F496061

General Info

Members Datasets Scaffolds Average Seq Length
1920 784 1639 250

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|637000220|637317770
Length 304
Sequence CCFGTCLKHLDPACVKTSRRIAILHSALPRQRPPPALECPAFSFGDSDMTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRAGNRVLDIAGGTGDLTKRFSHLVGPTGQVVLADINESMLKVGRDRLLDLGVAGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSKPTNALMSKVYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRVTYHNMTAGIVALHRGIKP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2547132181 Kosakonia sacchari SP1 Isolate Stem
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
29 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
30 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
31 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
32 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
33 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
34 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
35 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
36 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
37 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
38 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
39 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
40 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
41 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
42 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
43 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
44 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
45 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
46 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
47 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
48 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
49 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
50 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
51 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
52 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
53 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
54 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
55 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
56 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
57 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
58 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
59 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
60 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
61 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
62 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
63 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
64 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
65 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
66 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
67 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
68 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
69 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
70 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
71 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
72 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
73 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
74 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
75 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
76 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
77 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
78 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
79 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
80 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
81 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
82 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
83 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
84 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
85 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
86 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
87 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
88 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
89 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
90 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
91 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
92 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
93 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
94 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
95 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
96 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
97 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
98 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
99 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
100 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
101 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
102 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
103 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
104 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
105 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
106 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
107 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
108 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
109 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
110 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
111 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
112 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
113 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
114 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
115 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
116 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
117 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
118 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
119 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
120 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
121 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
122 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
123 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
124 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
125 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
126 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
127 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
128 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
129 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
130 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
131 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
132 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
133 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
134 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
135 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
136 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
137 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
138 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
139 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
140 2765235841 Pseudomonas putida AA7 Isolate Unclassified
141 2773857670 Pseudomonas sp. 478 Isolate Unclassified
142 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
143 2773857673 Pseudomonas sp. 443 Isolate Unclassified
144 2784132063 Pseudomonas sp. 424 Isolate Unclassified
145 2784132072 Pseudomonas sp. 460 Isolate Unclassified
146 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
147 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
148 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
149 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
150 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
151 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
152 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
153 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
154 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
155 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
156 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
157 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
158 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
159 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
160 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
161 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
162 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
163 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
164 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
165 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
166 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
167 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
168 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
169 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
170 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
171 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
172 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
173 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
174 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
175 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
176 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
177 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
178 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
179 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
180 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
181 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
182 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
183 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
184 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
185 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
186 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
187 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
188 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
189 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
190 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
191 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
192 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
193 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
194 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
195 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
196 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
197 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
198 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
199 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
200 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
201 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
202 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
203 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
204 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
205 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
206 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
207 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
208 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
209 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
210 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
211 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
212 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
213 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
214 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
215 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
216 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
217 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
218 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
219 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
220 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
221 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
222 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
223 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
224 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
225 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
226 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
227 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
228 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
229 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
230 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
231 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
232 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
233 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
234 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
235 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
236 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
237 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
238 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
239 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
240 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
241 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
242 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
243 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
244 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
245 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
246 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
247 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
248 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
249 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
250 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
251 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
252 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
253 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
254 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
255 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
256 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
257 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
258 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
259 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
260 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
261 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
262 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
264 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
265 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
266 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
267 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
268 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
269 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
270 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
271 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
272 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
273 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
274 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
275 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
276 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
277 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
278 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
279 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
280 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
281 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
282 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
283 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
284 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
285 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
286 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
287 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
288 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
289 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
290 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
291 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
292 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
293 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
294 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
295 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
296 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
297 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
298 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
299 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
300 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
301 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
302 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
303 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
304 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
305 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
306 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
307 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
308 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
309 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
310 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
311 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
312 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
313 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
314 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
315 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
316 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
317 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
318 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
319 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
320 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
321 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
322 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
323 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
324 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
325 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
326 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
327 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
328 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
329 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
330 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
331 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
332 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
333 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
334 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
335 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
336 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
337 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
338 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
339 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
340 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
341 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
342 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
343 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
344 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
345 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
346 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
347 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
348 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
349 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
350 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
351 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
352 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
353 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
354 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
355 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
356 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
357 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
358 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
359 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
360 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
361 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
362 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
363 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
364 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
365 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
366 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
367 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
368 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
369 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
370 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
371 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
372 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
373 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
374 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
375 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
376 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
377 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
378 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
379 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
380 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
381 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
382 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
388 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
389 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
390 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
391 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
392 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
393 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
396 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
397 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
398 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
399 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
401 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
402 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
403 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
405 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
406 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
408 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
409 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
462 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
466 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
467 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
469 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
471 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
472 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
474 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
475 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
476 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
478 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
479 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
480 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
483 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
484 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
485 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
486 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
487 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
488 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
489 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
490 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
491 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
492 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
493 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
494 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
495 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
496 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
497 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
498 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
499 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
500 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
501 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
502 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
503 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
504 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
506 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
508 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
509 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
510 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
511 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
512 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
513 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
514 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
515 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
516 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
517 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
518 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
519 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
520 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
521 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
522 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
523 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
524 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
525 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
526 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
527 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
528 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
529 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
530 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
531 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
532 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
533 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
534 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
535 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
536 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
537 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
538 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
539 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
540 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
541 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
542 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
543 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
544 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
545 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
546 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
547 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
548 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
549 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
550 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
551 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
552 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
553 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
554 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
555 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
556 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
557 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
558 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
559 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
560 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
561 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
562 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
563 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
564 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
565 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
566 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
567 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
568 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
569 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
570 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
571 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
572 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
573 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
574 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
575 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
576 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
577 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
578 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
579 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
580 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
581 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
582 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
583 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
584 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
585 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
586 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
587 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
588 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
589 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
590 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
591 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
592 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
593 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
594 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
595 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
596 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
597 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
598 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
599 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
600 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
601 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
602 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
603 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
604 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
605 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
606 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
607 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
608 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
609 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
610 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
611 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
612 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
613 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
614 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
615 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
616 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
617 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
618 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
619 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
620 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
621 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
622 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
623 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
624 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
625 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
626 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
627 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
628 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
629 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
630 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
631 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
632 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
633 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
634 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
635 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
636 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
637 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
638 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
639 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
640 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
641 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
642 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
643 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
644 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
645 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
646 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
647 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
648 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
649 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
650 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
651 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
652 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
653 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
654 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
655 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
656 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
657 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
658 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
659 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
660 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
661 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
662 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
663 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
664 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
665 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
666 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
667 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
668 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
669 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
670 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
671 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
672 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
673 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
674 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
675 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
676 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
677 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
678 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
679 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
680 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
681 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
682 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
683 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
684 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
685 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
686 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
687 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
688 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
689 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
690 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
692 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
693 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
694 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
695 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
696 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
697 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
698 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
699 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
700 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
701 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
702 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
703 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
704 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
705 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
706 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
707 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
708 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
709 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
710 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
711 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
712 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
713 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
714 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
715 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
716 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
717 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
718 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
719 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
720 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
721 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
722 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
723 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
724 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
725 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
726 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
727 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
728 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
729 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
730 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
731 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
732 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
733 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
734 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
735 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
736 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
737 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
738 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
739 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
740 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
741 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
742 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
743 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
744 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
745 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
746 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
747 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
748 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
749 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
750 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
751 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
752 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
753 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
754 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
755 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
756 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
757 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
758 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
759 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
760 8052494512 Pseudomonas putida LD6 Isolate Unclassified
761 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
762 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
763 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
764 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
765 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
766 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
767 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
768 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
769 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
770 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
771 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
772 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
773 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
774 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
775 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
776 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
777 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
778 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
779 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
780 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
781 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
782 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
783 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
784 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.11
Metatranscriptomes 1.25
Isolates 14.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 9.38
Nodule 1.72
Rhizoplane 5.94
Rhizosphere 73.91
Stem 0.05
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1652 2124908027 Bacteria 30845
2 JGI25156J39149_1000267 3300002705 Bacteria 35297
3 JGI25156J39149_1002692 3300002705 Bacteria 6223
4 JGI25162J39368_1000040 3300002737 Bacteria 175938
5 JGI25162J39368_1000098 3300002737 Bacteria 95821
6 JGI25162J39368_1000129 3300002737 Bacteria 83712
7 JGI25162J39368_1006805 3300002737 Bacteria 1890
8 JGI25154J39366_1000739 3300002738 Bacteria 14651
9 JGI25154J39366_1002155 3300002738 Bacteria 5508
10 JGI25158J39367_1014308 3300002739 Bacteria 1027
11 JGI25157J39369_1000372 3300002741 Bacteria 30863
12 JGI25157J39369_1000495 3300002741 Bacteria 24307
13 JGI25163J39215_1004713 3300002771 Bacteria 929
14 JGI25164J39214_1000076 3300002772 Bacteria 95821
15 JGI25164J39214_1000101 3300002772 Bacteria 83715
16 JGI25152J39213_1003789 3300002773 Bacteria 5023
17 JGI25159J45721_1003356 3300002987 Bacteria 5702
18 JGI25159J45721_1010497 3300002987 Bacteria 2354
19 JGI25159J45721_1024725 3300002987 Bacteria 1063
20 JGI25165J46597_1000051 3300003214 Bacteria 241012
21 JGI25165J46597_1000150 3300003214 Bacteria 115430
22 JGI25165J46597_1000180 3300003214 Bacteria 95821
23 JGI25153J46596_10003428 3300003215 Bacteria 8879
24 JGI25160J50197_1017779 3300003354 Bacteria 2239
25 JGI25161J50226_1001939 3300003374 Bacteria 5706
26 JGI25161J50226_1011958 3300003374 Bacteria 1063
27 Ga0006562J51391_1024911 3300003578 Bacteria 2650
28 Ga0032354_1037465 3300003693 Bacteria 2117
29 Ga0055538_1000025 3300003751 Bacteria 241012
30 Ga0055538_1000037 3300003751 Bacteria 190238
31 Ga0055538_1000062 3300003751 Bacteria 105260
32 Ga0055539_1000032 3300003752 Bacteria 241012
33 Ga0055539_1000048 3300003752 Bacteria 190238
34 Ga0055539_1000093 3300003752 Bacteria 105260
35 Ga0055533_1000042 3300003756 Bacteria 241012
36 Ga0055533_1000059 3300003756 Bacteria 190238
37 Ga0055533_1000105 3300003756 Bacteria 105260
38 Ga0055532_1000034 3300003758 Bacteria 210984
39 Ga0055532_1000105 3300003758 Bacteria 91428
40 Ga0055525_1000018 3300003759 Bacteria 393974
41 Ga0055525_1000050 3300003759 Bacteria 241012
42 Ga0055525_1000128 3300003759 Bacteria 113553
43 Ga0055525_1000137 3300003759 Bacteria 105260
44 Ga0055535_1003795 3300003761 Bacteria 4028
45 Ga0055542_1004530 3300003762 Bacteria 3347
46 Ga0055526_1000045 3300003771 Bacteria 121703
47 Ga0055526_1000481 3300003771 Bacteria 31637
48 Ga0055526_1002752 3300003771 Bacteria 11667
49 Ga0055526_1009931 3300003771 Bacteria 4503
50 Ga0055537_1000626 3300003773 Bacteria 19168
51 Ga0055537_1003160 3300003773 Bacteria 5157
52 Ga0055524_1000024 3300003775 Bacteria 217953
53 Ga0055524_1006833 3300003775 Bacteria 4920
54 Ga0055524_1013987 3300003775 Bacteria 2997
55 Ga0055524_1018011 3300003775 Bacteria 2469
56 Ga0055536_1002523 3300003781 Bacteria 10259
57 Ga0055534_1000557 3300003784 Bacteria 19717
58 Ga0055534_1018769 3300003784 Bacteria 1197
59 Ga0055528_1000252 3300003790 Bacteria 45454
60 Ga0055528_1011419 3300003790 Bacteria 3527
61 Ga0055530_10000312 3300003791 Bacteria 44214
62 Ga0055530_10001569 3300003791 Bacteria 16372
63 Ga0055540_1000217 3300003792 Bacteria 54396
64 Ga0055540_1000294 3300003792 Bacteria 44469
65 Ga0055540_1001288 3300003792 Bacteria 15226
66 Ga0055531_10000238 3300003794 Bacteria 60414
67 Ga0055531_10000275 3300003794 Bacteria 53122
68 Ga0055541_1000023 3300003841 Bacteria 241012
69 Ga0055541_1000035 3300003841 Bacteria 190238
70 Ga0055541_1000063 3300003841 Bacteria 105260
71 Ga0058692_1020622 3300003856 Bacteria 1382
72 Ga0055543_1002659 3300004625 Bacteria 5744
73 Ga0065165_1000379 3300005262 Bacteria 72513
74 Ga0065165_1000936 3300005262 Bacteria 37330
75 Ga0065165_1006940 3300005262 Bacteria 5744
76 Ga0065714_10000282 3300005288 Bacteria 6343
77 Ga0065714_10022826 3300005288 Bacteria 1032
78 Ga0065714_10066311 3300005288 Bacteria 7130
79 Ga0065704_10007693 3300005289 Bacteria 3988
80 Ga0065704_10159285 3300005289 Bacteria 1367
81 Ga0065712_10008788 3300005290 Bacteria 2181
82 Ga0065712_10067807 3300005290 Bacteria 30871
83 Ga0065715_10145527 3300005293 Bacteria 1789
84 Ga0065715_10361477 3300005293 Bacteria 935
85 Ga0070658_10065716 3300005327 Bacteria 2961
86 Ga0070658_10114609 3300005327 Bacteria 2235
87 Ga0070676_10106008 3300005328 Bacteria 1744
88 Ga0070690_100269075 3300005330 Bacteria 1211
89 Ga0070670_100062353 3300005331 Bacteria 3201
90 Ga0070670_100084312 3300005331 Bacteria 2730
91 Ga0070670_100139271 3300005331 Bacteria 2098
92 Ga0070666_10001127 3300005335 Bacteria 16241
93 Ga0068868_100002829 3300005338 Bacteria 12020
94 Ga0070660_100003755 3300005339 Bacteria 10495
95 Ga0070660_100061598 3300005339 Bacteria 2913
96 Ga0070660_100383095 3300005339 Bacteria 1161
97 Ga0070689_100022500 3300005340 Bacteria 4706
98 Ga0070689_100128199 3300005340 Bacteria 2033
99 Ga0070661_100000178 3300005344 Bacteria 52325
100 Ga0070661_100005481 3300005344 Bacteria 8749
101 Ga0070661_100058455 3300005344 Bacteria 2825
102 Ga0070668_100355067 3300005347 Unclassified 1242
103 Ga0070669_100000265 3300005353 Bacteria 42842
104 Ga0070669_100005987 3300005353 Bacteria 8776
105 Ga0070669_100026715 3300005353 Bacteria 4154
106 Ga0070675_100090409 3300005354 Bacteria 2564
107 Ga0070673_100074726 3300005364 Bacteria 2732
108 Ga0070659_100001965 3300005366 Bacteria 14678
109 Ga0070667_100010227 3300005367 Bacteria 7751
110 Ga0070714_100029472 3300005435 Bacteria 4562
111 Ga0070714_100038437 3300005435 Bacteria 4023
112 Ga0070713_100065540 3300005436 Bacteria 3052
113 Ga0070700_100047678 3300005441 Bacteria 2652
114 Ga0070663_100239210 3300005455 Bacteria 1432
115 Ga0070678_100149427 3300005456 Bacteria 1880
116 Ga0070662_100000348 3300005457 Bacteria 27713
117 Ga0070662_100040368 3300005457 Bacteria 3322
118 Ga0070662_100162552 3300005457 Bacteria 1747
119 Ga0070662_100175405 3300005457 Bacteria 1686
120 Ga0070681_10014570 3300005458 Bacteria 7824
121 Ga0070681_10079256 3300005458 Bacteria 3241
122 Ga0070681_10159163 3300005458 Bacteria 2182
123 Ga0068867_100244163 3300005459 Bacteria 1457
124 Ga0070706_100057979 3300005467 Bacteria 3574
125 Ga0070684_100145004 3300005535 Bacteria 2149
126 Ga0070697_100702760 3300005536 Bacteria 892
127 Ga0068853_100000029 3300005539 Bacteria 121775
128 Ga0068853_100004343 3300005539 Bacteria 10970
129 Ga0068853_100178370 3300005539 Bacteria 1926
130 Ga0068853_100283618 3300005539 Bacteria 1527
131 Ga0068853_100602475 3300005539 Bacteria 1043
132 Ga0070672_100303253 3300005543 Bacteria 1354
133 Ga0070686_100087636 3300005544 Bacteria 2075
134 Ga0070686_100211913 3300005544 Bacteria 1395
135 Ga0070665_100018864 3300005548 Bacteria 6917
136 Ga0070665_100064242 3300005548 Bacteria 3680
137 Ga0068855_100003915 3300005563 Bacteria 18175
138 Ga0068855_100102548 3300005563 Bacteria 3293
139 Ga0068855_100132978 3300005563 Bacteria 2840
140 Ga0068855_100396691 3300005563 Bacteria 1513
141 Ga0068855_100560194 3300005563 Bacteria 1236
142 Ga0070664_100000680 3300005564 Bacteria 26007
143 Ga0070664_100010538 3300005564 Bacteria 7492
144 Ga0070664_100064635 3300005564 Bacteria 3121
145 Ga0070664_100078682 3300005564 Bacteria 2836
146 Ga0070664_100290271 3300005564 Bacteria 1476
147 Ga0070664_100547781 3300005564 Bacteria 1069
148 Ga0070664_100592055 3300005564 Bacteria 1028
149 Ga0068857_100086731 3300005577 Bacteria 2799
150 Ga0068857_100160228 3300005577 Bacteria 2041
151 Ga0068854_100064390 3300005578 Bacteria 2663
152 Ga0068854_100667834 3300005578 Bacteria 894
153 Ga0068856_100039033 3300005614 Bacteria 4662
154 Ga0068856_100161565 3300005614 Bacteria 2250
155 Ga0070702_100008784 3300005615 Bacteria 4914
156 Ga0068852_100031182 3300005616 Bacteria 4395
157 Ga0068859_100005859 3300005617 Bacteria 12471
158 Ga0068864_100002557 3300005618 Bacteria 15027
159 Ga0068851_10000024 3300005834 Bacteria 125917
160 Ga0068851_10102682 3300005834 Bacteria 1519
161 Ga0068858_100006205 3300005842 Bacteria 11651
162 Ga0070717_10035845 3300006028 Bacteria 4020
163 Ga0070717_10293650 3300006028 Bacteria 1444
164 Ga0075368_10002887 3300006042 Bacteria 5675
165 Ga0075363_100005456 3300006048 Bacteria 5660
166 Ga0075364_10035001 3300006051 Bacteria 3244
167 Ga0075432_10006193 3300006058 Bacteria 4067
168 Ga0075432_10155801 3300006058 Bacteria 880
169 Ga0070716_100015793 3300006173 Bacteria 3887
170 Ga0075367_10003131 3300006178 Bacteria 7787
171 Ga0075369_10010363 3300006186 Bacteria 3644
172 Ga0075366_10001060 3300006195 Bacteria 13490
173 Ga0075370_10026031 3300006353 Bacteria 3238
174 Ga0075433_10553656 3300006852 Bacteria 1011
175 Ga0075434_100048649 3300006871 Bacteria 4207
176 Ga0068865_100057233 3300006881 Bacteria 2719
177 Ga0068865_100074790 3300006881 Bacteria 2414
178 Ga0097620_100005859 3300006931 Bacteria 12471
179 Ga0099823_1000243 3300006944 Bacteria 31673
180 Ga0099823_1041682 3300006944 Bacteria 3253
181 Ga0079104_1000508 3300006946 Bacteria 41889
182 Ga0099826_10000010 3300006948 Bacteria 314346
183 Ga0099826_10022339 3300006948 Bacteria 4730
184 Ga0105251_10000118 3300009011 Bacteria 79165
185 Ga0105251_10000191 3300009011 Bacteria 62283
186 Ga0105251_10000327 3300009011 Bacteria 47707
187 Ga0105251_10000977 3300009011 Bacteria 25320
188 Ga0105251_10002348 3300009011 Bacteria 14969
189 Ga0105251_10003254 3300009011 Bacteria 11933
190 Ga0105251_10003735 3300009011 Bacteria 10894
191 Ga0105251_10005020 3300009011 Bacteria 8783
192 Ga0105251_10025865 3300009011 Bacteria 2995
193 Ga0105251_10044310 3300009011 Bacteria 2150
194 Ga0105251_10122702 3300009011 Bacteria 1180
195 Ga0105244_10000639 3300009036 Bacteria 30878
196 Ga0105244_10001496 3300009036 Bacteria 18753
197 Ga0105244_10002229 3300009036 Bacteria 14769
198 Ga0105244_10002769 3300009036 Bacteria 13073
199 Ga0105244_10003018 3300009036 Bacteria 12355
200 Ga0105244_10005078 3300009036 Bacteria 8847
201 Ga0105244_10008540 3300009036 Bacteria 6389
202 Ga0105244_10011004 3300009036 Bacteria 5452
203 Ga0105244_10014131 3300009036 Bacteria 4630
204 Ga0105244_10032077 3300009036 Bacteria 2784
205 Ga0105244_10038657 3300009036 Bacteria 2488
206 Ga0105244_10054229 3300009036 Bacteria 2035
207 Ga0105250_10000251 3300009092 Bacteria 44435
208 Ga0105250_10000487 3300009092 Bacteria 27888
209 Ga0105250_10019916 3300009092 Bacteria 2714
210 Ga0105240_10001608 3300009093 Bacteria 38292
211 Ga0105240_10019527 3300009093 Bacteria 9051
212 Ga0105240_10026829 3300009093 Bacteria 7554
213 Ga0105240_10043423 3300009093 Bacteria 5720
214 Ga0105240_10061599 3300009093 Bacteria 4676
215 Ga0105245_10077129 3300009098 Bacteria 3037
216 Ga0105247_10004253 3300009101 Bacteria 9174
217 Ga0105247_10012542 3300009101 Bacteria 5091
218 Ga0105243_10000299 3300009148 Bacteria 54796
219 Ga0105243_10005926 3300009148 Bacteria 9467
220 Ga0105243_10007642 3300009148 Bacteria 8308
221 Ga0105243_10009460 3300009148 Bacteria 7424
222 Ga0105243_10118388 3300009148 Bacteria 2229
223 Ga0105243_10135951 3300009148 Bacteria 2091
224 Ga0105241_10039775 3300009174 Bacteria 3548
225 Ga0105241_10055742 3300009174 Bacteria 3029
226 Ga0105242_10001173 3300009176 Bacteria 20612
227 Ga0105248_10002113 3300009177 Bacteria 22001
228 Ga0105248_10024766 3300009177 Bacteria 6674
229 Ga0105237_10002206 3300009545 Bacteria 24399
230 Ga0105237_10020762 3300009545 Bacteria 6765
231 Ga0105237_10096738 3300009545 Bacteria 2943
232 Ga0105237_10516438 3300009545 Unclassified 1201
233 Ga0105238_10000763 3300009551 Bacteria 33477
234 Ga0105238_10002078 3300009551 Bacteria 20242
235 Ga0105238_10027792 3300009551 Bacteria 5765
236 Ga0105238_10061370 3300009551 Bacteria 3762
237 Ga0105238_10236152 3300009551 Bacteria 1805
238 Ga0105238_10551097 3300009551 Bacteria 1157
239 Ga0105249_10038235 3300009553 Bacteria 4353
240 Ga0105249_10143100 3300009553 Bacteria 2295
241 Ga0105249_10888895 3300009553 Bacteria 957
242 Ga0105239_10008100 3300010375 Bacteria 11995
243 Ga0105239_10009911 3300010375 Bacteria 10701
244 Ga0105239_10033547 3300010375 Bacteria 5636
245 Ga0105239_10195939 3300010375 Bacteria 2262
246 Ga0105239_10407477 3300010375 Bacteria 1539
247 Ga0105239_10515560 3300010375 Bacteria 1360
248 Ga0105239_11222117 3300010375 Bacteria 866
249 Ga0105246_10000652 3300011119 Bacteria 19387
250 Ga0105246_10004799 3300011119 Bacteria 8233
251 Ga0105246_10011845 3300011119 Bacteria 5422
252 Ga0105246_10070897 3300011119 Bacteria 2452
253 Ga0105246_10181268 3300011119 Bacteria 1622
254 Ga0157373_10000793 3300013100 Bacteria 24394
255 Ga0157373_10004410 3300013100 Bacteria 10598
256 Ga0157373_10139519 3300013100 Bacteria 1705
257 Ga0157373_10199167 3300013100 Bacteria 1412
258 Ga0157371_10000238 3300013102 Bacteria 78535
259 Ga0157371_10087043 3300013102 Bacteria 2212
260 Ga0157371_10118230 3300013102 Bacteria 1884
261 Ga0157370_10127631 3300013104 Bacteria 2374
262 Ga0157370_10129271 3300013104 Bacteria 2357
263 Ga0157369_10000537 3300013105 Bacteria 50143
264 Ga0157369_10354798 3300013105 Bacteria 1523
265 Ga0157369_10484147 3300013105 Bacteria 1280
266 Ga0163162_10016611 3300013306 Bacteria 7194
267 Ga0163162_10049541 3300013306 Bacteria 4210
268 Ga0163162_10142729 3300013306 Bacteria 2509
269 Ga0163162_10183552 3300013306 Bacteria 2218
270 Ga0157372_10006660 3300013307 Bacteria 12294
271 Ga0157372_10049515 3300013307 Bacteria 4671
272 Ga0157372_10072658 3300013307 Bacteria 3877
273 Ga0157372_10229871 3300013307 Bacteria 2150
274 Ga0157372_11507295 3300013307 Bacteria 775
275 Ga0157375_10056113 3300013308 Bacteria 3887
276 Ga0163163_10003386 3300014325 Bacteria 13534
277 Ga0163163_10012524 3300014325 Bacteria 7734
278 Ga0182008_10001211 3300014497 Bacteria 17767
279 Ga0182008_10004382 3300014497 Bacteria 8259
280 Ga0182008_10005360 3300014497 Bacteria 7321
281 Ga0182008_10010498 3300014497 Bacteria 4954
282 Ga0182008_10044122 3300014497 Bacteria 2218
283 Ga0157377_10007511 3300014745 Bacteria 5267
284 Ga0157379_10103371 3300014968 Bacteria 2556
285 Ga0157379_10107319 3300014968 Bacteria 2507
286 Ga0157376_10041402 3300014969 Bacteria 3770
287 Ga0157376_10103651 3300014969 Bacteria 2491
288 Ga0182006_1000033 3300015261 Bacteria 238180
289 Ga0182006_1000141 3300015261 Bacteria 77478
290 Ga0182006_1008100 3300015261 Bacteria 4772
291 Ga0182006_1010430 3300015261 Bacteria 4132
292 Ga0182006_1027033 3300015261 Bacteria 2345
293 Ga0182006_1030859 3300015261 Bacteria 2163
294 Ga0182007_10001557 3300015262 Bacteria 12229
295 Ga0182007_10026404 3300015262 Bacteria 2013
296 Ga0182005_1000016 3300015265 Bacteria 346889
297 Ga0182005_1000024 3300015265 Bacteria 238256
298 Ga0182005_1001902 3300015265 Bacteria 7908
299 Ga0183360_10154 3300015689 Bacteria 1448
300 Ga0163161_10015922 3300017792 Bacteria 5246
301 Ga0163161_10025047 3300017792 Bacteria 4219
302 Ga0163161_10111303 3300017792 Bacteria 2047
303 Ga0206351_10464379 3300020077 Bacteria 853
304 Ga0213872_10000005 3300021361 Bacteria 290165
305 Ga0213872_10001171 3300021361 Bacteria 17824
306 Ga0213872_10002039 3300021361 Bacteria 12282
307 Ga0213872_10007513 3300021361 Bacteria 5355
308 Ga0213872_10010335 3300021361 Bacteria 4445
309 Ga0213872_10018649 3300021361 Bacteria 3198
310 Ga0213872_10021029 3300021361 Bacteria 3004
311 Ga0209435_100007 3300025206 Bacteria 516857
312 Ga0209435_100176 3300025206 Bacteria 19214
313 Ga0209435_100319 3300025206 Bacteria 11575
314 Ga0209760_100080 3300025207 Bacteria 77279
315 Ga0209760_100465 3300025207 Bacteria 8919
316 Ga0209436_100287 3300025208 Bacteria 23212
317 Ga0209436_102115 3300025208 Bacteria 6223
318 Ga0209784_100010 3300025224 Bacteria 683664
319 Ga0209784_100021 3300025224 Bacteria 408534
320 Ga0209784_100028 3300025224 Bacteria 357464
321 Ga0209566_100008 3300025225 Bacteria 683664
322 Ga0209566_100028 3300025225 Bacteria 357464
323 Ga0209566_100119 3300025225 Bacteria 105312
324 Ga0209674_100019 3300025226 Bacteria 683664
325 Ga0209674_100036 3300025226 Bacteria 408534
326 Ga0209674_100047 3300025226 Bacteria 357464
327 Ga0209147_100017 3300025229 Bacteria 516857
328 Ga0209147_100031 3300025229 Bacteria 357464
329 Ga0209563_100011 3300025230 Bacteria 1187808
330 Ga0209563_100021 3300025230 Bacteria 683764
331 Ga0209563_100040 3300025230 Bacteria 408534
332 Ga0209563_100050 3300025230 Bacteria 357464
333 Ga0209563_102312 3300025230 Bacteria 4377
334 Ga0207427_100014 3300025231 Bacteria 561361
335 Ga0207427_100016 3300025231 Bacteria 538697
336 Ga0207427_102072 3300025231 Bacteria 5925
337 Ga0209437_100011 3300025233 Bacteria 818520
338 Ga0209437_100016 3300025233 Bacteria 710118
339 Ga0209437_100019 3300025233 Bacteria 683764
340 Ga0209437_100332 3300025233 Bacteria 58796
341 Ga0209258_100115 3300025242 Bacteria 190367
342 Ga0209258_100460 3300025242 Bacteria 44368
343 Ga0207425_1000021 3300025245 Bacteria 367537
344 Ga0207425_1000170 3300025245 Bacteria 53604
345 Ga0207425_1002098 3300025245 Bacteria 7365
346 Ga0209646_1000044 3300025246 Bacteria 334596
347 Ga0209646_1000068 3300025246 Bacteria 233765
348 Ga0209646_1000107 3300025246 Bacteria 163112
349 Ga0209646_1000183 3300025246 Bacteria 79021
350 Ga0209026_1000063 3300025250 Bacteria 211324
351 Ga0209026_1002108 3300025250 Bacteria 7803
352 Ga0209026_1008584 3300025250 Bacteria 2115
353 Ga0209677_100011 3300025253 Bacteria 683664
354 Ga0209677_100023 3300025253 Bacteria 408534
355 Ga0209677_100029 3300025253 Bacteria 357464
356 Ga0209677_102948 3300025253 Bacteria 5935
357 Ga0209148_1001117 3300025254 Bacteria 15972
358 Ga0209759_1000048 3300025256 Bacteria 224817
359 Ga0209759_1000198 3300025256 Bacteria 95052
360 Ga0209129_1000020 3300025258 Bacteria 457053
361 Ga0209129_1004970 3300025258 Bacteria 4923
362 Ga0209129_1023052 3300025258 Bacteria 1115
363 Ga0209233_1000019 3300025261 Bacteria 818520
364 Ga0209233_1000025 3300025261 Bacteria 683764
365 Ga0209233_1000036 3300025261 Bacteria 561361
366 Ga0209233_1051831 3300025261 Bacteria 830
367 Ga0209565_1000123 3300025263 Bacteria 111069
368 Ga0209565_1000632 3300025263 Bacteria 23018
369 Ga0209565_1000689 3300025263 Bacteria 21007
370 Ga0209565_1011339 3300025263 Bacteria 2170
371 Ga0209565_1023449 3300025263 Bacteria 1267
372 Ga0209455_1000070 3300025272 Bacteria 307867
373 Ga0209455_1001196 3300025272 Bacteria 12392
374 Ga0209673_1000040 3300025273 Bacteria 312633
375 Ga0209673_1008854 3300025273 Bacteria 4432
376 Ga0209130_1000589 3300025284 Bacteria 35424
377 Ga0209130_1002447 3300025284 Bacteria 9298
378 Ga0209130_1003581 3300025284 Bacteria 6485
379 Ga0209675_1000117 3300025291 Bacteria 111087
380 Ga0209675_1000567 3300025291 Bacteria 26633
381 Ga0209675_1010611 3300025291 Bacteria 3129
382 Ga0209676_1000025 3300025292 Bacteria 577569
383 Ga0209676_1000032 3300025292 Bacteria 469558
384 Ga0209676_1001206 3300025292 Bacteria 27625
385 Ga0209676_1006288 3300025292 Bacteria 5902
386 Ga0209564_1000027 3300025295 Bacteria 518458
387 Ga0209564_1000047 3300025295 Bacteria 368031
388 Ga0209564_1000063 3300025295 Bacteria 318515
389 Ga0209564_1000121 3300025295 Bacteria 204081
390 Ga0209564_1001500 3300025295 Bacteria 23422
391 Ga0209564_1024695 3300025295 Bacteria 2047
392 Ga0209758_1000077 3300025297 Bacteria 268195
393 Ga0209758_1000394 3300025297 Bacteria 75557
394 Ga0209050_1000025 3300025298 Bacteria 528225
395 Ga0209050_1000028 3300025298 Bacteria 477133
396 Ga0209050_1000050 3300025298 Bacteria 362578
397 Ga0209050_1000381 3300025298 Bacteria 83623
398 Ga0209050_1000981 3300025298 Bacteria 36358
399 Ga0209050_1001569 3300025298 Bacteria 23757
400 Ga0209256_1000054 3300025299 Bacteria 298431
401 Ga0209256_1000288 3300025299 Bacteria 88470
402 Ga0209256_1001035 3300025299 Bacteria 32598
403 Ga0209256_1001444 3300025299 Bacteria 24546
404 Ga0209256_1001988 3300025299 Bacteria 18381
405 Ga0207426_1000956 3300025302 Bacteria 28468
406 Ga0209051_1000026 3300025303 Bacteria 413311
407 Ga0209051_1000080 3300025303 Bacteria 199694
408 Ga0209051_1000299 3300025303 Bacteria 78310
409 Ga0209257_1000034 3300025304 Bacteria 662719
410 Ga0209257_1000075 3300025304 Bacteria 324855
411 Ga0209257_1004941 3300025304 Bacteria 9781
412 Ga0207656_10000008 3300025321 Bacteria 275365
413 Ga0207696_1000020 3300025711 Bacteria 434998
414 Ga0207696_1000057 3300025711 Bacteria 249404
415 Ga0207696_1000074 3300025711 Bacteria 215333
416 Ga0207696_1000084 3300025711 Bacteria 196086
417 Ga0207696_1004990 3300025711 Bacteria 5596
418 Ga0207655_1000014 3300025728 Bacteria 607124
419 Ga0207655_1000341 3300025728 Bacteria 68003
420 Ga0207655_1000417 3300025728 Bacteria 58184
421 Ga0207655_1000502 3300025728 Bacteria 50106
422 Ga0207655_1000556 3300025728 Bacteria 46531
423 Ga0207655_1001671 3300025728 Bacteria 19602
424 Ga0207655_1003052 3300025728 Bacteria 12771
425 Ga0207655_1004059 3300025728 Bacteria 10542
426 Ga0207655_1004382 3300025728 Bacteria 10028
427 Ga0207655_1009008 3300025728 Bacteria 6252
428 Ga0207655_1014363 3300025728 Bacteria 4479
429 Ga0207655_1019136 3300025728 Bacteria 3596
430 Ga0207655_1031800 3300025728 Bacteria 2424
431 Ga0207655_1047084 3300025728 Bacteria 1783
432 Ga0207713_1000031 3300025735 Bacteria 283971
433 Ga0207713_1000114 3300025735 Bacteria 132170
434 Ga0207713_1000572 3300025735 Bacteria 36532
435 Ga0207713_1001535 3300025735 Bacteria 18179
436 Ga0207713_1001823 3300025735 Bacteria 16278
437 Ga0207713_1002851 3300025735 Bacteria 12154
438 Ga0207713_1002976 3300025735 Bacteria 11843
439 Ga0207713_1003112 3300025735 Bacteria 11505
440 Ga0207713_1005620 3300025735 Bacteria 7797
441 Ga0207713_1026063 3300025735 Bacteria 2687
442 Ga0207713_1026175 3300025735 Bacteria 2678
443 Ga0207713_1028291 3300025735 Bacteria 2531
444 Ga0207642_10090366 3300025899 Bacteria 1511
445 Ga0207680_10058347 3300025903 Bacteria 2339
446 Ga0207699_10129730 3300025906 Bacteria 1643
447 Ga0207645_10090148 3300025907 Bacteria 1972
448 Ga0207645_10196251 3300025907 Bacteria 1327
449 Ga0207643_10081658 3300025908 Bacteria 1874
450 Ga0207705_10060456 3300025909 Bacteria 2737
451 Ga0207705_10330705 3300025909 Bacteria 1172
452 Ga0207684_10035065 3300025910 Bacteria 4261
453 Ga0207654_10092385 3300025911 Bacteria 1848
454 Ga0207707_10141988 3300025912 Bacteria 2099
455 Ga0207707_10183472 3300025912 Bacteria 1826
456 Ga0207695_10003613 3300025913 Bacteria 21636
457 Ga0207695_10004696 3300025913 Bacteria 18501
458 Ga0207695_10004927 3300025913 Bacteria 17992
459 Ga0207695_10019466 3300025913 Bacteria 7819
460 Ga0207671_10000015 3300025914 Bacteria 439607
461 Ga0207671_10003371 3300025914 Bacteria 16001
462 Ga0207671_10005095 3300025914 Bacteria 12259
463 Ga0207671_10043537 3300025914 Bacteria 3320
464 Ga0207693_10035205 3300025915 Bacteria 3948
465 Ga0207663_10005967 3300025916 Bacteria 6187
466 Ga0207660_10172548 3300025917 Bacteria 1675
467 Ga0207662_10314382 3300025918 Bacteria 1044
468 Ga0207657_10005929 3300025919 Bacteria 12719
469 Ga0207657_10014161 3300025919 Bacteria 7802
470 Ga0207657_10046922 3300025919 Bacteria 3782
471 Ga0207657_10322084 3300025919 Bacteria 1222
472 Ga0207649_10000001 3300025920 Bacteria 537851
473 Ga0207649_10011459 3300025920 Bacteria 4890
474 Ga0207649_10072113 3300025920 Bacteria 2208
475 Ga0207649_10191300 3300025920 Bacteria 1439
476 Ga0207681_10002623 3300025923 Bacteria 11397
477 Ga0207681_10004161 3300025923 Bacteria 8964
478 Ga0207681_10057803 3300025923 Bacteria 2653
479 Ga0207694_10000343 3300025924 Bacteria 44142
480 Ga0207694_10002811 3300025924 Bacteria 14054
481 Ga0207694_10027879 3300025924 Bacteria 4303
482 Ga0207694_10193957 3300025924 Bacteria 1651
483 Ga0207694_10515190 3300025924 Bacteria 1002
484 Ga0207650_10000239 3300025925 Bacteria 60879
485 Ga0207650_10044437 3300025925 Bacteria 3265
486 Ga0207650_10100131 3300025925 Bacteria 2229
487 Ga0207650_10213466 3300025925 Bacteria 1550
488 Ga0207687_10030810 3300025927 Bacteria 3620
489 Ga0207687_10198559 3300025927 Bacteria 1566
490 Ga0207700_10761438 3300025928 Bacteria 865
491 Ga0207664_10011629 3300025929 Bacteria 6268
492 Ga0207644_10018840 3300025931 Bacteria 4676
493 Ga0207690_10001518 3300025932 Bacteria 14519
494 Ga0207690_10189335 3300025932 Bacteria 1555
495 Ga0207706_10000069 3300025933 Bacteria 105541
496 Ga0207706_10015680 3300025933 Bacteria 6850
497 Ga0207706_10088647 3300025933 Bacteria 2720
498 Ga0207706_10283716 3300025933 Bacteria 1444
499 Ga0207686_10001137 3300025934 Bacteria 15348
500 Ga0207709_10000022 3300025935 Bacteria 383573
501 Ga0207709_10000164 3300025935 Bacteria 91154
502 Ga0207709_10011415 3300025935 Bacteria 4900
503 Ga0207709_10017758 3300025935 Bacteria 3976
504 Ga0207709_10018345 3300025935 Bacteria 3918
505 Ga0207709_10138322 3300025935 Bacteria 1670
506 Ga0207670_10102381 3300025936 Bacteria 2047
507 Ga0207669_10123372 3300025937 Bacteria 1764
508 Ga0207704_10129377 3300025938 Bacteria 1745
509 Ga0207704_10256567 3300025938 Unclassified 1316
510 Ga0207665_10002622 3300025939 Bacteria 12104
511 Ga0207691_10110359 3300025940 Bacteria 2447
512 Ga0207691_10159973 3300025940 Bacteria 1976
513 Ga0207691_10570357 3300025940 Bacteria 959
514 Ga0207661_10107254 3300025944 Bacteria 2356
515 Ga0207679_10000011 3300025945 Bacteria 346112
516 Ga0207679_10010792 3300025945 Bacteria 5890
517 Ga0207679_10014950 3300025945 Bacteria 5114
518 Ga0207667_10000912 3300025949 Bacteria 37632
519 Ga0207667_10001085 3300025949 Bacteria 34518
520 Ga0207667_10007366 3300025949 Bacteria 13242
521 Ga0207667_10011221 3300025949 Bacteria 10426
522 Ga0207667_10141020 3300025949 Bacteria 2481
523 Ga0207667_10153364 3300025949 Bacteria 2370
524 Ga0207651_10116229 3300025960 Bacteria 2019
525 Ga0207712_10020485 3300025961 Bacteria 4330
526 Ga0207712_10090785 3300025961 Bacteria 2248
527 Ga0207668_10594829 3300025972 Bacteria 963
528 Ga0207640_10022476 3300025981 Bacteria 3775
529 Ga0207640_10044348 3300025981 Bacteria 2848
530 Ga0207640_10241346 3300025981 Bacteria 1396
531 Ga0207640_10568425 3300025981 Bacteria 955
532 Ga0207658_10254903 3300025986 Bacteria 1492
533 Ga0207703_10006804 3300026035 Bacteria 9111
534 Ga0207703_10009193 3300026035 Bacteria 7774
535 Ga0207639_10000099 3300026041 Bacteria 71467
536 Ga0207639_10161261 3300026041 Bacteria 1890
537 Ga0207639_10337317 3300026041 Bacteria 1343
538 Ga0207639_10342056 3300026041 Bacteria 1334
539 Ga0207678_10097937 3300026067 Bacteria 2506
540 Ga0207708_10023225 3300026075 Bacteria 4685
541 Ga0207702_10022953 3300026078 Bacteria 5176
542 Ga0207702_10280934 3300026078 Bacteria 1574
543 Ga0207648_10093658 3300026089 Bacteria 2627
544 Ga0207674_10348802 3300026116 Bacteria 1431
545 Ga0207683_10002493 3300026121 Bacteria 16052
546 Ga0207683_10190397 3300026121 Bacteria 1862
547 Ga0207698_10009503 3300026142 Bacteria 6203
548 Ga0207698_10231225 3300026142 Bacteria 1678
549 Ga0207698_10401314 3300026142 Bacteria 1310
550 Ga0209281_1000026 3300027111 Bacteria 465877
551 Ga0209281_1000033 3300027111 Bacteria 383539
552 Ga0209281_1001858 3300027111 Bacteria 10222
553 Ga0209281_1008759 3300027111 Bacteria 2427
554 Ga0209389_1000099 3300027296 Bacteria 79310
555 Ga0209389_1074527 3300027296 Bacteria 1774
556 Ga0209371_1000066 3300027312 Bacteria 212660
557 Ga0209371_1000653 3300027312 Bacteria 30228
558 Ga0209371_1020557 3300027312 Bacteria 1622
559 Ga0209371_1023115 3300027312 Bacteria 1470
560 Ga0209996_1004612 3300027395 Bacteria 1754
561 Ga0209984_1015393 3300027424 Bacteria 1017
562 Ga0210000_1010807 3300027462 Bacteria 1351
563 Ga0209995_1007635 3300027471 Bacteria 1742
564 Ga0209179_1000427 3300027512 Bacteria 4210
565 Ga0209999_1004223 3300027543 Bacteria 2585
566 Ga0209983_1002700 3300027665 Bacteria 3851
567 Ga0209282_1000009 3300027666 Bacteria 233366
568 Ga0209282_1018395 3300027666 Bacteria 4432
569 Ga0209588_1016338 3300027671 Bacteria 2290
570 Ga0209813_10000948 3300027866 Bacteria 6518
571 Ga0209974_10007762 3300027876 Bacteria 3689
572 Ga0207428_10008430 3300027907 Bacteria 9306
573 Ga0207428_10117153 3300027907 Bacteria 2045
574 Ga0268266_10011009 3300028379 Bacteria 7873
575 Ga0268266_10014303 3300028379 Bacteria 6825
576 Ga0268266_10040888 3300028379 Bacteria 3953
577 Ga0268264_10020011 3300028381 Bacteria 5467
578 Ga0268256_1000063 3300030500 Bacteria 212660
579 Ga0268256_1000557 3300030500 Bacteria 30228
580 Ga0268256_1010906 3300030500 Bacteria 2915
581 Ga0268256_1023065 3300030500 Bacteria 1622
582 Ga0316177_1113840 3300030731 Bacteria 2189
583 Ga0316178_1035927 3300030735 Bacteria 1596
584 Ga0316178_1083481 3300030735 Bacteria 46215
585 Ga0316181_1294605 3300030744 Bacteria 1774
586 Ga0316182_1261839 3300030745 Bacteria 2227
587 Ga0265332_10000026 3300031238 Bacteria 193153
588 Ga0265328_10000005 3300031239 Bacteria 230229
589 Ga0265325_10010023 3300031241 Bacteria 5506
590 Ga0265316_10214386 3300031344 Bacteria 1423
591 Ga0307408_100000002 3300031548 Bacteria 827227
592 Ga0307408_100001156 3300031548 Bacteria 20063
593 Ga0307408_100001884 3300031548 Bacteria 15272
594 Ga0307408_100011848 3300031548 Bacteria 5768
595 Ga0307408_100021702 3300031548 Bacteria 4349
596 Ga0307408_100261484 3300031548 Bacteria 1432
597 Ga0307408_100537858 3300031548 Bacteria 1029
598 Ga0265314_10138880 3300031711 Bacteria 1505
599 Ga0316576_10105075 3300031727 Bacteria 2114
600 Ga0316576_10118312 3300031727 Bacteria 1989
601 Ga0307516_10307486 3300031730 Bacteria 1259
602 Ga0307405_10095274 3300031731 Bacteria 1981
603 Ga0316577_10081869 3300031733 Bacteria 1805
604 Ga0307413_10003639 3300031824 Bacteria 6541
605 Ga0307413_10067409 3300031824 Bacteria 2237
606 Ga0307406_10061018 3300031901 Bacteria 2433
607 Ga0307412_10062698 3300031911 Bacteria 2504
608 Ga0307412_10106730 3300031911 Bacteria 1991
609 Ga0307416_100010124 3300032002 Bacteria 6213
610 Ga0307416_100157677 3300032002 Bacteria 2092
611 Ga0307416_100373505 3300032002 Bacteria 1453
612 Ga0307414_10205232 3300032004 Bacteria 1606
613 Ga0307411_10109863 3300032005 Bacteria 1970
614 Ga0307411_10124650 3300032005 Bacteria 1871
615 Ga0316583_10002143 3300032133 Bacteria 6798
616 Ga0316593_10001594 3300032168 Bacteria 5060
617 Ga0307507_10124839 3300033179 Bacteria 2042
618 Ga0316596_1009375 3300033541 Bacteria 2348
619 Ga0373923_0015386 3300035111 Bacteria 2887
620 Ga0373936_0165467 3300035113 Bacteria 965
621 Ga0373954_0177355 3300035118 Bacteria 1045
622 Ga0373957_0144322 3300035120 Bacteria 975
623 Ga0373955_0145301 3300035172 Bacteria 1393
624 Ga0316574_0005596 3300035398 Bacteria 6713
625 Ga0316574_0016538 3300035398 Bacteria 4301
626 Ga0316574_0148045 3300035398 Bacteria 1513
627 Ga0316574_0170392 3300035398 Bacteria 1402
628 Ga0373931_0177872 3300035691 Bacteria 1258
629 Ga0373935_0356469 3300035692 Bacteria 1044
630 Ga0373947_0092428 3300035725 Bacteria 1889
631 Ga0373937_0039003 3300036401 Bacteria 4328
632 Ga0373937_0902321 3300036401 Bacteria 832
633 Ga0316582_0013300 3300036647 Bacteria 4628
634 Ga0316582_0014298 3300036647 Bacteria 4499
635 Ga0316584_0013824 3300036712 Bacteria 5727
636 Ga0316584_0016947 3300036712 Bacteria 5228
637 Ga0316584_0058617 3300036712 Bacteria 2883
638 Ga0316584_0181626 3300036712 Bacteria 1557
639 Ga0316584_0201854 3300036712 Bacteria 1467
640 Ga0395899_0000386 3300037312 Bacteria 52584
641 Ga0395899_0011613 3300037312 Bacteria 6742
642 Ga0395899_0015194 3300037312 Bacteria 5870
643 Ga0395899_0037924 3300037312 Bacteria 3612
644 Ga0395900_0000715 3300037418 Bacteria 44112
645 Ga0395900_0001341 3300037418 Bacteria 29739
646 Ga0395900_0042927 3300037418 Bacteria 4659
647 Ga0395900_0048659 3300037418 Bacteria 4367
648 Ga0395900_0055574 3300037418 Bacteria 4076
649 Ga0395900_0087488 3300037418 Bacteria 3202
650 Ga0395900_0113741 3300037418 Bacteria 2777
651 Ga0395900_0172432 3300037418 Bacteria 2201
652 Ga0395900_0357081 3300037418 Bacteria 1433
653 Ga0395898_0007625 3300037466 Bacteria 11488
654 Ga0395898_0065139 3300037466 Bacteria 3533
655 Ga0395898_0777034 3300037466 Bacteria 898
656 Ga0395905_0000242 3300037471 Bacteria 82835
657 Ga0395905_0081547 3300037471 Bacteria 3031
658 Ga0395905_0276633 3300037471 Bacteria 1565
659 Ga0395905_0461668 3300037471 Bacteria 1168
660 Ga0395905_0463854 3300037471 Bacteria 1165
661 Ga0395905_0624659 3300037471 Bacteria 979
662 Ga0395905_0775665 3300037471 Bacteria 861
663 Ga0316581_0073666 3300037588 Bacteria 1049
664 Ga0395901_0000943 3300038443 Bacteria 31649
665 Ga0395901_0005142 3300038443 Bacteria 13210
666 Ga0395901_0147921 3300038443 Bacteria 2468
667 Ga0395901_0151300 3300038443 Bacteria 2438
668 Ga0395901_0357010 3300038443 Bacteria 1508
669 Ga0395901_0681271 3300038443 Bacteria 1028
670 Ga0400486_14879 3300038742 Bacteria 17024
671 Ga0400483_024557 3300039062 Bacteria 25024
672 Ga0436361_0042090 3300039447 Bacteria 10550
673 Ga0436361_0089100 3300039447 Bacteria 10026
674 Ga0436361_0089479 3300039447 Bacteria 55221
675 Ga0436361_0133183 3300039447 Bacteria 45710
676 Ga0436361_0303014 3300039447 Bacteria 21994
677 Ga0436361_0531483 3300039447 Bacteria 7649
678 Ga0436361_0675827 3300039447 Bacteria 6954
679 Ga0436361_0832413 3300039447 Bacteria 5350
680 Ga0436361_1136783 3300039447 Bacteria 7625
681 Ga0436361_1218785 3300039447 Bacteria 111760
682 Ga0439436_0002075 3300041404 Bacteria 5978
683 Ga0439438_000705 3300041405 Bacteria 14944
684 Ga0439447_003922 3300041407 Bacteria 5212
685 Ga0439447_020765 3300041407 Bacteria 1737
686 Ga0439461_0030251 3300041410 Bacteria 1125
687 Ga0439466_0004826 3300041411 Bacteria 5182
688 Ga0439466_0008959 3300041411 Bacteria 3762
689 Ga0451843_1691138 3300041509 Bacteria 2808
690 Ga0439437_000145 3300042000 Bacteria 5852
691 Ga0439442_032513 3300042002 Bacteria 1090
692 Ga0439448_0000099 3300042005 Bacteria 15433
693 Ga0439432_013934 3300042006 Bacteria 2725
694 Ga0439449_0033446 3300042007 Bacteria 1915
695 Ga0439450_002360 3300042008 Bacteria 2958
696 Ga0439451_007568 3300042009 Bacteria 2210
697 Ga0439451_013029 3300042009 Bacteria 1679
698 Ga0439452_000639 3300042010 Bacteria 17643
699 Ga0439456_000539 3300042013 Bacteria 7977
700 Ga0439463_001585 3300042016 Bacteria 5999
701 Ga0450911_000018 3300042115 Bacteria 104759
702 Ga0450923_009679 3300042125 Bacteria 1692
703 Ga0450904_001458 3300042139 Bacteria 3305
704 Ga0450905_000366 3300042142 Bacteria 5418
705 Ga0450905_003143 3300042142 Bacteria 2160
706 Ga0439446_0000261 3300042156 Bacteria 9812
707 Ga0439446_0003402 3300042156 Bacteria 3946
708 Ga0439434_0002153 3300042435 Bacteria 5707
709 Ga0439464_0004654 3300042439 Bacteria 3516
710 Ga0439460_0004961 3300042461 Bacteria 3251
711 Ga0450901_001568 3300042533 Bacteria 2588
712 Ga0451577_0304333 3300042876 Bacteria 1444
713 Ga0451577_0500264 3300042876 Bacteria 1103
714 Ga0439440_0009344 3300042993 Bacteria 2030
715 Ga0466969_0006033 3300044656 Bacteria 6446
716 Ga0466969_0034753 3300044656 Bacteria 2553
717 Ga0466969_0051856 3300044656 Bacteria 2017
718 Ga0466972_0000359 3300044658 Bacteria 24761
719 Ga0466972_0016650 3300044658 Bacteria 3675
720 Ga0453683_0061956 3300044673 Bacteria 2339
721 Ga0453683_0134717 3300044673 Bacteria 1557
722 Ga0453683_0415733 3300044673 Bacteria 868
723 Ga0466965_0024588 3300044683 Bacteria 2914
724 Ga0466965_0026547 3300044683 Bacteria 2807
725 Ga0466965_0041682 3300044683 Bacteria 2262
726 Ga0466965_0164028 3300044683 Bacteria 1166
727 Ga0466966_0005044 3300044684 Bacteria 8680
728 Ga0466966_0025197 3300044684 Bacteria 3886
729 Ga0466961_0000260 3300044693 Bacteria 35189
730 Ga0466961_0006689 3300044693 Bacteria 7333
731 Ga0466961_0107351 3300044693 Bacteria 1757
732 Ga0466963_0022166 3300044694 Bacteria 4020
733 Ga0466964_0000517 3300044706 Bacteria 12049
734 Ga0466964_0003220 3300044706 Bacteria 5941
735 Ga0466964_0004695 3300044706 Bacteria 5050
736 Ga0466964_0023589 3300044706 Bacteria 2392
737 Ga0453684_0000142 3300044712 Bacteria 316405
738 Ga0453684_0000158 3300044712 Bacteria 302033
739 Ga0453684_0025204 3300044712 Bacteria 8646
740 Ga0453684_0029140 3300044712 Bacteria 7851
741 Ga0453684_0030951 3300044712 Bacteria 7541
742 Ga0453684_0151971 3300044712 Bacteria 2750
743 Ga0453684_0217168 3300044712 Bacteria 2218
744 Ga0466971_0087119 3300044719 Bacteria 1427
745 Ga0466971_0206999 3300044719 Bacteria 927
746 Ga0466968_0000899 3300044735 Bacteria 10470
747 Ga0466968_0005369 3300044735 Bacteria 4797
748 Ga0466968_0050008 3300044735 Bacteria 1782
749 Ga0466970_0061050 3300044765 Bacteria 2019
750 Ga0466957_0002970 3300044842 Bacteria 9204
751 Ga0466957_0206142 3300044842 Bacteria 1293
752 Ga0466957_0232654 3300044842 Bacteria 1220
753 Ga0466959_0006393 3300045049 Bacteria 8158
754 Ga0466959_0016513 3300045049 Bacteria 5395
755 Ga0466959_0020955 3300045049 Bacteria 4819
756 Ga0466959_0086836 3300045049 Bacteria 2250
757 Ga0466959_0125723 3300045049 Bacteria 1820
758 Ga0466959_0181562 3300045049 Bacteria 1471
759 Ga0466959_0315335 3300045049 Bacteria 1069
760 Ga0451576_0006384 3300045051 Bacteria 14478
761 Ga0451576_0063755 3300045051 Bacteria 3840
762 Ga0451576_0067833 3300045051 Bacteria 3713
763 Ga0451576_0085745 3300045051 Bacteria 3276
764 Ga0451576_0198517 3300045051 Bacteria 2095
765 Ga0466958_0066239 3300045836 Bacteria 2205
766 Ga0466967_0017377 3300045976 Bacteria 5709
767 Ga0495617_000027 3300046452 Bacteria 157385
768 Ga0495617_000466 3300046452 Bacteria 21733
769 Ga0495617_001485 3300046452 Bacteria 10254
770 Ga0495617_002660 3300046452 Bacteria 6954
771 Ga0495627_000011 3300046453 Bacteria 354522
772 Ga0495627_000023 3300046453 Bacteria 251113
773 Ga0495627_000277 3300046453 Bacteria 51556
774 Ga0495627_000694 3300046453 Bacteria 25749
775 Ga0495627_002842 3300046453 Bacteria 8004
776 Ga0495627_004813 3300046453 Bacteria 5575
777 Ga0495627_007437 3300046453 Bacteria 4194
778 Ga0495627_008570 3300046453 Bacteria 3820
779 Ga0495627_020864 3300046453 Bacteria 2178
780 Ga0495627_056033 3300046453 Bacteria 1176
781 Ga0495592_0036756 3300046454 Bacteria 3687
782 Ga0495603_0009876 3300046455 Bacteria 5777
783 Ga0495603_0025025 3300046455 Bacteria 3610
784 Ga0495603_0048475 3300046455 Bacteria 2529
785 Ga0495603_0063173 3300046455 Bacteria 2185
786 Ga0495590_0000020 3300046457 Bacteria 212352
787 Ga0495590_0000544 3300046457 Bacteria 18083
788 Ga0495590_0007474 3300046457 Bacteria 4213
789 Ga0495590_0015377 3300046457 Bacteria 2779
790 Ga0495590_0036439 3300046457 Bacteria 1716
791 Ga0495591_000025 3300046458 Bacteria 189897
792 Ga0495591_000616 3300046458 Bacteria 26709
793 Ga0495591_001313 3300046458 Bacteria 15663
794 Ga0495591_005620 3300046458 Bacteria 5751
795 Ga0495591_011566 3300046458 Bacteria 3332
796 Ga0495591_027194 3300046458 Bacteria 1767
797 Ga0495629_0014675 3300046459 Bacteria 5634
798 Ga0495629_0036710 3300046459 Bacteria 3457
799 Ga0495629_0129424 3300046459 Bacteria 1758
800 Ga0495638_0003336 3300046460 Bacteria 12664
801 Ga0495638_0004087 3300046460 Bacteria 11176
802 Ga0495638_0007859 3300046460 Bacteria 7609
803 Ga0495638_0010020 3300046460 Bacteria 6607
804 Ga0495638_0012287 3300046460 Bacteria 5873
805 Ga0495638_0063316 3300046460 Bacteria 2280
806 Ga0495638_0241892 3300046460 Bacteria 999
807 Ga0495638_0318791 3300046460 Bacteria 831
808 Ga0495651_0003918 3300046462 Bacteria 11381
809 Ga0495651_0287656 3300046462 Bacteria 1107
810 Ga0495653_0000313 3300046463 Bacteria 39510
811 Ga0495653_0004554 3300046463 Bacteria 11203
812 Ga0495653_0008977 3300046463 Bacteria 8175
813 Ga0495653_0014418 3300046463 Bacteria 6448
814 Ga0495653_0040360 3300046463 Bacteria 3647
815 Ga0495653_0042162 3300046463 Bacteria 3557
816 Ga0495650_0000251 3300046471 Bacteria 105577
817 Ga0495650_0000431 3300046471 Bacteria 67716
818 Ga0495650_0000582 3300046471 Bacteria 51082
819 Ga0495650_0002001 3300046471 Bacteria 17881
820 Ga0495650_0002200 3300046471 Bacteria 16466
821 Ga0495650_0002310 3300046471 Bacteria 15812
822 Ga0495650_0002792 3300046471 Bacteria 13424
823 Ga0495650_0003052 3300046471 Bacteria 12610
824 Ga0495650_0004232 3300046471 Bacteria 9936
825 Ga0495650_0018979 3300046471 Bacteria 3401
826 Ga0495650_0019731 3300046471 Bacteria 3307
827 Ga0495580_0014963 3300046472 Bacteria 5873
828 Ga0495580_0075326 3300046472 Bacteria 2354
829 Ga0495582_0005379 3300046473 Bacteria 7145
830 Ga0495582_0072833 3300046473 Bacteria 1901
831 Ga0495582_0083844 3300046473 Bacteria 1771
832 Ga0495605_0000061 3300046474 Bacteria 145286
833 Ga0495605_0000095 3300046474 Bacteria 112622
834 Ga0495605_0000135 3300046474 Bacteria 95104
835 Ga0495605_0000210 3300046474 Bacteria 71875
836 Ga0495605_0000287 3300046474 Bacteria 55659
837 Ga0495605_0000815 3300046474 Bacteria 22270
838 Ga0495605_0001165 3300046474 Bacteria 17447
839 Ga0495605_0003898 3300046474 Bacteria 8840
840 Ga0495605_0004070 3300046474 Bacteria 8634
841 Ga0495605_0004819 3300046474 Bacteria 7892
842 Ga0495605_0006784 3300046474 Bacteria 6543
843 Ga0495605_0012293 3300046474 Bacteria 4752
844 Ga0495605_0017922 3300046474 Bacteria 3803
845 Ga0495605_0018104 3300046474 Bacteria 3782
846 Ga0495605_0018632 3300046474 Bacteria 3717
847 Ga0495605_0028357 3300046474 Bacteria 2890
848 Ga0495605_0043047 3300046474 Bacteria 2241
849 Ga0495605_0059235 3300046474 Bacteria 1839
850 Ga0495605_0200745 3300046474 Bacteria 869
851 Ga0495639_0034531 3300046475 Bacteria 2263
852 Ga0495639_0125911 3300046475 Bacteria 1224
853 Ga0495662_0153763 3300046476 Bacteria 1133
854 Ga0495664_0060436 3300046477 Bacteria 2256
855 Ga0495584_0000005 3300046491 Bacteria 306957
856 Ga0495584_0001526 3300046491 Bacteria 13771
857 Ga0495584_0002496 3300046491 Bacteria 10423
858 Ga0495584_0003202 3300046491 Bacteria 9107
859 Ga0495584_0005016 3300046491 Bacteria 7048
860 Ga0495584_0008160 3300046491 Bacteria 5439
861 Ga0495584_0012854 3300046491 Bacteria 4272
862 Ga0495584_0014909 3300046491 Bacteria 3959
863 Ga0495584_0029283 3300046491 Bacteria 2790
864 Ga0495584_0041697 3300046491 Bacteria 2316
865 Ga0495584_0046583 3300046491 Bacteria 2187
866 Ga0495584_0159452 3300046491 Bacteria 1146
867 Ga0495585_0000238 3300046492 Bacteria 57003
868 Ga0495585_0000277 3300046492 Bacteria 51354
869 Ga0495585_0002047 3300046492 Bacteria 14867
870 Ga0495585_0005810 3300046492 Bacteria 7737
871 Ga0495585_0006567 3300046492 Bacteria 7191
872 Ga0495585_0007203 3300046492 Bacteria 6834
873 Ga0495585_0007306 3300046492 Bacteria 6779
874 Ga0495585_0007413 3300046492 Bacteria 6718
875 Ga0495585_0010334 3300046492 Bacteria 5563
876 Ga0495585_0013630 3300046492 Bacteria 4753
877 Ga0495585_0019262 3300046492 Bacteria 3936
878 Ga0495585_0026231 3300046492 Bacteria 3328
879 Ga0495585_0027300 3300046492 Bacteria 3258
880 Ga0495585_0027620 3300046492 Bacteria 3238
881 Ga0495585_0041082 3300046492 Bacteria 2594
882 Ga0495585_0051733 3300046492 Bacteria 2275
883 Ga0495585_0096763 3300046492 Bacteria 1583
884 Ga0495594_0002420 3300046499 Bacteria 9721
885 Ga0495594_0004751 3300046499 Bacteria 7000
886 Ga0495594_0007475 3300046499 Bacteria 5623
887 Ga0495594_0008695 3300046499 Bacteria 5235
888 Ga0495594_0017449 3300046499 Bacteria 3793
889 Ga0495594_0019462 3300046499 Bacteria 3607
890 Ga0495594_0019945 3300046499 Bacteria 3567
891 Ga0495594_0027947 3300046499 Bacteria 3042
892 Ga0495594_0074625 3300046499 Bacteria 1889
893 Ga0495594_0195976 3300046499 Bacteria 1151
894 Ga0495594_0234190 3300046499 Bacteria 1046
895 Ga0495596_0002220 3300046500 Bacteria 10583
896 Ga0495596_0002744 3300046500 Bacteria 9244
897 Ga0495596_0003179 3300046500 Bacteria 8463
898 Ga0495596_0006538 3300046500 Bacteria 5353
899 Ga0495596_0006811 3300046500 Bacteria 5215
900 Ga0495596_0009327 3300046500 Bacteria 4318
901 Ga0495596_0009431 3300046500 Bacteria 4291
902 Ga0495596_0019527 3300046500 Bacteria 2782
903 Ga0495596_0031673 3300046500 Bacteria 2110
904 Ga0495607_0000069 3300046501 Bacteria 101754
905 Ga0495607_0000983 3300046501 Bacteria 26447
906 Ga0495607_0001148 3300046501 Bacteria 23968
907 Ga0495607_0002749 3300046501 Bacteria 14027
908 Ga0495607_0003003 3300046501 Bacteria 13172
909 Ga0495607_0003245 3300046501 Bacteria 12535
910 Ga0495607_0003593 3300046501 Bacteria 11788
911 Ga0495607_0005409 3300046501 Bacteria 9144
912 Ga0495607_0006203 3300046501 Bacteria 8437
913 Ga0495607_0008558 3300046501 Bacteria 6988
914 Ga0495607_0010786 3300046501 Bacteria 6118
915 Ga0495607_0013867 3300046501 Bacteria 5266
916 Ga0495607_0016351 3300046501 Bacteria 4787
917 Ga0495607_0024541 3300046501 Bacteria 3757
918 Ga0495607_0033727 3300046501 Bacteria 3113
919 Ga0495607_0042439 3300046501 Bacteria 2695
920 Ga0495607_0050478 3300046501 Bacteria 2421
921 Ga0495607_0055848 3300046501 Bacteria 2269
922 Ga0495607_0077811 3300046501 Bacteria 1831
923 Ga0495607_0094518 3300046501 Bacteria 1612
924 Ga0495583_0000015 3300046506 Bacteria 316392
925 Ga0495583_0000158 3300046506 Bacteria 113645
926 Ga0495583_0000214 3300046506 Bacteria 97639
927 Ga0495583_0000779 3300046506 Bacteria 39867
928 Ga0495583_0000947 3300046506 Bacteria 33746
929 Ga0495583_0001239 3300046506 Bacteria 27114
930 Ga0495583_0005046 3300046506 Bacteria 9122
931 Ga0495583_0005144 3300046506 Bacteria 9012
932 Ga0495583_0005773 3300046506 Bacteria 8276
933 Ga0495583_0006211 3300046506 Bacteria 7863
934 Ga0495583_0007334 3300046506 Bacteria 6957
935 Ga0495583_0008544 3300046506 Bacteria 6243
936 Ga0495583_0014775 3300046506 Bacteria 4282
937 Ga0495583_0019297 3300046506 Bacteria 3562
938 Ga0495583_0020702 3300046506 Bacteria 3400
939 Ga0495583_0024718 3300046506 Bacteria 3013
940 Ga0495583_0025072 3300046506 Bacteria 2985
941 Ga0495583_0067726 3300046506 Bacteria 1576
942 Ga0495583_0159784 3300046506 Bacteria 930
943 Ga0495606_0000090 3300046507 Bacteria 154737
944 Ga0495606_0000120 3300046507 Bacteria 133907
945 Ga0495606_0000447 3300046507 Bacteria 67335
946 Ga0495606_0001053 3300046507 Bacteria 39877
947 Ga0495606_0001278 3300046507 Bacteria 34873
948 Ga0495606_0003666 3300046507 Bacteria 16088
949 Ga0495606_0004932 3300046507 Bacteria 13057
950 Ga0495606_0006821 3300046507 Bacteria 10426
951 Ga0495606_0006937 3300046507 Bacteria 10301
952 Ga0495606_0007094 3300046507 Bacteria 10133
953 Ga0495606_0008015 3300046507 Bacteria 9282
954 Ga0495606_0009951 3300046507 Bacteria 7954
955 Ga0495606_0015316 3300046507 Bacteria 5915
956 Ga0495606_0016358 3300046507 Bacteria 5662
957 Ga0495606_0016681 3300046507 Bacteria 5586
958 Ga0495606_0017490 3300046507 Bacteria 5417
959 Ga0495606_0038321 3300046507 Bacteria 3244
960 Ga0495606_0173371 3300046507 Bacteria 1249
961 Ga0495606_0182316 3300046507 Bacteria 1209
962 Ga0495608_0004039 3300046511 Bacteria 10532
963 Ga0495608_0016194 3300046511 Bacteria 5158
964 Ga0495610_0000017 3300046512 Bacteria 365675
965 Ga0495610_0015524 3300046512 Bacteria 4420
966 Ga0495610_0025321 3300046512 Bacteria 3185
967 Ga0495616_0001092 3300046513 Bacteria 19273
968 Ga0495616_0001261 3300046513 Bacteria 17787
969 Ga0495616_0001563 3300046513 Bacteria 15771
970 Ga0495616_0005938 3300046513 Bacteria 7445
971 Ga0495616_0009383 3300046513 Bacteria 5731
972 Ga0495616_0010379 3300046513 Bacteria 5394
973 Ga0495616_0015513 3300046513 Bacteria 4236
974 Ga0495616_0018791 3300046513 Bacteria 3785
975 Ga0495616_0019317 3300046513 Bacteria 3719
976 Ga0495616_0043053 3300046513 Bacteria 2295
977 Ga0495616_0050041 3300046513 Bacteria 2091
978 Ga0495616_0184103 3300046513 Bacteria 926
979 Ga0495620_0000042 3300046515 Bacteria 112107
980 Ga0495620_0000146 3300046515 Bacteria 57888
981 Ga0495620_0002809 3300046515 Bacteria 10009
982 Ga0495620_0018263 3300046515 Bacteria 3475
983 Ga0495620_0024957 3300046515 Bacteria 2836
984 Ga0495620_0027170 3300046515 Bacteria 2681
985 Ga0495628_0002401 3300046516 Bacteria 16892
986 Ga0495628_0004370 3300046516 Bacteria 12536
987 Ga0495628_0008265 3300046516 Bacteria 8944
988 Ga0495630_0040193 3300046517 Bacteria 3495
989 Ga0495631_0005014 3300046518 Bacteria 6973
990 Ga0495631_0006359 3300046518 Bacteria 6110
991 Ga0495631_0008278 3300046518 Bacteria 5242
992 Ga0495631_0012371 3300046518 Bacteria 4169
993 Ga0495631_0019676 3300046518 Bacteria 3165
994 Ga0495631_0022032 3300046518 Bacteria 2963
995 Ga0495631_0022053 3300046518 Bacteria 2961
996 Ga0495631_0037637 3300046518 Bacteria 2154
997 Ga0495631_0170180 3300046518 Bacteria 934
998 Ga0495632_0001074 3300046519 Bacteria 23458
999 Ga0495632_0001637 3300046519 Bacteria 18338
1000 Ga0495632_0001728 3300046519 Bacteria 17741
1001 Ga0495632_0002651 3300046519 Bacteria 13436
1002 Ga0495632_0003276 3300046519 Bacteria 11566
1003 Ga0495632_0007442 3300046519 Bacteria 6876
1004 Ga0495632_0028128 3300046519 Bacteria 2936
1005 Ga0495632_0139103 3300046519 Bacteria 1127
1006 Ga0495637_0000515 3300046520 Bacteria 28094
1007 Ga0495637_0001117 3300046520 Bacteria 16430
1008 Ga0495637_0001430 3300046520 Bacteria 14075
1009 Ga0495637_0002408 3300046520 Bacteria 10351
1010 Ga0495637_0005705 3300046520 Bacteria 6313
1011 Ga0495643_0000175 3300046522 Bacteria 102200
1012 Ga0495643_0000455 3300046522 Bacteria 52002
1013 Ga0495643_0000675 3300046522 Bacteria 40184
1014 Ga0495643_0000908 3300046522 Bacteria 31233
1015 Ga0495643_0000930 3300046522 Bacteria 30503
1016 Ga0495643_0001824 3300046522 Bacteria 18120
1017 Ga0495643_0002067 3300046522 Bacteria 16628
1018 Ga0495643_0002344 3300046522 Bacteria 15206
1019 Ga0495643_0009119 3300046522 Bacteria 6208
1020 Ga0495643_0012110 3300046522 Bacteria 5215
1021 Ga0495643_0015824 3300046522 Bacteria 4445
1022 Ga0495643_0022084 3300046522 Bacteria 3637
1023 Ga0495643_0033177 3300046522 Bacteria 2859
1024 Ga0495643_0121836 3300046522 Bacteria 1317
1025 Ga0495644_0002948 3300046523 Bacteria 6762
1026 Ga0495644_0003375 3300046523 Bacteria 6310
1027 Ga0495644_0005497 3300046523 Bacteria 4945
1028 Ga0495644_0006022 3300046523 Bacteria 4723
1029 Ga0495644_0013726 3300046523 Bacteria 3105
1030 Ga0495644_0015700 3300046523 Bacteria 2903
1031 Ga0495644_0017503 3300046523 Bacteria 2739
1032 Ga0495644_0032409 3300046523 Bacteria 1974
1033 Ga0495644_0036566 3300046523 Bacteria 1852
1034 Ga0495644_0042546 3300046523 Bacteria 1710
1035 Ga0495644_0055027 3300046523 Bacteria 1494
1036 Ga0495648_0000168 3300046524 Bacteria 75736
1037 Ga0495648_0000183 3300046524 Bacteria 72118
1038 Ga0495648_0002908 3300046524 Bacteria 15401
1039 Ga0495648_0002984 3300046524 Bacteria 15180
1040 Ga0495648_0004633 3300046524 Bacteria 11682
1041 Ga0495648_0004932 3300046524 Bacteria 11218
1042 Ga0495648_0007325 3300046524 Bacteria 8844
1043 Ga0495648_0011240 3300046524 Bacteria 6759
1044 Ga0495648_0017788 3300046524 Bacteria 5067
1045 Ga0495648_0020900 3300046524 Bacteria 4552
1046 Ga0495648_0024858 3300046524 Bacteria 4067
1047 Ga0495648_0034007 3300046524 Bacteria 3323
1048 Ga0495648_0034012 3300046524 Bacteria 3323
1049 Ga0495648_0041657 3300046524 Bacteria 2897
1050 Ga0495648_0085646 3300046524 Bacteria 1779
1051 Ga0495648_0104119 3300046524 Bacteria 1559
1052 Ga0495663_0001620 3300046525 Bacteria 7036
1053 Ga0495663_0004246 3300046525 Bacteria 4043
1054 Ga0495663_0061576 3300046525 Bacteria 1181
1055 Ga0495663_0096622 3300046525 Bacteria 968
1056 Ga0495666_0015846 3300046526 Bacteria 3754
1057 Ga0495666_0016390 3300046526 Bacteria 3690
1058 Ga0495642_0000587 3300046528 Bacteria 18236
1059 Ga0495642_0000876 3300046528 Bacteria 14202
1060 Ga0495642_0001506 3300046528 Bacteria 10368
1061 Ga0495642_0002007 3300046528 Bacteria 8487
1062 Ga0495642_0003631 3300046528 Bacteria 6056
1063 Ga0495642_0013311 3300046528 Bacteria 3180
1064 Ga0495642_0016497 3300046528 Bacteria 2879
1065 Ga0495642_0026994 3300046528 Bacteria 2283
1066 Ga0495642_0028689 3300046528 Bacteria 2218
1067 Ga0495642_0051203 3300046528 Bacteria 1698
1068 Ga0495652_0007905 3300046529 Bacteria 9763
1069 Ga0495652_0008714 3300046529 Bacteria 9243
1070 Ga0495652_0032735 3300046529 Bacteria 4544
1071 Ga0495652_0035636 3300046529 Bacteria 4330
1072 Ga0495652_0041809 3300046529 Bacteria 3954
1073 Ga0495652_0081403 3300046529 Bacteria 2670
1074 Ga0495654_0000060 3300046530 Bacteria 134307
1075 Ga0495654_0000906 3300046530 Bacteria 22097
1076 Ga0495654_0010226 3300046530 Bacteria 5111
1077 Ga0495654_0013265 3300046530 Bacteria 4413
1078 Ga0495654_0018980 3300046530 Bacteria 3598
1079 Ga0495654_0030579 3300046530 Bacteria 2738
1080 Ga0495654_0154595 3300046530 Bacteria 1012
1081 Ga0495665_0009613 3300046531 Bacteria 5239
1082 Ga0495665_0014977 3300046531 Bacteria 4177
1083 Ga0495665_0021786 3300046531 Bacteria 3446
1084 Ga0495665_0032396 3300046531 Bacteria 2795
1085 Ga0495640_0013804 3300046533 Bacteria 6136
1086 Ga0495586_0001555 3300046535 Bacteria 12666
1087 Ga0495586_0017975 3300046535 Bacteria 3760
1088 Ga0495586_0021446 3300046535 Bacteria 3444
1089 Ga0495586_0079390 3300046535 Bacteria 1801
1090 Ga0495587_0073539 3300046536 Bacteria 1985
1091 Ga0495609_0000007 3300046538 Bacteria 398812
1092 Ga0495609_0000053 3300046538 Bacteria 149126
1093 Ga0495609_0000102 3300046538 Bacteria 100762
1094 Ga0495609_0000133 3300046538 Bacteria 79787
1095 Ga0495609_0001519 3300046538 Bacteria 15282
1096 Ga0495609_0002547 3300046538 Bacteria 11152
1097 Ga0495609_0002784 3300046538 Bacteria 10519
1098 Ga0495609_0003217 3300046538 Bacteria 9474
1099 Ga0495609_0007980 3300046538 Bacteria 5228
1100 Ga0495609_0010452 3300046538 Bacteria 4448
1101 Ga0495609_0012437 3300046538 Bacteria 4037
1102 Ga0495609_0027527 3300046538 Bacteria 2597
1103 Ga0495609_0032381 3300046538 Bacteria 2374
1104 Ga0495609_0059039 3300046538 Bacteria 1696
1105 Ga0495609_0070427 3300046538 Bacteria 1537
1106 Ga0495609_0075686 3300046538 Bacteria 1475
1107 Ga0495597_0000068 3300046542 Bacteria 90143
1108 Ga0495597_0000907 3300046542 Bacteria 22980
1109 Ga0495597_0002989 3300046542 Bacteria 10218
1110 Ga0495597_0003023 3300046542 Bacteria 10143
1111 Ga0495597_0003385 3300046542 Bacteria 9346
1112 Ga0495597_0005581 3300046542 Bacteria 6640
1113 Ga0495597_0005707 3300046542 Bacteria 6544
1114 Ga0495597_0006706 3300046542 Bacteria 5927
1115 Ga0495597_0008370 3300046542 Bacteria 5185
1116 Ga0495597_0009251 3300046542 Bacteria 4879
1117 Ga0495597_0010738 3300046542 Bacteria 4463
1118 Ga0495597_0042028 3300046542 Bacteria 2039
1119 Ga0495597_0043540 3300046542 Bacteria 1999
1120 Ga0495597_0050403 3300046542 Bacteria 1838
1121 Ga0495645_0074549 3300046543 Bacteria 2443
1122 Ga0495645_0111173 3300046543 Bacteria 1938
1123 Ga0495622_0002486 3300046557 Bacteria 8917
1124 Ga0495622_0002494 3300046557 Bacteria 8898
1125 Ga0495622_0017175 3300046557 Bacteria 3369
1126 Ga0495622_0109043 3300046557 Bacteria 1267
1127 Ga0495622_0159298 3300046557 Bacteria 1018
1128 Ga0495633_0000115 3300046558 Bacteria 108676
1129 Ga0495633_0002814 3300046558 Bacteria 12035
1130 Ga0495633_0002851 3300046558 Bacteria 11880
1131 Ga0495633_0004074 3300046558 Bacteria 9437
1132 Ga0495633_0006023 3300046558 Bacteria 7278
1133 Ga0495633_0006720 3300046558 Bacteria 6769
1134 Ga0495633_0007463 3300046558 Bacteria 6289
1135 Ga0495633_0008007 3300046558 Bacteria 6019
1136 Ga0495633_0008646 3300046558 Bacteria 5716
1137 Ga0495633_0014098 3300046558 Bacteria 4190
1138 Ga0495633_0026789 3300046558 Bacteria 2824
1139 Ga0495633_0046632 3300046558 Bacteria 2049
1140 Ga0495633_0062757 3300046558 Bacteria 1739
1141 Ga0495633_0077343 3300046558 Bacteria 1549
1142 Ga0495667_0056292 3300046559 Bacteria 2586
1143 Ga0495656_0001760 3300046615 Bacteria 7105
1144 Ga0495656_0017319 3300046615 Bacteria 2748
1145 Ga0495656_0021883 3300046615 Bacteria 2495
1146 Ga0495656_0047268 3300046615 Bacteria 1824
1147 Ga0495656_0307701 3300046615 Bacteria 813
1148 Ga0495668_0000343 3300046616 Bacteria 61962
1149 Ga0495668_0001087 3300046616 Bacteria 28336
1150 Ga0495668_0001732 3300046616 Bacteria 20089
1151 Ga0495668_0003183 3300046616 Bacteria 12580
1152 Ga0495668_0003908 3300046616 Bacteria 10886
1153 Ga0495668_0004561 3300046616 Bacteria 9753
1154 Ga0495668_0005358 3300046616 Bacteria 8748
1155 Ga0495668_0005407 3300046616 Bacteria 8679
1156 Ga0495668_0009136 3300046616 Bacteria 6108
1157 Ga0495668_0017136 3300046616 Bacteria 4207
1158 Ga0495668_0032297 3300046616 Bacteria 2946
1159 Ga0495668_0037723 3300046616 Bacteria 2703
1160 Ga0495668_0049740 3300046616 Bacteria 2324
1161 Ga0495668_0054847 3300046616 Bacteria 2201
1162 Ga0495668_0086461 3300046616 Bacteria 1719
1163 Ga0495668_0100225 3300046616 Bacteria 1584
1164 Ga0495634_0009917 3300046642 Bacteria 7000
1165 Ga0495611_0001456 3300046648 Bacteria 11774
1166 Ga0495611_0001664 3300046648 Bacteria 10772
1167 Ga0495611_0013168 3300046648 Bacteria 3518
1168 Ga0495611_0016564 3300046648 Bacteria 3151
1169 Ga0495611_0022060 3300046648 Bacteria 2753
1170 Ga0495611_0045159 3300046648 Bacteria 1972
1171 Ga0495625_0000086 3300046660 Bacteria 151735
1172 Ga0495625_0003347 3300046660 Bacteria 16136
1173 Ga0495625_0006637 3300046660 Bacteria 10271
1174 Ga0495625_0007014 3300046660 Bacteria 9921
1175 Ga0495625_0007415 3300046660 Bacteria 9551
1176 Ga0495625_0007684 3300046660 Bacteria 9335
1177 Ga0495625_0013314 3300046660 Bacteria 6614
1178 Ga0495625_0015335 3300046660 Bacteria 6072
1179 Ga0495625_0035107 3300046660 Bacteria 3697
1180 Ga0495625_0047992 3300046660 Bacteria 3076
1181 Ga0495625_0092102 3300046660 Bacteria 2095
1182 Ga0495625_0388953 3300046660 Bacteria 873
1183 Ga0495635_0031660 3300046663 Bacteria 3670
1184 Ga0495635_0053923 3300046663 Bacteria 2769
1185 Ga0495659_0001316 3300046664 Bacteria 8531
1186 Ga0495659_0004057 3300046664 Bacteria 4632
1187 Ga0495659_0011058 3300046664 Bacteria 2906
1188 Ga0495659_0012089 3300046664 Bacteria 2790
1189 Ga0495659_0049601 3300046664 Bacteria 1525
1190 Ga0495659_0137873 3300046664 Bacteria 972
1191 Ga0495661_0000058 3300046665 Bacteria 133316
1192 Ga0495661_0000212 3300046665 Bacteria 67078
1193 Ga0495661_0000346 3300046665 Bacteria 50529
1194 Ga0495661_0000788 3300046665 Bacteria 30104
1195 Ga0495661_0001039 3300046665 Bacteria 24633
1196 Ga0495661_0004283 3300046665 Bacteria 10356
1197 Ga0495661_0005323 3300046665 Bacteria 9153
1198 Ga0495661_0007508 3300046665 Bacteria 7599
1199 Ga0495661_0008231 3300046665 Bacteria 7223
1200 Ga0495661_0010573 3300046665 Bacteria 6293
1201 Ga0495661_0026189 3300046665 Bacteria 3758
1202 Ga0495661_0027932 3300046665 Bacteria 3618
1203 Ga0495661_0030098 3300046665 Bacteria 3459
1204 Ga0495661_0033613 3300046665 Bacteria 3233
1205 Ga0495661_0034461 3300046665 Bacteria 3185
1206 Ga0495661_0037884 3300046665 Bacteria 3007
1207 Ga0495661_0057480 3300046665 Bacteria 2322
1208 Ga0495661_0065346 3300046665 Bacteria 2144
1209 Ga0495661_0081724 3300046665 Bacteria 1861
1210 Ga0495661_0085830 3300046665 Bacteria 1803
1211 Ga0495588_0000147 3300046674 Bacteria 100948
1212 Ga0495588_0011107 3300046674 Bacteria 4216
1213 Ga0495588_0014594 3300046674 Bacteria 3762
1214 Ga0495588_0017622 3300046674 Bacteria 3473
1215 Ga0495588_0022311 3300046674 Bacteria 3128
1216 Ga0495588_0033805 3300046674 Bacteria 2584
1217 Ga0495588_0043042 3300046674 Bacteria 2310
1218 Ga0495588_0058718 3300046674 Bacteria 1988
1219 Ga0495588_0060865 3300046674 Bacteria 1954
1220 Ga0495588_0064041 3300046674 Bacteria 1907
1221 Ga0495588_0089576 3300046674 Bacteria 1611
1222 Ga0495588_0106232 3300046674 Bacteria 1477
1223 Ga0495588_0151507 3300046674 Bacteria 1225
1224 Ga0495588_0221072 3300046674 Bacteria 1000
1225 Ga0495599_0005211 3300046678 Bacteria 7754
1226 Ga0495623_0014300 3300046679 Bacteria 5140
1227 Ga0495646_0008367 3300046680 Bacteria 6577
1228 Ga0495646_0023778 3300046680 Bacteria 3857
1229 Ga0495669_0000073 3300046684 Bacteria 66387
1230 Ga0495669_0002254 3300046684 Bacteria 7906
1231 Ga0495669_0007961 3300046684 Bacteria 4446
1232 Ga0495669_0013268 3300046684 Bacteria 3509
1233 Ga0495669_0013494 3300046684 Bacteria 3482
1234 Ga0495613_0045730 3300046689 Bacteria 3237
1235 Ga0495624_0011275 3300046690 Bacteria 6145
1236 Ga0495624_0022700 3300046690 Bacteria 4143
1237 Ga0495624_0042991 3300046690 Bacteria 2884
1238 Ga0495670_0001254 3300046691 Bacteria 12410
1239 Ga0495670_0004528 3300046691 Bacteria 6812
1240 Ga0495670_0005953 3300046691 Bacteria 5969
1241 Ga0495670_0009328 3300046691 Bacteria 4829
1242 Ga0495670_0010129 3300046691 Bacteria 4638
1243 Ga0495670_0038805 3300046691 Bacteria 2375
1244 Ga0495670_0049309 3300046691 Bacteria 2106
1245 Ga0495670_0053103 3300046691 Bacteria 2029
1246 Ga0495670_0102139 3300046691 Bacteria 1477
1247 Ga0495670_0212428 3300046691 Bacteria 1026
1248 Ga0495670_0308568 3300046691 Bacteria 849
1249 Ga0495671_0000026 3300046692 Bacteria 237110
1250 Ga0495671_0001460 3300046692 Bacteria 15858
1251 Ga0495671_0001961 3300046692 Bacteria 13207
1252 Ga0495671_0005885 3300046692 Bacteria 7136
1253 Ga0495671_0006589 3300046692 Bacteria 6697
1254 Ga0495671_0007537 3300046692 Bacteria 6195
1255 Ga0495671_0009894 3300046692 Bacteria 5305
1256 Ga0495671_0010452 3300046692 Bacteria 5141
1257 Ga0495671_0022149 3300046692 Bacteria 3331
1258 Ga0495671_0024992 3300046692 Bacteria 3107
1259 Ga0495671_0033940 3300046692 Bacteria 2597
1260 Ga0495671_0038113 3300046692 Bacteria 2430
1261 Ga0495671_0146567 3300046692 Bacteria 1149
1262 Ga0495649_0000186 3300046694 Bacteria 54356
1263 Ga0495649_0000839 3300046694 Bacteria 24685
1264 Ga0495649_0001335 3300046694 Bacteria 18749
1265 Ga0495649_0004497 3300046694 Bacteria 9101
1266 Ga0495649_0018456 3300046694 Bacteria 3925
1267 Ga0495649_0019957 3300046694 Bacteria 3761
1268 Ga0495649_0031678 3300046694 Bacteria 2914
1269 Ga0495649_0034553 3300046694 Bacteria 2781
1270 Ga0495649_0061289 3300046694 Bacteria 2022
1271 Ga0495649_0067756 3300046694 Bacteria 1915
1272 Ga0495649_0079750 3300046694 Bacteria 1750
1273 Ga0495589_0000744 3300046794 Bacteria 20973
1274 Ga0495589_0002015 3300046794 Bacteria 11503
1275 Ga0495589_0002358 3300046794 Bacteria 10595
1276 Ga0495589_0011232 3300046794 Bacteria 4649
1277 Ga0495589_0020733 3300046794 Bacteria 3360
1278 Ga0495589_0030555 3300046794 Bacteria 2712
1279 Ga0495589_0038733 3300046794 Bacteria 2384
1280 Ga0495589_0055292 3300046794 Bacteria 1956
1281 Ga0495589_0061523 3300046794 Bacteria 1842
1282 Ga0495589_0083801 3300046794 Bacteria 1549
1283 Ga0495600_0000574 3300046809 Bacteria 19018
1284 Ga0495600_0022926 3300046809 Bacteria 4013
1285 Ga0495600_0025351 3300046809 Bacteria 3822
1286 Ga0495600_0032124 3300046809 Bacteria 3404
1287 Ga0495600_0211469 3300046809 Bacteria 1243
1288 Ga0495660_0000101 3300046810 Bacteria 91466
1289 Ga0495660_0001103 3300046810 Bacteria 19288
1290 Ga0495660_0002130 3300046810 Bacteria 12786
1291 Ga0495660_0005483 3300046810 Bacteria 7599
1292 Ga0495660_0009610 3300046810 Bacteria 5637
1293 Ga0495660_0010073 3300046810 Bacteria 5498
1294 Ga0495660_0025181 3300046810 Bacteria 3381
1295 Ga0495660_0029272 3300046810 Bacteria 3108
1296 Ga0495660_0031405 3300046810 Bacteria 2985
1297 Ga0495660_0046547 3300046810 Bacteria 2378
1298 Ga0495660_0047713 3300046810 Bacteria 2344
1299 Ga0495660_0068129 3300046810 Bacteria 1894
1300 Ga0495660_0088565 3300046810 Bacteria 1612
1301 Ga0495660_0088690 3300046810 Bacteria 1611
1302 Ga0495660_0097211 3300046810 Bacteria 1520
1303 Ga0495581_0010383 3300047315 Bacteria 5387
1304 Ga0495581_0038882 3300047315 Bacteria 2754
1305 Ga0495604_0006351 3300047317 Bacteria 9372
1306 Ga0495604_0104107 3300047317 Bacteria 2080
1307 Ga0495604_0111832 3300047317 Bacteria 1990
1308 Ga0495636_0001420 3300047318 Bacteria 9056
1309 Ga0495636_0002442 3300047318 Bacteria 7127
1310 Ga0495636_0004292 3300047318 Bacteria 5594
1311 Ga0495636_0006432 3300047318 Bacteria 4616
1312 Ga0495636_0012427 3300047318 Bacteria 3371
1313 Ga0495674_0001181 3300047319 Bacteria 25219
1314 Ga0495674_0090508 3300047319 Bacteria 2614
1315 Ga0495674_0104664 3300047319 Bacteria 2406
1316 Ga0495672_0000340 3300047320 Bacteria 59814
1317 Ga0495672_0000348 3300047320 Bacteria 59143
1318 Ga0495672_0001839 3300047320 Bacteria 20263
1319 Ga0495672_0003352 3300047320 Bacteria 13800
1320 Ga0495672_0003446 3300047320 Bacteria 13529
1321 Ga0495672_0004309 3300047320 Bacteria 11720
1322 Ga0495672_0007196 3300047320 Bacteria 8407
1323 Ga0495672_0029277 3300047320 Bacteria 3471
1324 Ga0495672_0042744 3300047320 Bacteria 2730
1325 Ga0495672_0051068 3300047320 Bacteria 2437
1326 Ga0495676_0000022 3300047321 Bacteria 163719
1327 Ga0495676_0000221 3300047321 Bacteria 45708
1328 Ga0495676_0024269 3300047321 Bacteria 5254
1329 Ga0495676_0029806 3300047321 Bacteria 4640
1330 Ga0495676_0044680 3300047321 Bacteria 3613
1331 Ga0495676_0217029 3300047321 Bacteria 1320
1332 Ga0495676_0219987 3300047321 Bacteria 1309
1333 Ga0495680_0011792 3300047322 Bacteria 7720
1334 Ga0495680_0048458 3300047322 Bacteria 3336
1335 Ga0495680_0209144 3300047322 Bacteria 1397
1336 Ga0495683_0000030 3300047323 Bacteria 150551
1337 Ga0495683_0000044 3300047323 Bacteria 133747
1338 Ga0495683_0001121 3300047323 Bacteria 18461
1339 Ga0495683_0001282 3300047323 Bacteria 17017
1340 Ga0495683_0003427 3300047323 Bacteria 9251
1341 Ga0495683_0019747 3300047323 Bacteria 3476
1342 Ga0495683_0025662 3300047323 Bacteria 3019
1343 Ga0495683_0037847 3300047323 Bacteria 2443
1344 Ga0495683_0107345 3300047323 Bacteria 1336
1345 Ga0495683_0118344 3300047323 Bacteria 1259
1346 Ga0495687_000011 3300047443 Bacteria 397225
1347 Ga0495687_000030 3300047443 Bacteria 279992
1348 Ga0495687_000120 3300047443 Bacteria 120987
1349 Ga0495687_000374 3300047443 Bacteria 55800
1350 Ga0495687_000814 3300047443 Bacteria 33460
1351 Ga0495687_002263 3300047443 Bacteria 15785
1352 Ga0495687_005069 3300047443 Bacteria 8551
1353 Ga0495687_005087 3300047443 Bacteria 8535
1354 Ga0495687_005249 3300047443 Bacteria 8325
1355 Ga0495687_006481 3300047443 Bacteria 7160
1356 Ga0495687_006723 3300047443 Bacteria 6970
1357 Ga0495687_018413 3300047443 Bacteria 3452
1358 Ga0495675_0007931 3300047444 Bacteria 6562
1359 Ga0495675_0014225 3300047444 Bacteria 5030
1360 Ga0495677_0000045 3300047445 Bacteria 73995
1361 Ga0495677_0001255 3300047445 Bacteria 10158
1362 Ga0495677_0001897 3300047445 Bacteria 8351
1363 Ga0495677_0002978 3300047445 Bacteria 6589
1364 Ga0495677_0003654 3300047445 Bacteria 5954
1365 Ga0495677_0003854 3300047445 Bacteria 5798
1366 Ga0495677_0005291 3300047445 Bacteria 4899
1367 Ga0495677_0030911 3300047445 Bacteria 1949
1368 Ga0495677_0033917 3300047445 Bacteria 1861
1369 Ga0495677_0036059 3300047445 Bacteria 1805
1370 Ga0495677_0046008 3300047445 Bacteria 1601
1371 Ga0495677_0053556 3300047445 Bacteria 1488
1372 Ga0495679_000212 3300047446 Bacteria 49948
1373 Ga0495679_000736 3300047446 Bacteria 21003
1374 Ga0495679_002165 3300047446 Bacteria 10314
1375 Ga0495679_003747 3300047446 Bacteria 7231
1376 Ga0495679_013607 3300047446 Bacteria 3045
1377 Ga0495679_020712 3300047446 Bacteria 2285
1378 Ga0495685_000505 3300047447 Bacteria 12081
1379 Ga0495685_001117 3300047447 Bacteria 8204
1380 Ga0495685_044866 3300047447 Bacteria 1507
1381 Ga0495673_0000179 3300047469 Bacteria 102128
1382 Ga0495673_0000201 3300047469 Bacteria 92885
1383 Ga0495673_0000391 3300047469 Bacteria 51513
1384 Ga0495673_0004747 3300047469 Bacteria 8420
1385 Ga0495673_0010934 3300047469 Bacteria 4909
1386 Ga0495673_0022072 3300047469 Bacteria 3126
1387 Ga0495673_0028308 3300047469 Bacteria 2655
1388 Ga0495673_0033851 3300047469 Bacteria 2366
1389 Ga0495681_0002281 3300047470 Bacteria 13792
1390 Ga0495681_0004090 3300047470 Bacteria 10030
1391 Ga0495681_0005170 3300047470 Bacteria 8780
1392 Ga0495681_0005907 3300047470 Bacteria 8121
1393 Ga0495681_0005937 3300047470 Bacteria 8100
1394 Ga0495681_0017127 3300047470 Bacteria 4036
1395 Ga0495681_0020045 3300047470 Bacteria 3636
1396 Ga0495681_0027137 3300047470 Bacteria 2968
1397 Ga0495681_0032542 3300047470 Bacteria 2624
1398 Ga0495681_0035175 3300047470 Bacteria 2489
1399 Ga0495681_0036810 3300047470 Bacteria 2417
1400 Ga0495681_0051141 3300047470 Bacteria 1944
1401 Ga0495681_0055757 3300047470 Bacteria 1841
1402 Ga0495681_0112950 3300047470 Bacteria 1174
1403 Ga0495681_0114113 3300047470 Bacteria 1166
1404 Ga0495686_0000793 3300047472 Bacteria 41237
1405 Ga0495686_0001487 3300047472 Bacteria 25415
1406 Ga0495686_0002313 3300047472 Bacteria 18221
1407 Ga0495686_0007032 3300047472 Bacteria 8497
1408 Ga0495686_0012729 3300047472 Bacteria 5871
1409 Ga0495686_0016478 3300047472 Bacteria 5011
1410 Ga0495686_0021328 3300047472 Bacteria 4304
1411 Ga0495686_0058084 3300047472 Bacteria 2412
1412 Ga0495686_0077016 3300047472 Bacteria 2042
1413 Ga0495686_0099123 3300047472 Bacteria 1759
1414 Ga0495593_0011040 3300047673 Bacteria 5199
1415 Ga0495593_0025631 3300047673 Bacteria 3263
1416 Ga0495593_0025956 3300047673 Bacteria 3239
1417 Ga0495602_0003238 3300048088 Bacteria 16812
1418 Ga0495602_0024518 3300048088 Bacteria 5852
1419 Ga0495602_0087339 3300048088 Bacteria 2599
1420 Ga0495602_0170950 3300048088 Bacteria 1687
1421 Ga0495614_0034086 3300048089 Bacteria 2189
1422 Ga0495626_0000022 3300048091 Bacteria 216166
1423 Ga0495626_0000039 3300048091 Bacteria 175454
1424 Ga0495626_0000105 3300048091 Bacteria 109725
1425 Ga0495626_0001496 3300048091 Bacteria 18442
1426 Ga0495626_0001817 3300048091 Bacteria 16083
1427 Ga0495626_0002464 3300048091 Bacteria 12814
1428 Ga0495626_0004240 3300048091 Bacteria 8859
1429 Ga0495626_0009776 3300048091 Bacteria 5163
1430 Ga0495626_0011488 3300048091 Bacteria 4682
1431 Ga0495626_0025600 3300048091 Bacteria 2884
1432 Ga0495626_0027200 3300048091 Bacteria 2782
1433 Ga0495626_0035334 3300048091 Bacteria 2385
1434 Ga0495626_0046884 3300048091 Bacteria 2010
1435 Ga0495626_0047022 3300048091 Bacteria 2007
1436 Ga0495626_0048178 3300048091 Bacteria 1978
1437 Ga0495626_0049362 3300048091 Bacteria 1948
1438 Ga0495626_0074510 3300048091 Bacteria 1518
1439 Ga0496100_0026304 3300048903 Bacteria 3567
1440 Ga0496100_0071368 3300048903 Bacteria 2318
1441 Ga0496100_0152475 3300048903 Bacteria 1650
1442 Ga0496101_0012306 3300048904 Bacteria 5706
1443 Ga0496102_0000836 3300048905 Bacteria 29566
1444 Ga0496102_0001960 3300048905 Bacteria 17748
1445 Ga0496102_0116493 3300048905 Bacteria 2493
1446 Ga0496102_0159383 3300048905 Bacteria 2122
1447 Ga0496102_0249210 3300048905 Bacteria 1674
1448 Ga0496103_0035508 3300048906 Bacteria 3052
1449 Ga0496103_0056784 3300048906 Bacteria 2430
1450 Ga0496103_0066831 3300048906 Bacteria 2244
1451 Ga0496103_0405502 3300048906 Bacteria 876
1452 Ga0496104_0706501 3300048907 Bacteria 916
1453 Ga0496105_0122864 3300048908 Bacteria 2141
1454 Ga0496106_0007806 3300048909 Bacteria 7915
1455 Ga0496106_0030116 3300048909 Bacteria 4046
1456 Ga0496106_0142191 3300048909 Bacteria 1888
1457 Ga0496107_0037389 3300048910 Bacteria 3483
1458 Ga0496107_0075472 3300048910 Bacteria 2454
1459 Ga0496107_0125500 3300048910 Bacteria 1893
1460 Ga0496107_0329708 3300048910 Bacteria 1136
1461 Ga0496107_0531092 3300048910 Bacteria 872
1462 Ga0496108_0337275 3300048911 Bacteria 1315
1463 Ga0496109_0019163 3300048912 Bacteria 6027
1464 Ga0496109_0024376 3300048912 Bacteria 5378
1465 Ga0496109_0180887 3300048912 Bacteria 1980
1466 Ga0496110_0003614 3300048913 Bacteria 11901
1467 Ga0496110_0054436 3300048913 Bacteria 3519
1468 Ga0496110_0068198 3300048913 Bacteria 3148
1469 Ga0496110_0106607 3300048913 Bacteria 2515
1470 Ga0496110_0183492 3300048913 Bacteria 1900
1471 Ga0496110_0366094 3300048913 Bacteria 1313
1472 Ga0496111_0035112 3300048914 Bacteria 3582
1473 Ga0496113_0007466 3300048916 Bacteria 7039
1474 Ga0496113_0075979 3300048916 Bacteria 2565
1475 Ga0496114_0096118 3300048917 Bacteria 2522
1476 Ga0496114_0102792 3300048917 Bacteria 2441
1477 Ga0496114_0569376 3300048917 Bacteria 1000
1478 Ga0496115_0031619 3300048918 Bacteria 4170
1479 Ga0496116_0000008 3300048919 Bacteria 726753
1480 Ga0496116_0000667 3300048919 Bacteria 44735
1481 Ga0496116_0057003 3300048919 Bacteria 2557
1482 Ga0496116_0161931 3300048919 Bacteria 1226
1483 Ga0496117_0000005 3300048920 Bacteria 777468
1484 Ga0496117_0000385 3300048920 Bacteria 75873
1485 Ga0496117_0003287 3300048920 Bacteria 18948
1486 Ga0496117_0006460 3300048920 Bacteria 11854
1487 Ga0496118_0000031 3300048921 Bacteria 339329
1488 Ga0496118_0002475 3300048921 Bacteria 24791
1489 Ga0496118_0003109 3300048921 Bacteria 21275
1490 Ga0496118_0119068 3300048921 Bacteria 1727
1491 Ga0496119_0000060 3300048922 Bacteria 172646
1492 Ga0496120_0003085 3300048923 Bacteria 15703
1493 Ga0496121_0000012 3300048924 Bacteria 653131
1494 Ga0496121_0004115 3300048924 Bacteria 19938
1495 Ga0496121_0006040 3300048924 Bacteria 15254
1496 Ga0496121_0011729 3300048924 Bacteria 9671
1497 Ga0496121_0014995 3300048924 Bacteria 8159
1498 Ga0496121_0023622 3300048924 Bacteria 5912
1499 Ga0496121_0027645 3300048924 Bacteria 5303
1500 Ga0496121_0048724 3300048924 Bacteria 3602
1501 Ga0496121_0064564 3300048924 Bacteria 2984
1502 Ga0496122_0001366 3300048925 Bacteria 39678
1503 Ga0496122_0002458 3300048925 Bacteria 26220
1504 Ga0496122_0003525 3300048925 Bacteria 20479
1505 Ga0496122_0004630 3300048925 Bacteria 16923
1506 Ga0496122_0010326 3300048925 Bacteria 9656
1507 Ga0496122_0011135 3300048925 Bacteria 9161
1508 Ga0496122_0030996 3300048925 Bacteria 4463
1509 Ga0496123_0000717 3300048926 Bacteria 54100
1510 Ga0496123_0001033 3300048926 Bacteria 42272
1511 Ga0496123_0003683 3300048926 Bacteria 16896
1512 Ga0496123_0006523 3300048926 Bacteria 11271
1513 Ga0496123_0013096 3300048926 Bacteria 6997
1514 Ga0496123_0014932 3300048926 Bacteria 6402
1515 Ga0496123_0016214 3300048926 Bacteria 6064
1516 Ga0496124_0000007 3300048927 Bacteria 883534
1517 Ga0496124_0000120 3300048927 Bacteria 163899
1518 Ga0496124_0003062 3300048927 Bacteria 20837
1519 Ga0496124_0003568 3300048927 Bacteria 18917
1520 Ga0496124_0004471 3300048927 Bacteria 16316
1521 Ga0496124_0007303 3300048927 Bacteria 11787
1522 Ga0496124_0010350 3300048927 Bacteria 9456
1523 Ga0496124_0010787 3300048927 Bacteria 9208
1524 Ga0496124_0012015 3300048927 Bacteria 8608
1525 Ga0496124_0050716 3300048927 Bacteria 3534
1526 Ga0496124_0073013 3300048927 Bacteria 2840
1527 Ga0496124_0140991 3300048927 Bacteria 1902
1528 Ga0496124_0148322 3300048927 Bacteria 1843
1529 Ga0496124_0186639 3300048927 Bacteria 1591
1530 Ga0496124_0272975 3300048927 Bacteria 1237
1531 Ga0496124_0309621 3300048927 Bacteria 1136
1532 Ga0496125_0001735 3300048928 Bacteria 30307
1533 Ga0496125_0005087 3300048928 Bacteria 14812
1534 Ga0496125_0007226 3300048928 Bacteria 11838
1535 Ga0496125_0008517 3300048928 Bacteria 10719
1536 Ga0496125_0009631 3300048928 Bacteria 9878
1537 Ga0496125_0019456 3300048928 Bacteria 6402
1538 Ga0496125_0038131 3300048928 Bacteria 4165
1539 Ga0496126_0012840 3300048929 Bacteria 8560
1540 Ga0496126_0031712 3300048929 Bacteria 4987
1541 Ga0496126_0225901 3300048929 Bacteria 1570
1542 Ga0501308_001808 3300049128 Bacteria 1788
1543 Ga0495678_000010 3300049459 Bacteria 357896
1544 Ga0495678_000017 3300049459 Bacteria 282592
1545 Ga0495678_000190 3300049459 Bacteria 71878
1546 Ga0495678_000774 3300049459 Bacteria 28808
1547 Ga0495678_001665 3300049459 Bacteria 16901
1548 Ga0495678_001755 3300049459 Bacteria 16084
1549 Ga0495678_002527 3300049459 Bacteria 12310
1550 Ga0495678_006438 3300049459 Bacteria 6248
1551 Ga0495678_007129 3300049459 Bacteria 5840
1552 Ga0495678_010503 3300049459 Bacteria 4498
1553 Ga0495678_019199 3300049459 Bacteria 3055
1554 Ga0495678_035133 3300049459 Bacteria 2057
1555 Ga0495678_071648 3300049459 Bacteria 1268
1556 Ga0495682_0000264 3300049460 Bacteria 41397
1557 Ga0495682_0000527 3300049460 Bacteria 26345
1558 Ga0495682_0001034 3300049460 Bacteria 16403
1559 Ga0495682_0005671 3300049460 Bacteria 5157
1560 Ga0495682_0024552 3300049460 Bacteria 2246
1561 Ga0495682_0045630 3300049460 Bacteria 1600
1562 Ga0501290_001453 3300049513 Bacteria 3238
1563 Ga0501031_0020689 3300049568 Bacteria 4289
1564 Ga0501032_0025216 3300049569 Bacteria 4100
1565 Ga0501033_0008191 3300049570 Bacteria 8096
1566 Ga0501034_0000576 3300049571 Bacteria 58021
1567 Ga0501034_0083131 3300049571 Bacteria 3203
1568 Ga0501034_0154875 3300049571 Bacteria 2266
1569 Ga0501034_0170472 3300049571 Bacteria 2144
1570 Ga0501036_0000484 3300049572 Bacteria 28401
1571 Ga0501036_0173451 3300049572 Bacteria 1816
1572 Ga0501037_0001076 3300049573 Bacteria 20246
1573 Ga0501037_0315923 3300049573 Bacteria 1082
1574 Ga0501038_0009984 3300049574 Bacteria 8692
1575 Ga0501038_0013559 3300049574 Bacteria 7427
1576 Ga0501038_0017565 3300049574 Bacteria 6467
1577 Ga0501038_0050136 3300049574 Bacteria 3608
1578 Ga0501039_0026382 3300049575 Bacteria 4464
1579 Ga0501043_0210509 3300049579 Bacteria 1507
1580 Ga0501047_0020371 3300049581 Bacteria 6370
1581 Ga0501047_0067479 3300049581 Bacteria 3447
1582 Ga0501068_0007074 3300049584 Bacteria 6215
1583 Ga0501072_0401611 3300049588 Bacteria 1087
1584 Ga0501207_020312 3300049654 Bacteria 1060
1585 Ga0501230_002213 3300049667 Bacteria 2454
1586 Ga0501238_004739 3300049671 Bacteria 1708
1587 Ga0501249_003941 3300049679 Bacteria 3004
1588 Ga0501269_000416 3300049766 Bacteria 9697
1589 Ga0501279_008716 3300049775 Bacteria 1357
1590 Ga0501035_0006430 3300049822 Bacteria 11037
1591 Ga0501044_0000066 3300049823 Bacteria 128533
1592 Ga0501044_0019977 3300049823 Bacteria 7152
1593 Ga0501044_0244029 3300049823 Bacteria 1739
1594 Ga0501044_0605967 3300049823 Bacteria 988
1595 Ga0501045_0027707 3300049824 Bacteria 4085
1596 Ga0501226_000002 3300049853 Bacteria 426935
1597 nmdc:mga0yw44_34389_c1 3300050492 Bacteria 2970
1598 nmdc:mga0k408_42919_c1 3300050493 Bacteria 2605
1599 nmdc:mga04h51_3065_c1 3300050495 Bacteria 4029
1600 nmdc:mga07m45_91940_c1 3300050496 Bacteria 1739
1601 nmdc:mga08y16_405438_c1 3300050511 Bacteria 1395
1602 nmdc:mga0n895_34016_c1 3300050512 Bacteria 4903
1603 nmdc:mga0a205_203132_c1 3300050515 Bacteria 1872
1604 Ga0495601_0009638 3300053077 Bacteria 5717
1605 Ga0495601_0033773 3300053077 Bacteria 3188
1606 Ga0500650_0000173 3300053098 Bacteria 16349
1607 Ga0500572_016555 3300053111 Bacteria 1880
1608 Ga0500594_0006183 3300053118 Bacteria 2683
1609 Ga0500595_001801 3300053119 Bacteria 11110
1610 Ga0500618_000364 3300053125 Bacteria 31481
1611 Ga0500618_003165 3300053125 Bacteria 5780
1612 Ga0500618_004967 3300053125 Bacteria 4120
1613 Ga0500659_0000765 3300053135 Bacteria 20671
1614 Ga0500564_015033 3300053138 Bacteria 3491
1615 Ga0500574_002852 3300053141 Bacteria 2940
1616 Ga0500586_002898 3300053145 Bacteria 3966
1617 Ga0500586_021361 3300053145 Bacteria 2040
1618 Ga0500619_000766 3300053154 Bacteria 5495
1619 Ga0500634_0123624 3300053161 Bacteria 1255
1620 Ga0587093_007139 3300059478 Bacteria 1238
1621 Ga0587077_016481 3300059493 Bacteria 1245
1622 Ga0587082_014811 3300059504 Bacteria 1195
1623 Ga0587083_0022915 3300059505 Bacteria 1174
1624 Ga0587083_0025900 3300059505 Bacteria 1128
1625 Ga0587085_008539 3300059506 Bacteria 1310
1626 Ga0587090_010604 3300059510 Bacteria 1280
1627 Ga0587090_011356 3300059510 Bacteria 1251
1628 Ga0587091_040564 3300059511 Bacteria 916
1629 Ga0587092_010749 3300059512 Bacteria 1259
1630 Ga0587062_004270 3300059639 Bacteria 1507
1631 Ga0587068_004766 3300059641 Bacteria 1812
1632 Ga0587068_008736 3300059641 Bacteria 1476
1633 Ga0587072_020222 3300059643 Bacteria 1171
1634 Ga0587072_021628 3300059643 Bacteria 1143
1635 Ga0587076_035377 3300059645 Bacteria 908
1636 Ga0587079_026495 3300059647 Bacteria 1084
1637 Ga0587111_0007637 3300060346 Bacteria 1764
1638 Ga0466962_0013955 3300061719 Bacteria 3870
1639 Ga0466962_0031666 3300061719 Bacteria 2532

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0201854 Ga0316584_0201854_40_678 212
2 3300046523 Ga0495644_0002948 Ga0495644_0002948_793_1518 241
3 3300005563 Ga0068855_100132978 Ga0068855_1001329782 242
4 3300005614 Ga0068856_100039033 Ga0068856_1000390334 242
5 3300005842 Ga0068858_100006205 Ga0068858_1000062054 242
6 3300009551 Ga0105238_10236152 Ga0105238_102361522 242
7 3300014325 Ga0163163_10012524 Ga0163163_100125245 242
8 3300014968 Ga0157379_10103371 Ga0157379_101033712 242
9 3300025949 Ga0207667_10141020 Ga0207667_101410202 242
10 3300026035 Ga0207703_10009193 Ga0207703_100091936 242
11 3300003578 Ga0006562J51391_1024911 Ga0006562J51391_10249113 243
12 3300005331 Ga0070670_100139271 Ga0070670_1001392711 243
13 3300005458 Ga0070681_10159163 Ga0070681_101591633 243
14 3300006042 Ga0075368_10002887 Ga0075368_100028875 243
15 3300006048 Ga0075363_100005456 Ga0075363_1000054565 243
16 3300006051 Ga0075364_10035001 Ga0075364_100350013 243
17 3300006178 Ga0075367_10003131 Ga0075367_100031318 243
18 3300006186 Ga0075369_10010363 Ga0075369_100103633 243
19 3300006195 Ga0075366_10001060 Ga0075366_100010606 243
20 3300006353 Ga0075370_10026031 Ga0075370_100260313 243
21 3300013100 Ga0157373_10139519 Ga0157373_101395192 243
22 3300025915 Ga0207693_10035205 Ga0207693_100352054 243
23 3300025925 Ga0207650_10100131 Ga0207650_101001313 243
24 3300026078 Ga0207702_10280934 Ga0207702_102809342 243
25 3300027512 Ga0209179_1000427 Ga0209179_10004273 243
26 3300027671 Ga0209588_1016338 Ga0209588_10163383 243
27 3300027866 Ga0209813_10000948 Ga0209813_100009482 243
28 3300031241 Ga0265325_10010023 Ga0265325_100100234 243
29 3300033179 Ga0307507_10124839 Ga0307507_101248391 243
30 3300035111 Ga0373923_0015386 Ga0373923_0015386_1874_2605 243
31 3300035113 Ga0373936_0165467 Ga0373936_0165467_71_802 243
32 3300035725 Ga0373947_0092428 Ga0373947_0092428_983_1714 243
33 3300038443 Ga0395901_0357010 Ga0395901_0357010_374_1105 243
34 3300038443 Ga0395901_0681271 Ga0395901_0681271_24_755 243
35 3300041410 Ga0439461_0030251 Ga0439461_0030251_143_874 243
36 3300042876 Ga0451577_0304333 Ga0451577_0304333_392_1123 243
37 3300044673 Ga0453683_0061956 Ga0453683_0061956_910_1641 243
38 3300044673 Ga0453683_0134717 Ga0453683_0134717_672_1403 243
39 3300044673 Ga0453683_0415733 Ga0453683_0415733_120_851 243
40 3300044712 Ga0453684_0000142 Ga0453684_0000142_267975_268706 243
41 3300044712 Ga0453684_0000158 Ga0453684_0000158_265350_266081 243
42 3300044712 Ga0453684_0025204 Ga0453684_0025204_2607_3338 243
43 3300044712 Ga0453684_0151971 Ga0453684_0151971_500_1231 243
44 3300044712 Ga0453684_0217168 Ga0453684_0217168_421_1152 243
45 3300045051 Ga0451576_0006384 Ga0451576_0006384_2392_3123 243
46 3300045051 Ga0451576_0063755 Ga0451576_0063755_181_912 243
47 3300045051 Ga0451576_0067833 Ga0451576_0067833_22_753 243
48 3300045051 Ga0451576_0085745 Ga0451576_0085745_75_806 243
49 3300046455 Ga0495603_0063173 Ga0495603_0063173_67_798 243
50 3300046457 Ga0495590_0007474 Ga0495590_0007474_2652_3383 243
51 3300046459 Ga0495629_0129424 Ga0495629_0129424_110_841 243
52 3300046463 Ga0495653_0008977 Ga0495653_0008977_103_834 243
53 3300046463 Ga0495653_0014418 Ga0495653_0014418_307_1038 243
54 3300046472 Ga0495580_0075326 Ga0495580_0075326_181_912 243
55 3300046473 Ga0495582_0005379 Ga0495582_0005379_4440_5171 243
56 3300046473 Ga0495582_0072833 Ga0495582_0072833_522_1253 243
57 3300046475 Ga0495639_0125911 Ga0495639_0125911_181_912 243
58 3300046477 Ga0495664_0060436 Ga0495664_0060436_346_1077 243
59 3300046499 Ga0495594_0019945 Ga0495594_0019945_1394_2125 243
60 3300046499 Ga0495594_0074625 Ga0495594_0074625_1083_1814 243
61 3300046500 Ga0495596_0006811 Ga0495596_0006811_291_1022 243
62 3300046501 Ga0495607_0094518 Ga0495607_0094518_303_1034 243
63 3300046513 Ga0495616_0050041 Ga0495616_0050041_685_1416 243
64 3300046516 Ga0495628_0008265 Ga0495628_0008265_2159_2890 243
65 3300046517 Ga0495630_0040193 Ga0495630_0040193_271_1002 243
66 3300046523 Ga0495644_0013726 Ga0495644_0013726_1293_2024 243
67 3300046526 Ga0495666_0015846 Ga0495666_0015846_1642_2373 243
68 3300046526 Ga0495666_0016390 Ga0495666_0016390_375_1106 243
69 3300046528 Ga0495642_0013311 Ga0495642_0013311_257_988 243
70 3300046528 Ga0495642_0016497 Ga0495642_0016497_217_948 243
71 3300046529 Ga0495652_0008714 Ga0495652_0008714_1796_2527 243
72 3300046529 Ga0495652_0035636 Ga0495652_0035636_2683_3414 243
73 3300046531 Ga0495665_0009613 Ga0495665_0009613_478_1209 243
74 3300046531 Ga0495665_0021786 Ga0495665_0021786_900_1631 243
75 3300046533 Ga0495640_0013804 Ga0495640_0013804_1386_2117 243
76 3300046535 Ga0495586_0001555 Ga0495586_0001555_5803_6534 243
77 3300046535 Ga0495586_0079390 Ga0495586_0079390_146_877 243
78 3300046536 Ga0495587_0073539 Ga0495587_0073539_229_960 243
79 3300046542 Ga0495597_0009251 Ga0495597_0009251_2912_3643 243
80 3300046616 Ga0495668_0032297 Ga0495668_0032297_1119_1850 243
81 3300046642 Ga0495634_0009917 Ga0495634_0009917_4003_4734 243
82 3300046663 Ga0495635_0031660 Ga0495635_0031660_455_1186 243
83 3300046665 Ga0495661_0001039 Ga0495661_0001039_5568_6299 243
84 3300046674 Ga0495588_0011107 Ga0495588_0011107_1353_2084 243
85 3300046674 Ga0495588_0221072 Ga0495588_0221072_16_747 243
86 3300046679 Ga0495623_0014300 Ga0495623_0014300_2552_3316 243
87 3300046684 Ga0495669_0000073 Ga0495669_0000073_56057_56788 243
88 3300046691 Ga0495670_0038805 Ga0495670_0038805_1049_1780 243
89 3300046694 Ga0495649_0067756 Ga0495649_0067756_306_1037 243
90 3300046809 Ga0495600_0025351 Ga0495600_0025351_1442_2173 243
91 3300047317 Ga0495604_0104107 Ga0495604_0104107_1083_1814 243
92 3300047321 Ga0495676_0000221 Ga0495676_0000221_34883_35614 243
93 3300047322 Ga0495680_0048458 Ga0495680_0048458_2588_3319 243
94 3300047443 Ga0495687_005249 Ga0495687_005249_64_795 243
95 3300047444 Ga0495675_0007931 Ga0495675_0007931_2924_3655 243
96 3300047444 Ga0495675_0014225 Ga0495675_0014225_1667_2398 243
97 3300047445 Ga0495677_0046008 Ga0495677_0046008_761_1492 243
98 3300047470 Ga0495681_0114113 Ga0495681_0114113_396_1127 243
99 3300047673 Ga0495593_0011040 Ga0495593_0011040_567_1298 243
100 3300048088 Ga0495602_0003238 Ga0495602_0003238_3188_3919 243
101 3300048089 Ga0495614_0034086 Ga0495614_0034086_1093_1824 243
102 3300048091 Ga0495626_0011488 Ga0495626_0011488_3719_4450 243
103 3300048903 Ga0496100_0026304 Ga0496100_0026304_705_1436 243
104 3300048906 Ga0496103_0405502 Ga0496103_0405502_32_763 243
105 3300048908 Ga0496105_0122864 Ga0496105_0122864_601_1332 243
106 3300048909 Ga0496106_0030116 Ga0496106_0030116_696_1427 243
107 3300048910 Ga0496107_0075472 Ga0496107_0075472_92_823 243
108 3300048917 Ga0496114_0096118 Ga0496114_0096118_771_1502 243
109 3300048929 Ga0496126_0225901 Ga0496126_0225901_709_1440 243
110 3300049568 Ga0501031_0020689 Ga0501031_0020689_1090_1821 243
111 3300049570 Ga0501033_0008191 Ga0501033_0008191_6549_7280 243
112 3300049571 Ga0501034_0154875 Ga0501034_0154875_1127_1858 243
113 3300049572 Ga0501036_0000484 Ga0501036_0000484_8423_9154 243
114 3300049572 Ga0501036_0173451 Ga0501036_0173451_739_1470 243
115 3300049573 Ga0501037_0001076 Ga0501037_0001076_768_1499 243
116 3300049573 Ga0501037_0315923 Ga0501037_0315923_12_743 243
117 3300049574 Ga0501038_0009984 Ga0501038_0009984_368_1099 243
118 3300049574 Ga0501038_0013559 Ga0501038_0013559_4147_4878 243
119 3300049574 Ga0501038_0017565 Ga0501038_0017565_2414_3145 243
120 3300049575 Ga0501039_0026382 Ga0501039_0026382_3325_4056 243
121 3300049581 Ga0501047_0020371 Ga0501047_0020371_5033_5764 243
122 3300049581 Ga0501047_0067479 Ga0501047_0067479_2409_3140 243
123 3300049584 Ga0501068_0007074 Ga0501068_0007074_1116_1847 243
124 3300049588 Ga0501072_0401611 Ga0501072_0401611_270_1004 243
125 3300049822 Ga0501035_0006430 Ga0501035_0006430_4524_5255 243
126 3300049823 Ga0501044_0000066 Ga0501044_0000066_88311_89042 243
127 3300049823 Ga0501044_0019977 Ga0501044_0019977_3072_3803 243
128 3300049823 Ga0501044_0244029 Ga0501044_0244029_95_826 243
129 3300049824 Ga0501045_0027707 Ga0501045_0027707_849_1580 243
130 3300050492 nmdc:mga0yw44_34389_c1 nmdc:mga0yw44_34389_c1_790_1521 243
131 3300050493 nmdc:mga0k408_42919_c1 nmdc:mga0k408_42919_c1_656_1387 243
132 3300050495 nmdc:mga04h51_3065_c1 nmdc:mga04h51_3065_c1_1881_2612 243
133 3300050496 nmdc:mga07m45_91940_c1 nmdc:mga07m45_91940_c1_512_1243 243
134 3300053077 Ga0495601_0033773 Ga0495601_0033773_2402_3133 243
135 3300002705 JGI25156J39149_1000267 JGI25156J39149_100026712 244
136 3300002705 JGI25156J39149_1002692 JGI25156J39149_10026925 244
137 3300002737 JGI25162J39368_1000040 JGI25162J39368_1000040155 244
138 3300002737 JGI25162J39368_1006805 JGI25162J39368_10068052 244
139 3300002738 JGI25154J39366_1000739 JGI25154J39366_10007394 244
140 3300002738 JGI25154J39366_1002155 JGI25154J39366_10021555 244
141 3300002739 JGI25158J39367_1014308 JGI25158J39367_10143082 244
142 3300002741 JGI25157J39369_1000372 JGI25157J39369_100037219 244
143 3300002741 JGI25157J39369_1000495 JGI25157J39369_100049513 244
144 3300002771 JGI25163J39215_1004713 JGI25163J39215_10047131 244
145 3300002773 JGI25152J39213_1003789 JGI25152J39213_10037896 244
146 3300002987 JGI25159J45721_1003356 JGI25159J45721_10033567 244
147 3300002987 JGI25159J45721_1010497 JGI25159J45721_10104972 244
148 3300002987 JGI25159J45721_1024725 JGI25159J45721_10247251 244
149 3300003214 JGI25165J46597_1000051 JGI25165J46597_100005144 244
150 3300003215 JGI25153J46596_10003428 JGI25153J46596_100034288 244
151 3300003354 JGI25160J50197_1017779 JGI25160J50197_10177792 244
152 3300003374 JGI25161J50226_1001939 JGI25161J50226_10019397 244
153 3300003374 JGI25161J50226_1011958 JGI25161J50226_10119582 244
154 3300003693 Ga0032354_1037465 Ga0032354_10374651 244
155 3300003751 Ga0055538_1000025 Ga0055538_1000025189 244
156 3300003751 Ga0055538_1000062 Ga0055538_100006275 244
157 3300003752 Ga0055539_1000032 Ga0055539_100003244 244
158 3300003752 Ga0055539_1000093 Ga0055539_100009375 244
159 3300003756 Ga0055533_1000042 Ga0055533_1000042189 244
160 3300003756 Ga0055533_1000105 Ga0055533_100010575 244
161 3300003758 Ga0055532_1000034 Ga0055532_100003419 244
162 3300003759 Ga0055525_1000018 Ga0055525_1000018225 244
163 3300003759 Ga0055525_1000050 Ga0055525_1000050189 244
164 3300003759 Ga0055525_1000137 Ga0055525_100013775 244
165 3300003761 Ga0055535_1003795 Ga0055535_10037954 244
166 3300003762 Ga0055542_1004530 Ga0055542_10045303 244
167 3300003771 Ga0055526_1000045 Ga0055526_100004586 244
168 3300003771 Ga0055526_1000481 Ga0055526_100048129 244
169 3300003771 Ga0055526_1002752 Ga0055526_10027526 244
170 3300003771 Ga0055526_1009931 Ga0055526_10099312 244
171 3300003773 Ga0055537_1000626 Ga0055537_100062615 244
172 3300003773 Ga0055537_1003160 Ga0055537_10031605 244
173 3300003775 Ga0055524_1000024 Ga0055524_100002495 244
174 3300003775 Ga0055524_1006833 Ga0055524_10068331 244
175 3300003775 Ga0055524_1013987 Ga0055524_10139872 244
176 3300003775 Ga0055524_1018011 Ga0055524_10180115 244
177 3300003784 Ga0055534_1000557 Ga0055534_10005578 244
178 3300003790 Ga0055528_1000252 Ga0055528_10002528 244
179 3300003790 Ga0055528_1011419 Ga0055528_10114197 244
180 3300003841 Ga0055541_1000023 Ga0055541_1000023188 244
181 3300003841 Ga0055541_1000063 Ga0055541_100006375 244
182 3300004625 Ga0055543_1002659 Ga0055543_10026591 244
183 3300005262 Ga0065165_1000379 Ga0065165_100037918 244
184 3300005262 Ga0065165_1000936 Ga0065165_100093630 244
185 3300005262 Ga0065165_1006940 Ga0065165_10069401 244
186 3300005293 Ga0065715_10361477 Ga0065715_103614771 244
187 3300005327 Ga0070658_10065716 Ga0070658_100657161 244
188 3300005327 Ga0070658_10114609 Ga0070658_101146092 244
189 3300005331 Ga0070670_100084312 Ga0070670_1000843124 244
190 3300005339 Ga0070660_100003755 Ga0070660_1000037557 244
191 3300005339 Ga0070660_100061598 Ga0070660_1000615982 244
192 3300005344 Ga0070661_100005481 Ga0070661_1000054818 244
193 3300005366 Ga0070659_100001965 Ga0070659_1000019657 244
194 3300005435 Ga0070714_100029472 Ga0070714_1000294723 244
195 3300005455 Ga0070663_100239210 Ga0070663_1002392101 244
196 3300005457 Ga0070662_100175405 Ga0070662_1001754052 244
197 3300005467 Ga0070706_100057979 Ga0070706_1000579794 244
198 3300005536 Ga0070697_100702760 Ga0070697_1007027601 244
199 3300005563 Ga0068855_100102548 Ga0068855_1001025484 244
200 3300005563 Ga0068855_100560194 Ga0068855_1005601942 244
201 3300005564 Ga0070664_100078682 Ga0070664_1000786822 244
202 3300005564 Ga0070664_100290271 Ga0070664_1002902712 244
203 3300005564 Ga0070664_100547781 Ga0070664_1005477811 244
204 3300005577 Ga0068857_100086731 Ga0068857_1000867312 244
205 3300005578 Ga0068854_100064390 Ga0068854_1000643902 244
206 3300005578 Ga0068854_100667834 Ga0068854_1006678341 244
207 3300005616 Ga0068852_100031182 Ga0068852_1000311824 244
208 3300005834 Ga0068851_10102682 Ga0068851_101026822 244
209 3300006028 Ga0070717_10035845 Ga0070717_100358454 244
210 3300006852 Ga0075433_10553656 Ga0075433_105536561 244
211 3300006871 Ga0075434_100048649 Ga0075434_1000486493 244
212 3300006948 Ga0099826_10000010 Ga0099826_10000010164 244
213 3300009036 Ga0105244_10000639 Ga0105244_1000063910 244
214 3300009036 Ga0105244_10002229 Ga0105244_100022298 244
215 3300009036 Ga0105244_10014131 Ga0105244_100141312 244
216 3300009093 Ga0105240_10001608 Ga0105240_1000160821 244
217 3300009093 Ga0105240_10026829 Ga0105240_100268295 244
218 3300009093 Ga0105240_10043423 Ga0105240_100434235 244
219 3300009098 Ga0105245_10077129 Ga0105245_100771292 244
220 3300009148 Ga0105243_10007642 Ga0105243_100076424 244
221 3300009545 Ga0105237_10096738 Ga0105237_100967383 244
222 3300009551 Ga0105238_10000763 Ga0105238_1000076318 244
223 3300009551 Ga0105238_10061370 Ga0105238_100613702 244
224 3300010375 Ga0105239_10009911 Ga0105239_100099114 244
225 3300010375 Ga0105239_10195939 Ga0105239_101959392 244
226 3300010375 Ga0105239_10407477 Ga0105239_104074772 244
227 3300010375 Ga0105239_11222117 Ga0105239_112221171 244
228 3300011119 Ga0105246_10181268 Ga0105246_101812683 244
229 3300013100 Ga0157373_10199167 Ga0157373_101991671 244
230 3300013105 Ga0157369_10354798 Ga0157369_103547981 244
231 3300013306 Ga0163162_10049541 Ga0163162_100495414 244
232 3300013307 Ga0157372_11507295 Ga0157372_115072951 244
233 3300014497 Ga0182008_10004382 Ga0182008_100043822 244
234 3300014497 Ga0182008_10005360 Ga0182008_100053603 244
235 3300014497 Ga0182008_10044122 Ga0182008_100441224 244
236 3300015261 Ga0182006_1000033 Ga0182006_1000033169 244
237 3300015261 Ga0182006_1000141 Ga0182006_100014167 244
238 3300015261 Ga0182006_1008100 Ga0182006_10081004 244
239 3300015261 Ga0182006_1027033 Ga0182006_10270332 244
240 3300015261 Ga0182006_1030859 Ga0182006_10308592 244
241 3300015262 Ga0182007_10001557 Ga0182007_100015578 244
242 3300015262 Ga0182007_10026404 Ga0182007_100264042 244
243 3300015265 Ga0182005_1000016 Ga0182005_1000016190 244
244 3300015265 Ga0182005_1000024 Ga0182005_100002453 244
245 3300015265 Ga0182005_1001902 Ga0182005_10019026 244
246 3300017792 Ga0163161_10015922 Ga0163161_100159224 244
247 3300017792 Ga0163161_10025047 Ga0163161_100250476 244
248 3300020077 Ga0206351_10464379 Ga0206351_104643791 244
249 3300021361 Ga0213872_10000005 Ga0213872_10000005104 244
250 3300021361 Ga0213872_10001171 Ga0213872_1000117113 244
251 3300021361 Ga0213872_10002039 Ga0213872_1000203910 244
252 3300021361 Ga0213872_10007513 Ga0213872_100075133 244
253 3300021361 Ga0213872_10010335 Ga0213872_100103354 244
254 3300021361 Ga0213872_10021029 Ga0213872_100210293 244
255 3300025206 Ga0209435_100007 Ga0209435_10000719 244
256 3300025206 Ga0209435_100176 Ga0209435_10017611 244
257 3300025208 Ga0209436_100287 Ga0209436_1002878 244
258 3300025208 Ga0209436_102115 Ga0209436_1021151 244
259 3300025224 Ga0209784_100010 Ga0209784_100010567 244
260 3300025224 Ga0209784_100021 Ga0209784_100021365 244
261 3300025225 Ga0209566_100008 Ga0209566_100008567 244
262 3300025225 Ga0209566_100119 Ga0209566_10011917 244
263 3300025226 Ga0209674_100019 Ga0209674_100019567 244
264 3300025226 Ga0209674_100036 Ga0209674_100036365 244
265 3300025229 Ga0209147_100017 Ga0209147_100017453 244
266 3300025230 Ga0209563_100011 Ga0209563_100011866 244
267 3300025230 Ga0209563_100021 Ga0209563_100021567 244
268 3300025230 Ga0209563_100040 Ga0209563_100040365 244
269 3300025231 Ga0207427_102072 Ga0207427_1020722 244
270 3300025233 Ga0209437_100019 Ga0209437_100019567 244
271 3300025233 Ga0209437_100332 Ga0209437_10033219 244
272 3300025242 Ga0209258_100115 Ga0209258_1001158 244
273 3300025245 Ga0207425_1000021 Ga0207425_1000021120 244
274 3300025245 Ga0207425_1000170 Ga0207425_100017026 244
275 3300025245 Ga0207425_1002098 Ga0207425_10020982 244
276 3300025246 Ga0209646_1000044 Ga0209646_1000044294 244
277 3300025246 Ga0209646_1000068 Ga0209646_1000068124 244
278 3300025246 Ga0209646_1000107 Ga0209646_1000107129 244
279 3300025250 Ga0209026_1000063 Ga0209026_100006319 244
280 3300025250 Ga0209026_1002108 Ga0209026_10021085 244
281 3300025250 Ga0209026_1008584 Ga0209026_10085842 244
282 3300025253 Ga0209677_100011 Ga0209677_100011567 244
283 3300025253 Ga0209677_100023 Ga0209677_100023365 244
284 3300025253 Ga0209677_102948 Ga0209677_1029484 244
285 3300025254 Ga0209148_1001117 Ga0209148_100111713 244
286 3300025256 Ga0209759_1000048 Ga0209759_100004819 244
287 3300025256 Ga0209759_1000198 Ga0209759_100019873 244
288 3300025258 Ga0209129_1000020 Ga0209129_1000020191 244
289 3300025258 Ga0209129_1004970 Ga0209129_10049704 244
290 3300025258 Ga0209129_1023052 Ga0209129_10230522 244
291 3300025261 Ga0209233_1000025 Ga0209233_1000025567 244
292 3300025261 Ga0209233_1051831 Ga0209233_10518311 244
293 3300025263 Ga0209565_1000123 Ga0209565_100012316 244
294 3300025263 Ga0209565_1000632 Ga0209565_10006326 244
295 3300025263 Ga0209565_1000689 Ga0209565_100068920 244
296 3300025263 Ga0209565_1011339 Ga0209565_10113392 244
297 3300025263 Ga0209565_1023449 Ga0209565_10234492 244
298 3300025272 Ga0209455_1000070 Ga0209455_1000070166 244
299 3300025272 Ga0209455_1001196 Ga0209455_10011969 244
300 3300025273 Ga0209673_1000040 Ga0209673_1000040204 244
301 3300025273 Ga0209673_1008854 Ga0209673_10088542 244
302 3300025284 Ga0209130_1000589 Ga0209130_100058930 244
303 3300025284 Ga0209130_1002447 Ga0209130_10024476 244
304 3300025284 Ga0209130_1003581 Ga0209130_10035812 244
305 3300025291 Ga0209675_1000117 Ga0209675_100011789 244
306 3300025291 Ga0209675_1000567 Ga0209675_100056721 244
307 3300025295 Ga0209564_1000027 Ga0209564_1000027229 244
308 3300025295 Ga0209564_1000047 Ga0209564_1000047134 244
309 3300025295 Ga0209564_1000063 Ga0209564_1000063253 244
310 3300025295 Ga0209564_1000121 Ga0209564_100012199 244
311 3300025295 Ga0209564_1001500 Ga0209564_10015008 244
312 3300025295 Ga0209564_1024695 Ga0209564_10246952 244
313 3300025297 Ga0209758_1000077 Ga0209758_1000077144 244
314 3300025297 Ga0209758_1000394 Ga0209758_100039441 244
315 3300025298 Ga0209050_1000050 Ga0209050_1000050126 244
316 3300025298 Ga0209050_1001569 Ga0209050_10015698 244
317 3300025299 Ga0209256_1000054 Ga0209256_1000054157 244
318 3300025299 Ga0209256_1000288 Ga0209256_100028870 244
319 3300025299 Ga0209256_1001035 Ga0209256_10010355 244
320 3300025299 Ga0209256_1001444 Ga0209256_10014448 244
321 3300025299 Ga0209256_1001988 Ga0209256_100198820 244
322 3300025302 Ga0207426_1000956 Ga0207426_100095611 244
323 3300025304 Ga0209257_1000075 Ga0209257_1000075126 244
324 3300025728 Ga0207655_1004059 Ga0207655_100405911 244
325 3300025728 Ga0207655_1014363 Ga0207655_10143633 244
326 3300025909 Ga0207705_10060456 Ga0207705_100604562 244
327 3300025910 Ga0207684_10035065 Ga0207684_100350653 244
328 3300025912 Ga0207707_10141988 Ga0207707_101419882 244
329 3300025913 Ga0207695_10003613 Ga0207695_1000361313 244
330 3300025913 Ga0207695_10004696 Ga0207695_100046964 244
331 3300025913 Ga0207695_10019466 Ga0207695_100194665 244
332 3300025914 Ga0207671_10043537 Ga0207671_100435372 244
333 3300025917 Ga0207660_10172548 Ga0207660_101725482 244
334 3300025919 Ga0207657_10005929 Ga0207657_100059295 244
335 3300025919 Ga0207657_10014161 Ga0207657_100141619 244
336 3300025919 Ga0207657_10046922 Ga0207657_100469222 244
337 3300025920 Ga0207649_10072113 Ga0207649_100721133 244
338 3300025924 Ga0207694_10000343 Ga0207694_1000034311 244
339 3300025924 Ga0207694_10193957 Ga0207694_101939572 244
340 3300025928 Ga0207700_10761438 Ga0207700_107614382 244
341 3300025929 Ga0207664_10011629 Ga0207664_100116294 244
342 3300025932 Ga0207690_10001518 Ga0207690_100015188 244
343 3300025932 Ga0207690_10189335 Ga0207690_101893352 244
344 3300025933 Ga0207706_10088647 Ga0207706_100886475 244
345 3300025933 Ga0207706_10283716 Ga0207706_102837162 244
346 3300025935 Ga0207709_10018345 Ga0207709_100183453 244
347 3300025937 Ga0207669_10123372 Ga0207669_101233723 244
348 3300025945 Ga0207679_10010792 Ga0207679_100107924 244
349 3300025945 Ga0207679_10014950 Ga0207679_100149504 244
350 3300025949 Ga0207667_10000912 Ga0207667_1000091218 244
351 3300025949 Ga0207667_10007366 Ga0207667_1000736611 244
352 3300025949 Ga0207667_10011221 Ga0207667_100112218 244
353 3300025981 Ga0207640_10044348 Ga0207640_100443482 244
354 3300025981 Ga0207640_10568425 Ga0207640_105684252 244
355 3300026067 Ga0207678_10097937 Ga0207678_100979371 244
356 3300026142 Ga0207698_10009503 Ga0207698_100095034 244
357 3300027111 Ga0209281_1008759 Ga0209281_10087592 244
358 3300027666 Ga0209282_1000009 Ga0209282_1000009163 244
359 3300030735 Ga0316178_1035927 Ga0316178_10359272 244
360 3300030745 Ga0316182_1261839 Ga0316182_12618392 244
361 3300031238 Ga0265332_10000026 Ga0265332_10000026115 244
362 3300031548 Ga0307408_100001156 Ga0307408_10000115612 244
363 3300031548 Ga0307408_100001884 Ga0307408_1000018847 244
364 3300031548 Ga0307408_100011848 Ga0307408_1000118484 244
365 3300031548 Ga0307408_100261484 Ga0307408_1002614842 244
366 3300031548 Ga0307408_100537858 Ga0307408_1005378582 244
367 3300031711 Ga0265314_10138880 Ga0265314_101388802 244
368 3300032002 Ga0307416_100010124 Ga0307416_1000101242 244
369 3300032002 Ga0307416_100373505 Ga0307416_1003735051 244
370 3300032004 Ga0307414_10205232 Ga0307414_102052322 244
371 3300035691 Ga0373931_0177872 Ga0373931_0177872_190_924 244
372 3300035692 Ga0373935_0356469 Ga0373935_0356469_108_842 244
373 3300036401 Ga0373937_0902321 Ga0373937_0902321_40_774 244
374 3300037312 Ga0395899_0000386 Ga0395899_0000386_48305_49039 244
375 3300037312 Ga0395899_0011613 Ga0395899_0011613_1980_2714 244
376 3300037312 Ga0395899_0015194 Ga0395899_0015194_4325_5059 244
377 3300037312 Ga0395899_0037924 Ga0395899_0037924_2087_2821 244
378 3300037418 Ga0395900_0000715 Ga0395900_0000715_34565_35299 244
379 3300037418 Ga0395900_0001341 Ga0395900_0001341_21188_21922 244
380 3300037418 Ga0395900_0048659 Ga0395900_0048659_735_1469 244
381 3300037418 Ga0395900_0055574 Ga0395900_0055574_1750_2484 244
382 3300037418 Ga0395900_0087488 Ga0395900_0087488_2114_2848 244
383 3300037418 Ga0395900_0113741 Ga0395900_0113741_1949_2683 244
384 3300037418 Ga0395900_0172432 Ga0395900_0172432_959_1693 244
385 3300037418 Ga0395900_0357081 Ga0395900_0357081_379_1113 244
386 3300037466 Ga0395898_0007625 Ga0395898_0007625_3669_4403 244
387 3300037466 Ga0395898_0065139 Ga0395898_0065139_2339_3073 244
388 3300037466 Ga0395898_0777034 Ga0395898_0777034_77_811 244
389 3300037471 Ga0395905_0000242 Ga0395905_0000242_39169_39951 244
390 3300037471 Ga0395905_0081547 Ga0395905_0081547_891_1625 244
391 3300037471 Ga0395905_0276633 Ga0395905_0276633_292_1026 244
392 3300037471 Ga0395905_0461668 Ga0395905_0461668_323_1057 244
393 3300037471 Ga0395905_0463854 Ga0395905_0463854_67_801 244
394 3300037471 Ga0395905_0624659 Ga0395905_0624659_137_871 244
395 3300037471 Ga0395905_0775665 Ga0395905_0775665_36_770 244
396 3300038443 Ga0395901_0000943 Ga0395901_0000943_13240_13974 244
397 3300038443 Ga0395901_0005142 Ga0395901_0005142_4959_5693 244
398 3300038443 Ga0395901_0147921 Ga0395901_0147921_173_907 244
399 3300038443 Ga0395901_0151300 Ga0395901_0151300_1242_1976 244
400 3300039447 Ga0436361_0042090 Ga0436361_0042090_1195_1929 244
401 3300039447 Ga0436361_0089100 Ga0436361_0089100_7914_8648 244
402 3300039447 Ga0436361_0089479 Ga0436361_0089479_46986_47720 244
403 3300039447 Ga0436361_0303014 Ga0436361_0303014_13030_13764 244
404 3300039447 Ga0436361_0531483 Ga0436361_0531483_2199_2933 244
405 3300039447 Ga0436361_0675827 Ga0436361_0675827_120_854 244
406 3300039447 Ga0436361_0832413 Ga0436361_0832413_2292_3026 244
407 3300039447 Ga0436361_1218785 Ga0436361_1218785_45913_46647 244
408 3300041509 Ga0451843_1691138 Ga0451843_1691138_1357_2094 244
409 3300042002 Ga0439442_032513 Ga0439442_032513_340_1074 244
410 3300042005 Ga0439448_0000099 Ga0439448_0000099_8575_9309 244
411 3300042007 Ga0439449_0033446 Ga0439449_0033446_746_1480 244
412 3300042008 Ga0439450_002360 Ga0439450_002360_986_1720 244
413 3300042139 Ga0450904_001458 Ga0450904_001458_94_828 244
414 3300042876 Ga0451577_0500264 Ga0451577_0500264_31_765 244
415 3300044656 Ga0466969_0034753 Ga0466969_0034753_1043_1777 244
416 3300044656 Ga0466969_0051856 Ga0466969_0051856_1157_1891 244
417 3300044658 Ga0466972_0000359 Ga0466972_0000359_20266_21000 244
418 3300044658 Ga0466972_0016650 Ga0466972_0016650_1102_1836 244
419 3300044683 Ga0466965_0024588 Ga0466965_0024588_1801_2535 244
420 3300044683 Ga0466965_0026547 Ga0466965_0026547_28_762 244
421 3300044683 Ga0466965_0041682 Ga0466965_0041682_707_1441 244
422 3300044683 Ga0466965_0164028 Ga0466965_0164028_199_933 244
423 3300044684 Ga0466966_0005044 Ga0466966_0005044_2286_3020 244
424 3300044684 Ga0466966_0025197 Ga0466966_0025197_2649_3383 244
425 3300044693 Ga0466961_0006689 Ga0466961_0006689_2701_3435 244
426 3300044693 Ga0466961_0107351 Ga0466961_0107351_671_1405 244
427 3300044694 Ga0466963_0022166 Ga0466963_0022166_2309_3043 244
428 3300044706 Ga0466964_0000517 Ga0466964_0000517_5704_6438 244
429 3300044706 Ga0466964_0003220 Ga0466964_0003220_1332_2066 244
430 3300044706 Ga0466964_0004695 Ga0466964_0004695_3543_4277 244
431 3300044706 Ga0466964_0023589 Ga0466964_0023589_975_1751 244
432 3300044712 Ga0453684_0029140 Ga0453684_0029140_5200_5937 244
433 3300044719 Ga0466971_0087119 Ga0466971_0087119_451_1185 244
434 3300044719 Ga0466971_0206999 Ga0466971_0206999_65_799 244
435 3300044735 Ga0466968_0000899 Ga0466968_0000899_4218_4952 244
436 3300044735 Ga0466968_0005369 Ga0466968_0005369_1946_2680 244
437 3300044735 Ga0466968_0050008 Ga0466968_0050008_931_1665 244
438 3300044765 Ga0466970_0061050 Ga0466970_0061050_979_1713 244
439 3300044842 Ga0466957_0002970 Ga0466957_0002970_5097_5831 244
440 3300044842 Ga0466957_0206142 Ga0466957_0206142_279_1013 244
441 3300044842 Ga0466957_0232654 Ga0466957_0232654_53_787 244
442 3300045049 Ga0466959_0006393 Ga0466959_0006393_6232_6966 244
443 3300045049 Ga0466959_0016513 Ga0466959_0016513_2322_3056 244
444 3300045049 Ga0466959_0086836 Ga0466959_0086836_1011_1745 244
445 3300045049 Ga0466959_0125723 Ga0466959_0125723_389_1123 244
446 3300045049 Ga0466959_0181562 Ga0466959_0181562_238_972 244
447 3300045049 Ga0466959_0315335 Ga0466959_0315335_30_764 244
448 3300045051 Ga0451576_0198517 Ga0451576_0198517_106_843 244
449 3300045836 Ga0466958_0066239 Ga0466958_0066239_98_832 244
450 3300045976 Ga0466967_0017377 Ga0466967_0017377_1357_2091 244
451 3300046452 Ga0495617_000027 Ga0495617_000027_142665_143399 244
452 3300046452 Ga0495617_000466 Ga0495617_000466_15008_15742 244
453 3300046452 Ga0495617_002660 Ga0495617_002660_2642_3376 244
454 3300046453 Ga0495627_000011 Ga0495627_000011_232456_233190 244
455 3300046453 Ga0495627_000277 Ga0495627_000277_2706_3440 244
456 3300046453 Ga0495627_002842 Ga0495627_002842_1333_2067 244
457 3300046453 Ga0495627_008570 Ga0495627_008570_1737_2471 244
458 3300046453 Ga0495627_020864 Ga0495627_020864_106_840 244
459 3300046454 Ga0495592_0036756 Ga0495592_0036756_1999_2733 244
460 3300046455 Ga0495603_0009876 Ga0495603_0009876_2168_2902 244
461 3300046455 Ga0495603_0025025 Ga0495603_0025025_2478_3212 244
462 3300046455 Ga0495603_0048475 Ga0495603_0048475_1389_2123 244
463 3300046457 Ga0495590_0000020 Ga0495590_0000020_205558_206292 244
464 3300046457 Ga0495590_0000544 Ga0495590_0000544_3479_4213 244
465 3300046457 Ga0495590_0015377 Ga0495590_0015377_1881_2615 244
466 3300046457 Ga0495590_0036439 Ga0495590_0036439_643_1377 244
467 3300046458 Ga0495591_000616 Ga0495591_000616_12164_12898 244
468 3300046459 Ga0495629_0014675 Ga0495629_0014675_468_1202 244
469 3300046459 Ga0495629_0036710 Ga0495629_0036710_116_850 244
470 3300046460 Ga0495638_0003336 Ga0495638_0003336_6048_6782 244
471 3300046460 Ga0495638_0004087 Ga0495638_0004087_6905_7639 244
472 3300046460 Ga0495638_0010020 Ga0495638_0010020_5008_5742 244
473 3300046460 Ga0495638_0063316 Ga0495638_0063316_189_923 244
474 3300046460 Ga0495638_0241892 Ga0495638_0241892_157_891 244
475 3300046460 Ga0495638_0318791 Ga0495638_0318791_41_775 244
476 3300046462 Ga0495651_0003918 Ga0495651_0003918_4649_5383 244
477 3300046462 Ga0495651_0287656 Ga0495651_0287656_332_1066 244
478 3300046463 Ga0495653_0000313 Ga0495653_0000313_37819_38553 244
479 3300046463 Ga0495653_0004554 Ga0495653_0004554_9565_10299 244
480 3300046463 Ga0495653_0040360 Ga0495653_0040360_2025_2759 244
481 3300046463 Ga0495653_0042162 Ga0495653_0042162_471_1205 244
482 3300046471 Ga0495650_0000251 Ga0495650_0000251_50496_51230 244
483 3300046471 Ga0495650_0000431 Ga0495650_0000431_5789_6523 244
484 3300046471 Ga0495650_0000582 Ga0495650_0000582_45092_45826 244
485 3300046471 Ga0495650_0002001 Ga0495650_0002001_6111_6875 244
486 3300046471 Ga0495650_0002200 Ga0495650_0002200_6061_6795 244
487 3300046471 Ga0495650_0002792 Ga0495650_0002792_5655_6389 244
488 3300046471 Ga0495650_0019731 Ga0495650_0019731_2525_3259 244
489 3300046473 Ga0495582_0083844 Ga0495582_0083844_244_978 244
490 3300046474 Ga0495605_0000061 Ga0495605_0000061_6060_6830 244
491 3300046474 Ga0495605_0000135 Ga0495605_0000135_13915_14649 244
492 3300046474 Ga0495605_0000287 Ga0495605_0000287_53193_53927 244
493 3300046474 Ga0495605_0003898 Ga0495605_0003898_2753_3487 244
494 3300046474 Ga0495605_0006784 Ga0495605_0006784_888_1622 244
495 3300046474 Ga0495605_0012293 Ga0495605_0012293_1599_2333 244
496 3300046474 Ga0495605_0017922 Ga0495605_0017922_2383_3117 244
497 3300046474 Ga0495605_0018104 Ga0495605_0018104_2182_2916 244
498 3300046474 Ga0495605_0018632 Ga0495605_0018632_923_1657 244
499 3300046474 Ga0495605_0028357 Ga0495605_0028357_1858_2592 244
500 3300046474 Ga0495605_0043047 Ga0495605_0043047_204_938 244
501 3300046474 Ga0495605_0200745 Ga0495605_0200745_45_779 244
502 3300046491 Ga0495584_0000005 Ga0495584_0000005_94626_95360 244
503 3300046491 Ga0495584_0001526 Ga0495584_0001526_2940_3674 244
504 3300046491 Ga0495584_0002496 Ga0495584_0002496_2557_3291 244
505 3300046491 Ga0495584_0003202 Ga0495584_0003202_5577_6311 244
506 3300046491 Ga0495584_0005016 Ga0495584_0005016_2120_2854 244
507 3300046491 Ga0495584_0008160 Ga0495584_0008160_2040_2774 244
508 3300046491 Ga0495584_0012854 Ga0495584_0012854_899_1633 244
509 3300046491 Ga0495584_0014909 Ga0495584_0014909_1791_2525 244
510 3300046491 Ga0495584_0041697 Ga0495584_0041697_1386_2120 244
511 3300046491 Ga0495584_0046583 Ga0495584_0046583_1072_1806 244
512 3300046491 Ga0495584_0159452 Ga0495584_0159452_140_874 244
513 3300046492 Ga0495585_0000238 Ga0495585_0000238_50405_51139 244
514 3300046492 Ga0495585_0000277 Ga0495585_0000277_43799_44533 244
515 3300046492 Ga0495585_0002047 Ga0495585_0002047_7583_8317 244
516 3300046492 Ga0495585_0005810 Ga0495585_0005810_5072_5806 244
517 3300046492 Ga0495585_0006567 Ga0495585_0006567_2643_3377 244
518 3300046492 Ga0495585_0007203 Ga0495585_0007203_2855_3589 244
519 3300046492 Ga0495585_0007306 Ga0495585_0007306_4257_4991 244
520 3300046492 Ga0495585_0007413 Ga0495585_0007413_4153_4887 244
521 3300046492 Ga0495585_0010334 Ga0495585_0010334_2656_3390 244
522 3300046492 Ga0495585_0013630 Ga0495585_0013630_1797_2531 244
523 3300046492 Ga0495585_0019262 Ga0495585_0019262_1063_1797 244
524 3300046492 Ga0495585_0026231 Ga0495585_0026231_1195_1929 244
525 3300046492 Ga0495585_0027620 Ga0495585_0027620_1434_2168 244
526 3300046492 Ga0495585_0051733 Ga0495585_0051733_759_1493 244
527 3300046499 Ga0495594_0002420 Ga0495594_0002420_3279_4013 244
528 3300046499 Ga0495594_0004751 Ga0495594_0004751_1077_1811 244
529 3300046499 Ga0495594_0007475 Ga0495594_0007475_2251_2985 244
530 3300046499 Ga0495594_0017449 Ga0495594_0017449_2702_3436 244
531 3300046499 Ga0495594_0019462 Ga0495594_0019462_1346_2080 244
532 3300046499 Ga0495594_0027947 Ga0495594_0027947_170_904 244
533 3300046499 Ga0495594_0195976 Ga0495594_0195976_47_781 244
534 3300046499 Ga0495594_0234190 Ga0495594_0234190_53_787 244
535 3300046500 Ga0495596_0002220 Ga0495596_0002220_4799_5533 244
536 3300046500 Ga0495596_0002744 Ga0495596_0002744_7756_8490 244
537 3300046500 Ga0495596_0003179 Ga0495596_0003179_5871_6605 244
538 3300046500 Ga0495596_0006538 Ga0495596_0006538_29_763 244
539 3300046500 Ga0495596_0009431 Ga0495596_0009431_2456_3190 244
540 3300046500 Ga0495596_0019527 Ga0495596_0019527_1539_2273 244
541 3300046500 Ga0495596_0031673 Ga0495596_0031673_484_1218 244
542 3300046501 Ga0495607_0003003 Ga0495607_0003003_4909_5643 244
543 3300046501 Ga0495607_0003245 Ga0495607_0003245_10395_11129 244
544 3300046501 Ga0495607_0006203 Ga0495607_0006203_5817_6551 244
545 3300046501 Ga0495607_0010786 Ga0495607_0010786_2607_3341 244
546 3300046501 Ga0495607_0013867 Ga0495607_0013867_1816_2550 244
547 3300046501 Ga0495607_0016351 Ga0495607_0016351_2788_3522 244
548 3300046501 Ga0495607_0033727 Ga0495607_0033727_1461_2195 244
549 3300046501 Ga0495607_0042439 Ga0495607_0042439_796_1530 244
550 3300046501 Ga0495607_0055848 Ga0495607_0055848_1150_1884 244
551 3300046506 Ga0495583_0000158 Ga0495583_0000158_7093_7857 244
552 3300046506 Ga0495583_0000214 Ga0495583_0000214_33411_34145 244
553 3300046506 Ga0495583_0000947 Ga0495583_0000947_5870_6604 244
554 3300046506 Ga0495583_0001239 Ga0495583_0001239_52_786 244
555 3300046506 Ga0495583_0005046 Ga0495583_0005046_5904_6638 244
556 3300046506 Ga0495583_0005144 Ga0495583_0005144_5448_6182 244
557 3300046506 Ga0495583_0005773 Ga0495583_0005773_7411_8145 244
558 3300046506 Ga0495583_0006211 Ga0495583_0006211_6939_7673 244
559 3300046506 Ga0495583_0007334 Ga0495583_0007334_2866_3600 244
560 3300046506 Ga0495583_0014775 Ga0495583_0014775_741_1475 244
561 3300046506 Ga0495583_0020702 Ga0495583_0020702_2241_2975 244
562 3300046506 Ga0495583_0024718 Ga0495583_0024718_658_1392 244
563 3300046506 Ga0495583_0025072 Ga0495583_0025072_1673_2407 244
564 3300046506 Ga0495583_0159784 Ga0495583_0159784_145_879 244
565 3300046507 Ga0495606_0000090 Ga0495606_0000090_5759_6493 244
566 3300046507 Ga0495606_0000120 Ga0495606_0000120_6201_6935 244
567 3300046507 Ga0495606_0003666 Ga0495606_0003666_6395_7129 244
568 3300046507 Ga0495606_0004932 Ga0495606_0004932_9423_10157 244
569 3300046507 Ga0495606_0006821 Ga0495606_0006821_3903_4637 244
570 3300046507 Ga0495606_0006937 Ga0495606_0006937_4302_5036 244
571 3300046507 Ga0495606_0007094 Ga0495606_0007094_3561_4295 244
572 3300046507 Ga0495606_0008015 Ga0495606_0008015_2143_2877 244
573 3300046507 Ga0495606_0009951 Ga0495606_0009951_4451_5185 244
574 3300046507 Ga0495606_0016358 Ga0495606_0016358_2568_3302 244
575 3300046507 Ga0495606_0017490 Ga0495606_0017490_44_778 244
576 3300046507 Ga0495606_0038321 Ga0495606_0038321_2417_3181 244
577 3300046507 Ga0495606_0173371 Ga0495606_0173371_81_815 244
578 3300046507 Ga0495606_0182316 Ga0495606_0182316_85_819 244
579 3300046511 Ga0495608_0004039 Ga0495608_0004039_8376_9110 244
580 3300046511 Ga0495608_0016194 Ga0495608_0016194_2137_2871 244
581 3300046512 Ga0495610_0000017 Ga0495610_0000017_234275_235009 244
582 3300046512 Ga0495610_0025321 Ga0495610_0025321_1776_2510 244
583 3300046513 Ga0495616_0001092 Ga0495616_0001092_5963_6697 244
584 3300046513 Ga0495616_0001261 Ga0495616_0001261_6435_7169 244
585 3300046513 Ga0495616_0001563 Ga0495616_0001563_8328_9062 244
586 3300046513 Ga0495616_0005938 Ga0495616_0005938_5135_5869 244
587 3300046513 Ga0495616_0009383 Ga0495616_0009383_2815_3549 244
588 3300046513 Ga0495616_0010379 Ga0495616_0010379_2028_2762 244
589 3300046513 Ga0495616_0015513 Ga0495616_0015513_2734_3468 244
590 3300046513 Ga0495616_0018791 Ga0495616_0018791_787_1521 244
591 3300046513 Ga0495616_0019317 Ga0495616_0019317_604_1338 244
592 3300046515 Ga0495620_0018263 Ga0495620_0018263_2190_2924 244
593 3300046516 Ga0495628_0002401 Ga0495628_0002401_7567_8301 244
594 3300046516 Ga0495628_0004370 Ga0495628_0004370_2770_3504 244
595 3300046518 Ga0495631_0005014 Ga0495631_0005014_2802_3536 244
596 3300046518 Ga0495631_0006359 Ga0495631_0006359_4307_5041 244
597 3300046518 Ga0495631_0008278 Ga0495631_0008278_281_1015 244
598 3300046518 Ga0495631_0019676 Ga0495631_0019676_68_802 244
599 3300046518 Ga0495631_0022032 Ga0495631_0022032_1114_1848 244
600 3300046518 Ga0495631_0022053 Ga0495631_0022053_1860_2594 244
601 3300046518 Ga0495631_0037637 Ga0495631_0037637_1126_1860 244
602 3300046518 Ga0495631_0170180 Ga0495631_0170180_137_871 244
603 3300046519 Ga0495632_0001074 Ga0495632_0001074_12405_13139 244
604 3300046519 Ga0495632_0002651 Ga0495632_0002651_2291_3025 244
605 3300046519 Ga0495632_0003276 Ga0495632_0003276_8057_8791 244
606 3300046519 Ga0495632_0007442 Ga0495632_0007442_2909_3643 244
607 3300046519 Ga0495632_0028128 Ga0495632_0028128_1909_2643 244
608 3300046519 Ga0495632_0139103 Ga0495632_0139103_33_767 244
609 3300046520 Ga0495637_0000515 Ga0495637_0000515_14052_14786 244
610 3300046520 Ga0495637_0001430 Ga0495637_0001430_7054_7788 244
611 3300046520 Ga0495637_0002408 Ga0495637_0002408_3474_4208 244
612 3300046522 Ga0495643_0000455 Ga0495643_0000455_45334_46068 244
613 3300046522 Ga0495643_0000908 Ga0495643_0000908_5862_6596 244
614 3300046522 Ga0495643_0001824 Ga0495643_0001824_399_1133 244
615 3300046522 Ga0495643_0002067 Ga0495643_0002067_6247_6981 244
616 3300046522 Ga0495643_0002344 Ga0495643_0002344_5174_5908 244
617 3300046522 Ga0495643_0009119 Ga0495643_0009119_2830_3564 244
618 3300046522 Ga0495643_0012110 Ga0495643_0012110_2583_3317 244
619 3300046522 Ga0495643_0015824 Ga0495643_0015824_1108_1842 244
620 3300046522 Ga0495643_0022084 Ga0495643_0022084_2520_3254 244
621 3300046522 Ga0495643_0121836 Ga0495643_0121836_560_1294 244
622 3300046523 Ga0495644_0003375 Ga0495644_0003375_775_1509 244
623 3300046523 Ga0495644_0006022 Ga0495644_0006022_2989_3723 244
624 3300046523 Ga0495644_0015700 Ga0495644_0015700_1898_2632 244
625 3300046523 Ga0495644_0017503 Ga0495644_0017503_350_1084 244
626 3300046523 Ga0495644_0032409 Ga0495644_0032409_590_1324 244
627 3300046523 Ga0495644_0036566 Ga0495644_0036566_325_1059 244
628 3300046523 Ga0495644_0042546 Ga0495644_0042546_609_1343 244
629 3300046523 Ga0495644_0055027 Ga0495644_0055027_447_1181 244
630 3300046524 Ga0495648_0000168 Ga0495648_0000168_10060_10794 244
631 3300046524 Ga0495648_0000183 Ga0495648_0000183_6335_7069 244
632 3300046524 Ga0495648_0002984 Ga0495648_0002984_2447_3181 244
633 3300046524 Ga0495648_0004633 Ga0495648_0004633_8109_8843 244
634 3300046524 Ga0495648_0007325 Ga0495648_0007325_5419_6153 244
635 3300046524 Ga0495648_0011240 Ga0495648_0011240_2676_3410 244
636 3300046524 Ga0495648_0017788 Ga0495648_0017788_861_1595 244
637 3300046524 Ga0495648_0020900 Ga0495648_0020900_1569_2303 244
638 3300046524 Ga0495648_0024858 Ga0495648_0024858_1300_2034 244
639 3300046524 Ga0495648_0034012 Ga0495648_0034012_2309_3043 244
640 3300046524 Ga0495648_0041657 Ga0495648_0041657_2080_2814 244
641 3300046524 Ga0495648_0085646 Ga0495648_0085646_161_895 244
642 3300046524 Ga0495648_0104119 Ga0495648_0104119_86_820 244
643 3300046525 Ga0495663_0001620 Ga0495663_0001620_3859_4593 244
644 3300046525 Ga0495663_0004246 Ga0495663_0004246_2821_3555 244
645 3300046525 Ga0495663_0061576 Ga0495663_0061576_59_793 244
646 3300046525 Ga0495663_0096622 Ga0495663_0096622_143_877 244
647 3300046528 Ga0495642_0000587 Ga0495642_0000587_13971_14705 244
648 3300046528 Ga0495642_0000876 Ga0495642_0000876_2894_3628 244
649 3300046528 Ga0495642_0001506 Ga0495642_0001506_5738_6472 244
650 3300046528 Ga0495642_0002007 Ga0495642_0002007_5857_6591 244
651 3300046528 Ga0495642_0003631 Ga0495642_0003631_1383_2117 244
652 3300046528 Ga0495642_0026994 Ga0495642_0026994_300_1034 244
653 3300046528 Ga0495642_0028689 Ga0495642_0028689_79_813 244
654 3300046528 Ga0495642_0051203 Ga0495642_0051203_697_1431 244
655 3300046529 Ga0495652_0007905 Ga0495652_0007905_7458_8192 244
656 3300046529 Ga0495652_0032735 Ga0495652_0032735_1225_1959 244
657 3300046529 Ga0495652_0041809 Ga0495652_0041809_921_1655 244
658 3300046529 Ga0495652_0081403 Ga0495652_0081403_1220_1954 244
659 3300046530 Ga0495654_0000060 Ga0495654_0000060_6308_7042 244
660 3300046530 Ga0495654_0010226 Ga0495654_0010226_1846_2580 244
661 3300046530 Ga0495654_0013265 Ga0495654_0013265_777_1511 244
662 3300046530 Ga0495654_0018980 Ga0495654_0018980_1998_2732 244
663 3300046531 Ga0495665_0014977 Ga0495665_0014977_1860_2594 244
664 3300046531 Ga0495665_0032396 Ga0495665_0032396_912_1646 244
665 3300046535 Ga0495586_0017975 Ga0495586_0017975_2668_3402 244
666 3300046535 Ga0495586_0021446 Ga0495586_0021446_989_1723 244
667 3300046538 Ga0495609_0000007 Ga0495609_0000007_274024_274758 244
668 3300046538 Ga0495609_0001519 Ga0495609_0001519_10116_10850 244
669 3300046538 Ga0495609_0002547 Ga0495609_0002547_5495_6229 244
670 3300046538 Ga0495609_0002784 Ga0495609_0002784_8238_8972 244
671 3300046538 Ga0495609_0007980 Ga0495609_0007980_1281_2015 244
672 3300046538 Ga0495609_0010452 Ga0495609_0010452_1439_2173 244
673 3300046538 Ga0495609_0012437 Ga0495609_0012437_1976_2710 244
674 3300046538 Ga0495609_0027527 Ga0495609_0027527_237_971 244
675 3300046538 Ga0495609_0032381 Ga0495609_0032381_192_926 244
676 3300046538 Ga0495609_0059039 Ga0495609_0059039_155_889 244
677 3300046538 Ga0495609_0070427 Ga0495609_0070427_367_1101 244
678 3300046538 Ga0495609_0075686 Ga0495609_0075686_727_1461 244
679 3300046542 Ga0495597_0000907 Ga0495597_0000907_12541_13275 244
680 3300046542 Ga0495597_0002989 Ga0495597_0002989_3459_4193 244
681 3300046542 Ga0495597_0003023 Ga0495597_0003023_7227_7961 244
682 3300046542 Ga0495597_0003385 Ga0495597_0003385_2914_3648 244
683 3300046542 Ga0495597_0005581 Ga0495597_0005581_5541_6275 244
684 3300046542 Ga0495597_0005707 Ga0495597_0005707_2113_2847 244
685 3300046542 Ga0495597_0006706 Ga0495597_0006706_2627_3361 244
686 3300046542 Ga0495597_0008370 Ga0495597_0008370_3115_3849 244
687 3300046542 Ga0495597_0010738 Ga0495597_0010738_1027_1761 244
688 3300046542 Ga0495597_0042028 Ga0495597_0042028_1061_1795 244
689 3300046542 Ga0495597_0043540 Ga0495597_0043540_376_1110 244
690 3300046542 Ga0495597_0050403 Ga0495597_0050403_19_753 244
691 3300046543 Ga0495645_0074549 Ga0495645_0074549_689_1423 244
692 3300046543 Ga0495645_0111173 Ga0495645_0111173_418_1152 244
693 3300046557 Ga0495622_0002486 Ga0495622_0002486_5826_6560 244
694 3300046557 Ga0495622_0002494 Ga0495622_0002494_6095_6829 244
695 3300046557 Ga0495622_0159298 Ga0495622_0159298_154_888 244
696 3300046558 Ga0495633_0002814 Ga0495633_0002814_2876_3610 244
697 3300046558 Ga0495633_0002851 Ga0495633_0002851_6716_7450 244
698 3300046558 Ga0495633_0004074 Ga0495633_0004074_2789_3523 244
699 3300046558 Ga0495633_0006023 Ga0495633_0006023_514_1248 244
700 3300046558 Ga0495633_0006720 Ga0495633_0006720_1497_2231 244
701 3300046558 Ga0495633_0007463 Ga0495633_0007463_2476_3210 244
702 3300046558 Ga0495633_0008007 Ga0495633_0008007_2788_3522 244
703 3300046558 Ga0495633_0008646 Ga0495633_0008646_2894_3628 244
704 3300046558 Ga0495633_0014098 Ga0495633_0014098_707_1441 244
705 3300046558 Ga0495633_0026789 Ga0495633_0026789_114_848 244
706 3300046558 Ga0495633_0046632 Ga0495633_0046632_18_752 244
707 3300046558 Ga0495633_0062757 Ga0495633_0062757_18_752 244
708 3300046558 Ga0495633_0077343 Ga0495633_0077343_280_1014 244
709 3300046559 Ga0495667_0056292 Ga0495667_0056292_911_1645 244
710 3300046615 Ga0495656_0001760 Ga0495656_0001760_4284_5018 244
711 3300046615 Ga0495656_0017319 Ga0495656_0017319_1997_2731 244
712 3300046615 Ga0495656_0047268 Ga0495656_0047268_1029_1763 244
713 3300046615 Ga0495656_0307701 Ga0495656_0307701_62_796 244
714 3300046616 Ga0495668_0000343 Ga0495668_0000343_5619_6353 244
715 3300046616 Ga0495668_0001087 Ga0495668_0001087_16026_16760 244
716 3300046616 Ga0495668_0001732 Ga0495668_0001732_6284_7018 244
717 3300046616 Ga0495668_0003183 Ga0495668_0003183_9113_9847 244
718 3300046616 Ga0495668_0003908 Ga0495668_0003908_7470_8204 244
719 3300046616 Ga0495668_0004561 Ga0495668_0004561_3219_3953 244
720 3300046616 Ga0495668_0005358 Ga0495668_0005358_6632_7366 244
721 3300046616 Ga0495668_0005407 Ga0495668_0005407_39_773 244
722 3300046616 Ga0495668_0009136 Ga0495668_0009136_3436_4170 244
723 3300046616 Ga0495668_0017136 Ga0495668_0017136_2733_3467 244
724 3300046616 Ga0495668_0037723 Ga0495668_0037723_1252_1986 244
725 3300046616 Ga0495668_0054847 Ga0495668_0054847_360_1094 244
726 3300046616 Ga0495668_0100225 Ga0495668_0100225_777_1511 244
727 3300046648 Ga0495611_0001456 Ga0495611_0001456_6916_7650 244
728 3300046648 Ga0495611_0013168 Ga0495611_0013168_2018_2752 244
729 3300046648 Ga0495611_0016564 Ga0495611_0016564_1143_1877 244
730 3300046648 Ga0495611_0022060 Ga0495611_0022060_394_1128 244
731 3300046648 Ga0495611_0045159 Ga0495611_0045159_889_1623 244
732 3300046660 Ga0495625_0003347 Ga0495625_0003347_9276_10040 244
733 3300046660 Ga0495625_0006637 Ga0495625_0006637_6754_7488 244
734 3300046660 Ga0495625_0007014 Ga0495625_0007014_6523_7257 244
735 3300046660 Ga0495625_0007415 Ga0495625_0007415_26_760 244
736 3300046660 Ga0495625_0007684 Ga0495625_0007684_6024_6758 244
737 3300046660 Ga0495625_0013314 Ga0495625_0013314_580_1314 244
738 3300046660 Ga0495625_0015335 Ga0495625_0015335_2254_2988 244
739 3300046660 Ga0495625_0035107 Ga0495625_0035107_2866_3600 244
740 3300046660 Ga0495625_0047992 Ga0495625_0047992_2026_2760 244
741 3300046660 Ga0495625_0092102 Ga0495625_0092102_1234_1968 244
742 3300046660 Ga0495625_0388953 Ga0495625_0388953_37_771 244
743 3300046663 Ga0495635_0053923 Ga0495635_0053923_1124_1858 244
744 3300046664 Ga0495659_0001316 Ga0495659_0001316_5227_5961 244
745 3300046664 Ga0495659_0004057 Ga0495659_0004057_2723_3457 244
746 3300046664 Ga0495659_0011058 Ga0495659_0011058_500_1234 244
747 3300046664 Ga0495659_0012089 Ga0495659_0012089_1721_2455 244
748 3300046664 Ga0495659_0049601 Ga0495659_0049601_480_1214 244
749 3300046664 Ga0495659_0137873 Ga0495659_0137873_176_910 244
750 3300046665 Ga0495661_0000788 Ga0495661_0000788_23477_24211 244
751 3300046665 Ga0495661_0004283 Ga0495661_0004283_6834_7568 244
752 3300046665 Ga0495661_0007508 Ga0495661_0007508_4585_5319 244
753 3300046665 Ga0495661_0008231 Ga0495661_0008231_1500_2234 244
754 3300046665 Ga0495661_0010573 Ga0495661_0010573_2564_3298 244
755 3300046665 Ga0495661_0026189 Ga0495661_0026189_1228_1962 244
756 3300046665 Ga0495661_0027932 Ga0495661_0027932_1550_2284 244
757 3300046665 Ga0495661_0030098 Ga0495661_0030098_422_1156 244
758 3300046665 Ga0495661_0033613 Ga0495661_0033613_1683_2417 244
759 3300046665 Ga0495661_0034461 Ga0495661_0034461_926_1660 244
760 3300046665 Ga0495661_0037884 Ga0495661_0037884_719_1453 244
761 3300046665 Ga0495661_0057480 Ga0495661_0057480_977_1711 244
762 3300046665 Ga0495661_0065346 Ga0495661_0065346_572_1306 244
763 3300046665 Ga0495661_0085830 Ga0495661_0085830_861_1595 244
764 3300046674 Ga0495588_0000147 Ga0495588_0000147_46354_47088 244
765 3300046674 Ga0495588_0014594 Ga0495588_0014594_1812_2546 244
766 3300046674 Ga0495588_0017622 Ga0495588_0017622_1938_2672 244
767 3300046674 Ga0495588_0022311 Ga0495588_0022311_1760_2494 244
768 3300046674 Ga0495588_0033805 Ga0495588_0033805_1178_1912 244
769 3300046674 Ga0495588_0043042 Ga0495588_0043042_160_894 244
770 3300046674 Ga0495588_0058718 Ga0495588_0058718_877_1611 244
771 3300046674 Ga0495588_0060865 Ga0495588_0060865_450_1214 244
772 3300046674 Ga0495588_0064041 Ga0495588_0064041_851_1585 244
773 3300046674 Ga0495588_0089576 Ga0495588_0089576_457_1191 244
774 3300046674 Ga0495588_0106232 Ga0495588_0106232_390_1124 244
775 3300046674 Ga0495588_0151507 Ga0495588_0151507_73_807 244
776 3300046678 Ga0495599_0005211 Ga0495599_0005211_6128_6862 244
777 3300046680 Ga0495646_0008367 Ga0495646_0008367_731_1465 244
778 3300046680 Ga0495646_0023778 Ga0495646_0023778_2511_3245 244
779 3300046684 Ga0495669_0007961 Ga0495669_0007961_2211_2945 244
780 3300046684 Ga0495669_0013268 Ga0495669_0013268_1902_2636 244
781 3300046684 Ga0495669_0013494 Ga0495669_0013494_2382_3116 244
782 3300046689 Ga0495613_0045730 Ga0495613_0045730_1503_2237 244
783 3300046690 Ga0495624_0011275 Ga0495624_0011275_894_1628 244
784 3300046690 Ga0495624_0022700 Ga0495624_0022700_546_1280 244
785 3300046690 Ga0495624_0042991 Ga0495624_0042991_137_871 244
786 3300046691 Ga0495670_0001254 Ga0495670_0001254_7101_7835 244
787 3300046691 Ga0495670_0004528 Ga0495670_0004528_2736_3470 244
788 3300046691 Ga0495670_0009328 Ga0495670_0009328_1480_2214 244
789 3300046691 Ga0495670_0010129 Ga0495670_0010129_3626_4360 244
790 3300046691 Ga0495670_0049309 Ga0495670_0049309_951_1685 244
791 3300046691 Ga0495670_0053103 Ga0495670_0053103_700_1434 244
792 3300046691 Ga0495670_0102139 Ga0495670_0102139_629_1363 244
793 3300046691 Ga0495670_0212428 Ga0495670_0212428_258_992 244
794 3300046691 Ga0495670_0308568 Ga0495670_0308568_23_757 244
795 3300046692 Ga0495671_0000026 Ga0495671_0000026_12272_13006 244
796 3300046692 Ga0495671_0001460 Ga0495671_0001460_12367_13101 244
797 3300046692 Ga0495671_0001961 Ga0495671_0001961_1436_2170 244
798 3300046692 Ga0495671_0005885 Ga0495671_0005885_2497_3231 244
799 3300046692 Ga0495671_0006589 Ga0495671_0006589_2532_3266 244
800 3300046692 Ga0495671_0022149 Ga0495671_0022149_1114_1848 244
801 3300046692 Ga0495671_0024992 Ga0495671_0024992_239_973 244
802 3300046692 Ga0495671_0033940 Ga0495671_0033940_1480_2214 244
803 3300046692 Ga0495671_0038113 Ga0495671_0038113_675_1409 244
804 3300046694 Ga0495649_0001335 Ga0495649_0001335_13935_14669 244
805 3300046694 Ga0495649_0004497 Ga0495649_0004497_384_1118 244
806 3300046694 Ga0495649_0018456 Ga0495649_0018456_531_1265 244
807 3300046694 Ga0495649_0031678 Ga0495649_0031678_1909_2643 244
808 3300046694 Ga0495649_0034553 Ga0495649_0034553_1846_2580 244
809 3300046694 Ga0495649_0079750 Ga0495649_0079750_143_877 244
810 3300046794 Ga0495589_0000744 Ga0495589_0000744_14217_14951 244
811 3300046794 Ga0495589_0002015 Ga0495589_0002015_8596_9330 244
812 3300046794 Ga0495589_0002358 Ga0495589_0002358_3261_3995 244
813 3300046794 Ga0495589_0011232 Ga0495589_0011232_301_1035 244
814 3300046794 Ga0495589_0030555 Ga0495589_0030555_958_1692 244
815 3300046794 Ga0495589_0055292 Ga0495589_0055292_114_848 244
816 3300046794 Ga0495589_0061523 Ga0495589_0061523_275_1009 244
817 3300046794 Ga0495589_0083801 Ga0495589_0083801_359_1093 244
818 3300046809 Ga0495600_0000574 Ga0495600_0000574_9756_10490 244
819 3300046809 Ga0495600_0022926 Ga0495600_0022926_1700_2434 244
820 3300046809 Ga0495600_0211469 Ga0495600_0211469_271_1005 244
821 3300046810 Ga0495660_0000101 Ga0495660_0000101_83645_84379 244
822 3300046810 Ga0495660_0001103 Ga0495660_0001103_4398_5132 244
823 3300046810 Ga0495660_0002130 Ga0495660_0002130_1782_2516 244
824 3300046810 Ga0495660_0005483 Ga0495660_0005483_2695_3429 244
825 3300046810 Ga0495660_0009610 Ga0495660_0009610_2643_3377 244
826 3300046810 Ga0495660_0010073 Ga0495660_0010073_2794_3528 244
827 3300046810 Ga0495660_0029272 Ga0495660_0029272_1071_1805 244
828 3300046810 Ga0495660_0047713 Ga0495660_0047713_502_1236 244
829 3300046810 Ga0495660_0068129 Ga0495660_0068129_359_1093 244
830 3300046810 Ga0495660_0088690 Ga0495660_0088690_80_814 244
831 3300046810 Ga0495660_0097211 Ga0495660_0097211_381_1115 244
832 3300047315 Ga0495581_0010383 Ga0495581_0010383_1252_1986 244
833 3300047315 Ga0495581_0038882 Ga0495581_0038882_370_1104 244
834 3300047317 Ga0495604_0006351 Ga0495604_0006351_1663_2397 244
835 3300047317 Ga0495604_0111832 Ga0495604_0111832_658_1392 244
836 3300047318 Ga0495636_0001420 Ga0495636_0001420_2639_3373 244
837 3300047318 Ga0495636_0002442 Ga0495636_0002442_5487_6221 244
838 3300047318 Ga0495636_0004292 Ga0495636_0004292_3149_3883 244
839 3300047318 Ga0495636_0006432 Ga0495636_0006432_1231_1965 244
840 3300047318 Ga0495636_0012427 Ga0495636_0012427_1813_2547 244
841 3300047319 Ga0495674_0001181 Ga0495674_0001181_13673_14407 244
842 3300047319 Ga0495674_0090508 Ga0495674_0090508_1131_1865 244
843 3300047320 Ga0495672_0000340 Ga0495672_0000340_3086_3820 244
844 3300047320 Ga0495672_0000348 Ga0495672_0000348_50058_50792 244
845 3300047320 Ga0495672_0001839 Ga0495672_0001839_13205_13939 244
846 3300047320 Ga0495672_0003446 Ga0495672_0003446_9894_10628 244
847 3300047320 Ga0495672_0007196 Ga0495672_0007196_5540_6274 244
848 3300047320 Ga0495672_0042744 Ga0495672_0042744_49_783 244
849 3300047321 Ga0495676_0024269 Ga0495676_0024269_2412_3146 244
850 3300047321 Ga0495676_0029806 Ga0495676_0029806_1554_2288 244
851 3300047321 Ga0495676_0217029 Ga0495676_0217029_318_1052 244
852 3300047321 Ga0495676_0219987 Ga0495676_0219987_552_1286 244
853 3300047322 Ga0495680_0209144 Ga0495680_0209144_167_901 244
854 3300047323 Ga0495683_0001121 Ga0495683_0001121_3857_4591 244
855 3300047323 Ga0495683_0001282 Ga0495683_0001282_10167_10901 244
856 3300047323 Ga0495683_0003427 Ga0495683_0003427_2865_3599 244
857 3300047323 Ga0495683_0019747 Ga0495683_0019747_2349_3083 244
858 3300047323 Ga0495683_0037847 Ga0495683_0037847_822_1556 244
859 3300047323 Ga0495683_0107345 Ga0495683_0107345_156_890 244
860 3300047323 Ga0495683_0118344 Ga0495683_0118344_455_1189 244
861 3300047443 Ga0495687_000030 Ga0495687_000030_112162_112896 244
862 3300047443 Ga0495687_000120 Ga0495687_000120_98413_99147 244
863 3300047443 Ga0495687_000374 Ga0495687_000374_48444_49178 244
864 3300047443 Ga0495687_000814 Ga0495687_000814_5628_6362 244
865 3300047443 Ga0495687_002263 Ga0495687_002263_7545_8279 244
866 3300047443 Ga0495687_005069 Ga0495687_005069_6820_7554 244
867 3300047443 Ga0495687_005087 Ga0495687_005087_1900_2634 244
868 3300047443 Ga0495687_006481 Ga0495687_006481_5175_5909 244
869 3300047443 Ga0495687_006723 Ga0495687_006723_845_1579 244
870 3300047443 Ga0495687_018413 Ga0495687_018413_1358_2092 244
871 3300047445 Ga0495677_0000045 Ga0495677_0000045_26496_27230 244
872 3300047445 Ga0495677_0001255 Ga0495677_0001255_4258_4992 244
873 3300047445 Ga0495677_0001897 Ga0495677_0001897_4054_4788 244
874 3300047445 Ga0495677_0002978 Ga0495677_0002978_2962_3696 244
875 3300047445 Ga0495677_0003654 Ga0495677_0003654_3823_4557 244
876 3300047445 Ga0495677_0003854 Ga0495677_0003854_1932_2666 244
877 3300047445 Ga0495677_0005291 Ga0495677_0005291_1694_2428 244
878 3300047445 Ga0495677_0030911 Ga0495677_0030911_34_768 244
879 3300047445 Ga0495677_0033917 Ga0495677_0033917_292_1026 244
880 3300047445 Ga0495677_0036059 Ga0495677_0036059_370_1104 244
881 3300047445 Ga0495677_0053556 Ga0495677_0053556_215_949 244
882 3300047446 Ga0495679_002165 Ga0495679_002165_3503_4237 244
883 3300047446 Ga0495679_003747 Ga0495679_003747_2781_3515 244
884 3300047446 Ga0495679_013607 Ga0495679_013607_106_840 244
885 3300047446 Ga0495679_020712 Ga0495679_020712_1071_1805 244
886 3300047447 Ga0495685_000505 Ga0495685_000505_5734_6468 244
887 3300047447 Ga0495685_001117 Ga0495685_001117_1481_2215 244
888 3300047447 Ga0495685_044866 Ga0495685_044866_100_834 244
889 3300047469 Ga0495673_0000179 Ga0495673_0000179_94660_95394 244
890 3300047469 Ga0495673_0000201 Ga0495673_0000201_974_1708 244
891 3300047469 Ga0495673_0000391 Ga0495673_0000391_6274_7008 244
892 3300047469 Ga0495673_0010934 Ga0495673_0010934_707_1441 244
893 3300047469 Ga0495673_0022072 Ga0495673_0022072_1182_1916 244
894 3300047470 Ga0495681_0002281 Ga0495681_0002281_9978_10739 244
895 3300047470 Ga0495681_0004090 Ga0495681_0004090_2157_2891 244
896 3300047470 Ga0495681_0005170 Ga0495681_0005170_5116_5850 244
897 3300047470 Ga0495681_0005907 Ga0495681_0005907_4597_5331 244
898 3300047470 Ga0495681_0005937 Ga0495681_0005937_5437_6171 244
899 3300047470 Ga0495681_0017127 Ga0495681_0017127_2592_3326 244
900 3300047470 Ga0495681_0020045 Ga0495681_0020045_2800_3534 244
901 3300047470 Ga0495681_0027137 Ga0495681_0027137_1567_2301 244
902 3300047470 Ga0495681_0035175 Ga0495681_0035175_345_1079 244
903 3300047470 Ga0495681_0036810 Ga0495681_0036810_234_968 244
904 3300047470 Ga0495681_0051141 Ga0495681_0051141_928_1662 244
905 3300047470 Ga0495681_0055757 Ga0495681_0055757_495_1229 244
906 3300047472 Ga0495686_0000793 Ga0495686_0000793_28132_28866 244
907 3300047472 Ga0495686_0001487 Ga0495686_0001487_13606_14340 244
908 3300047472 Ga0495686_0002313 Ga0495686_0002313_2570_3304 244
909 3300047472 Ga0495686_0007032 Ga0495686_0007032_5733_6467 244
910 3300047472 Ga0495686_0012729 Ga0495686_0012729_1426_2160 244
911 3300047472 Ga0495686_0016478 Ga0495686_0016478_3308_4042 244
912 3300047472 Ga0495686_0021328 Ga0495686_0021328_2325_3059 244
913 3300047472 Ga0495686_0077016 Ga0495686_0077016_226_960 244
914 3300047472 Ga0495686_0099123 Ga0495686_0099123_146_880 244
915 3300047673 Ga0495593_0025631 Ga0495593_0025631_2120_2854 244
916 3300047673 Ga0495593_0025956 Ga0495593_0025956_1828_2562 244
917 3300048088 Ga0495602_0024518 Ga0495602_0024518_3757_4491 244
918 3300048088 Ga0495602_0087339 Ga0495602_0087339_717_1451 244
919 3300048088 Ga0495602_0170950 Ga0495602_0170950_889_1623 244
920 3300048091 Ga0495626_0000022 Ga0495626_0000022_207527_208261 244
921 3300048091 Ga0495626_0000105 Ga0495626_0000105_98531_99265 244
922 3300048091 Ga0495626_0001496 Ga0495626_0001496_7415_8149 244
923 3300048091 Ga0495626_0002464 Ga0495626_0002464_4463_5197 244
924 3300048091 Ga0495626_0004240 Ga0495626_0004240_288_1022 244
925 3300048091 Ga0495626_0009776 Ga0495626_0009776_1626_2360 244
926 3300048091 Ga0495626_0025600 Ga0495626_0025600_1109_1843 244
927 3300048091 Ga0495626_0027200 Ga0495626_0027200_1589_2323 244
928 3300048091 Ga0495626_0035334 Ga0495626_0035334_381_1115 244
929 3300048091 Ga0495626_0046884 Ga0495626_0046884_955_1689 244
930 3300048091 Ga0495626_0047022 Ga0495626_0047022_965_1699 244
931 3300048091 Ga0495626_0048178 Ga0495626_0048178_243_977 244
932 3300048091 Ga0495626_0049362 Ga0495626_0049362_1181_1915 244
933 3300048091 Ga0495626_0074510 Ga0495626_0074510_37_771 244
934 3300048903 Ga0496100_0071368 Ga0496100_0071368_1146_1907 244
935 3300048903 Ga0496100_0152475 Ga0496100_0152475_689_1423 244
936 3300048904 Ga0496101_0012306 Ga0496101_0012306_3729_4490 244
937 3300048905 Ga0496102_0000836 Ga0496102_0000836_7407_8141 244
938 3300048905 Ga0496102_0001960 Ga0496102_0001960_11072_11806 244
939 3300048905 Ga0496102_0116493 Ga0496102_0116493_423_1157 244
940 3300048905 Ga0496102_0159383 Ga0496102_0159383_105_839 244
941 3300048905 Ga0496102_0249210 Ga0496102_0249210_39_773 244
942 3300048906 Ga0496103_0035508 Ga0496103_0035508_572_1306 244
943 3300048906 Ga0496103_0056784 Ga0496103_0056784_1665_2399 244
944 3300048906 Ga0496103_0066831 Ga0496103_0066831_1326_2060 244
945 3300048907 Ga0496104_0706501 Ga0496104_0706501_101_835 244
946 3300048909 Ga0496106_0007806 Ga0496106_0007806_1310_2044 244
947 3300048909 Ga0496106_0142191 Ga0496106_0142191_265_999 244
948 3300048910 Ga0496107_0037389 Ga0496107_0037389_522_1256 244
949 3300048910 Ga0496107_0125500 Ga0496107_0125500_78_812 244
950 3300048910 Ga0496107_0329708 Ga0496107_0329708_374_1108 244
951 3300048910 Ga0496107_0531092 Ga0496107_0531092_78_812 244
952 3300048911 Ga0496108_0337275 Ga0496108_0337275_124_858 244
953 3300048912 Ga0496109_0019163 Ga0496109_0019163_2597_3358 244
954 3300048912 Ga0496109_0180887 Ga0496109_0180887_359_1093 244
955 3300048913 Ga0496110_0003614 Ga0496110_0003614_6552_7286 244
956 3300048913 Ga0496110_0106607 Ga0496110_0106607_185_919 244
957 3300048913 Ga0496110_0366094 Ga0496110_0366094_237_971 244
958 3300048914 Ga0496111_0035112 Ga0496111_0035112_2688_3422 244
959 3300048916 Ga0496113_0007466 Ga0496113_0007466_3228_3962 244
960 3300048917 Ga0496114_0102792 Ga0496114_0102792_1278_2012 244
961 3300048917 Ga0496114_0569376 Ga0496114_0569376_38_772 244
962 3300048918 Ga0496115_0031619 Ga0496115_0031619_1018_1782 244
963 3300048919 Ga0496116_0161931 Ga0496116_0161931_31_765 244
964 3300048920 Ga0496117_0000005 Ga0496117_0000005_594510_595244 244
965 3300048921 Ga0496118_0000031 Ga0496118_0000031_182225_182959 244
966 3300048924 Ga0496121_0011729 Ga0496121_0011729_6623_7357 244
967 3300048924 Ga0496121_0023622 Ga0496121_0023622_3452_4186 244
968 3300048924 Ga0496121_0027645 Ga0496121_0027645_3514_4248 244
969 3300048924 Ga0496121_0048724 Ga0496121_0048724_535_1269 244
970 3300048924 Ga0496121_0064564 Ga0496121_0064564_872_1606 244
971 3300048925 Ga0496122_0003525 Ga0496122_0003525_1574_2308 244
972 3300048925 Ga0496122_0004630 Ga0496122_0004630_8362_9096 244
973 3300048925 Ga0496122_0010326 Ga0496122_0010326_2886_3647 244
974 3300048925 Ga0496122_0011135 Ga0496122_0011135_3863_4597 244
975 3300048925 Ga0496122_0030996 Ga0496122_0030996_1552_2286 244
976 3300048926 Ga0496123_0003683 Ga0496123_0003683_14672_15406 244
977 3300048926 Ga0496123_0006523 Ga0496123_0006523_7816_8550 244
978 3300048926 Ga0496123_0013096 Ga0496123_0013096_2778_3539 244
979 3300048926 Ga0496123_0014932 Ga0496123_0014932_2677_3411 244
980 3300048926 Ga0496123_0016214 Ga0496123_0016214_3871_4605 244
981 3300048927 Ga0496124_0004471 Ga0496124_0004471_10115_10849 244
982 3300048927 Ga0496124_0010787 Ga0496124_0010787_2604_3338 244
983 3300048927 Ga0496124_0012015 Ga0496124_0012015_670_1404 244
984 3300048927 Ga0496124_0140991 Ga0496124_0140991_1041_1775 244
985 3300048927 Ga0496124_0148322 Ga0496124_0148322_138_872 244
986 3300048927 Ga0496124_0186639 Ga0496124_0186639_179_913 244
987 3300048927 Ga0496124_0272975 Ga0496124_0272975_158_892 244
988 3300048927 Ga0496124_0309621 Ga0496124_0309621_49_783 244
989 3300048928 Ga0496125_0005087 Ga0496125_0005087_12297_13031 244
990 3300048928 Ga0496125_0007226 Ga0496125_0007226_8985_9719 244
991 3300048928 Ga0496125_0009631 Ga0496125_0009631_2924_3685 244
992 3300048928 Ga0496125_0038131 Ga0496125_0038131_2823_3557 244
993 3300048929 Ga0496126_0031712 Ga0496126_0031712_986_1720 244
994 3300049128 Ga0501308_001808 Ga0501308_001808_66_800 244
995 3300049459 Ga0495678_000010 Ga0495678_000010_240758_241492 244
996 3300049459 Ga0495678_000190 Ga0495678_000190_6470_7204 244
997 3300049459 Ga0495678_000774 Ga0495678_000774_1556_2290 244
998 3300049459 Ga0495678_002527 Ga0495678_002527_6051_6785 244
999 3300049459 Ga0495678_007129 Ga0495678_007129_2408_3142 244
1000 3300049459 Ga0495678_010503 Ga0495678_010503_805_1539 244
1001 3300049459 Ga0495678_019199 Ga0495678_019199_1551_2285 244
1002 3300049459 Ga0495678_035133 Ga0495678_035133_1080_1814 244
1003 3300049459 Ga0495678_071648 Ga0495678_071648_106_840 244
1004 3300049460 Ga0495682_0001034 Ga0495682_0001034_3136_3870 244
1005 3300049460 Ga0495682_0005671 Ga0495682_0005671_1864_2598 244
1006 3300049460 Ga0495682_0045630 Ga0495682_0045630_508_1242 244
1007 3300049513 Ga0501290_001453 Ga0501290_001453_231_968 244
1008 3300049569 Ga0501032_0025216 Ga0501032_0025216_2807_3541 244
1009 3300049571 Ga0501034_0170472 Ga0501034_0170472_305_1039 244
1010 3300049654 Ga0501207_020312 Ga0501207_020312_156_890 244
1011 3300049667 Ga0501230_002213 Ga0501230_002213_57_791 244
1012 3300049671 Ga0501238_004739 Ga0501238_004739_853_1587 244
1013 3300049679 Ga0501249_003941 Ga0501249_003941_1082_1816 244
1014 3300049766 Ga0501269_000416 Ga0501269_000416_7905_8639 244
1015 3300049775 Ga0501279_008716 Ga0501279_008716_278_1012 244
1016 3300050511 nmdc:mga08y16_405438_c1 nmdc:mga08y16_405438_c1_275_1009 244
1017 3300050512 nmdc:mga0n895_34016_c1 nmdc:mga0n895_34016_c1_2394_3128 244
1018 3300050515 nmdc:mga0a205_203132_c1 nmdc:mga0a205_203132_c1_833_1567 244
1019 3300053077 Ga0495601_0009638 Ga0495601_0009638_2597_3331 244
1020 3300053111 Ga0500572_016555 Ga0500572_016555_311_1045 244
1021 3300053118 Ga0500594_0006183 Ga0500594_0006183_985_1719 244
1022 3300053119 Ga0500595_001801 Ga0500595_001801_8235_8969 244
1023 3300053125 Ga0500618_000364 Ga0500618_000364_964_1698 244
1024 3300053125 Ga0500618_003165 Ga0500618_003165_2932_3666 244
1025 3300053125 Ga0500618_004967 Ga0500618_004967_1218_1952 244
1026 3300053141 Ga0500574_002852 Ga0500574_002852_1313_2047 244
1027 3300053145 Ga0500586_002898 Ga0500586_002898_984_1718 244
1028 3300053145 Ga0500586_021361 Ga0500586_021361_126_860 244
1029 3300053154 Ga0500619_000766 Ga0500619_000766_2946_3680 244
1030 3300053161 Ga0500634_0123624 Ga0500634_0123624_476_1210 244
1031 3300059478 Ga0587093_007139 Ga0587093_007139_330_1064 244
1032 3300059493 Ga0587077_016481 Ga0587077_016481_336_1070 244
1033 3300059504 Ga0587082_014811 Ga0587082_014811_431_1165 244
1034 3300059505 Ga0587083_0022915 Ga0587083_0022915_139_873 244
1035 3300059505 Ga0587083_0025900 Ga0587083_0025900_319_1053 244
1036 3300059506 Ga0587085_008539 Ga0587085_008539_194_928 244
1037 3300059510 Ga0587090_010604 Ga0587090_010604_217_951 244
1038 3300059510 Ga0587090_011356 Ga0587090_011356_273_1007 244
1039 3300059511 Ga0587091_040564 Ga0587091_040564_26_760 244
1040 3300059512 Ga0587092_010749 Ga0587092_010749_376_1110 244
1041 3300059639 Ga0587062_004270 Ga0587062_004270_610_1344 244
1042 3300059641 Ga0587068_004766 Ga0587068_004766_940_1674 244
1043 3300059641 Ga0587068_008736 Ga0587068_008736_171_905 244
1044 3300059643 Ga0587072_020222 Ga0587072_020222_159_893 244
1045 3300059643 Ga0587072_021628 Ga0587072_021628_145_879 244
1046 3300059645 Ga0587076_035377 Ga0587076_035377_145_879 244
1047 3300059647 Ga0587079_026495 Ga0587079_026495_228_962 244
1048 3300060346 Ga0587111_0007637 Ga0587111_0007637_172_906 244
1049 3300061719 Ga0466962_0013955 Ga0466962_0013955_1699_2433 244
1050 3300061719 Ga0466962_0031666 Ga0466962_0031666_16_750 244
1051 iso_pu_bacteria 2687453129 2687577761 244
1052 iso_pu_bacteria 8057160832 8057162633 244
1053 3300005435 Ga0070714_100038437 Ga0070714_1000384373 245
1054 3300005436 Ga0070713_100065540 Ga0070713_1000655403 245
1055 3300005458 Ga0070681_10079256 Ga0070681_100792563 245
1056 3300005539 Ga0068853_100178370 Ga0068853_1001783702 245
1057 3300005563 Ga0068855_100003915 Ga0068855_10000391513 245
1058 3300005564 Ga0070664_100592055 Ga0070664_1005920552 245
1059 3300005614 Ga0068856_100161565 Ga0068856_1001615652 245
1060 3300006028 Ga0070717_10293650 Ga0070717_102936502 245
1061 3300009093 Ga0105240_10019527 Ga0105240_100195274 245
1062 3300009551 Ga0105238_10551097 Ga0105238_105510972 245
1063 3300013307 Ga0157372_10072658 Ga0157372_100726583 245
1064 3300021361 Ga0213872_10018649 Ga0213872_100186492 245
1065 3300025909 Ga0207705_10330705 Ga0207705_103307052 245
1066 3300025911 Ga0207654_10092385 Ga0207654_100923853 245
1067 3300025924 Ga0207694_10515190 Ga0207694_105151902 245
1068 3300025949 Ga0207667_10001085 Ga0207667_1000108525 245
1069 3300026041 Ga0207639_10337317 Ga0207639_103373172 245
1070 3300026078 Ga0207702_10022953 Ga0207702_100229537 245
1071 3300031239 Ga0265328_10000005 Ga0265328_10000005147 245
1072 3300031344 Ga0265316_10214386 Ga0265316_102143862 245
1073 3300035118 Ga0373954_0177355 Ga0373954_0177355_145_882 245
1074 3300039447 Ga0436361_0133183 Ga0436361_0133183_28088_28840 245
1075 3300039447 Ga0436361_1136783 Ga0436361_1136783_2246_2998 245
1076 3300044656 Ga0466969_0006033 Ga0466969_0006033_1991_2728 245
1077 3300044693 Ga0466961_0000260 Ga0466961_0000260_18546_19283 245
1078 3300044712 Ga0453684_0030951 Ga0453684_0030951_4879_5619 245
1079 3300045049 Ga0466959_0020955 Ga0466959_0020955_1228_1965 245
1080 3300046471 Ga0495650_0004232 Ga0495650_0004232_1995_2732 245
1081 3300049459 Ga0495678_001665 Ga0495678_001665_13402_14139 245
1082 3300049459 Ga0495678_006438 Ga0495678_006438_2502_3239 245
1083 3300026142 Ga0207698_10231225 Ga0207698_102312252 246
1084 3300027424 Ga0209984_1015393 Ga0209984_10153932 246
1085 3300031730 Ga0307516_10307486 Ga0307516_103074862 246
1086 3300032005 Ga0307411_10124650 Ga0307411_101246502 246
1087 3300035120 Ga0373957_0144322 Ga0373957_0144322_81_842 246
1088 3300035172 Ga0373955_0145301 Ga0373955_0145301_448_1209 246
1089 3300036401 Ga0373937_0039003 Ga0373937_0039003_2128_2889 246
1090 3300048927 Ga0496124_0000007 Ga0496124_0000007_381735_382508 246
1091 iso_pu_bacteria 2857542790 2857544047 246
1092 3300031727 Ga0316576_10105075 Ga0316576_101050753 247
1093 3300035398 Ga0316574_0005596 Ga0316574_0005596_5611_6354 247
1094 3300037418 Ga0395900_0042927 Ga0395900_0042927_1818_2570 247
1095 iso_pu_bacteria 2547132181 2547698536 247
1096 iso_pu_bacteria 2600255257 2601541779 247
1097 iso_pu_bacteria 2600255310 2601760177 247
1098 iso_pu_bacteria 2600255311 2601765541 247
1099 iso_pu_bacteria 2602042046 2603641611 247
1100 iso_pu_bacteria 2609459761 2609914184 247
1101 iso_pu_bacteria 2690315857 2691332773 247
1102 iso_pu_bacteria 2791355010 2792314559 247
1103 iso_pu_bacteria 2811995292 2813731170 247
1104 iso_pu_bacteria 2814123068 2814698862 247
1105 iso_pu_bacteria 2846540461 2846542741 247
1106 iso_pu_bacteria 2919534386 2919537900 247
1107 iso_pu_bacteria 2945874760 2945874978 247
1108 iso_pu_bacteria 8054357960 8054358892 247
1109 iso_pu_bacteria 8055693939 8055694180 247
1110 3300005330 Ga0070690_100269075 Ga0070690_1002690751 248
1111 3300005344 Ga0070661_100058455 Ga0070661_1000584552 248
1112 3300005458 Ga0070681_10014570 Ga0070681_100145702 248
1113 3300005539 Ga0068853_100004343 Ga0068853_1000043436 248
1114 3300005544 Ga0070686_100211913 Ga0070686_1002119131 248
1115 3300005563 Ga0068855_100396691 Ga0068855_1003966912 248
1116 3300006173 Ga0070716_100015793 Ga0070716_1000157933 248
1117 3300006881 Ga0068865_100057233 Ga0068865_1000572332 248
1118 3300009101 Ga0105247_10012542 Ga0105247_100125424 248
1119 3300009174 Ga0105241_10039775 Ga0105241_100397753 248
1120 3300013105 Ga0157369_10484147 Ga0157369_104841472 248
1121 3300014969 Ga0157376_10103651 Ga0157376_101036513 248
1122 3300025912 Ga0207707_10183472 Ga0207707_101834723 248
1123 3300025916 Ga0207663_10005967 Ga0207663_100059673 248
1124 3300025920 Ga0207649_10191300 Ga0207649_101913002 248
1125 3300025927 Ga0207687_10198559 Ga0207687_101985592 248
1126 3300025938 Ga0207704_10129377 Ga0207704_101293772 248
1127 3300025939 Ga0207665_10002622 Ga0207665_100026223 248
1128 3300025949 Ga0207667_10153364 Ga0207667_101533643 248
1129 3300025981 Ga0207640_10241346 Ga0207640_102413462 248
1130 3300025986 Ga0207658_10254903 Ga0207658_102549032 248
1131 3300026041 Ga0207639_10161261 Ga0207639_101612612 248
1132 3300026116 Ga0207674_10348802 Ga0207674_103488022 248
1133 3300031727 Ga0316576_10118312 Ga0316576_101183122 248
1134 3300032133 Ga0316583_10002143 Ga0316583_100021433 248
1135 3300046472 Ga0495580_0014963 Ga0495580_0014963_3432_4178 248
1136 3300046474 Ga0495605_0004070 Ga0495605_0004070_3432_4178 248
1137 3300046475 Ga0495639_0034531 Ga0495639_0034531_288_1034 248
1138 3300046476 Ga0495662_0153763 Ga0495662_0153763_246_992 248
1139 3300048913 Ga0496110_0054436 Ga0496110_0054436_2554_3300 248
1140 3300049579 Ga0501043_0210509 Ga0501043_0210509_662_1408 248
1141 3300049823 Ga0501044_0605967 Ga0501044_0605967_74_820 248
1142 3300053098 Ga0500650_0000173 Ga0500650_0000173_15324_16070 248
1143 3300036647 Ga0316582_0013300 Ga0316582_0013300_167_916 249
1144 3300036712 Ga0316584_0016947 Ga0316584_0016947_958_1707 249
1145 3300038742 Ga0400486_14879 Ga0400486_14879_12703_13452 249
1146 3300039062 Ga0400483_024557 Ga0400483_024557_10422_11171 249
1147 3300047323 Ga0495683_0025662 Ga0495683_0025662_583_1371 249
1148 3300047443 Ga0495687_000011 Ga0495687_000011_182511_183299 249
1149 3300053138 Ga0500564_015033 Ga0500564_015033_2226_2975 249
1150 3300035398 Ga0316574_0016538 Ga0316574_0016538_1298_2050 250
1151 3300035398 Ga0316574_0170392 Ga0316574_0170392_101_856 251
1152 3300036712 Ga0316584_0058617 Ga0316584_0058617_555_1310 251
1153 3300046452 Ga0495617_001485 Ga0495617_001485_1128_1883 251
1154 3300005347 Ga0070668_100355067 Ga0070668_1003550671 252
1155 3300005441 Ga0070700_100047678 Ga0070700_1000476784 252
1156 3300005456 Ga0070678_100149427 Ga0070678_1001494272 252
1157 3300005539 Ga0068853_100602475 Ga0068853_1006024752 252
1158 3300005543 Ga0070672_100303253 Ga0070672_1003032532 252
1159 3300009148 Ga0105243_10135951 Ga0105243_101359512 252
1160 3300009545 Ga0105237_10516438 Ga0105237_105164382 252
1161 3300013308 Ga0157375_10056113 Ga0157375_100561134 252
1162 3300015689 Ga0183360_10154 Ga0183360_101542 252
1163 3300025899 Ga0207642_10090366 Ga0207642_100903662 252
1164 3300025938 Ga0207704_10256567 Ga0207704_102565672 252
1165 3300025940 Ga0207691_10159973 Ga0207691_101599731 252
1166 3300025972 Ga0207668_10594829 Ga0207668_105948291 252
1167 3300026035 Ga0207703_10006804 Ga0207703_100068049 252
1168 3300026075 Ga0207708_10023225 Ga0207708_100232255 252
1169 3300026121 Ga0207683_10190397 Ga0207683_101903973 252
1170 iso_pu_bacteria 2510065053 2510284631 252
1171 iso_pu_bacteria 2510065055 2510295656 252
1172 iso_pu_bacteria 2510065058 2510312009 252
1173 iso_pu_bacteria 2511231004 2511254766 252
1174 iso_pu_bacteria 2511231006 2511265578 252
1175 iso_pu_bacteria 2511231007 2511271092 252
1176 iso_pu_bacteria 2511231008 2511280562 252
1177 iso_pu_bacteria 2511231010 2511288830 252
1178 iso_pu_bacteria 2511231011 2511293927 252
1179 iso_pu_bacteria 2511231012 2511302360 252
1180 iso_pu_bacteria 2511231014 2511315211 252
1181 iso_pu_bacteria 2511231015 2511319198 252
1182 iso_pu_bacteria 2511231016 2511323599 252
1183 iso_pu_bacteria 2511231017 2511331034 252
1184 iso_pu_bacteria 2511231018 2511336380 252
1185 iso_pu_bacteria 2511231019 2511345744 252
1186 iso_pu_bacteria 2511231020 2511349058 252
1187 iso_pu_bacteria 2511231021 2511355950 252
1188 iso_pu_bacteria 2511231022 2511361439 252
1189 iso_pu_bacteria 2511231023 2511368582 252
1190 iso_pu_bacteria 2511231024 2511376105 252
1191 iso_pu_bacteria 2511231031 2511411269 252
1192 iso_pu_bacteria 2511231156 2511822388 252
1193 iso_pu_bacteria 2512047018 2512325910 252
1194 iso_pu_bacteria 2554235132 2554818109 252
1195 iso_pu_bacteria 2554235231 2555245034 252
1196 iso_pu_bacteria 2554235341 2555667373 252
1197 iso_pu_bacteria 2582580891 2583789849 252
1198 iso_pu_bacteria 2597489887 2597855617 252
1199 iso_pu_bacteria 2597489888 2597861620 252
1200 iso_pu_bacteria 2597489889 2597867342 252
1201 iso_pu_bacteria 2599185155 2599327464 252
1202 iso_pu_bacteria 2599185160 2599356596 252
1203 iso_pu_bacteria 2599185161 2599363374 252
1204 iso_pu_bacteria 2599185162 2599369674 252
1205 iso_pu_bacteria 2599185163 2599376483 252
1206 iso_pu_bacteria 2599185164 2599381701 252
1207 iso_pu_bacteria 2599185165 2599388155 252
1208 iso_pu_bacteria 2599185166 2599395321 252
1209 iso_pu_bacteria 2599185167 2599398899 252
1210 iso_pu_bacteria 2599185168 2599407086 252
1211 iso_pu_bacteria 2599185179 2599450954 252
1212 iso_pu_bacteria 2599185181 2599463429 252
1213 iso_pu_bacteria 2599185182 2599469221 252
1214 iso_pu_bacteria 2599185185 2599485519 252
1215 iso_pu_bacteria 2599185186 2599492446 252
1216 iso_pu_bacteria 2599185188 2599500169 252
1217 iso_pu_bacteria 2599185189 2599506387 252
1218 iso_pu_bacteria 2599185190 2599514100 252
1219 iso_pu_bacteria 2599185191 2599518701 252
1220 iso_pu_bacteria 2599185212 2599614523 252
1221 iso_pu_bacteria 2599185248 2599769350 252
1222 iso_pu_bacteria 2599185257 2599806648 252
1223 iso_pu_bacteria 2599185288 2599882613 252
1224 iso_pu_bacteria 2599185289 2599886770 252
1225 iso_pu_bacteria 2599185290 2599893565 252
1226 iso_pu_bacteria 2599185291 2599898099 252
1227 iso_pu_bacteria 2599185300 2599930833 252
1228 iso_pu_bacteria 2599185302 2599943644 252
1229 iso_pu_bacteria 2599185303 2599952155 252
1230 iso_pu_bacteria 2599185304 2599955954 252
1231 iso_pu_bacteria 2599185305 2599962101 252
1232 iso_pu_bacteria 2599185306 2599966871 252
1233 iso_pu_bacteria 2599185308 2599978318 252
1234 iso_pu_bacteria 2599185309 2599984648 252
1235 iso_pu_bacteria 2599185310 2599991199 252
1236 iso_pu_bacteria 2599185311 2599994909 252
1237 iso_pu_bacteria 2599185312 2600002270 252
1238 iso_pu_bacteria 2599185313 2600004802 252
1239 iso_pu_bacteria 2599185314 2600012462 252
1240 iso_pu_bacteria 2599185315 2600019036 252
1241 iso_pu_bacteria 2599185316 2600023909 252
1242 iso_pu_bacteria 2599185317 2600033069 252
1243 iso_pu_bacteria 2599185318 2600034732 252
1244 iso_pu_bacteria 2599185319 2600044903 252
1245 iso_pu_bacteria 2599185320 2600048010 252
1246 iso_pu_bacteria 2599185321 2600053264 252
1247 iso_pu_bacteria 2599185322 2600061259 252
1248 iso_pu_bacteria 2599185323 2600068180 252
1249 iso_pu_bacteria 2599185324 2600071731 252
1250 iso_pu_bacteria 2599185325 2600077602 252
1251 iso_pu_bacteria 2599185356 2600216058 252
1252 iso_pu_bacteria 2600254930 2600359151 252
1253 iso_pu_bacteria 2600254931 2600364927 252
1254 iso_pu_bacteria 2600254954 2600443934 252
1255 iso_pu_bacteria 2600255296 2601692299 252
1256 iso_pu_bacteria 2600255313 2601776225 252
1257 iso_pu_bacteria 2600255318 2601797788 252
1258 iso_pu_bacteria 2600255389 2602008582 252
1259 iso_pu_bacteria 2603880185 2606076729 252
1260 iso_pu_bacteria 2603880199 2606128857 252
1261 iso_pu_bacteria 2606217733 2608380590 252
1262 iso_pu_bacteria 2619619299 2621302219 252
1263 iso_pu_bacteria 2623620443 2624478175 252
1264 iso_pu_bacteria 2623620446 2624489718 252
1265 iso_pu_bacteria 2643221565 2643840935 252
1266 iso_pu_bacteria 2643221571 2643872664 252
1267 iso_pu_bacteria 2643221589 2643954959 252
1268 iso_pu_bacteria 2643221602 2644024597 252
1269 iso_pu_bacteria 2643221633 2644186077 252
1270 iso_pu_bacteria 2643221650 2644282122 252
1271 iso_pu_bacteria 2643221713 2644619605 252
1272 iso_pu_bacteria 2651869719 2652546251 252
1273 iso_pu_bacteria 2667528170 2671090862 252
1274 iso_pu_bacteria 2667528171 2671100014 252
1275 iso_pu_bacteria 2667528176 2671127278 252
1276 iso_pu_bacteria 2671180172 2671772299 252
1277 iso_pu_bacteria 2675903420 2677898259 252
1278 iso_pu_bacteria 2675903515 2678260930 252
1279 iso_pu_bacteria 2713897149 2715759544 252
1280 iso_pu_bacteria 2718217725 2718632115 252
1281 iso_pu_bacteria 2721755607 2723246511 252
1282 iso_pu_bacteria 2728369097 2729146677 252
1283 iso_pu_bacteria 2738541265 2738674876 252
1284 iso_pu_bacteria 2738541282 2738753269 252
1285 iso_pu_bacteria 2738541294 2738807960 252
1286 iso_pu_bacteria 2738541303 2738862835 252
1287 iso_pu_bacteria 2738541309 2738895320 252
1288 iso_pu_bacteria 2738543004 2739197980 252
1289 iso_pu_bacteria 2738543015 2739260354 252
1290 iso_pu_bacteria 2738543020 2739286990 252
1291 iso_pu_bacteria 2738543021 2739292303 252
1292 iso_pu_bacteria 2738543025 2739311236 252
1293 iso_pu_bacteria 2740892503 2743735033 252
1294 iso_pu_bacteria 2744054620 2745006242 252
1295 iso_pu_bacteria 2765235841 2765581583 252
1296 iso_pu_bacteria 2773857670 2774119604 252
1297 iso_pu_bacteria 2773857672 2774130689 252
1298 iso_pu_bacteria 2773857673 2774134693 252
1299 iso_pu_bacteria 2784132063 2784261094 252
1300 iso_pu_bacteria 2784132072 2784316321 252
1301 iso_pu_bacteria 2791355520 2794593931 252
1302 iso_pu_bacteria 2806310737 2807406212 252
1303 iso_pu_bacteria 2806310745 2807454564 252
1304 iso_pu_bacteria 2808606361 2808856519 252
1305 iso_pu_bacteria 2808606373 2808905479 252
1306 iso_pu_bacteria 2808606376 2808922802 252
1307 iso_pu_bacteria 2808606377 2808932135 252
1308 iso_pu_bacteria 2808606378 2808936578 252
1309 iso_pu_bacteria 2808606379 2808939729 252
1310 iso_pu_bacteria 2808606380 2808944489 252
1311 iso_pu_bacteria 2808606381 2808954264 252
1312 iso_pu_bacteria 2808606382 2808955814 252
1313 iso_pu_bacteria 2808606383 2808964906 252
1314 iso_pu_bacteria 2808606385 2808976710 252
1315 iso_pu_bacteria 2808606388 2808991852 252
1316 iso_pu_bacteria 2808606389 2808999798 252
1317 iso_pu_bacteria 2808606445 2809217934 252
1318 iso_pu_bacteria 2811994881 2812370136 252
1319 iso_pu_bacteria 2816332298 2817488367 252
1320 iso_pu_bacteria 2818991456 2819657184 252
1321 iso_pu_bacteria 2818991464 2819705170 252
1322 iso_pu_bacteria 2823421272 2823425559 252
1323 iso_pu_bacteria 2825651385 2825654313 252
1324 iso_pu_bacteria 2826581358 2826582492 252
1325 iso_pu_bacteria 2834028612 2834032254 252
1326 iso_pu_bacteria 2842805378 2842809043 252
1327 iso_pu_bacteria 2842815866 2842817663 252
1328 iso_pu_bacteria 2842826826 2842830669 252
1329 iso_pu_bacteria 2842832357 2842834116 252
1330 iso_pu_bacteria 2842837860 2842838574 252
1331 iso_pu_bacteria 2842843487 2842846409 252
1332 iso_pu_bacteria 2842849001 2842851620 252
1333 iso_pu_bacteria 2842854478 2842858780 252
1334 iso_pu_bacteria 2844665904 2844667854 252
1335 iso_pu_bacteria 2852612431 2852617028 252
1336 iso_pu_bacteria 2852657418 2852660497 252
1337 iso_pu_bacteria 2852667396 2852671983 252
1338 iso_pu_bacteria 2860339153 2860343684 252
1339 iso_pu_bacteria 2860867994 2860872879 252
1340 iso_pu_bacteria 2878029506 2878030120 252
1341 iso_pu_bacteria 2880230671 2880231067 252
1342 iso_pu_bacteria 2904518522 2904519526 252
1343 iso_pu_bacteria 2904550169 2904552289 252
1344 iso_pu_bacteria 2908446538 2908446985 252
1345 iso_pu_bacteria 2912963787 2912964152 252
1346 iso_pu_bacteria 2913036834 2913037228 252
1347 iso_pu_bacteria 2917070673 2917071124 252
1348 iso_pu_bacteria 2917832318 2917834393 252
1349 iso_pu_bacteria 2919063839 2919066198 252
1350 iso_pu_bacteria 2919125081 2919127946 252
1351 iso_pu_bacteria 2919155634 2919157561 252
1352 iso_pu_bacteria 2919385768 2919389821 252
1353 iso_pu_bacteria 2919456309 2919459941 252
1354 iso_pu_bacteria 2919481497 2919486832 252
1355 iso_pu_bacteria 2919487758 2919488753 252
1356 iso_pu_bacteria 2919501602 2919502295 252
1357 iso_pu_bacteria 2919697872 2919699003 252
1358 iso_pu_bacteria 2923153595 2923154028 252
1359 iso_pu_bacteria 2923519811 2923524227 252
1360 iso_pu_bacteria 2923586266 2923589725 252
1361 iso_pu_bacteria 2926063275 2926063968 252
1362 iso_pu_bacteria 2929144301 2929144759 252
1363 iso_pu_bacteria 2929189879 2929190258 252
1364 iso_pu_bacteria 2931369376 2931371907 252
1365 iso_pu_bacteria 2931390751 2931391330 252
1366 iso_pu_bacteria 2931396565 2931398792 252
1367 iso_pu_bacteria 2935353572 2935358952 252
1368 iso_pu_bacteria 2939636861 2939641054 252
1369 iso_pu_bacteria 2939651529 2939655269 252
1370 iso_pu_bacteria 2945928738 2945930219 252
1371 iso_pu_bacteria 2946006987 2946012554 252
1372 iso_pu_bacteria 2947233263 2947235129 252
1373 iso_pu_bacteria 2969304461 2969304914 252
1374 iso_pu_bacteria 2974298342 2974298460 252
1375 iso_pu_bacteria 2984286254 2984292031 252
1376 iso_pu_bacteria 2984499530 2984504162 252
1377 iso_pu_bacteria 2984504281 2984505859 252
1378 iso_pu_bacteria 2988728565 2988732151 252
1379 iso_pu_bacteria 2990196909 2990199620 252
1380 iso_pu_bacteria 3007252601 3007254671 252
1381 iso_pu_bacteria 3007315729 3007316551 252
1382 iso_pu_bacteria 3007395558 3007398041 252
1383 iso_pu_bacteria 3007511990 3007517850 252
1384 iso_pu_bacteria 3007614139 3007614615 252
1385 iso_pu_bacteria 3007619802 3007625032 252
1386 iso_pu_bacteria 3007718800 3007724359 252
1387 iso_pu_bacteria 3007803356 3007803712 252
1388 iso_pu_bacteria 3007855910 3007859655 252
1389 iso_pu_bacteria 3007861166 3007864377 252
1390 iso_pu_bacteria 3007866637 3007872084 252
1391 iso_pu_bacteria 3007872151 3007876667 252
1392 iso_pu_bacteria 640427133 640486296 252
1393 iso_pu_bacteria 651053060 651174261 252
1394 iso_pu_bacteria 8011350971 8011352532 252
1395 iso_pu_bacteria 8015687852 8015688277 252
1396 iso_pu_bacteria 8016728285 8016732181 252
1397 iso_pu_bacteria 8019769354 8019770264 252
1398 iso_pu_bacteria 8019775933 8019777292 252
1399 iso_pu_bacteria 8034962539 8034963505 252
1400 iso_pu_bacteria 8052494512 8052495020 252
1401 iso_pu_bacteria 8054285046 8054290221 252
1402 iso_pu_bacteria 8054347763 8054350171 252
1403 iso_pu_bacteria 8054503363 8054503907 252
1404 iso_pu_bacteria 8054929484 8054930679 252
1405 iso_pu_bacteria 8055770955 8055771375 252
1406 iso_pu_bacteria 8055817908 8055818310 252
1407 iso_pu_bacteria 8055878733 8055880002 252
1408 iso_pu_bacteria 8056115690 8056116697 252
1409 iso_pu_bacteria 8056120720 8056125497 252
1410 iso_pu_bacteria 8056125926 8056126419 252
1411 iso_pu_bacteria 8056131705 8056132289 252
1412 iso_pu_bacteria 8056137416 8056142586 252
1413 iso_pu_bacteria 8056143049 8056143685 252
1414 iso_pu_bacteria 8056148874 8056152432 252
1415 iso_pu_bacteria 8056155041 8056158469 252
1416 iso_pu_bacteria 8056161164 8056164300 252
1417 iso_pu_bacteria 8056166840 8056170635 252
1418 iso_pu_bacteria 8056172158 8056176747 252
1419 iso_pu_bacteria 8056177738 8056183096 252
1420 iso_pu_bacteria 8056569372 8056572277 252
1421 iso_pu_bacteria 8057798959 8057802666 252
1422 3300005335 Ga0070666_10001127 Ga0070666_100011273 253
1423 3300005338 Ga0068868_100002829 Ga0068868_1000028299 253
1424 3300005340 Ga0070689_100022500 Ga0070689_1000225002 253
1425 3300005364 Ga0070673_100074726 Ga0070673_1000747262 253
1426 3300005367 Ga0070667_100010227 Ga0070667_1000102274 253
1427 3300005457 Ga0070662_100162552 Ga0070662_1001625522 253
1428 3300005535 Ga0070684_100145004 Ga0070684_1001450042 253
1429 3300005539 Ga0068853_100283618 Ga0068853_1002836182 253
1430 3300005544 Ga0070686_100087636 Ga0070686_1000876362 253
1431 3300005548 Ga0070665_100018864 Ga0070665_1000188644 253
1432 3300005564 Ga0070664_100010538 Ga0070664_1000105383 253
1433 3300005615 Ga0070702_100008784 Ga0070702_1000087844 253
1434 3300005617 Ga0068859_100005859 Ga0068859_1000058592 253
1435 3300005618 Ga0068864_100002557 Ga0068864_10000255710 253
1436 3300006931 Ga0097620_100005859 Ga0097620_1000058592 253
1437 3300009093 Ga0105240_10061599 Ga0105240_100615994 253
1438 3300009101 Ga0105247_10004253 Ga0105247_100042533 253
1439 3300009174 Ga0105241_10055742 Ga0105241_100557424 253
1440 3300009177 Ga0105248_10002113 Ga0105248_1000211317 253
1441 3300009545 Ga0105237_10020762 Ga0105237_100207624 253
1442 3300009551 Ga0105238_10002078 Ga0105238_1000207819 253
1443 3300009551 Ga0105238_10027792 Ga0105238_100277924 253
1444 3300009553 Ga0105249_10143100 Ga0105249_101431002 253
1445 3300010375 Ga0105239_10008100 Ga0105239_100081004 253
1446 3300010375 Ga0105239_10033547 Ga0105239_100335472 253
1447 3300011119 Ga0105246_10004799 Ga0105246_100047994 253
1448 3300013105 Ga0157369_10000537 Ga0157369_1000053723 253
1449 3300013306 Ga0163162_10016611 Ga0163162_100166115 253
1450 3300014325 Ga0163163_10003386 Ga0163163_1000338610 253
1451 3300014745 Ga0157377_10007511 Ga0157377_100075112 253
1452 3300014968 Ga0157379_10107319 Ga0157379_101073192 253
1453 3300014969 Ga0157376_10041402 Ga0157376_100414022 253
1454 3300025903 Ga0207680_10058347 Ga0207680_100583472 253
1455 3300025906 Ga0207699_10129730 Ga0207699_101297302 253
1456 3300025913 Ga0207695_10004927 Ga0207695_1000492716 253
1457 3300025914 Ga0207671_10003371 Ga0207671_100033717 253
1458 3300025914 Ga0207671_10005095 Ga0207671_1000509510 253
1459 3300025918 Ga0207662_10314382 Ga0207662_103143821 253
1460 3300025920 Ga0207649_10011459 Ga0207649_100114594 253
1461 3300025924 Ga0207694_10002811 Ga0207694_100028114 253
1462 3300025924 Ga0207694_10027879 Ga0207694_100278793 253
1463 3300025925 Ga0207650_10044437 Ga0207650_100444373 253
1464 3300025927 Ga0207687_10030810 Ga0207687_100308102 253
1465 3300025931 Ga0207644_10018840 Ga0207644_100188404 253
1466 3300025940 Ga0207691_10570357 Ga0207691_105703571 253
1467 3300025944 Ga0207661_10107254 Ga0207661_101072542 253
1468 3300025960 Ga0207651_10116229 Ga0207651_101162292 253
1469 3300025961 Ga0207712_10090785 Ga0207712_100907853 253
1470 3300026041 Ga0207639_10342056 Ga0207639_103420561 253
1471 3300026142 Ga0207698_10401314 Ga0207698_104013141 253
1472 3300028379 Ga0268266_10014303 Ga0268266_100143034 253
1473 3300028381 Ga0268264_10020011 Ga0268264_100200114 253
1474 3300031733 Ga0316577_10081869 Ga0316577_100818692 253
1475 3300032168 Ga0316593_10001594 Ga0316593_100015943 253
1476 3300036647 Ga0316582_0014298 Ga0316582_0014298_2041_2805 253
1477 3300036712 Ga0316584_0013824 Ga0316584_0013824_3814_4578 253
1478 3300037588 Ga0316581_0073666 Ga0316581_0073666_230_991 253
1479 3300047319 Ga0495674_0104664 Ga0495674_0104664_1374_2135 253
1480 3300048912 Ga0496109_0024376 Ga0496109_0024376_594_1355 253
1481 3300048916 Ga0496113_0075979 Ga0496113_0075979_10_771 253
1482 3300048919 Ga0496116_0000008 Ga0496116_0000008_426881_427642 253
1483 3300048924 Ga0496121_0000012 Ga0496121_0000012_288110_288871 253
1484 3300049574 Ga0501038_0050136 Ga0501038_0050136_2736_3521 253
1485 3300005328 Ga0070676_10106008 Ga0070676_101060082 254
1486 3300005331 Ga0070670_100062353 Ga0070670_1000623532 254
1487 3300005340 Ga0070689_100128199 Ga0070689_1001281992 254
1488 3300005353 Ga0070669_100026715 Ga0070669_1000267151 254
1489 3300005354 Ga0070675_100090409 Ga0070675_1000904093 254
1490 3300005459 Ga0068867_100244163 Ga0068867_1002441632 254
1491 3300006881 Ga0068865_100074790 Ga0068865_1000747902 254
1492 3300025907 Ga0207645_10090148 Ga0207645_100901482 254
1493 3300025908 Ga0207643_10081658 Ga0207643_100816582 254
1494 3300025923 Ga0207681_10057803 Ga0207681_100578034 254
1495 3300025925 Ga0207650_10213466 Ga0207650_102134662 254
1496 3300025936 Ga0207670_10102381 Ga0207670_101023812 254
1497 3300025940 Ga0207691_10110359 Ga0207691_101103593 254
1498 3300026089 Ga0207648_10093658 Ga0207648_100936583 254
1499 3300026121 Ga0207683_10002493 Ga0207683_100024934 254
1500 2124908027 MRS2a_Contig_1652 MRS2a_00514420 256
1501 3300002737 JGI25162J39368_1000098 JGI25162J39368_100009819 256
1502 3300002737 JGI25162J39368_1000129 JGI25162J39368_10001294 256
1503 3300002772 JGI25164J39214_1000076 JGI25164J39214_100007672 256
1504 3300002772 JGI25164J39214_1000101 JGI25164J39214_100010174 256
1505 3300003214 JGI25165J46597_1000150 JGI25165J46597_100015028 256
1506 3300003214 JGI25165J46597_1000180 JGI25165J46597_100018019 256
1507 3300003751 Ga0055538_1000037 Ga0055538_1000037141 256
1508 3300003752 Ga0055539_1000048 Ga0055539_1000048141 256
1509 3300003756 Ga0055533_1000059 Ga0055533_1000059141 256
1510 3300003758 Ga0055532_1000105 Ga0055532_100010564 256
1511 3300003759 Ga0055525_1000128 Ga0055525_100012819 256
1512 3300003781 Ga0055536_1002523 Ga0055536_10025231 256
1513 3300003784 Ga0055534_1018769 Ga0055534_10187691 256
1514 3300003791 Ga0055530_10000312 Ga0055530_1000031212 256
1515 3300003791 Ga0055530_10001569 Ga0055530_1000156911 256
1516 3300003792 Ga0055540_1000217 Ga0055540_100021726 256
1517 3300003792 Ga0055540_1000294 Ga0055540_100029428 256
1518 3300003792 Ga0055540_1001288 Ga0055540_100128815 256
1519 3300003794 Ga0055531_10000238 Ga0055531_1000023837 256
1520 3300003794 Ga0055531_10000275 Ga0055531_1000027527 256
1521 3300003841 Ga0055541_1000035 Ga0055541_100003519 256
1522 3300003856 Ga0058692_1020622 Ga0058692_10206221 256
1523 3300005288 Ga0065714_10000282 Ga0065714_100002824 256
1524 3300005288 Ga0065714_10022826 Ga0065714_100228261 256
1525 3300005288 Ga0065714_10066311 Ga0065714_100663113 256
1526 3300005289 Ga0065704_10007693 Ga0065704_100076933 256
1527 3300005289 Ga0065704_10159285 Ga0065704_101592851 256
1528 3300005290 Ga0065712_10008788 Ga0065712_100087883 256
1529 3300005290 Ga0065712_10067807 Ga0065712_1006780724 256
1530 3300005293 Ga0065715_10145527 Ga0065715_101455272 256
1531 3300005339 Ga0070660_100383095 Ga0070660_1003830952 256
1532 3300005344 Ga0070661_100000178 Ga0070661_1000001782 256
1533 3300005353 Ga0070669_100000265 Ga0070669_1000002657 256
1534 3300005353 Ga0070669_100005987 Ga0070669_1000059873 256
1535 3300005457 Ga0070662_100000348 Ga0070662_10000034824 256
1536 3300005457 Ga0070662_100040368 Ga0070662_1000403683 256
1537 3300005539 Ga0068853_100000029 Ga0068853_10000002917 256
1538 3300005548 Ga0070665_100064242 Ga0070665_1000642426 256
1539 3300005564 Ga0070664_100000680 Ga0070664_10000068023 256
1540 3300005564 Ga0070664_100064635 Ga0070664_1000646355 256
1541 3300005577 Ga0068857_100160228 Ga0068857_1001602283 256
1542 3300005834 Ga0068851_10000024 Ga0068851_1000002481 256
1543 3300006058 Ga0075432_10006193 Ga0075432_100061933 256
1544 3300006058 Ga0075432_10155801 Ga0075432_101558011 256
1545 3300006944 Ga0099823_1000243 Ga0099823_10002435 256
1546 3300006944 Ga0099823_1041682 Ga0099823_10416822 256
1547 3300006946 Ga0079104_1000508 Ga0079104_100050810 256
1548 3300006948 Ga0099826_10022339 Ga0099826_100223393 256
1549 3300009011 Ga0105251_10000118 Ga0105251_1000011840 256
1550 3300009011 Ga0105251_10000191 Ga0105251_1000019128 256
1551 3300009011 Ga0105251_10000327 Ga0105251_1000032731 256
1552 3300009011 Ga0105251_10000977 Ga0105251_100009779 256
1553 3300009011 Ga0105251_10002348 Ga0105251_1000234813 256
1554 3300009011 Ga0105251_10003254 Ga0105251_100032543 256
1555 3300009011 Ga0105251_10003735 Ga0105251_100037358 256
1556 3300009011 Ga0105251_10005020 Ga0105251_100050203 256
1557 3300009011 Ga0105251_10025865 Ga0105251_100258654 256
1558 3300009011 Ga0105251_10044310 Ga0105251_100443102 256
1559 3300009011 Ga0105251_10122702 Ga0105251_101227022 256
1560 3300009036 Ga0105244_10001496 Ga0105244_1000149617 256
1561 3300009036 Ga0105244_10002769 Ga0105244_100027692 256
1562 3300009036 Ga0105244_10003018 Ga0105244_100030183 256
1563 3300009036 Ga0105244_10005078 Ga0105244_100050784 256
1564 3300009036 Ga0105244_10008540 Ga0105244_100085406 256
1565 3300009036 Ga0105244_10011004 Ga0105244_100110043 256
1566 3300009036 Ga0105244_10032077 Ga0105244_100320771 256
1567 3300009036 Ga0105244_10038657 Ga0105244_100386573 256
1568 3300009036 Ga0105244_10054229 Ga0105244_100542293 256
1569 3300009092 Ga0105250_10000251 Ga0105250_100002511 256
1570 3300009092 Ga0105250_10000487 Ga0105250_1000048717 256
1571 3300009092 Ga0105250_10019916 Ga0105250_100199161 256
1572 3300009148 Ga0105243_10000299 Ga0105243_100002998 256
1573 3300009148 Ga0105243_10005926 Ga0105243_100059268 256
1574 3300009148 Ga0105243_10009460 Ga0105243_100094608 256
1575 3300009148 Ga0105243_10118388 Ga0105243_101183883 256
1576 3300009176 Ga0105242_10001173 Ga0105242_100011738 256
1577 3300009177 Ga0105248_10024766 Ga0105248_100247667 256
1578 3300009545 Ga0105237_10002206 Ga0105237_100022063 256
1579 3300009553 Ga0105249_10038235 Ga0105249_100382356 256
1580 3300009553 Ga0105249_10888895 Ga0105249_108888951 256
1581 3300010375 Ga0105239_10515560 Ga0105239_105155601 256
1582 3300011119 Ga0105246_10000652 Ga0105246_1000065216 256
1583 3300011119 Ga0105246_10011845 Ga0105246_100118455 256
1584 3300011119 Ga0105246_10070897 Ga0105246_100708973 256
1585 3300013100 Ga0157373_10000793 Ga0157373_1000079317 256
1586 3300013100 Ga0157373_10004410 Ga0157373_100044109 256
1587 3300013102 Ga0157371_10000238 Ga0157371_1000023826 256
1588 3300013102 Ga0157371_10087043 Ga0157371_100870433 256
1589 3300013102 Ga0157371_10118230 Ga0157371_101182303 256
1590 3300013104 Ga0157370_10127631 Ga0157370_101276312 256
1591 3300013104 Ga0157370_10129271 Ga0157370_101292712 256
1592 3300013306 Ga0163162_10142729 Ga0163162_101427293 256
1593 3300013306 Ga0163162_10183552 Ga0163162_101835522 256
1594 3300013307 Ga0157372_10006660 Ga0157372_100066605 256
1595 3300013307 Ga0157372_10049515 Ga0157372_100495157 256
1596 3300013307 Ga0157372_10229871 Ga0157372_102298713 256
1597 3300014497 Ga0182008_10001211 Ga0182008_1000121114 256
1598 3300014497 Ga0182008_10010498 Ga0182008_100104983 256
1599 3300015261 Ga0182006_1010430 Ga0182006_10104305 256
1600 3300017792 Ga0163161_10111303 Ga0163161_101113031 256
1601 3300025206 Ga0209435_100319 Ga0209435_10031911 256
1602 3300025207 Ga0209760_100080 Ga0209760_10008040 256
1603 3300025207 Ga0209760_100465 Ga0209760_1004652 256
1604 3300025224 Ga0209784_100028 Ga0209784_10002819 256
1605 3300025225 Ga0209566_100028 Ga0209566_10002819 256
1606 3300025226 Ga0209674_100047 Ga0209674_10004719 256
1607 3300025229 Ga0209147_100031 Ga0209147_10003119 256
1608 3300025230 Ga0209563_100050 Ga0209563_10005019 256
1609 3300025230 Ga0209563_102312 Ga0209563_1023125 256
1610 3300025231 Ga0207427_100014 Ga0207427_100014326 256
1611 3300025231 Ga0207427_100016 Ga0207427_10001694 256
1612 3300025233 Ga0209437_100011 Ga0209437_100011283 256
1613 3300025233 Ga0209437_100016 Ga0209437_100016311 256
1614 3300025242 Ga0209258_100460 Ga0209258_10046028 256
1615 3300025246 Ga0209646_1000183 Ga0209646_100018364 256
1616 3300025253 Ga0209677_100029 Ga0209677_10002919 256
1617 3300025261 Ga0209233_1000019 Ga0209233_1000019283 256
1618 3300025261 Ga0209233_1000036 Ga0209233_1000036326 256
1619 3300025291 Ga0209675_1010611 Ga0209675_10106115 256
1620 3300025292 Ga0209676_1000025 Ga0209676_1000025314 256
1621 3300025292 Ga0209676_1000032 Ga0209676_1000032307 256
1622 3300025292 Ga0209676_1001206 Ga0209676_10012063 256
1623 3300025292 Ga0209676_1006288 Ga0209676_10062883 256
1624 3300025298 Ga0209050_1000025 Ga0209050_1000025308 256
1625 3300025298 Ga0209050_1000028 Ga0209050_1000028207 256
1626 3300025298 Ga0209050_1000381 Ga0209050_100038128 256
1627 3300025298 Ga0209050_1000981 Ga0209050_10009818 256
1628 3300025303 Ga0209051_1000026 Ga0209051_1000026109 256
1629 3300025303 Ga0209051_1000080 Ga0209051_100008040 256
1630 3300025303 Ga0209051_1000299 Ga0209051_100029937 256
1631 3300025304 Ga0209257_1000034 Ga0209257_1000034314 256
1632 3300025304 Ga0209257_1004941 Ga0209257_100494110 256
1633 3300025321 Ga0207656_10000008 Ga0207656_10000008209 256
1634 3300025711 Ga0207696_1000020 Ga0207696_100002081 256
1635 3300025711 Ga0207696_1000057 Ga0207696_1000057142 256
1636 3300025711 Ga0207696_1000074 Ga0207696_100007441 256
1637 3300025711 Ga0207696_1000084 Ga0207696_100008478 256
1638 3300025711 Ga0207696_1004990 Ga0207696_10049904 256
1639 3300025728 Ga0207655_1000014 Ga0207655_1000014281 256
1640 3300025728 Ga0207655_1000341 Ga0207655_100034114 256
1641 3300025728 Ga0207655_1000417 Ga0207655_100041710 256
1642 3300025728 Ga0207655_1000502 Ga0207655_100050230 256
1643 3300025728 Ga0207655_1000556 Ga0207655_100055639 256
1644 3300025728 Ga0207655_1001671 Ga0207655_10016715 256
1645 3300025728 Ga0207655_1003052 Ga0207655_10030523 256
1646 3300025728 Ga0207655_1004382 Ga0207655_10043825 256
1647 3300025728 Ga0207655_1009008 Ga0207655_10090087 256
1648 3300025728 Ga0207655_1019136 Ga0207655_10191363 256
1649 3300025728 Ga0207655_1031800 Ga0207655_10318002 256
1650 3300025728 Ga0207655_1047084 Ga0207655_10470842 256
1651 3300025735 Ga0207713_1000031 Ga0207713_100003148 256
1652 3300025735 Ga0207713_1000114 Ga0207713_100011473 256
1653 3300025735 Ga0207713_1000572 Ga0207713_100057211 256
1654 3300025735 Ga0207713_1001535 Ga0207713_100153515 256
1655 3300025735 Ga0207713_1001823 Ga0207713_100182316 256
1656 3300025735 Ga0207713_1002851 Ga0207713_100285114 256
1657 3300025735 Ga0207713_1002976 Ga0207713_10029769 256
1658 3300025735 Ga0207713_1003112 Ga0207713_100311211 256
1659 3300025735 Ga0207713_1005620 Ga0207713_10056209 256
1660 3300025735 Ga0207713_1026063 Ga0207713_10260634 256
1661 3300025735 Ga0207713_1026175 Ga0207713_10261754 256
1662 3300025735 Ga0207713_1028291 Ga0207713_10282913 256
1663 3300025907 Ga0207645_10196251 Ga0207645_101962512 256
1664 3300025914 Ga0207671_10000015 Ga0207671_10000015198 256
1665 3300025919 Ga0207657_10322084 Ga0207657_103220841 256
1666 3300025920 Ga0207649_10000001 Ga0207649_10000001289 256
1667 3300025923 Ga0207681_10002623 Ga0207681_100026238 256
1668 3300025923 Ga0207681_10004161 Ga0207681_100041618 256
1669 3300025925 Ga0207650_10000239 Ga0207650_1000023915 256
1670 3300025933 Ga0207706_10000069 Ga0207706_1000006917 256
1671 3300025933 Ga0207706_10015680 Ga0207706_100156803 256
1672 3300025934 Ga0207686_10001137 Ga0207686_100011377 256
1673 3300025935 Ga0207709_10000022 Ga0207709_10000022309 256
1674 3300025935 Ga0207709_10000164 Ga0207709_1000016413 256
1675 3300025935 Ga0207709_10011415 Ga0207709_100114155 256
1676 3300025935 Ga0207709_10017758 Ga0207709_100177584 256
1677 3300025935 Ga0207709_10138322 Ga0207709_101383222 256
1678 3300025945 Ga0207679_10000011 Ga0207679_10000011289 256
1679 3300025961 Ga0207712_10020485 Ga0207712_100204852 256
1680 3300025981 Ga0207640_10022476 Ga0207640_100224765 256
1681 3300026041 Ga0207639_10000099 Ga0207639_1000009927 256
1682 3300027111 Ga0209281_1000026 Ga0209281_1000026246 256
1683 3300027111 Ga0209281_1000033 Ga0209281_1000033285 256
1684 3300027111 Ga0209281_1001858 Ga0209281_100185810 256
1685 3300027296 Ga0209389_1000099 Ga0209389_100009946 256
1686 3300027296 Ga0209389_1074527 Ga0209389_10745273 256
1687 3300027312 Ga0209371_1000066 Ga0209371_1000066181 256
1688 3300027312 Ga0209371_1000653 Ga0209371_100065311 256
1689 3300027312 Ga0209371_1020557 Ga0209371_10205573 256
1690 3300027312 Ga0209371_1023115 Ga0209371_10231152 256
1691 3300027395 Ga0209996_1004612 Ga0209996_10046122 256
1692 3300027462 Ga0210000_1010807 Ga0210000_10108071 256
1693 3300027471 Ga0209995_1007635 Ga0209995_10076353 256
1694 3300027543 Ga0209999_1004223 Ga0209999_10042232 256
1695 3300027665 Ga0209983_1002700 Ga0209983_10027004 256
1696 3300027666 Ga0209282_1018395 Ga0209282_10183953 256
1697 3300027876 Ga0209974_10007762 Ga0209974_100077623 256
1698 3300027907 Ga0207428_10008430 Ga0207428_100084307 256
1699 3300027907 Ga0207428_10117153 Ga0207428_101171532 256
1700 3300028379 Ga0268266_10011009 Ga0268266_1001100910 256
1701 3300028379 Ga0268266_10040888 Ga0268266_100408882 256
1702 3300030500 Ga0268256_1000063 Ga0268256_1000063181 256
1703 3300030500 Ga0268256_1000557 Ga0268256_100055716 256
1704 3300030500 Ga0268256_1010906 Ga0268256_10109063 256
1705 3300030500 Ga0268256_1023065 Ga0268256_10230651 256
1706 3300030731 Ga0316177_1113840 Ga0316177_11138403 256
1707 3300030735 Ga0316178_1083481 Ga0316178_108348117 256
1708 3300030744 Ga0316181_1294605 Ga0316181_12946052 256
1709 3300031548 Ga0307408_100000002 Ga0307408_100000002246 256
1710 3300031548 Ga0307408_100021702 Ga0307408_1000217024 256
1711 3300031731 Ga0307405_10095274 Ga0307405_100952742 256
1712 3300031824 Ga0307413_10003639 Ga0307413_100036393 256
1713 3300031824 Ga0307413_10067409 Ga0307413_100674093 256
1714 3300031901 Ga0307406_10061018 Ga0307406_100610183 256
1715 3300031911 Ga0307412_10062698 Ga0307412_100626983 256
1716 3300031911 Ga0307412_10106730 Ga0307412_101067302 256
1717 3300032002 Ga0307416_100157677 Ga0307416_1001576772 256
1718 3300032005 Ga0307411_10109863 Ga0307411_101098633 256
1719 3300033541 Ga0316596_1009375 Ga0316596_10093751 256
1720 3300035398 Ga0316574_0148045 Ga0316574_0148045_149_925 256
1721 3300036712 Ga0316584_0181626 Ga0316584_0181626_480_1250 256
1722 3300041404 Ga0439436_0002075 Ga0439436_0002075_4705_5475 256
1723 3300041405 Ga0439438_000705 Ga0439438_000705_6142_6912 256
1724 3300041407 Ga0439447_003922 Ga0439447_003922_1599_2369 256
1725 3300041407 Ga0439447_020765 Ga0439447_020765_376_1146 256
1726 3300041411 Ga0439466_0004826 Ga0439466_0004826_1104_1874 256
1727 3300041411 Ga0439466_0008959 Ga0439466_0008959_2104_2919 256
1728 3300042000 Ga0439437_000145 Ga0439437_000145_2102_2872 256
1729 3300042006 Ga0439432_013934 Ga0439432_013934_1511_2281 256
1730 3300042009 Ga0439451_007568 Ga0439451_007568_705_1475 256
1731 3300042009 Ga0439451_013029 Ga0439451_013029_742_1512 256
1732 3300042010 Ga0439452_000639 Ga0439452_000639_13768_14538 256
1733 3300042013 Ga0439456_000539 Ga0439456_000539_1449_2219 256
1734 3300042016 Ga0439463_001585 Ga0439463_001585_1216_2016 256
1735 3300042115 Ga0450911_000018 Ga0450911_000018_72255_73025 256
1736 3300042125 Ga0450923_009679 Ga0450923_009679_576_1346 256
1737 3300042142 Ga0450905_000366 Ga0450905_000366_3096_3866 256
1738 3300042142 Ga0450905_003143 Ga0450905_003143_171_941 256
1739 3300042156 Ga0439446_0000261 Ga0439446_0000261_1446_2225 256
1740 3300042156 Ga0439446_0003402 Ga0439446_0003402_1278_2048 256
1741 3300042435 Ga0439434_0002153 Ga0439434_0002153_1738_2508 256
1742 3300042439 Ga0439464_0004654 Ga0439464_0004654_1432_2202 256
1743 3300042461 Ga0439460_0004961 Ga0439460_0004961_1527_2297 256
1744 3300042533 Ga0450901_001568 Ga0450901_001568_1624_2394 256
1745 3300042993 Ga0439440_0009344 Ga0439440_0009344_822_1592 256
1746 3300046453 Ga0495627_000023 Ga0495627_000023_137759_138616 256
1747 3300046453 Ga0495627_000694 Ga0495627_000694_11152_11922 256
1748 3300046453 Ga0495627_004813 Ga0495627_004813_2406_3281 256
1749 3300046453 Ga0495627_007437 Ga0495627_007437_565_1365 256
1750 3300046453 Ga0495627_056033 Ga0495627_056033_349_1149 256
1751 3300046458 Ga0495591_000025 Ga0495591_000025_83002_83859 256
1752 3300046458 Ga0495591_001313 Ga0495591_001313_14405_15205 256
1753 3300046458 Ga0495591_005620 Ga0495591_005620_2264_3139 256
1754 3300046458 Ga0495591_011566 Ga0495591_011566_1661_2461 256
1755 3300046458 Ga0495591_027194 Ga0495591_027194_653_1423 256
1756 3300046460 Ga0495638_0007859 Ga0495638_0007859_5177_5977 256
1757 3300046460 Ga0495638_0012287 Ga0495638_0012287_839_1609 256
1758 3300046471 Ga0495650_0002310 Ga0495650_0002310_2889_3689 256
1759 3300046471 Ga0495650_0003052 Ga0495650_0003052_1724_2584 256
1760 3300046471 Ga0495650_0018979 Ga0495650_0018979_1079_1879 256
1761 3300046474 Ga0495605_0000095 Ga0495605_0000095_63360_64160 256
1762 3300046474 Ga0495605_0000210 Ga0495605_0000210_15980_16780 256
1763 3300046474 Ga0495605_0000815 Ga0495605_0000815_14606_15463 256
1764 3300046474 Ga0495605_0001165 Ga0495605_0001165_5739_6539 256
1765 3300046474 Ga0495605_0004819 Ga0495605_0004819_557_1357 256
1766 3300046474 Ga0495605_0059235 Ga0495605_0059235_682_1482 256
1767 3300046491 Ga0495584_0029283 Ga0495584_0029283_654_1454 256
1768 3300046492 Ga0495585_0027300 Ga0495585_0027300_508_1308 256
1769 3300046492 Ga0495585_0041082 Ga0495585_0041082_1154_1924 256
1770 3300046492 Ga0495585_0096763 Ga0495585_0096763_365_1165 256
1771 3300046499 Ga0495594_0008695 Ga0495594_0008695_3877_4677 256
1772 3300046500 Ga0495596_0009327 Ga0495596_0009327_1613_2413 256
1773 3300046501 Ga0495607_0000069 Ga0495607_0000069_91888_92745 256
1774 3300046501 Ga0495607_0000983 Ga0495607_0000983_5220_6077 256
1775 3300046501 Ga0495607_0001148 Ga0495607_0001148_5742_6542 256
1776 3300046501 Ga0495607_0002749 Ga0495607_0002749_1803_2573 256
1777 3300046501 Ga0495607_0003593 Ga0495607_0003593_10343_11143 256
1778 3300046501 Ga0495607_0005409 Ga0495607_0005409_1177_1947 256
1779 3300046501 Ga0495607_0008558 Ga0495607_0008558_2091_2891 256
1780 3300046501 Ga0495607_0024541 Ga0495607_0024541_2305_3180 256
1781 3300046501 Ga0495607_0050478 Ga0495607_0050478_1360_2160 256
1782 3300046501 Ga0495607_0077811 Ga0495607_0077811_488_1288 256
1783 3300046506 Ga0495583_0000015 Ga0495583_0000015_109382_110182 256
1784 3300046506 Ga0495583_0000779 Ga0495583_0000779_14562_15422 256
1785 3300046506 Ga0495583_0008544 Ga0495583_0008544_1650_2450 256
1786 3300046506 Ga0495583_0019297 Ga0495583_0019297_1082_1852 256
1787 3300046506 Ga0495583_0067726 Ga0495583_0067726_625_1425 256
1788 3300046507 Ga0495606_0000447 Ga0495606_0000447_40523_41323 256
1789 3300046507 Ga0495606_0001053 Ga0495606_0001053_30942_31742 256
1790 3300046507 Ga0495606_0001278 Ga0495606_0001278_8053_8853 256
1791 3300046507 Ga0495606_0015316 Ga0495606_0015316_3509_4279 256
1792 3300046507 Ga0495606_0016681 Ga0495606_0016681_2417_3292 256
1793 3300046512 Ga0495610_0015524 Ga0495610_0015524_747_1547 256
1794 3300046513 Ga0495616_0043053 Ga0495616_0043053_959_1759 256
1795 3300046513 Ga0495616_0184103 Ga0495616_0184103_20_820 256
1796 3300046515 Ga0495620_0000042 Ga0495620_0000042_23927_24727 256
1797 3300046515 Ga0495620_0000146 Ga0495620_0000146_40770_41540 256
1798 3300046515 Ga0495620_0002809 Ga0495620_0002809_8675_9475 256
1799 3300046515 Ga0495620_0024957 Ga0495620_0024957_1391_2191 256
1800 3300046515 Ga0495620_0027170 Ga0495620_0027170_995_1765 256
1801 3300046518 Ga0495631_0012371 Ga0495631_0012371_1984_2754 256
1802 3300046519 Ga0495632_0001637 Ga0495632_0001637_2324_3184 256
1803 3300046519 Ga0495632_0001728 Ga0495632_0001728_10321_11091 256
1804 3300046520 Ga0495637_0001117 Ga0495637_0001117_14450_15250 256
1805 3300046520 Ga0495637_0005705 Ga0495637_0005705_625_1482 256
1806 3300046522 Ga0495643_0000175 Ga0495643_0000175_7600_8370 256
1807 3300046522 Ga0495643_0000675 Ga0495643_0000675_33412_34182 256
1808 3300046522 Ga0495643_0000930 Ga0495643_0000930_11715_12485 256
1809 3300046522 Ga0495643_0033177 Ga0495643_0033177_460_1260 256
1810 3300046523 Ga0495644_0005497 Ga0495644_0005497_2101_2901 256
1811 3300046524 Ga0495648_0002908 Ga0495648_0002908_10309_11079 256
1812 3300046524 Ga0495648_0004932 Ga0495648_0004932_1462_2232 256
1813 3300046524 Ga0495648_0034007 Ga0495648_0034007_1185_1985 256
1814 3300046530 Ga0495654_0000906 Ga0495654_0000906_2196_2966 256
1815 3300046530 Ga0495654_0030579 Ga0495654_0030579_1078_1848 256
1816 3300046530 Ga0495654_0154595 Ga0495654_0154595_83_883 256
1817 3300046538 Ga0495609_0000053 Ga0495609_0000053_19424_20224 256
1818 3300046538 Ga0495609_0000102 Ga0495609_0000102_89041_89841 256
1819 3300046538 Ga0495609_0000133 Ga0495609_0000133_36666_37466 256
1820 3300046538 Ga0495609_0003217 Ga0495609_0003217_918_1688 256
1821 3300046542 Ga0495597_0000068 Ga0495597_0000068_57566_58423 256
1822 3300046557 Ga0495622_0017175 Ga0495622_0017175_2099_2899 256
1823 3300046557 Ga0495622_0109043 Ga0495622_0109043_248_1018 256
1824 3300046558 Ga0495633_0000115 Ga0495633_0000115_32415_33215 256
1825 3300046615 Ga0495656_0021883 Ga0495656_0021883_918_1688 256
1826 3300046616 Ga0495668_0049740 Ga0495668_0049740_939_1739 256
1827 3300046616 Ga0495668_0086461 Ga0495668_0086461_625_1425 256
1828 3300046648 Ga0495611_0001664 Ga0495611_0001664_9348_10148 256
1829 3300046660 Ga0495625_0000086 Ga0495625_0000086_62470_63270 256
1830 3300046665 Ga0495661_0000058 Ga0495661_0000058_7930_8790 256
1831 3300046665 Ga0495661_0000212 Ga0495661_0000212_60319_61119 256
1832 3300046665 Ga0495661_0000346 Ga0495661_0000346_17774_18574 256
1833 3300046665 Ga0495661_0005323 Ga0495661_0005323_5974_6849 256
1834 3300046665 Ga0495661_0081724 Ga0495661_0081724_451_1251 256
1835 3300046684 Ga0495669_0002254 Ga0495669_0002254_1024_1794 256
1836 3300046691 Ga0495670_0005953 Ga0495670_0005953_5014_5814 256
1837 3300046692 Ga0495671_0007537 Ga0495671_0007537_1643_2443 256
1838 3300046692 Ga0495671_0009894 Ga0495671_0009894_625_1425 256
1839 3300046692 Ga0495671_0010452 Ga0495671_0010452_479_1249 256
1840 3300046692 Ga0495671_0146567 Ga0495671_0146567_116_916 256
1841 3300046694 Ga0495649_0000186 Ga0495649_0000186_1018_1788 256
1842 3300046694 Ga0495649_0000839 Ga0495649_0000839_5538_6338 256
1843 3300046694 Ga0495649_0019957 Ga0495649_0019957_2103_2873 256
1844 3300046694 Ga0495649_0061289 Ga0495649_0061289_656_1456 256
1845 3300046794 Ga0495589_0020733 Ga0495589_0020733_758_1528 256
1846 3300046794 Ga0495589_0038733 Ga0495589_0038733_1281_2051 256
1847 3300046809 Ga0495600_0032124 Ga0495600_0032124_2192_2962 256
1848 3300046810 Ga0495660_0025181 Ga0495660_0025181_1769_2539 256
1849 3300046810 Ga0495660_0031405 Ga0495660_0031405_2103_2903 256
1850 3300046810 Ga0495660_0046547 Ga0495660_0046547_1141_1998 256
1851 3300046810 Ga0495660_0088565 Ga0495660_0088565_737_1537 256
1852 3300047320 Ga0495672_0003352 Ga0495672_0003352_11492_12262 256
1853 3300047320 Ga0495672_0004309 Ga0495672_0004309_9051_9821 256
1854 3300047320 Ga0495672_0029277 Ga0495672_0029277_1322_2122 256
1855 3300047320 Ga0495672_0051068 Ga0495672_0051068_567_1367 256
1856 3300047321 Ga0495676_0000022 Ga0495676_0000022_62997_63797 256
1857 3300047321 Ga0495676_0044680 Ga0495676_0044680_2057_2857 256
1858 3300047322 Ga0495680_0011792 Ga0495680_0011792_1699_2469 256
1859 3300047323 Ga0495683_0000030 Ga0495683_0000030_125466_126266 256
1860 3300047323 Ga0495683_0000044 Ga0495683_0000044_12178_12978 256
1861 3300047446 Ga0495679_000212 Ga0495679_000212_2361_3161 256
1862 3300047446 Ga0495679_000736 Ga0495679_000736_10786_11586 256
1863 3300047469 Ga0495673_0004747 Ga0495673_0004747_6960_7760 256
1864 3300047469 Ga0495673_0028308 Ga0495673_0028308_1129_1929 256
1865 3300047469 Ga0495673_0033851 Ga0495673_0033851_858_1658 256
1866 3300047470 Ga0495681_0032542 Ga0495681_0032542_1330_2130 256
1867 3300047470 Ga0495681_0112950 Ga0495681_0112950_184_1059 256
1868 3300047472 Ga0495686_0058084 Ga0495686_0058084_610_1410 256
1869 3300048091 Ga0495626_0000039 Ga0495626_0000039_99947_100747 256
1870 3300048091 Ga0495626_0001817 Ga0495626_0001817_11700_12470 256
1871 3300048913 Ga0496110_0068198 Ga0496110_0068198_2073_2843 256
1872 3300048913 Ga0496110_0183492 Ga0496110_0183492_848_1648 256
1873 3300048919 Ga0496116_0000667 Ga0496116_0000667_33114_33884 256
1874 3300048919 Ga0496116_0057003 Ga0496116_0057003_1294_2094 256
1875 3300048920 Ga0496117_0000385 Ga0496117_0000385_36258_37028 256
1876 3300048920 Ga0496117_0003287 Ga0496117_0003287_11789_12664 256
1877 3300048920 Ga0496117_0006460 Ga0496117_0006460_9712_10482 256
1878 3300048921 Ga0496118_0002475 Ga0496118_0002475_13802_14572 256
1879 3300048921 Ga0496118_0003109 Ga0496118_0003109_10985_11755 256
1880 3300048921 Ga0496118_0119068 Ga0496118_0119068_432_1307 256
1881 3300048922 Ga0496119_0000060 Ga0496119_0000060_115933_116703 256
1882 3300048923 Ga0496120_0003085 Ga0496120_0003085_4019_4789 256
1883 3300048924 Ga0496121_0004115 Ga0496121_0004115_10612_11412 256
1884 3300048924 Ga0496121_0006040 Ga0496121_0006040_11596_12396 256
1885 3300048924 Ga0496121_0014995 Ga0496121_0014995_1431_2201 256
1886 3300048925 Ga0496122_0001366 Ga0496122_0001366_30022_30822 256
1887 3300048925 Ga0496122_0002458 Ga0496122_0002458_9099_9869 256
1888 3300048926 Ga0496123_0000717 Ga0496123_0000717_37674_38444 256
1889 3300048926 Ga0496123_0001033 Ga0496123_0001033_8599_9399 256
1890 3300048927 Ga0496124_0000120 Ga0496124_0000120_48112_48912 256
1891 3300048927 Ga0496124_0003062 Ga0496124_0003062_9675_10445 256
1892 3300048927 Ga0496124_0003568 Ga0496124_0003568_5757_6527 256
1893 3300048927 Ga0496124_0007303 Ga0496124_0007303_1999_2799 256
1894 3300048927 Ga0496124_0010350 Ga0496124_0010350_6371_7246 256
1895 3300048927 Ga0496124_0050716 Ga0496124_0050716_2095_2865 256
1896 3300048927 Ga0496124_0073013 Ga0496124_0073013_515_1285 256
1897 3300048928 Ga0496125_0001735 Ga0496125_0001735_14933_15703 256
1898 3300048928 Ga0496125_0008517 Ga0496125_0008517_9396_10166 256
1899 3300048928 Ga0496125_0019456 Ga0496125_0019456_3249_4124 256
1900 3300048929 Ga0496126_0012840 Ga0496126_0012840_482_1252 256
1901 3300049459 Ga0495678_000017 Ga0495678_000017_75601_76401 256
1902 3300049459 Ga0495678_001755 Ga0495678_001755_12323_13123 256
1903 3300049460 Ga0495682_0000264 Ga0495682_0000264_28558_29328 256
1904 3300049460 Ga0495682_0000527 Ga0495682_0000527_12261_13061 256
1905 3300049460 Ga0495682_0024552 Ga0495682_0024552_355_1125 256
1906 3300049571 Ga0501034_0000576 Ga0501034_0000576_43641_44411 256
1907 3300049571 Ga0501034_0083131 Ga0501034_0083131_1217_1999 256
1908 3300049853 Ga0501226_000002 Ga0501226_000002_424621_425391 256
1909 3300053135 Ga0500659_0000765 Ga0500659_0000765_12643_13413 256
1910 iso_pu_bacteria 2599185307 2599975297 256
1911 iso_pu_bacteria 2600255283 2601627232 256
1912 iso_pu_bacteria 2713897148 2715749162 256
1913 iso_pu_bacteria 2738541271 2738687622 256
1914 iso_pu_bacteria 2738543016 2739263243 256
1915 iso_pu_bacteria 2945961074 2945967549 256
1916 iso_pu_bacteria 2974289157 2974293393 256
1917 iso_pu_bacteria 2998139840 2998140410 256
1918 iso_pu_bacteria 3007419365 3007419969 256
1919 iso_pu_bacteria 637000220 637317770 256
1920 iso_pu_bacteria 8029995093 8030000322 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

67

303

0.99

PF08241

Methyltransf_11

Methyltransferase domain

121

221

0.97

PF08242

Methyltransf_12

Methyltransferase domain

121

219

0.96

PF13649

Methyltransf_25

Methyltransferase domain

120

217

0.95

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

75

237

0.89

PF13489

Methyltransf_23

Methyltransferase domain

96

288

0.87

PF13847

Methyltransf_31

Methyltransferase domain

114

282

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9146 36 246
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.854 61 162
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.838 57 243
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8225 56 171
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8216 36 246
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9858 36 246 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9514 37 245 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9465 45 121 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9462 62 246 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9449 37 246 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H1XRR2-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9886 8 246 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9851 8 206 GO:0008425
GO:0009234
GO:0032259
AF-A0A389M0U1-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9823 45 246 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9769 9 246 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A6V7WQ93-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9728 9 245 GO:0008425
GO:0031314
GO:0032259

Feature Viewer

pLDDT pTM Quality
83.35 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map