069942	Ga0207694_100699423	263
1536	3300037312	Ga0395899_0256156	Ga0395899_0256156_175_1002	263
1537	3300037418	Ga0395900_0059304	Ga0395900_0059304_170_997	263
1538	3300037466	Ga0395898_0195890	Ga0395898_0195890_568_1395	263
1539	3300047472	Ga0495686_0053491	Ga0495686_0053491_1013_1840	263
1540	3300048924	Ga0496121_0093052	Ga0496121_0093052_940_1767	263
1541	3300048929	Ga0496126_0023656	Ga0496126_0023656_1342_2169	263
1542	3300005329	Ga0070683_100050728	Ga0070683_1000507282	264
1543	3300005336	Ga0070680_100245781	Ga0070680_1002457812	264
1544	3300005440	Ga0070705_100068495	Ga0070705_1000684952	264
1545	3300005458	Ga0070681_10178933	Ga0070681_101789333	264
1546	3300005530	Ga0070679_100102147	Ga0070679_1001021473	264
1547	3300005535	Ga0070684_100011463	Ga0070684_1000114635	264
1548	3300005618	Ga0068864_100041943	Ga0068864_1000419434	264
1549	3300005841	Ga0068863_100590181	Ga0068863_1005901812	264
1550	3300006175	Ga0070712_100261447	Ga0070712_1002614472	264
1551	3300006871	Ga0075434_100196284	Ga0075434_1001962842	264
1552	3300006914	Ga0075436_100201759	Ga0075436_1002017592	264
1553	3300009177	Ga0105248_10574894	Ga0105248_105748942	264
1554	3300009553	Ga0105249_10649842	Ga0105249_106498421	264
1555	3300010375	Ga0105239_10079128	Ga0105239_100791282	264
1556	3300013306	Ga0163162_10101474	Ga0163162_101014743	264
1557	3300013308	Ga0157375_10288388	Ga0157375_102883882	264
1558	3300014325	Ga0163163_10032478	Ga0163163_100324784	264
1559	3300014968	Ga0157379_10233306	Ga0157379_102333062	264
1560	3300025912	Ga0207707_10074339	Ga0207707_100743394	264
1561	3300025921	Ga0207652_10074840	Ga0207652_100748403	264
1562	3300025941	Ga0207711_10437715	Ga0207711_104377152	264
1563	3300025944	Ga0207661_10025129	Ga0207661_100251292	264
1564	3300026095	Ga0207676_10241379	Ga0207676_102413792	264
1565	3300031616	Ga0307508_10070792	Ga0307508_100707923	264
1566	3300033179	Ga0307507_10068020	Ga0307507_100680203	264
1567	3300035692	Ga0373935_0032233	Ga0373935_0032233_1401_2237	264
1568	3300035695	Ga0373927_0305928	Ga0373927_0305928_50_886	264
1569	3300048907	Ga0496104_0009097	Ga0496104_0009097_5877_6707	264
1570	3300048908	Ga0496105_0070475	Ga0496105_0070475_1491_2321	264
1571	3300048909	Ga0496106_0051559	Ga0496106_0051559_594_1424	264
1572	3300048910	Ga0496107_0020256	Ga0496107_0020256_410_1240	264
1573	3300048912	Ga0496109_0015980	Ga0496109_0015980_1187_2017	264
1574	3300048913	Ga0496110_0120504	Ga0496110_0120504_1349_2179	264
1575	3300048914	Ga0496111_0028844	Ga0496111_0028844_844_1674	264
1576	3300048915	Ga0496112_0018304	Ga0496112_0018304_1558_2388	264
1577	3300048916	Ga0496113_0232154	Ga0496113_0232154_386_1216	264
1578	3300048920	Ga0496117_0031029	Ga0496117_0031029_2771_3607	264
1579	3300048921	Ga0496118_0045268	Ga0496118_0045268_1016_1852	264
1580	3300050512	nmdc:mga0n895_296625_c1	nmdc:mga0n895_296625_c1_381_1211	264
1581	3300050514	nmdc:mga08x19_128218_c1	nmdc:mga08x19_128218_c1_281_1111	264
1582	3300053119	Ga0500595_022775	Ga0500595_022775_638_1474	264
1583	3300053130	Ga0500642_0000009	Ga0500642_0000009_144061_144897	264
1584	3300053131	Ga0500652_000259	Ga0500652_000259_14571_15407	264
1585	3300053145	Ga0500586_000081	Ga0500586_000081_7324_8160	264
1586	3300005329	Ga0070683_100110068	Ga0070683_1001100682	265
1587	3300005336	Ga0070680_100067985	Ga0070680_1000679853	265
1588	3300005337	Ga0070682_100021490	Ga0070682_1000214902	265
1589	3300005458	Ga0070681_10009562	Ga0070681_100095628	265
1590	3300005530	Ga0070679_100110452	Ga0070679_1001104523	265
1591	3300005535	Ga0070684_100112861	Ga0070684_1001128613	265
1592	3300005563	Ga0068855_100105181	Ga0068855_1001051813	265
1593	3300005563	Ga0068855_100313046	Ga0068855_1003130461	265
1594	3300005614	Ga0068856_100002788	Ga0068856_1000027886	265
1595	3300005614	Ga0068856_100488225	Ga0068856_1004882251	265
1596	3300025912	Ga0207707_10000398	Ga0207707_100003988	265
1597	3300025917	Ga0207660_10110346	Ga0207660_101103462	265
1598	3300025921	Ga0207652_10041401	Ga0207652_100414013	265
1599	3300025944	Ga0207661_10010897	Ga0207661_100108973	265
1600	3300025944	Ga0207661_10214548	Ga0207661_102145482	265
1601	3300026078	Ga0207702_10000623	Ga0207702_1000062323	265
1602	3300031616	Ga0307508_10000088	Ga0307508_1000008869	265
1603	3300035695	Ga0373927_0012415	Ga0373927_0012415_4495_5328	265
1604	3300035695	Ga0373927_0114074	Ga0373927_0114074_67_900	265
1605	3300035725	Ga0373947_0008868	Ga0373947_0008868_3872_4705	265
1606	3300037068	Ga0373925_0026045	Ga0373925_0026045_1820_2653	265
1607	3300037068	Ga0373925_0402976	Ga0373925_0402976_102_938	265
1608	3300039447	Ga0436361_1163319	Ga0436361_1163319_886_1719	265
1609	3300046461	Ga0495641_0096739	Ga0495641_0096739_80_916	265
1610	3300046475	Ga0495639_0124351	Ga0495639_0124351_188_1021	265
1611	3300046476	Ga0495662_0054571	Ga0495662_0054571_60_896	265
1612	3300048929	Ga0496126_0053184	Ga0496126_0053184_1736_2569	265
1613	3300049822	Ga0501035_0333785	Ga0501035_0333785_364_1197	265
1614	3300049823	Ga0501044_0054727	Ga0501044_0054727_855_1691	265
1615	3300005331	Ga0070670_100049785	Ga0070670_1000497852	266
1616	3300005339	Ga0070660_100163282	Ga0070660_1001632822	266
1617	3300005341	Ga0070691_10064474	Ga0070691_100644742	266
1618	3300005344	Ga0070661_100168062	Ga0070661_1001680622	266
1619	3300005355	Ga0070671_100014641	Ga0070671_1000146416	266
1620	3300005364	Ga0070673_100029733	Ga0070673_1000297332	266
1621	3300005366	Ga0070659_100060018	Ga0070659_1000600184	266
1622	3300005366	Ga0070659_100215318	Ga0070659_1002153182	266
1623	3300005434	Ga0070709_10015634	Ga0070709_100156342	266
1624	3300005434	Ga0070709_10033865	Ga0070709_100338652	266
1625	3300005434	Ga0070709_10187161	Ga0070709_101871612	266
1626	3300005435	Ga0070714_100004001	Ga0070714_10000400110	266
1627	3300005435	Ga0070714_100012654	Ga0070714_1000126543	266
1628	3300005435	Ga0070714_100061329	Ga0070714_1000613294	266
1629	3300005435	Ga0070714_100155992	Ga0070714_1001559922	266
1630	3300005436	Ga0070713_100006580	Ga0070713_10000658010	266
1631	3300005436	Ga0070713_100006616	Ga0070713_1000066164	266
1632	3300005436	Ga0070713_100080610	Ga0070713_1000806103	266
1633	3300005437	Ga0070710_10015416	Ga0070710_100154163	266
1634	3300005439	Ga0070711_100002404	Ga0070711_1000024048	266
1635	3300005455	Ga0070663_100300828	Ga0070663_1003008282	266
1636	3300005456	Ga0070678_100281307	Ga0070678_1002813072	266
1637	3300005457	Ga0070662_100043500	Ga0070662_1000435002	266
1638	3300005468	Ga0070707_100039062	Ga0070707_1000390623	266
1639	3300005530	Ga0070679_100106676	Ga0070679_1001066763	266
1640	3300005535	Ga0070684_100144922	Ga0070684_1001449222	266
1641	3300005536	Ga0070697_100189382	Ga0070697_1001893822	266
1642	3300005536	Ga0070697_100212460	Ga0070697_1002124602	266
1643	3300005539	Ga0068853_100038220	Ga0068853_1000382203	266
1644	3300005548	Ga0070665_100128038	Ga0070665_1001280382	266
1645	3300005563	Ga0068855_100266989	Ga0068855_1002669893	266
1646	3300005563	Ga0068855_100303900	Ga0068855_1003039002	266
1647	3300005578	Ga0068854_100537028	Ga0068854_1005370282	266
1648	3300005614	Ga0068856_100547261	Ga0068856_1005472611	266
1649	3300005616	Ga0068852_100027985	Ga0068852_1000279853	266
1650	3300005834	Ga0068851_10028747	Ga0068851_100287473	266
1651	3300005843	Ga0068860_100001070	Ga0068860_10000107017	266
1652	3300006028	Ga0070717_10038393	Ga0070717_100383931	266
1653	3300006028	Ga0070717_10055904	Ga0070717_100559043	266
1654	3300006028	Ga0070717_10312000	Ga0070717_103120002	266
1655	3300006038	Ga0075365_10160489	Ga0075365_101604892	266
1656	3300006163	Ga0070715_10047131	Ga0070715_100471312	266
1657	3300006163	Ga0070715_10081201	Ga0070715_100812012	266
1658	3300007265	Ga0099794_10023536	Ga0099794_100235363	266
1659	3300007265	Ga0099794_10084903	Ga0099794_100849032	266
1660	3300007265	Ga0099794_10158523	Ga0099794_101585231	266
1661	3300009093	Ga0105240_10046615	Ga0105240_100466156	266
1662	3300009093	Ga0105240_10061416	Ga0105240_100614165	266
1663	3300009093	Ga0105240_10708709	Ga0105240_107087092	266
1664	3300009098	Ga0105245_10058528	Ga0105245_100585283	266
1665	3300009545	Ga0105237_10036215	Ga0105237_100362155	266
1666	3300009545	Ga0105237_10139508	Ga0105237_101395082	266
1667	3300009545	Ga0105237_10236004	Ga0105237_102360042	266
1668	3300009551	Ga0105238_10081054	Ga0105238_100810543	266
1669	3300009551	Ga0105238_10395989	Ga0105238_103959892	266
1670	3300010159	Ga0099796_10092113	Ga0099796_100921132	266
1671	3300010375	Ga0105239_10110805	Ga0105239_101108054	266
1672	3300011119	Ga0105246_10473961	Ga0105246_104739611	266
1673	3300013104	Ga0157370_10273606	Ga0157370_102736062	266
1674	3300013105	Ga0157369_10014863	Ga0157369_100148636	266
1675	3300013105	Ga0157369_10180171	Ga0157369_101801712	266
1676	3300014968	Ga0157379_10375273	Ga0157379_103752732	266
1677	3300014969	Ga0157376_10025781	Ga0157376_100257812	266
1678	3300025321	Ga0207656_10064532	Ga0207656_100645322	266
1679	3300025898	Ga0207692_10000213	Ga0207692_1000021316	266
1680	3300025905	Ga0207685_10071066	Ga0207685_100710662	266
1681	3300025906	Ga0207699_10022158	Ga0207699_100221584	266
1682	3300025906	Ga0207699_10093553	Ga0207699_100935532	266
1683	3300025910	Ga0207684_10250135	Ga0207684_102501352	266
1684	3300025912	Ga0207707_10024840	Ga0207707_100248406	266
1685	3300025913	Ga0207695_10141453	Ga0207695_101414533	266
1686	3300025913	Ga0207695_10225317	Ga0207695_102253172	266
1687	3300025914	Ga0207671_10018633	Ga0207671_100186333	266
1688	3300025914	Ga0207671_10064637	Ga0207671_100646373	266
1689	3300025915	Ga0207693_10058273	Ga0207693_100582733	266
1690	3300025916	Ga0207663_10000167	Ga0207663_1000016729	266
1691	3300025917	Ga0207660_10095433	Ga0207660_100954332	266
1692	3300025919	Ga0207657_10020195	Ga0207657_100201958	266
1693	3300025921	Ga0207652_10269290	Ga0207652_102692902	266
1694	3300025922	Ga0207646_10038053	Ga0207646_100380534	266
1695	3300025924	Ga0207694_10297542	Ga0207694_102975422	266
1696	3300025925	Ga0207650_10007124	Ga0207650_1000712410	266
1697	3300025926	Ga0207659_10256029	Ga0207659_102560292	266
1698	3300025928	Ga0207700_10047186	Ga0207700_100471862	266
1699	3300025929	Ga0207664_10030499	Ga0207664_100304993	266
1700	3300025931	Ga0207644_10027851	Ga0207644_100278513	266
1701	3300025932	Ga0207690_10042002	Ga0207690_100420022	266
1702	3300025932	Ga0207690_10173769	Ga0207690_101737692	266
1703	3300025932	Ga0207690_10223202	Ga0207690_102232022	266
1704	3300025939	Ga0207665_10001098	Ga0207665_100010987	266
1705	3300025940	Ga0207691_10126014	Ga0207691_101260143	266
1706	3300025944	Ga0207661_10077750	Ga0207661_100777502	266
1707	3300025949	Ga0207667_10193848	Ga0207667_101938482	266
1708	3300025949	Ga0207667_10241536	Ga0207667_102415362	266
1709	3300025960	Ga0207651_10077236	Ga0207651_100772362	266
1710	3300026035	Ga0207703_10431582	Ga0207703_104315821	266
1711	3300026041	Ga0207639_10038411	Ga0207639_100384112	266
1712	3300026067	Ga0207678_10315737	Ga0207678_103157372	266
1713	3300026121	Ga0207683_10332020	Ga0207683_103320201	266
1714	3300026142	Ga0207698_10102378	Ga0207698_101023782	266
1715	3300027671	Ga0209588_1040375	Ga0209588_10403752	266
1716	3300028379	Ga0268266_10028190	Ga0268266_100281902	266
1717	3300028381	Ga0268264_10000107	Ga0268264_1000010714	266
1718	3300031235	Ga0265330_10031674	Ga0265330_100316743	266
1719	3300031238	Ga0265332_10006675	Ga0265332_100066756	266
1720	3300031239	Ga0265328_10085880	Ga0265328_100858802	266
1721	3300031344	Ga0265316_10036469	Ga0265316_100364694	266
1722	3300031344	Ga0265316_10410645	Ga0265316_104106452	266
1723	3300031711	Ga0265314_10013803	Ga0265314_100138033	266
1724	3300031711	Ga0265314_10059605	Ga0265314_100596053	266
1725	3300031712	Ga0265342_10010995	Ga0265342_100109956	266
1726	3300033180	Ga0307510_10076564	Ga0307510_100765643	266
1727	3300035111	Ga0373923_0000546	Ga0373923_0000546_1654_2490	266
1728	3300035113	Ga0373936_0020991	Ga0373936_0020991_1144_1980	266
1729	3300035117	Ga0373953_0003851	Ga0373953_0003851_960_1796	266
1730	3300035118	Ga0373954_0000782	Ga0373954_0000782_7051_7887	266
1731	3300035119	Ga0373956_0002869	Ga0373956_0002869_6011_6847	266
1732	3300035120	Ga0373957_0048821	Ga0373957_0048821_431_1267	266
1733	3300035170	Ga0373943_0001276	Ga0373943_0001276_243_1079	266
1734	3300035170	Ga0373943_0108014	Ga0373943_0108014_277_1113	266
1735	3300035172	Ga0373955_0002870	Ga0373955_0002870_595_1431	266
1736	3300035172	Ga0373955_0034153	Ga0373955_0034153_505_1341	266
1737	3300035172	Ga0373955_0201302	Ga0373955_0201302_312_1148	266
1738	3300035410	Ga0373924_0001544	Ga0373924_0001544_5668_6504	266
1739	3300035695	Ga0373927_0000136	Ga0373927_0000136_45992_46828	266
1740	3300035724	Ga0373933_0001268	Ga0373933_0001268_7589_8425	266
1741	3300035725	Ga0373947_0008188	Ga0373947_0008188_1848_2684	266
1742	3300035725	Ga0373947_0009170	Ga0373947_0009170_2627_3463	266
1743	3300036401	Ga0373937_0007853	Ga0373937_0007853_7162_7998	266
1744	3300036401	Ga0373937_0645839	Ga0373937_0645839_38_874	266
1745	3300037068	Ga0373925_0001167	Ga0373925_0001167_13298_14134	266
1746	3300037068	Ga0373925_0180363	Ga0373925_0180363_88_924	266
1747	3300044842	Ga0466957_0023546	Ga0466957_0023546_558_1394	266
1748	3300046454	Ga0495592_0001707	Ga0495592_0001707_8576_9412	266
1749	3300046454	Ga0495592_0012511	Ga0495592_0012511_1490_2326	266
1750	3300046455	Ga0495603_0000019	Ga0495603_0000019_41505_42341	266
1751	3300046455	Ga0495603_0019786	Ga0495603_0019786_298_1134	266
1752	3300046459	Ga0495629_0000151	Ga0495629_0000151_3289_4125	266
1753	3300046459	Ga0495629_0002944	Ga0495629_0002944_6818_7654	266
1754	3300046459	Ga0495629_0123681	Ga0495629_0123681_930_1766	266
1755	3300046463	Ga0495653_0004360	Ga0495653_0004360_5517_6353	266
1756	3300046463	Ga0495653_0182379	Ga0495653_0182379_313_1149	266
1757	3300046472	Ga0495580_0001229	Ga0495580_0001229_14708_15544	266
1758	3300046473	Ga0495582_0000019	Ga0495582_0000019_9954_10790	266
1759	3300046475	Ga0495639_0000159	Ga0495639_0000159_23570_24406	266
1760	3300046476	Ga0495662_0000798	Ga0495662_0000798_5391_6227	266
1761	3300046477	Ga0495664_0253965	Ga0495664_0253965_16_852	266
1762	3300046499	Ga0495594_0000235	Ga0495594_0000235_20675_21511	266
1763	3300046511	Ga0495608_0085652	Ga0495608_0085652_54_890	266
1764	3300046514	Ga0495618_0033917	Ga0495618_0033917_1158_1994	266
1765	3300046516	Ga0495628_0117915	Ga0495628_0117915_167_1003	266
1766	3300046526	Ga0495666_0015247	Ga0495666_0015247_1492_2328	266
1767	3300046529	Ga0495652_0013238	Ga0495652_0013238_5936_6772	266
1768	3300046529	Ga0495652_0031261	Ga0495652_0031261_1381_2217	266
1769	3300046529	Ga0495652_0347961	Ga0495652_0347961_56_892	266
1770	3300046531	Ga0495665_0000093	Ga0495665_0000093_29994_30830	266
1771	3300046533	Ga0495640_0005573	Ga0495640_0005573_3446_4282	266
1772	3300046533	Ga0495640_0053002	Ga0495640_0053002_1420_2256	266
1773	3300046536	Ga0495587_0002440	Ga0495587_0002440_3980_4816	266
1774	3300046543	Ga0495645_0204252	Ga0495645_0204252_219_1055	266
1775	3300046557	Ga0495622_0000571	Ga0495622_0000571_3114_3950	266
1776	3300046559	Ga0495667_0009574	Ga0495667_0009574_882_1718	266
1777	3300046559	Ga0495667_0043495	Ga0495667_0043495_710_1546	266
1778	3300046642	Ga0495634_0003979	Ga0495634_0003979_8929_9765	266
1779	3300046642	Ga0495634_0004199	Ga0495634_0004199_7850_8686	266
1780	3300046663	Ga0495635_0000322	Ga0495635_0000322_26912_27748	266
1781	3300046663	Ga0495635_0002995	Ga0495635_0002995_6547_7383	266
1782	3300046663	Ga0495635_0195046	Ga0495635_0195046_22_858	266
1783	3300046674	Ga0495588_0010061	Ga0495588_0010061_3107_3943	266
1784	3300046675	Ga0495657_0008039	Ga0495657_0008039_3327_4163	266
1785	3300046678	Ga0495599_0014770	Ga0495599_0014770_465_1301	266
1786	3300046678	Ga0495599_0068418	Ga0495599_0068418_109_945	266
1787	3300046679	Ga0495623_0003342	Ga0495623_0003342_3808_4644	266
1788	3300046680	Ga0495646_0001883	Ga0495646_0001883_935_1771	266
1789	3300046680	Ga0495646_0070591	Ga0495646_0070591_115_951	266
1790	3300046681	Ga0495647_0000250	Ga0495647_0000250_8335_9171	266
1791	3300046683	Ga0495658_0000054	Ga0495658_0000054_47340_48176	266
1792	3300046689	Ga0495613_0002331	Ga0495613_0002331_9043_9879	266
1793	3300046690	Ga0495624_0007986	Ga0495624_0007986_4561_5397	266
1794	3300046809	Ga0495600_0001578	Ga0495600_0001578_7919_8755	266
1795	3300047315	Ga0495581_0000247	Ga0495581_0000247_1385_2221	266
1796	3300047315	Ga0495581_0083016	Ga0495581_0083016_468_1304	266
1797	3300047317	Ga0495604_0004125	Ga0495604_0004125_7294_8130	266
1798	3300047319	Ga0495674_0000871	Ga0495674_0000871_9893_10729	266
1799	3300047320	Ga0495672_0018857	Ga0495672_0018857_1937_2773	266
1800	3300047322	Ga0495680_0007673	Ga0495680_0007673_5645_6481	266
1801	3300047444	Ga0495675_0005025	Ga0495675_0005025_754_1590	266
1802	3300047471	Ga0495684_0001840	Ga0495684_0001840_3039_3875	266
1803	3300047471	Ga0495684_0261796	Ga0495684_0261796_73_909	266
1804	3300047673	Ga0495593_0000063	Ga0495593_0000063_3468_4304	266
1805	3300047673	Ga0495593_0002843	Ga0495593_0002843_2542_3378	266
1806	3300048088	Ga0495602_0009382	Ga0495602_0009382_5537_6373	266
1807	3300048905	Ga0496102_0257552	Ga0496102_0257552_67_924	266
1808	3300048907	Ga0496104_0331111	Ga0496104_0331111_524_1360	266
1809	3300048908	Ga0496105_0173542	Ga0496105_0173542_496_1332	266
1810	3300048911	Ga0496108_0645086	Ga0496108_0645086_22_879	266
1811	3300048913	Ga0496110_0140867	Ga0496110_0140867_536_1372	266
1812	3300048913	Ga0496110_0510667	Ga0496110_0510667_23_880	266
1813	3300048915	Ga0496112_0035913	Ga0496112_0035913_1186_2043	266
1814	3300048916	Ga0496113_0280674	Ga0496113_0280674_113_949	266
1815	3300048917	Ga0496114_0560305	Ga0496114_0560305_80_916	266
1816	3300048918	Ga0496115_0242621	Ga0496115_0242621_490_1326	266
1817	3300048918	Ga0496115_0377078	Ga0496115_0377078_133_969	266
1818	3300048924	Ga0496121_0000091	Ga0496121_0000091_69005_69841	266
1819	3300048929	Ga0496126_0007845	Ga0496126_0007845_5050_5886	266
1820	3300048929	Ga0496126_0078080	Ga0496126_0078080_1352_2188	266
1821	3300049570	Ga0501033_0006530	Ga0501033_0006530_6586_7422	266
1822	3300049572	Ga0501036_0062741	Ga0501036_0062741_45_881	266
1823	3300049574	Ga0501038_0058855	Ga0501038_0058855_1586_2422	266
1824	3300049576	Ga0501040_0047771	Ga0501040_0047771_1666_2502	266
1825	3300049581	Ga0501047_0124385	Ga0501047_0124385_1167_2003	266
1826	3300049583	Ga0501067_0012443	Ga0501067_0012443_316_1152	266
1827	3300049585	Ga0501069_0031229	Ga0501069_0031229_1915_2751	266
1828	3300049586	Ga0501070_0100759	Ga0501070_0100759_1418_2254	266
1829	3300049587	Ga0501071_0094550	Ga0501071_0094550_745_1581	266
1830	3300049589	Ga0501073_0074421	Ga0501073_0074421_989_1825	266
1831	3300049590	Ga0501074_0004738	Ga0501074_0004738_713_1549	266
1832	3300049742	Ga0501080_0168257	Ga0501080_0168257_871_1707	266
1833	3300049743	Ga0501081_0384396	Ga0501081_0384396_25_861	266
1834	3300049744	Ga0501083_0005759	Ga0501083_0005759_3565_4401	266
1835	3300049823	Ga0501044_0108063	Ga0501044_0108063_254_1090	266
1836	3300049824	Ga0501045_0003166	Ga0501045_0003166_3351_4187	266
1837	3300053078	Ga0495612_0022878	Ga0495612_0022878_810_1646	266
1838	3300053084	Ga0495595_0004533	Ga0495595_0004533_3830_4666	266
1839	3300053085	Ga0495619_0001285	Ga0495619_0001285_11726_12562	266
1840	3300053085	Ga0495619_0030366	Ga0495619_0030366_1529_2365	266
1841	3300053085	Ga0495619_0076886	Ga0495619_0076886_575_1411	266
1842	3300053102	Ga0500554_012904	Ga0500554_012904_144_980	266
1843	3300053104	Ga0500556_0083942	Ga0500556_0083942_125_961	266
1844	3300053150	Ga0500603_000143	Ga0500603_000143_12579_13415	266
1845	3300053178	Ga0500637_0010521	Ga0500637_0010521_232_1068	266
1846	3300054114	Ga0501084_0036311	Ga0501084_0036311_3136_3972	266
1847	3300005339	Ga0070660_100233536	Ga0070660_1002335362	267
1848	3300005366	Ga0070659_100138772	Ga0070659_1001387722	267
1849	3300005530	Ga0070679_100083660	Ga0070679_1000836602	267
1850	3300005563	Ga0068855_100121183	Ga0068855_1001211833	267
1851	3300013100	Ga0157373_10099706	Ga0157373_100997062	267
1852	3300025909	Ga0207705_10159708	Ga0207705_101597082	267
1853	3300025917	Ga0207660_10071421	Ga0207660_100714212	267
1854	3300025919	Ga0207657_10102062	Ga0207657_101020622	267
1855	3300035170	Ga0373943_0150205	Ga0373943_0150205_133_999	267
1856	3300035172	Ga0373955_0090941	Ga0373955_0090941_93_962	267
1857	3300035410	Ga0373924_0041563	Ga0373924_0041563_139_1008	267
1858	3300035692	Ga0373935_0211475	Ga0373935_0211475_14_883	267
1859	3300036401	Ga0373937_0050181	Ga0373937_0050181_2347_3216	267
1860	3300046516	Ga0495628_0112659	Ga0495628_0112659_1067_1936	267
1861	3300046529	Ga0495652_0239640	Ga0495652_0239640_340_1209	267
1862	3300046642	Ga0495634_0108273	Ga0495634_0108273_243_1112	267
1863	3300046679	Ga0495623_0026492	Ga0495623_0026492_1577_2446	267
1864	3300046680	Ga0495646_0018133	Ga0495646_0018133_822_1691	267
1865	3300046689	Ga0495613_0099756	Ga0495613_0099756_385_1251	267
1866	3300047317	Ga0495604_0031190	Ga0495604_0031190_1987_2856	267
1867	3300047319	Ga0495674_0444505	Ga0495674_0444505_92_961	267
1868	3300047322	Ga0495680_0220916	Ga0495680_0220916_408_1277	267
1869	3300047444	Ga0495675_0033954	Ga0495675_0033954_989_1858	267
1870	3300049569	Ga0501032_0299570	Ga0501032_0299570_56_895	267
1871	3300049571	Ga0501034_0545971	Ga0501034_0545971_70_909	267
1872	3300049573	Ga0501037_0010785	Ga0501037_0010785_3900_4739	267
1873	3300049573	Ga0501037_0021756	Ga0501037_0021756_3691_4530	267
1874	3300049574	Ga0501038_0001243	Ga0501038_0001243_22137_22976	267
1875	3300049574	Ga0501038_0002129	Ga0501038_0002129_14479_15318	267
1876	3300049575	Ga0501039_0036146	Ga0501039_0036146_1125_1964	267
1877	3300049579	Ga0501043_0059965	Ga0501043_0059965_1561_2400	267
1878	3300049581	Ga0501047_0050383	Ga0501047_0050383_160_999	267
1879	3300049823	Ga0501044_0056673	Ga0501044_0056673_2424_3263	267
1880	3300053077	Ga0495601_0096735	Ga0495601_0096735_358_1227	267
1881	3300053084	Ga0495595_0071049	Ga0495595_0071049_304_1173	267
1882	3300053093	Ga0500651_0175590	Ga0500651_0175590_98_958	268
1883	3300053119	Ga0500595_001460	Ga0500595_001460_816_1676	268
1884	3300053130	Ga0500642_0043760	Ga0500642_0043760_388_1248	268
1885	3300001989	JGI24739J22299_10032334	JGI24739J22299_100323342	269
1886	3300001990	JGI24737J22298_10000208	JGI24737J22298_1000020815	269
1887	3300002067	JGI24735J21928_10004541	JGI24735J21928_100045413	269
1888	3300005455	Ga0070663_100115370	Ga0070663_1001153702	269
1889	3300005539	Ga0068853_100036694	Ga0068853_1000366944	269
1890	3300005577	Ga0068857_100014108	Ga0068857_1000141087	269
1891	3300005578	Ga0068854_100004314	Ga0068854_1000043148	269
1892	3300005616	Ga0068852_100032230	Ga0068852_1000322302	269
1893	3300005834	Ga0068851_10003007	Ga0068851_100030077	269
1894	3300005834	Ga0068851_10072828	Ga0068851_100728281	269
1895	3300009174	Ga0105241_10009598	Ga0105241_100095987	269
1896	3300009174	Ga0105241_10281633	Ga0105241_102816332	269
1897	3300009551	Ga0105238_10026085	Ga0105238_100260856	269
1898	3300009551	Ga0105238_10029551	Ga0105238_100295514	269
1899	3300010375	Ga0105239_10021610	Ga0105239_100216103	269
1900	3300025321	Ga0207656_10009178	Ga0207656_100091782	269
1901	3300025321	Ga0207656_10050211	Ga0207656_100502111	269
1902	3300025904	Ga0207647_10001412	Ga0207647_1000141216	269
1903	3300025911	Ga0207654_10000073	Ga0207654_1000007337	269
1904	3300025913	Ga0207695_10000366	Ga0207695_1000036674	269
1905	3300025914	Ga0207671_10022715	Ga0207671_100227155	269
1906	3300025924	Ga0207694_10000139	Ga0207694_1000013932	269
1907	3300025924	Ga0207694_10000268	Ga0207694_1000026837	269
1908	3300025924	Ga0207694_10012864	Ga0207694_100128643	269
1909	3300025933	Ga0207706_10042290	Ga0207706_100422904	269
1910	3300025949	Ga0207667_10015832	Ga0207667_100158323	269
1911	3300025949	Ga0207667_10020820	Ga0207667_100208202	269
1912	3300025981	Ga0207640_10006813	Ga0207640_100068133	269
1913	3300025981	Ga0207640_10009040	Ga0207640_100090406	269
1914	3300026041	Ga0207639_10007864	Ga0207639_100078647	269
1915	3300026041	Ga0207639_10031296	Ga0207639_100312963	269
1916	3300026067	Ga0207678_10203241	Ga0207678_102032412	269
1917	3300026078	Ga0207702_10000491	Ga0207702_1000049136	269
1918	3300026078	Ga0207702_10012083	Ga0207702_100120833	269
1919	3300026116	Ga0207674_10008730	Ga0207674_100087309	269
1920	3300026116	Ga0207674_10008835	Ga0207674_100088356	269
1921	3300026142	Ga0207698_10037777	Ga0207698_100377774	269
1922	3300026142	Ga0207698_10071940	Ga0207698_100719403	269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

230

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ahd-assembly1.cif.gz_A	opua (e190q) occluded	0.6186	72	244
7ahd-assembly1.cif.gz_B	opua (e190q) occluded	0.6065	63	248
7ahc-assembly1.cif.gz_B	opua apo inward-facing	0.5787	17	248
4jbw-assembly1.cif.gz_F	crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc	0.5364	67	191
4jbw-assembly2.cif.gz_H	crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc	0.5315	67	191

ID	Description	Score	Start	End	Superfamily
af_P75851_53_247_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6836	63	252	1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6754	70	245	1.10.3720.10
af_Q57856_64_258_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6639	63	252	1.10.3720.10
af_P14176_140_330_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6602	62	250	1.10.3720.10
af_P75851_53_247_1.10.3720.10	Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like	0.6546	63	252	1.10.3720.10

ID	Description	Score	Start	End	GO Terms
AF-A0A434L8T1-F1-model_v4	ABC transporter permease subunit	0.8234	72	227	GO:0005886 GO:0055085
AF-A0A434L8T1-F1-model_v4	ABC transporter permease subunit	0.804	72	227	GO:0005886 GO:0055085
AF-A0A382QDR3-F1-model_v4	ABC transmembrane type-1 domain-containing protein	0.7966	58	203	GO:0005886 GO:0055085
AF-A0A418H9K5-F1-model_v4	deleted	0.7864	67	203
AF-A0A376SBI9-F1-model_v4	ABC transporter permease	0.7669	30	202	GO:0005886 GO:0055085

Feature Viewer

pLDDT	pTM	Quality
79.2	0.69	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496063

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

230

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map