F496061
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1920 | 784 | 1639 | 250 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|637000220|637317770 |
| Length | 304 |
| Sequence | CCFGTCLKHLDPACVKTSRRIAILHSALPRQRPPPALECPAFSFGDSDMTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRAGNRVLDIAGGTGDLTKRFSHLVGPTGQVVLADINESMLKVGRDRLLDLGVAGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSKPTNALMSKVYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRVTYHNMTAGIVALHRGIKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 6 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 7 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 8 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 9 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 10 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 11 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 12 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 13 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 14 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 15 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 16 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 17 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 18 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 19 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 20 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 21 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 22 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 23 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 24 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 25 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 26 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 27 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 28 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 29 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 30 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 31 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 32 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 33 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 34 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 35 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 36 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 37 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 38 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 39 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 40 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 41 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 42 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 43 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 44 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 45 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 46 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 47 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 48 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 49 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 50 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 51 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 52 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 53 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 54 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 55 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 56 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 57 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 58 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 59 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 60 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 61 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 62 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 63 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 64 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 65 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 66 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 67 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 68 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 69 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 70 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 71 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 72 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 73 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 74 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 75 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 76 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 77 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 78 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 79 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 80 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 81 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 82 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 83 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 84 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 85 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 86 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 87 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 88 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 89 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 90 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 91 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 92 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 93 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 94 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 95 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 96 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 97 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 98 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 99 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 100 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 101 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 102 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 103 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 104 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 105 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 106 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 107 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 108 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 109 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 110 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 111 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 112 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 113 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 114 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 115 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 116 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 117 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 118 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 119 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 120 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 121 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 122 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 123 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 124 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 125 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 126 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 127 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 128 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 129 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 130 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 131 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 132 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 133 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 134 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 135 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 136 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 137 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 138 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 139 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 140 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 141 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 142 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 143 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 144 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 145 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 146 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 147 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 148 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 149 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 150 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 151 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 152 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 153 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 154 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 155 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 156 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 157 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 158 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 159 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 160 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 161 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 162 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 163 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 164 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 165 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 166 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 167 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 168 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 169 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 170 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 171 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 172 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 173 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 174 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 175 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 176 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 177 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 178 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 179 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 180 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 181 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 182 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 183 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 184 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 185 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 186 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 187 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 188 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 189 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 190 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 191 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 192 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 193 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 194 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 195 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 196 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 197 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 198 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 199 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 200 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 201 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 202 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 203 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 204 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 205 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 206 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 207 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 208 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 209 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 210 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 211 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 212 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 213 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 214 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 215 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 216 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 217 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 218 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 219 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 220 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 221 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 222 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 223 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 224 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 225 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 226 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 227 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 228 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 229 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 230 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 231 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 232 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 233 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 234 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 235 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 236 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 237 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 238 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 239 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 240 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 241 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 242 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 243 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 244 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 245 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 246 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 247 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 248 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 249 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 250 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 251 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 252 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 253 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 254 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 255 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 256 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 257 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 258 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 259 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 260 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 261 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 262 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 264 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 265 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 266 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 267 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 268 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 269 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 270 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 271 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 272 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 273 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 274 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 275 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 276 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 277 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 278 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 279 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 280 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 281 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 282 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 283 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 284 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 285 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 286 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 287 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 290 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 293 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 294 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 295 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 301 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 304 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 305 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 309 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 310 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 311 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 312 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 313 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 314 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 316 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 317 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 318 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 320 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 321 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 322 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 323 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 324 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 325 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 326 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 327 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 328 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 330 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 331 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 332 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 333 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 334 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 335 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 336 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 337 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 338 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 339 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 340 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 341 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 343 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 344 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 345 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 348 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 355 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 356 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 357 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 358 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 362 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 363 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 364 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 365 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 366 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 367 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 368 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 369 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 370 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 371 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 372 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 373 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 374 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 375 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 376 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 378 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 379 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 380 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 386 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 387 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 389 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 390 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 391 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 392 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 393 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 394 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 396 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 397 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 399 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 401 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 403 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 404 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 405 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 407 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 408 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 409 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 466 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 467 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 476 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 478 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 480 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 483 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 484 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 485 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 486 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 487 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 488 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 489 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 490 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 491 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 492 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 493 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 494 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 495 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 496 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 497 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 498 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 499 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 500 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 501 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 502 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 503 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 504 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 506 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 508 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 509 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 510 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 511 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 512 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 513 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 514 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 515 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 516 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 517 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 518 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 519 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 520 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 521 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 522 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 523 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 524 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 525 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 526 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 527 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 528 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 529 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 530 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 531 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 532 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 533 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 534 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 535 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 536 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 537 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 538 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 539 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 540 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 541 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 542 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 543 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 544 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 545 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 546 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 547 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 548 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 549 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 550 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 551 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 552 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 553 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 554 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 555 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 556 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 557 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 558 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 559 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 560 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 561 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 562 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 563 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 564 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 565 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 566 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 567 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 568 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 569 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 570 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 571 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 572 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 665 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 666 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 667 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 668 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 669 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 670 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 671 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 672 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 673 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 674 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 675 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 676 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 677 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 678 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 679 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 680 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 681 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 682 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 683 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 684 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 685 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 686 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 687 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 688 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 689 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 690 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 694 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 695 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 696 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 697 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 698 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 699 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 700 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 701 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 702 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 703 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 704 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 705 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 706 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 707 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 708 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 709 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 710 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 711 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 712 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 713 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 714 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 715 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 716 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 717 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 718 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 719 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 720 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 721 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 722 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 723 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 725 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 726 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 727 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 728 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 729 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 730 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 731 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 732 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 733 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 734 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 735 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 736 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 737 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 738 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 739 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 740 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 741 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 742 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 743 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 744 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 745 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 746 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 747 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 748 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 749 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 750 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 751 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 752 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 753 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 754 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 755 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 756 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 757 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 758 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 759 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 760 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 761 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 762 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 763 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 764 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 765 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 766 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 767 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 768 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 769 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 770 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 771 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 772 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 773 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 774 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 775 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 776 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 777 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 778 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 779 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 780 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 781 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 782 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 783 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 784 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.11 |
| Metatranscriptomes | 1.25 |
| Isolates | 14.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 9.38 |
| Nodule | 1.72 |
| Rhizoplane | 5.94 |
| Rhizosphere | 73.91 |
| Stem | 0.05 |
| Stem Tuber | 0 |
| Unclassified | 8.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1652 | 2124908027 | Bacteria | 30845 |
| 2 | JGI25156J39149_1000267 | 3300002705 | Bacteria | 35297 |
| 3 | JGI25156J39149_1002692 | 3300002705 | Bacteria | 6223 |
| 4 | JGI25162J39368_1000040 | 3300002737 | Bacteria | 175938 |
| 5 | JGI25162J39368_1000098 | 3300002737 | Bacteria | 95821 |
| 6 | JGI25162J39368_1000129 | 3300002737 | Bacteria | 83712 |
| 7 | JGI25162J39368_1006805 | 3300002737 | Bacteria | 1890 |
| 8 | JGI25154J39366_1000739 | 3300002738 | Bacteria | 14651 |
| 9 | JGI25154J39366_1002155 | 3300002738 | Bacteria | 5508 |
| 10 | JGI25158J39367_1014308 | 3300002739 | Bacteria | 1027 |
| 11 | JGI25157J39369_1000372 | 3300002741 | Bacteria | 30863 |
| 12 | JGI25157J39369_1000495 | 3300002741 | Bacteria | 24307 |
| 13 | JGI25163J39215_1004713 | 3300002771 | Bacteria | 929 |
| 14 | JGI25164J39214_1000076 | 3300002772 | Bacteria | 95821 |
| 15 | JGI25164J39214_1000101 | 3300002772 | Bacteria | 83715 |
| 16 | JGI25152J39213_1003789 | 3300002773 | Bacteria | 5023 |
| 17 | JGI25159J45721_1003356 | 3300002987 | Bacteria | 5702 |
| 18 | JGI25159J45721_1010497 | 3300002987 | Bacteria | 2354 |
| 19 | JGI25159J45721_1024725 | 3300002987 | Bacteria | 1063 |
| 20 | JGI25165J46597_1000051 | 3300003214 | Bacteria | 241012 |
| 21 | JGI25165J46597_1000150 | 3300003214 | Bacteria | 115430 |
| 22 | JGI25165J46597_1000180 | 3300003214 | Bacteria | 95821 |
| 23 | JGI25153J46596_10003428 | 3300003215 | Bacteria | 8879 |
| 24 | JGI25160J50197_1017779 | 3300003354 | Bacteria | 2239 |
| 25 | JGI25161J50226_1001939 | 3300003374 | Bacteria | 5706 |
| 26 | JGI25161J50226_1011958 | 3300003374 | Bacteria | 1063 |
| 27 | Ga0006562J51391_1024911 | 3300003578 | Bacteria | 2650 |
| 28 | Ga0032354_1037465 | 3300003693 | Bacteria | 2117 |
| 29 | Ga0055538_1000025 | 3300003751 | Bacteria | 241012 |
| 30 | Ga0055538_1000037 | 3300003751 | Bacteria | 190238 |
| 31 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 32 | Ga0055539_1000032 | 3300003752 | Bacteria | 241012 |
| 33 | Ga0055539_1000048 | 3300003752 | Bacteria | 190238 |
| 34 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 35 | Ga0055533_1000042 | 3300003756 | Bacteria | 241012 |
| 36 | Ga0055533_1000059 | 3300003756 | Bacteria | 190238 |
| 37 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 38 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 39 | Ga0055532_1000105 | 3300003758 | Bacteria | 91428 |
| 40 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 41 | Ga0055525_1000050 | 3300003759 | Bacteria | 241012 |
| 42 | Ga0055525_1000128 | 3300003759 | Bacteria | 113553 |
| 43 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 44 | Ga0055535_1003795 | 3300003761 | Bacteria | 4028 |
| 45 | Ga0055542_1004530 | 3300003762 | Bacteria | 3347 |
| 46 | Ga0055526_1000045 | 3300003771 | Bacteria | 121703 |
| 47 | Ga0055526_1000481 | 3300003771 | Bacteria | 31637 |
| 48 | Ga0055526_1002752 | 3300003771 | Bacteria | 11667 |
| 49 | Ga0055526_1009931 | 3300003771 | Bacteria | 4503 |
| 50 | Ga0055537_1000626 | 3300003773 | Bacteria | 19168 |
| 51 | Ga0055537_1003160 | 3300003773 | Bacteria | 5157 |
| 52 | Ga0055524_1000024 | 3300003775 | Bacteria | 217953 |
| 53 | Ga0055524_1006833 | 3300003775 | Bacteria | 4920 |
| 54 | Ga0055524_1013987 | 3300003775 | Bacteria | 2997 |
| 55 | Ga0055524_1018011 | 3300003775 | Bacteria | 2469 |
| 56 | Ga0055536_1002523 | 3300003781 | Bacteria | 10259 |
| 57 | Ga0055534_1000557 | 3300003784 | Bacteria | 19717 |
| 58 | Ga0055534_1018769 | 3300003784 | Bacteria | 1197 |
| 59 | Ga0055528_1000252 | 3300003790 | Bacteria | 45454 |
| 60 | Ga0055528_1011419 | 3300003790 | Bacteria | 3527 |
| 61 | Ga0055530_10000312 | 3300003791 | Bacteria | 44214 |
| 62 | Ga0055530_10001569 | 3300003791 | Bacteria | 16372 |
| 63 | Ga0055540_1000217 | 3300003792 | Bacteria | 54396 |
| 64 | Ga0055540_1000294 | 3300003792 | Bacteria | 44469 |
| 65 | Ga0055540_1001288 | 3300003792 | Bacteria | 15226 |
| 66 | Ga0055531_10000238 | 3300003794 | Bacteria | 60414 |
| 67 | Ga0055531_10000275 | 3300003794 | Bacteria | 53122 |
| 68 | Ga0055541_1000023 | 3300003841 | Bacteria | 241012 |
| 69 | Ga0055541_1000035 | 3300003841 | Bacteria | 190238 |
| 70 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 71 | Ga0058692_1020622 | 3300003856 | Bacteria | 1382 |
| 72 | Ga0055543_1002659 | 3300004625 | Bacteria | 5744 |
| 73 | Ga0065165_1000379 | 3300005262 | Bacteria | 72513 |
| 74 | Ga0065165_1000936 | 3300005262 | Bacteria | 37330 |
| 75 | Ga0065165_1006940 | 3300005262 | Bacteria | 5744 |
| 76 | Ga0065714_10000282 | 3300005288 | Bacteria | 6343 |
| 77 | Ga0065714_10022826 | 3300005288 | Bacteria | 1032 |
| 78 | Ga0065714_10066311 | 3300005288 | Bacteria | 7130 |
| 79 | Ga0065704_10007693 | 3300005289 | Bacteria | 3988 |
| 80 | Ga0065704_10159285 | 3300005289 | Bacteria | 1367 |
| 81 | Ga0065712_10008788 | 3300005290 | Bacteria | 2181 |
| 82 | Ga0065712_10067807 | 3300005290 | Bacteria | 30871 |
| 83 | Ga0065715_10145527 | 3300005293 | Bacteria | 1789 |
| 84 | Ga0065715_10361477 | 3300005293 | Bacteria | 935 |
| 85 | Ga0070658_10065716 | 3300005327 | Bacteria | 2961 |
| 86 | Ga0070658_10114609 | 3300005327 | Bacteria | 2235 |
| 87 | Ga0070676_10106008 | 3300005328 | Bacteria | 1744 |
| 88 | Ga0070690_100269075 | 3300005330 | Bacteria | 1211 |
| 89 | Ga0070670_100062353 | 3300005331 | Bacteria | 3201 |
| 90 | Ga0070670_100084312 | 3300005331 | Bacteria | 2730 |
| 91 | Ga0070670_100139271 | 3300005331 | Bacteria | 2098 |
| 92 | Ga0070666_10001127 | 3300005335 | Bacteria | 16241 |
| 93 | Ga0068868_100002829 | 3300005338 | Bacteria | 12020 |
| 94 | Ga0070660_100003755 | 3300005339 | Bacteria | 10495 |
| 95 | Ga0070660_100061598 | 3300005339 | Bacteria | 2913 |
| 96 | Ga0070660_100383095 | 3300005339 | Bacteria | 1161 |
| 97 | Ga0070689_100022500 | 3300005340 | Bacteria | 4706 |
| 98 | Ga0070689_100128199 | 3300005340 | Bacteria | 2033 |
| 99 | Ga0070661_100000178 | 3300005344 | Bacteria | 52325 |
| 100 | Ga0070661_100005481 | 3300005344 | Bacteria | 8749 |
| 101 | Ga0070661_100058455 | 3300005344 | Bacteria | 2825 |
| 102 | Ga0070668_100355067 | 3300005347 | Unclassified | 1242 |
| 103 | Ga0070669_100000265 | 3300005353 | Bacteria | 42842 |
| 104 | Ga0070669_100005987 | 3300005353 | Bacteria | 8776 |
| 105 | Ga0070669_100026715 | 3300005353 | Bacteria | 4154 |
| 106 | Ga0070675_100090409 | 3300005354 | Bacteria | 2564 |
| 107 | Ga0070673_100074726 | 3300005364 | Bacteria | 2732 |
| 108 | Ga0070659_100001965 | 3300005366 | Bacteria | 14678 |
| 109 | Ga0070667_100010227 | 3300005367 | Bacteria | 7751 |
| 110 | Ga0070714_100029472 | 3300005435 | Bacteria | 4562 |
| 111 | Ga0070714_100038437 | 3300005435 | Bacteria | 4023 |
| 112 | Ga0070713_100065540 | 3300005436 | Bacteria | 3052 |
| 113 | Ga0070700_100047678 | 3300005441 | Bacteria | 2652 |
| 114 | Ga0070663_100239210 | 3300005455 | Bacteria | 1432 |
| 115 | Ga0070678_100149427 | 3300005456 | Bacteria | 1880 |
| 116 | Ga0070662_100000348 | 3300005457 | Bacteria | 27713 |
| 117 | Ga0070662_100040368 | 3300005457 | Bacteria | 3322 |
| 118 | Ga0070662_100162552 | 3300005457 | Bacteria | 1747 |
| 119 | Ga0070662_100175405 | 3300005457 | Bacteria | 1686 |
| 120 | Ga0070681_10014570 | 3300005458 | Bacteria | 7824 |
| 121 | Ga0070681_10079256 | 3300005458 | Bacteria | 3241 |
| 122 | Ga0070681_10159163 | 3300005458 | Bacteria | 2182 |
| 123 | Ga0068867_100244163 | 3300005459 | Bacteria | 1457 |
| 124 | Ga0070706_100057979 | 3300005467 | Bacteria | 3574 |
| 125 | Ga0070684_100145004 | 3300005535 | Bacteria | 2149 |
| 126 | Ga0070697_100702760 | 3300005536 | Bacteria | 892 |
| 127 | Ga0068853_100000029 | 3300005539 | Bacteria | 121775 |
| 128 | Ga0068853_100004343 | 3300005539 | Bacteria | 10970 |
| 129 | Ga0068853_100178370 | 3300005539 | Bacteria | 1926 |
| 130 | Ga0068853_100283618 | 3300005539 | Bacteria | 1527 |
| 131 | Ga0068853_100602475 | 3300005539 | Bacteria | 1043 |
| 132 | Ga0070672_100303253 | 3300005543 | Bacteria | 1354 |
| 133 | Ga0070686_100087636 | 3300005544 | Bacteria | 2075 |
| 134 | Ga0070686_100211913 | 3300005544 | Bacteria | 1395 |
| 135 | Ga0070665_100018864 | 3300005548 | Bacteria | 6917 |
| 136 | Ga0070665_100064242 | 3300005548 | Bacteria | 3680 |
| 137 | Ga0068855_100003915 | 3300005563 | Bacteria | 18175 |
| 138 | Ga0068855_100102548 | 3300005563 | Bacteria | 3293 |
| 139 | Ga0068855_100132978 | 3300005563 | Bacteria | 2840 |
| 140 | Ga0068855_100396691 | 3300005563 | Bacteria | 1513 |
| 141 | Ga0068855_100560194 | 3300005563 | Bacteria | 1236 |
| 142 | Ga0070664_100000680 | 3300005564 | Bacteria | 26007 |
| 143 | Ga0070664_100010538 | 3300005564 | Bacteria | 7492 |
| 144 | Ga0070664_100064635 | 3300005564 | Bacteria | 3121 |
| 145 | Ga0070664_100078682 | 3300005564 | Bacteria | 2836 |
| 146 | Ga0070664_100290271 | 3300005564 | Bacteria | 1476 |
| 147 | Ga0070664_100547781 | 3300005564 | Bacteria | 1069 |
| 148 | Ga0070664_100592055 | 3300005564 | Bacteria | 1028 |
| 149 | Ga0068857_100086731 | 3300005577 | Bacteria | 2799 |
| 150 | Ga0068857_100160228 | 3300005577 | Bacteria | 2041 |
| 151 | Ga0068854_100064390 | 3300005578 | Bacteria | 2663 |
| 152 | Ga0068854_100667834 | 3300005578 | Bacteria | 894 |
| 153 | Ga0068856_100039033 | 3300005614 | Bacteria | 4662 |
| 154 | Ga0068856_100161565 | 3300005614 | Bacteria | 2250 |
| 155 | Ga0070702_100008784 | 3300005615 | Bacteria | 4914 |
| 156 | Ga0068852_100031182 | 3300005616 | Bacteria | 4395 |
| 157 | Ga0068859_100005859 | 3300005617 | Bacteria | 12471 |
| 158 | Ga0068864_100002557 | 3300005618 | Bacteria | 15027 |
| 159 | Ga0068851_10000024 | 3300005834 | Bacteria | 125917 |
| 160 | Ga0068851_10102682 | 3300005834 | Bacteria | 1519 |
| 161 | Ga0068858_100006205 | 3300005842 | Bacteria | 11651 |
| 162 | Ga0070717_10035845 | 3300006028 | Bacteria | 4020 |
| 163 | Ga0070717_10293650 | 3300006028 | Bacteria | 1444 |
| 164 | Ga0075368_10002887 | 3300006042 | Bacteria | 5675 |
| 165 | Ga0075363_100005456 | 3300006048 | Bacteria | 5660 |
| 166 | Ga0075364_10035001 | 3300006051 | Bacteria | 3244 |
| 167 | Ga0075432_10006193 | 3300006058 | Bacteria | 4067 |
| 168 | Ga0075432_10155801 | 3300006058 | Bacteria | 880 |
| 169 | Ga0070716_100015793 | 3300006173 | Bacteria | 3887 |
| 170 | Ga0075367_10003131 | 3300006178 | Bacteria | 7787 |
| 171 | Ga0075369_10010363 | 3300006186 | Bacteria | 3644 |
| 172 | Ga0075366_10001060 | 3300006195 | Bacteria | 13490 |
| 173 | Ga0075370_10026031 | 3300006353 | Bacteria | 3238 |
| 174 | Ga0075433_10553656 | 3300006852 | Bacteria | 1011 |
| 175 | Ga0075434_100048649 | 3300006871 | Bacteria | 4207 |
| 176 | Ga0068865_100057233 | 3300006881 | Bacteria | 2719 |
| 177 | Ga0068865_100074790 | 3300006881 | Bacteria | 2414 |
| 178 | Ga0097620_100005859 | 3300006931 | Bacteria | 12471 |
| 179 | Ga0099823_1000243 | 3300006944 | Bacteria | 31673 |
| 180 | Ga0099823_1041682 | 3300006944 | Bacteria | 3253 |
| 181 | Ga0079104_1000508 | 3300006946 | Bacteria | 41889 |
| 182 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 183 | Ga0099826_10022339 | 3300006948 | Bacteria | 4730 |
| 184 | Ga0105251_10000118 | 3300009011 | Bacteria | 79165 |
| 185 | Ga0105251_10000191 | 3300009011 | Bacteria | 62283 |
| 186 | Ga0105251_10000327 | 3300009011 | Bacteria | 47707 |
| 187 | Ga0105251_10000977 | 3300009011 | Bacteria | 25320 |
| 188 | Ga0105251_10002348 | 3300009011 | Bacteria | 14969 |
| 189 | Ga0105251_10003254 | 3300009011 | Bacteria | 11933 |
| 190 | Ga0105251_10003735 | 3300009011 | Bacteria | 10894 |
| 191 | Ga0105251_10005020 | 3300009011 | Bacteria | 8783 |
| 192 | Ga0105251_10025865 | 3300009011 | Bacteria | 2995 |
| 193 | Ga0105251_10044310 | 3300009011 | Bacteria | 2150 |
| 194 | Ga0105251_10122702 | 3300009011 | Bacteria | 1180 |
| 195 | Ga0105244_10000639 | 3300009036 | Bacteria | 30878 |
| 196 | Ga0105244_10001496 | 3300009036 | Bacteria | 18753 |
| 197 | Ga0105244_10002229 | 3300009036 | Bacteria | 14769 |
| 198 | Ga0105244_10002769 | 3300009036 | Bacteria | 13073 |
| 199 | Ga0105244_10003018 | 3300009036 | Bacteria | 12355 |
| 200 | Ga0105244_10005078 | 3300009036 | Bacteria | 8847 |
| 201 | Ga0105244_10008540 | 3300009036 | Bacteria | 6389 |
| 202 | Ga0105244_10011004 | 3300009036 | Bacteria | 5452 |
| 203 | Ga0105244_10014131 | 3300009036 | Bacteria | 4630 |
| 204 | Ga0105244_10032077 | 3300009036 | Bacteria | 2784 |
| 205 | Ga0105244_10038657 | 3300009036 | Bacteria | 2488 |
| 206 | Ga0105244_10054229 | 3300009036 | Bacteria | 2035 |
| 207 | Ga0105250_10000251 | 3300009092 | Bacteria | 44435 |
| 208 | Ga0105250_10000487 | 3300009092 | Bacteria | 27888 |
| 209 | Ga0105250_10019916 | 3300009092 | Bacteria | 2714 |
| 210 | Ga0105240_10001608 | 3300009093 | Bacteria | 38292 |
| 211 | Ga0105240_10019527 | 3300009093 | Bacteria | 9051 |
| 212 | Ga0105240_10026829 | 3300009093 | Bacteria | 7554 |
| 213 | Ga0105240_10043423 | 3300009093 | Bacteria | 5720 |
| 214 | Ga0105240_10061599 | 3300009093 | Bacteria | 4676 |
| 215 | Ga0105245_10077129 | 3300009098 | Bacteria | 3037 |
| 216 | Ga0105247_10004253 | 3300009101 | Bacteria | 9174 |
| 217 | Ga0105247_10012542 | 3300009101 | Bacteria | 5091 |
| 218 | Ga0105243_10000299 | 3300009148 | Bacteria | 54796 |
| 219 | Ga0105243_10005926 | 3300009148 | Bacteria | 9467 |
| 220 | Ga0105243_10007642 | 3300009148 | Bacteria | 8308 |
| 221 | Ga0105243_10009460 | 3300009148 | Bacteria | 7424 |
| 222 | Ga0105243_10118388 | 3300009148 | Bacteria | 2229 |
| 223 | Ga0105243_10135951 | 3300009148 | Bacteria | 2091 |
| 224 | Ga0105241_10039775 | 3300009174 | Bacteria | 3548 |
| 225 | Ga0105241_10055742 | 3300009174 | Bacteria | 3029 |
| 226 | Ga0105242_10001173 | 3300009176 | Bacteria | 20612 |
| 227 | Ga0105248_10002113 | 3300009177 | Bacteria | 22001 |
| 228 | Ga0105248_10024766 | 3300009177 | Bacteria | 6674 |
| 229 | Ga0105237_10002206 | 3300009545 | Bacteria | 24399 |
| 230 | Ga0105237_10020762 | 3300009545 | Bacteria | 6765 |
| 231 | Ga0105237_10096738 | 3300009545 | Bacteria | 2943 |
| 232 | Ga0105237_10516438 | 3300009545 | Unclassified | 1201 |
| 233 | Ga0105238_10000763 | 3300009551 | Bacteria | 33477 |
| 234 | Ga0105238_10002078 | 3300009551 | Bacteria | 20242 |
| 235 | Ga0105238_10027792 | 3300009551 | Bacteria | 5765 |
| 236 | Ga0105238_10061370 | 3300009551 | Bacteria | 3762 |
| 237 | Ga0105238_10236152 | 3300009551 | Bacteria | 1805 |
| 238 | Ga0105238_10551097 | 3300009551 | Bacteria | 1157 |
| 239 | Ga0105249_10038235 | 3300009553 | Bacteria | 4353 |
| 240 | Ga0105249_10143100 | 3300009553 | Bacteria | 2295 |
| 241 | Ga0105249_10888895 | 3300009553 | Bacteria | 957 |
| 242 | Ga0105239_10008100 | 3300010375 | Bacteria | 11995 |
| 243 | Ga0105239_10009911 | 3300010375 | Bacteria | 10701 |
| 244 | Ga0105239_10033547 | 3300010375 | Bacteria | 5636 |
| 245 | Ga0105239_10195939 | 3300010375 | Bacteria | 2262 |
| 246 | Ga0105239_10407477 | 3300010375 | Bacteria | 1539 |
| 247 | Ga0105239_10515560 | 3300010375 | Bacteria | 1360 |
| 248 | Ga0105239_11222117 | 3300010375 | Bacteria | 866 |
| 249 | Ga0105246_10000652 | 3300011119 | Bacteria | 19387 |
| 250 | Ga0105246_10004799 | 3300011119 | Bacteria | 8233 |
| 251 | Ga0105246_10011845 | 3300011119 | Bacteria | 5422 |
| 252 | Ga0105246_10070897 | 3300011119 | Bacteria | 2452 |
| 253 | Ga0105246_10181268 | 3300011119 | Bacteria | 1622 |
| 254 | Ga0157373_10000793 | 3300013100 | Bacteria | 24394 |
| 255 | Ga0157373_10004410 | 3300013100 | Bacteria | 10598 |
| 256 | Ga0157373_10139519 | 3300013100 | Bacteria | 1705 |
| 257 | Ga0157373_10199167 | 3300013100 | Bacteria | 1412 |
| 258 | Ga0157371_10000238 | 3300013102 | Bacteria | 78535 |
| 259 | Ga0157371_10087043 | 3300013102 | Bacteria | 2212 |
| 260 | Ga0157371_10118230 | 3300013102 | Bacteria | 1884 |
| 261 | Ga0157370_10127631 | 3300013104 | Bacteria | 2374 |
| 262 | Ga0157370_10129271 | 3300013104 | Bacteria | 2357 |
| 263 | Ga0157369_10000537 | 3300013105 | Bacteria | 50143 |
| 264 | Ga0157369_10354798 | 3300013105 | Bacteria | 1523 |
| 265 | Ga0157369_10484147 | 3300013105 | Bacteria | 1280 |
| 266 | Ga0163162_10016611 | 3300013306 | Bacteria | 7194 |
| 267 | Ga0163162_10049541 | 3300013306 | Bacteria | 4210 |
| 268 | Ga0163162_10142729 | 3300013306 | Bacteria | 2509 |
| 269 | Ga0163162_10183552 | 3300013306 | Bacteria | 2218 |
| 270 | Ga0157372_10006660 | 3300013307 | Bacteria | 12294 |
| 271 | Ga0157372_10049515 | 3300013307 | Bacteria | 4671 |
| 272 | Ga0157372_10072658 | 3300013307 | Bacteria | 3877 |
| 273 | Ga0157372_10229871 | 3300013307 | Bacteria | 2150 |
| 274 | Ga0157372_11507295 | 3300013307 | Bacteria | 775 |
| 275 | Ga0157375_10056113 | 3300013308 | Bacteria | 3887 |
| 276 | Ga0163163_10003386 | 3300014325 | Bacteria | 13534 |
| 277 | Ga0163163_10012524 | 3300014325 | Bacteria | 7734 |
| 278 | Ga0182008_10001211 | 3300014497 | Bacteria | 17767 |
| 279 | Ga0182008_10004382 | 3300014497 | Bacteria | 8259 |
| 280 | Ga0182008_10005360 | 3300014497 | Bacteria | 7321 |
| 281 | Ga0182008_10010498 | 3300014497 | Bacteria | 4954 |
| 282 | Ga0182008_10044122 | 3300014497 | Bacteria | 2218 |
| 283 | Ga0157377_10007511 | 3300014745 | Bacteria | 5267 |
| 284 | Ga0157379_10103371 | 3300014968 | Bacteria | 2556 |
| 285 | Ga0157379_10107319 | 3300014968 | Bacteria | 2507 |
| 286 | Ga0157376_10041402 | 3300014969 | Bacteria | 3770 |
| 287 | Ga0157376_10103651 | 3300014969 | Bacteria | 2491 |
| 288 | Ga0182006_1000033 | 3300015261 | Bacteria | 238180 |
| 289 | Ga0182006_1000141 | 3300015261 | Bacteria | 77478 |
| 290 | Ga0182006_1008100 | 3300015261 | Bacteria | 4772 |
| 291 | Ga0182006_1010430 | 3300015261 | Bacteria | 4132 |
| 292 | Ga0182006_1027033 | 3300015261 | Bacteria | 2345 |
| 293 | Ga0182006_1030859 | 3300015261 | Bacteria | 2163 |
| 294 | Ga0182007_10001557 | 3300015262 | Bacteria | 12229 |
| 295 | Ga0182007_10026404 | 3300015262 | Bacteria | 2013 |
| 296 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 297 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 298 | Ga0182005_1001902 | 3300015265 | Bacteria | 7908 |
| 299 | Ga0183360_10154 | 3300015689 | Bacteria | 1448 |
| 300 | Ga0163161_10015922 | 3300017792 | Bacteria | 5246 |
| 301 | Ga0163161_10025047 | 3300017792 | Bacteria | 4219 |
| 302 | Ga0163161_10111303 | 3300017792 | Bacteria | 2047 |
| 303 | Ga0206351_10464379 | 3300020077 | Bacteria | 853 |
| 304 | Ga0213872_10000005 | 3300021361 | Bacteria | 290165 |
| 305 | Ga0213872_10001171 | 3300021361 | Bacteria | 17824 |
| 306 | Ga0213872_10002039 | 3300021361 | Bacteria | 12282 |
| 307 | Ga0213872_10007513 | 3300021361 | Bacteria | 5355 |
| 308 | Ga0213872_10010335 | 3300021361 | Bacteria | 4445 |
| 309 | Ga0213872_10018649 | 3300021361 | Bacteria | 3198 |
| 310 | Ga0213872_10021029 | 3300021361 | Bacteria | 3004 |
| 311 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 312 | Ga0209435_100176 | 3300025206 | Bacteria | 19214 |
| 313 | Ga0209435_100319 | 3300025206 | Bacteria | 11575 |
| 314 | Ga0209760_100080 | 3300025207 | Bacteria | 77279 |
| 315 | Ga0209760_100465 | 3300025207 | Bacteria | 8919 |
| 316 | Ga0209436_100287 | 3300025208 | Bacteria | 23212 |
| 317 | Ga0209436_102115 | 3300025208 | Bacteria | 6223 |
| 318 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 319 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 320 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 321 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 322 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 323 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 324 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 325 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 326 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 327 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 328 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 329 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 330 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 331 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 332 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 333 | Ga0209563_102312 | 3300025230 | Bacteria | 4377 |
| 334 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 335 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 336 | Ga0207427_102072 | 3300025231 | Bacteria | 5925 |
| 337 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 338 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 339 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 340 | Ga0209437_100332 | 3300025233 | Bacteria | 58796 |
| 341 | Ga0209258_100115 | 3300025242 | Bacteria | 190367 |
| 342 | Ga0209258_100460 | 3300025242 | Bacteria | 44368 |
| 343 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 344 | Ga0207425_1000170 | 3300025245 | Bacteria | 53604 |
| 345 | Ga0207425_1002098 | 3300025245 | Bacteria | 7365 |
| 346 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 347 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 348 | Ga0209646_1000107 | 3300025246 | Bacteria | 163112 |
| 349 | Ga0209646_1000183 | 3300025246 | Bacteria | 79021 |
| 350 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 351 | Ga0209026_1002108 | 3300025250 | Bacteria | 7803 |
| 352 | Ga0209026_1008584 | 3300025250 | Bacteria | 2115 |
| 353 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 354 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 355 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 356 | Ga0209677_102948 | 3300025253 | Bacteria | 5935 |
| 357 | Ga0209148_1001117 | 3300025254 | Bacteria | 15972 |
| 358 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 359 | Ga0209759_1000198 | 3300025256 | Bacteria | 95052 |
| 360 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 361 | Ga0209129_1004970 | 3300025258 | Bacteria | 4923 |
| 362 | Ga0209129_1023052 | 3300025258 | Bacteria | 1115 |
| 363 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 364 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 365 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 366 | Ga0209233_1051831 | 3300025261 | Bacteria | 830 |
| 367 | Ga0209565_1000123 | 3300025263 | Bacteria | 111069 |
| 368 | Ga0209565_1000632 | 3300025263 | Bacteria | 23018 |
| 369 | Ga0209565_1000689 | 3300025263 | Bacteria | 21007 |
| 370 | Ga0209565_1011339 | 3300025263 | Bacteria | 2170 |
| 371 | Ga0209565_1023449 | 3300025263 | Bacteria | 1267 |
| 372 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 373 | Ga0209455_1001196 | 3300025272 | Bacteria | 12392 |
| 374 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 375 | Ga0209673_1008854 | 3300025273 | Bacteria | 4432 |
| 376 | Ga0209130_1000589 | 3300025284 | Bacteria | 35424 |
| 377 | Ga0209130_1002447 | 3300025284 | Bacteria | 9298 |
| 378 | Ga0209130_1003581 | 3300025284 | Bacteria | 6485 |
| 379 | Ga0209675_1000117 | 3300025291 | Bacteria | 111087 |
| 380 | Ga0209675_1000567 | 3300025291 | Bacteria | 26633 |
| 381 | Ga0209675_1010611 | 3300025291 | Bacteria | 3129 |
| 382 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 383 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 384 | Ga0209676_1001206 | 3300025292 | Bacteria | 27625 |
| 385 | Ga0209676_1006288 | 3300025292 | Bacteria | 5902 |
| 386 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 387 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 388 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 389 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 390 | Ga0209564_1001500 | 3300025295 | Bacteria | 23422 |
| 391 | Ga0209564_1024695 | 3300025295 | Bacteria | 2047 |
| 392 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 393 | Ga0209758_1000394 | 3300025297 | Bacteria | 75557 |
| 394 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 395 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 396 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 397 | Ga0209050_1000381 | 3300025298 | Bacteria | 83623 |
| 398 | Ga0209050_1000981 | 3300025298 | Bacteria | 36358 |
| 399 | Ga0209050_1001569 | 3300025298 | Bacteria | 23757 |
| 400 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 401 | Ga0209256_1000288 | 3300025299 | Bacteria | 88470 |
| 402 | Ga0209256_1001035 | 3300025299 | Bacteria | 32598 |
| 403 | Ga0209256_1001444 | 3300025299 | Bacteria | 24546 |
| 404 | Ga0209256_1001988 | 3300025299 | Bacteria | 18381 |
| 405 | Ga0207426_1000956 | 3300025302 | Bacteria | 28468 |
| 406 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 407 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 408 | Ga0209051_1000299 | 3300025303 | Bacteria | 78310 |
| 409 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 410 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 411 | Ga0209257_1004941 | 3300025304 | Bacteria | 9781 |
| 412 | Ga0207656_10000008 | 3300025321 | Bacteria | 275365 |
| 413 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 414 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 415 | Ga0207696_1000074 | 3300025711 | Bacteria | 215333 |
| 416 | Ga0207696_1000084 | 3300025711 | Bacteria | 196086 |
| 417 | Ga0207696_1004990 | 3300025711 | Bacteria | 5596 |
| 418 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 419 | Ga0207655_1000341 | 3300025728 | Bacteria | 68003 |
| 420 | Ga0207655_1000417 | 3300025728 | Bacteria | 58184 |
| 421 | Ga0207655_1000502 | 3300025728 | Bacteria | 50106 |
| 422 | Ga0207655_1000556 | 3300025728 | Bacteria | 46531 |
| 423 | Ga0207655_1001671 | 3300025728 | Bacteria | 19602 |
| 424 | Ga0207655_1003052 | 3300025728 | Bacteria | 12771 |
| 425 | Ga0207655_1004059 | 3300025728 | Bacteria | 10542 |
| 426 | Ga0207655_1004382 | 3300025728 | Bacteria | 10028 |
| 427 | Ga0207655_1009008 | 3300025728 | Bacteria | 6252 |
| 428 | Ga0207655_1014363 | 3300025728 | Bacteria | 4479 |
| 429 | Ga0207655_1019136 | 3300025728 | Bacteria | 3596 |
| 430 | Ga0207655_1031800 | 3300025728 | Bacteria | 2424 |
| 431 | Ga0207655_1047084 | 3300025728 | Bacteria | 1783 |
| 432 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 433 | Ga0207713_1000114 | 3300025735 | Bacteria | 132170 |
| 434 | Ga0207713_1000572 | 3300025735 | Bacteria | 36532 |
| 435 | Ga0207713_1001535 | 3300025735 | Bacteria | 18179 |
| 436 | Ga0207713_1001823 | 3300025735 | Bacteria | 16278 |
| 437 | Ga0207713_1002851 | 3300025735 | Bacteria | 12154 |
| 438 | Ga0207713_1002976 | 3300025735 | Bacteria | 11843 |
| 439 | Ga0207713_1003112 | 3300025735 | Bacteria | 11505 |
| 440 | Ga0207713_1005620 | 3300025735 | Bacteria | 7797 |
| 441 | Ga0207713_1026063 | 3300025735 | Bacteria | 2687 |
| 442 | Ga0207713_1026175 | 3300025735 | Bacteria | 2678 |
| 443 | Ga0207713_1028291 | 3300025735 | Bacteria | 2531 |
| 444 | Ga0207642_10090366 | 3300025899 | Bacteria | 1511 |
| 445 | Ga0207680_10058347 | 3300025903 | Bacteria | 2339 |
| 446 | Ga0207699_10129730 | 3300025906 | Bacteria | 1643 |
| 447 | Ga0207645_10090148 | 3300025907 | Bacteria | 1972 |
| 448 | Ga0207645_10196251 | 3300025907 | Bacteria | 1327 |
| 449 | Ga0207643_10081658 | 3300025908 | Bacteria | 1874 |
| 450 | Ga0207705_10060456 | 3300025909 | Bacteria | 2737 |
| 451 | Ga0207705_10330705 | 3300025909 | Bacteria | 1172 |
| 452 | Ga0207684_10035065 | 3300025910 | Bacteria | 4261 |
| 453 | Ga0207654_10092385 | 3300025911 | Bacteria | 1848 |
| 454 | Ga0207707_10141988 | 3300025912 | Bacteria | 2099 |
| 455 | Ga0207707_10183472 | 3300025912 | Bacteria | 1826 |
| 456 | Ga0207695_10003613 | 3300025913 | Bacteria | 21636 |
| 457 | Ga0207695_10004696 | 3300025913 | Bacteria | 18501 |
| 458 | Ga0207695_10004927 | 3300025913 | Bacteria | 17992 |
| 459 | Ga0207695_10019466 | 3300025913 | Bacteria | 7819 |
| 460 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 461 | Ga0207671_10003371 | 3300025914 | Bacteria | 16001 |
| 462 | Ga0207671_10005095 | 3300025914 | Bacteria | 12259 |
| 463 | Ga0207671_10043537 | 3300025914 | Bacteria | 3320 |
| 464 | Ga0207693_10035205 | 3300025915 | Bacteria | 3948 |
| 465 | Ga0207663_10005967 | 3300025916 | Bacteria | 6187 |
| 466 | Ga0207660_10172548 | 3300025917 | Bacteria | 1675 |
| 467 | Ga0207662_10314382 | 3300025918 | Bacteria | 1044 |
| 468 | Ga0207657_10005929 | 3300025919 | Bacteria | 12719 |
| 469 | Ga0207657_10014161 | 3300025919 | Bacteria | 7802 |
| 470 | Ga0207657_10046922 | 3300025919 | Bacteria | 3782 |
| 471 | Ga0207657_10322084 | 3300025919 | Bacteria | 1222 |
| 472 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 473 | Ga0207649_10011459 | 3300025920 | Bacteria | 4890 |
| 474 | Ga0207649_10072113 | 3300025920 | Bacteria | 2208 |
| 475 | Ga0207649_10191300 | 3300025920 | Bacteria | 1439 |
| 476 | Ga0207681_10002623 | 3300025923 | Bacteria | 11397 |
| 477 | Ga0207681_10004161 | 3300025923 | Bacteria | 8964 |
| 478 | Ga0207681_10057803 | 3300025923 | Bacteria | 2653 |
| 479 | Ga0207694_10000343 | 3300025924 | Bacteria | 44142 |
| 480 | Ga0207694_10002811 | 3300025924 | Bacteria | 14054 |
| 481 | Ga0207694_10027879 | 3300025924 | Bacteria | 4303 |
| 482 | Ga0207694_10193957 | 3300025924 | Bacteria | 1651 |
| 483 | Ga0207694_10515190 | 3300025924 | Bacteria | 1002 |
| 484 | Ga0207650_10000239 | 3300025925 | Bacteria | 60879 |
| 485 | Ga0207650_10044437 | 3300025925 | Bacteria | 3265 |
| 486 | Ga0207650_10100131 | 3300025925 | Bacteria | 2229 |
| 487 | Ga0207650_10213466 | 3300025925 | Bacteria | 1550 |
| 488 | Ga0207687_10030810 | 3300025927 | Bacteria | 3620 |
| 489 | Ga0207687_10198559 | 3300025927 | Bacteria | 1566 |
| 490 | Ga0207700_10761438 | 3300025928 | Bacteria | 865 |
| 491 | Ga0207664_10011629 | 3300025929 | Bacteria | 6268 |
| 492 | Ga0207644_10018840 | 3300025931 | Bacteria | 4676 |
| 493 | Ga0207690_10001518 | 3300025932 | Bacteria | 14519 |
| 494 | Ga0207690_10189335 | 3300025932 | Bacteria | 1555 |
| 495 | Ga0207706_10000069 | 3300025933 | Bacteria | 105541 |
| 496 | Ga0207706_10015680 | 3300025933 | Bacteria | 6850 |
| 497 | Ga0207706_10088647 | 3300025933 | Bacteria | 2720 |
| 498 | Ga0207706_10283716 | 3300025933 | Bacteria | 1444 |
| 499 | Ga0207686_10001137 | 3300025934 | Bacteria | 15348 |
| 500 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 501 | Ga0207709_10000164 | 3300025935 | Bacteria | 91154 |
| 502 | Ga0207709_10011415 | 3300025935 | Bacteria | 4900 |
| 503 | Ga0207709_10017758 | 3300025935 | Bacteria | 3976 |
| 504 | Ga0207709_10018345 | 3300025935 | Bacteria | 3918 |
| 505 | Ga0207709_10138322 | 3300025935 | Bacteria | 1670 |
| 506 | Ga0207670_10102381 | 3300025936 | Bacteria | 2047 |
| 507 | Ga0207669_10123372 | 3300025937 | Bacteria | 1764 |
| 508 | Ga0207704_10129377 | 3300025938 | Bacteria | 1745 |
| 509 | Ga0207704_10256567 | 3300025938 | Unclassified | 1316 |
| 510 | Ga0207665_10002622 | 3300025939 | Bacteria | 12104 |
| 511 | Ga0207691_10110359 | 3300025940 | Bacteria | 2447 |
| 512 | Ga0207691_10159973 | 3300025940 | Bacteria | 1976 |
| 513 | Ga0207691_10570357 | 3300025940 | Bacteria | 959 |
| 514 | Ga0207661_10107254 | 3300025944 | Bacteria | 2356 |
| 515 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 516 | Ga0207679_10010792 | 3300025945 | Bacteria | 5890 |
| 517 | Ga0207679_10014950 | 3300025945 | Bacteria | 5114 |
| 518 | Ga0207667_10000912 | 3300025949 | Bacteria | 37632 |
| 519 | Ga0207667_10001085 | 3300025949 | Bacteria | 34518 |
| 520 | Ga0207667_10007366 | 3300025949 | Bacteria | 13242 |
| 521 | Ga0207667_10011221 | 3300025949 | Bacteria | 10426 |
| 522 | Ga0207667_10141020 | 3300025949 | Bacteria | 2481 |
| 523 | Ga0207667_10153364 | 3300025949 | Bacteria | 2370 |
| 524 | Ga0207651_10116229 | 3300025960 | Bacteria | 2019 |
| 525 | Ga0207712_10020485 | 3300025961 | Bacteria | 4330 |
| 526 | Ga0207712_10090785 | 3300025961 | Bacteria | 2248 |
| 527 | Ga0207668_10594829 | 3300025972 | Bacteria | 963 |
| 528 | Ga0207640_10022476 | 3300025981 | Bacteria | 3775 |
| 529 | Ga0207640_10044348 | 3300025981 | Bacteria | 2848 |
| 530 | Ga0207640_10241346 | 3300025981 | Bacteria | 1396 |
| 531 | Ga0207640_10568425 | 3300025981 | Bacteria | 955 |
| 532 | Ga0207658_10254903 | 3300025986 | Bacteria | 1492 |
| 533 | Ga0207703_10006804 | 3300026035 | Bacteria | 9111 |
| 534 | Ga0207703_10009193 | 3300026035 | Bacteria | 7774 |
| 535 | Ga0207639_10000099 | 3300026041 | Bacteria | 71467 |
| 536 | Ga0207639_10161261 | 3300026041 | Bacteria | 1890 |
| 537 | Ga0207639_10337317 | 3300026041 | Bacteria | 1343 |
| 538 | Ga0207639_10342056 | 3300026041 | Bacteria | 1334 |
| 539 | Ga0207678_10097937 | 3300026067 | Bacteria | 2506 |
| 540 | Ga0207708_10023225 | 3300026075 | Bacteria | 4685 |
| 541 | Ga0207702_10022953 | 3300026078 | Bacteria | 5176 |
| 542 | Ga0207702_10280934 | 3300026078 | Bacteria | 1574 |
| 543 | Ga0207648_10093658 | 3300026089 | Bacteria | 2627 |
| 544 | Ga0207674_10348802 | 3300026116 | Bacteria | 1431 |
| 545 | Ga0207683_10002493 | 3300026121 | Bacteria | 16052 |
| 546 | Ga0207683_10190397 | 3300026121 | Bacteria | 1862 |
| 547 | Ga0207698_10009503 | 3300026142 | Bacteria | 6203 |
| 548 | Ga0207698_10231225 | 3300026142 | Bacteria | 1678 |
| 549 | Ga0207698_10401314 | 3300026142 | Bacteria | 1310 |
| 550 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 551 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 552 | Ga0209281_1001858 | 3300027111 | Bacteria | 10222 |
| 553 | Ga0209281_1008759 | 3300027111 | Bacteria | 2427 |
| 554 | Ga0209389_1000099 | 3300027296 | Bacteria | 79310 |
| 555 | Ga0209389_1074527 | 3300027296 | Bacteria | 1774 |
| 556 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 557 | Ga0209371_1000653 | 3300027312 | Bacteria | 30228 |
| 558 | Ga0209371_1020557 | 3300027312 | Bacteria | 1622 |
| 559 | Ga0209371_1023115 | 3300027312 | Bacteria | 1470 |
| 560 | Ga0209996_1004612 | 3300027395 | Bacteria | 1754 |
| 561 | Ga0209984_1015393 | 3300027424 | Bacteria | 1017 |
| 562 | Ga0210000_1010807 | 3300027462 | Bacteria | 1351 |
| 563 | Ga0209995_1007635 | 3300027471 | Bacteria | 1742 |
| 564 | Ga0209179_1000427 | 3300027512 | Bacteria | 4210 |
| 565 | Ga0209999_1004223 | 3300027543 | Bacteria | 2585 |
| 566 | Ga0209983_1002700 | 3300027665 | Bacteria | 3851 |
| 567 | Ga0209282_1000009 | 3300027666 | Bacteria | 233366 |
| 568 | Ga0209282_1018395 | 3300027666 | Bacteria | 4432 |
| 569 | Ga0209588_1016338 | 3300027671 | Bacteria | 2290 |
| 570 | Ga0209813_10000948 | 3300027866 | Bacteria | 6518 |
| 571 | Ga0209974_10007762 | 3300027876 | Bacteria | 3689 |
| 572 | Ga0207428_10008430 | 3300027907 | Bacteria | 9306 |
| 573 | Ga0207428_10117153 | 3300027907 | Bacteria | 2045 |
| 574 | Ga0268266_10011009 | 3300028379 | Bacteria | 7873 |
| 575 | Ga0268266_10014303 | 3300028379 | Bacteria | 6825 |
| 576 | Ga0268266_10040888 | 3300028379 | Bacteria | 3953 |
| 577 | Ga0268264_10020011 | 3300028381 | Bacteria | 5467 |
| 578 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 579 | Ga0268256_1000557 | 3300030500 | Bacteria | 30228 |
| 580 | Ga0268256_1010906 | 3300030500 | Bacteria | 2915 |
| 581 | Ga0268256_1023065 | 3300030500 | Bacteria | 1622 |
| 582 | Ga0316177_1113840 | 3300030731 | Bacteria | 2189 |
| 583 | Ga0316178_1035927 | 3300030735 | Bacteria | 1596 |
| 584 | Ga0316178_1083481 | 3300030735 | Bacteria | 46215 |
| 585 | Ga0316181_1294605 | 3300030744 | Bacteria | 1774 |
| 586 | Ga0316182_1261839 | 3300030745 | Bacteria | 2227 |
| 587 | Ga0265332_10000026 | 3300031238 | Bacteria | 193153 |
| 588 | Ga0265328_10000005 | 3300031239 | Bacteria | 230229 |
| 589 | Ga0265325_10010023 | 3300031241 | Bacteria | 5506 |
| 590 | Ga0265316_10214386 | 3300031344 | Bacteria | 1423 |
| 591 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 592 | Ga0307408_100001156 | 3300031548 | Bacteria | 20063 |
| 593 | Ga0307408_100001884 | 3300031548 | Bacteria | 15272 |
| 594 | Ga0307408_100011848 | 3300031548 | Bacteria | 5768 |
| 595 | Ga0307408_100021702 | 3300031548 | Bacteria | 4349 |
| 596 | Ga0307408_100261484 | 3300031548 | Bacteria | 1432 |
| 597 | Ga0307408_100537858 | 3300031548 | Bacteria | 1029 |
| 598 | Ga0265314_10138880 | 3300031711 | Bacteria | 1505 |
| 599 | Ga0316576_10105075 | 3300031727 | Bacteria | 2114 |
| 600 | Ga0316576_10118312 | 3300031727 | Bacteria | 1989 |
| 601 | Ga0307516_10307486 | 3300031730 | Bacteria | 1259 |
| 602 | Ga0307405_10095274 | 3300031731 | Bacteria | 1981 |
| 603 | Ga0316577_10081869 | 3300031733 | Bacteria | 1805 |
| 604 | Ga0307413_10003639 | 3300031824 | Bacteria | 6541 |
| 605 | Ga0307413_10067409 | 3300031824 | Bacteria | 2237 |
| 606 | Ga0307406_10061018 | 3300031901 | Bacteria | 2433 |
| 607 | Ga0307412_10062698 | 3300031911 | Bacteria | 2504 |
| 608 | Ga0307412_10106730 | 3300031911 | Bacteria | 1991 |
| 609 | Ga0307416_100010124 | 3300032002 | Bacteria | 6213 |
| 610 | Ga0307416_100157677 | 3300032002 | Bacteria | 2092 |
| 611 | Ga0307416_100373505 | 3300032002 | Bacteria | 1453 |
| 612 | Ga0307414_10205232 | 3300032004 | Bacteria | 1606 |
| 613 | Ga0307411_10109863 | 3300032005 | Bacteria | 1970 |
| 614 | Ga0307411_10124650 | 3300032005 | Bacteria | 1871 |
| 615 | Ga0316583_10002143 | 3300032133 | Bacteria | 6798 |
| 616 | Ga0316593_10001594 | 3300032168 | Bacteria | 5060 |
| 617 | Ga0307507_10124839 | 3300033179 | Bacteria | 2042 |
| 618 | Ga0316596_1009375 | 3300033541 | Bacteria | 2348 |
| 619 | Ga0373923_0015386 | 3300035111 | Bacteria | 2887 |
| 620 | Ga0373936_0165467 | 3300035113 | Bacteria | 965 |
| 621 | Ga0373954_0177355 | 3300035118 | Bacteria | 1045 |
| 622 | Ga0373957_0144322 | 3300035120 | Bacteria | 975 |
| 623 | Ga0373955_0145301 | 3300035172 | Bacteria | 1393 |
| 624 | Ga0316574_0005596 | 3300035398 | Bacteria | 6713 |
| 625 | Ga0316574_0016538 | 3300035398 | Bacteria | 4301 |
| 626 | Ga0316574_0148045 | 3300035398 | Bacteria | 1513 |
| 627 | Ga0316574_0170392 | 3300035398 | Bacteria | 1402 |
| 628 | Ga0373931_0177872 | 3300035691 | Bacteria | 1258 |
| 629 | Ga0373935_0356469 | 3300035692 | Bacteria | 1044 |
| 630 | Ga0373947_0092428 | 3300035725 | Bacteria | 1889 |
| 631 | Ga0373937_0039003 | 3300036401 | Bacteria | 4328 |
| 632 | Ga0373937_0902321 | 3300036401 | Bacteria | 832 |
| 633 | Ga0316582_0013300 | 3300036647 | Bacteria | 4628 |
| 634 | Ga0316582_0014298 | 3300036647 | Bacteria | 4499 |
| 635 | Ga0316584_0013824 | 3300036712 | Bacteria | 5727 |
| 636 | Ga0316584_0016947 | 3300036712 | Bacteria | 5228 |
| 637 | Ga0316584_0058617 | 3300036712 | Bacteria | 2883 |
| 638 | Ga0316584_0181626 | 3300036712 | Bacteria | 1557 |
| 639 | Ga0316584_0201854 | 3300036712 | Bacteria | 1467 |
| 640 | Ga0395899_0000386 | 3300037312 | Bacteria | 52584 |
| 641 | Ga0395899_0011613 | 3300037312 | Bacteria | 6742 |
| 642 | Ga0395899_0015194 | 3300037312 | Bacteria | 5870 |
| 643 | Ga0395899_0037924 | 3300037312 | Bacteria | 3612 |
| 644 | Ga0395900_0000715 | 3300037418 | Bacteria | 44112 |
| 645 | Ga0395900_0001341 | 3300037418 | Bacteria | 29739 |
| 646 | Ga0395900_0042927 | 3300037418 | Bacteria | 4659 |
| 647 | Ga0395900_0048659 | 3300037418 | Bacteria | 4367 |
| 648 | Ga0395900_0055574 | 3300037418 | Bacteria | 4076 |
| 649 | Ga0395900_0087488 | 3300037418 | Bacteria | 3202 |
| 650 | Ga0395900_0113741 | 3300037418 | Bacteria | 2777 |
| 651 | Ga0395900_0172432 | 3300037418 | Bacteria | 2201 |
| 652 | Ga0395900_0357081 | 3300037418 | Bacteria | 1433 |
| 653 | Ga0395898_0007625 | 3300037466 | Bacteria | 11488 |
| 654 | Ga0395898_0065139 | 3300037466 | Bacteria | 3533 |
| 655 | Ga0395898_0777034 | 3300037466 | Bacteria | 898 |
| 656 | Ga0395905_0000242 | 3300037471 | Bacteria | 82835 |
| 657 | Ga0395905_0081547 | 3300037471 | Bacteria | 3031 |
| 658 | Ga0395905_0276633 | 3300037471 | Bacteria | 1565 |
| 659 | Ga0395905_0461668 | 3300037471 | Bacteria | 1168 |
| 660 | Ga0395905_0463854 | 3300037471 | Bacteria | 1165 |
| 661 | Ga0395905_0624659 | 3300037471 | Bacteria | 979 |
| 662 | Ga0395905_0775665 | 3300037471 | Bacteria | 861 |
| 663 | Ga0316581_0073666 | 3300037588 | Bacteria | 1049 |
| 664 | Ga0395901_0000943 | 3300038443 | Bacteria | 31649 |
| 665 | Ga0395901_0005142 | 3300038443 | Bacteria | 13210 |
| 666 | Ga0395901_0147921 | 3300038443 | Bacteria | 2468 |
| 667 | Ga0395901_0151300 | 3300038443 | Bacteria | 2438 |
| 668 | Ga0395901_0357010 | 3300038443 | Bacteria | 1508 |
| 669 | Ga0395901_0681271 | 3300038443 | Bacteria | 1028 |
| 670 | Ga0400486_14879 | 3300038742 | Bacteria | 17024 |
| 671 | Ga0400483_024557 | 3300039062 | Bacteria | 25024 |
| 672 | Ga0436361_0042090 | 3300039447 | Bacteria | 10550 |
| 673 | Ga0436361_0089100 | 3300039447 | Bacteria | 10026 |
| 674 | Ga0436361_0089479 | 3300039447 | Bacteria | 55221 |
| 675 | Ga0436361_0133183 | 3300039447 | Bacteria | 45710 |
| 676 | Ga0436361_0303014 | 3300039447 | Bacteria | 21994 |
| 677 | Ga0436361_0531483 | 3300039447 | Bacteria | 7649 |
| 678 | Ga0436361_0675827 | 3300039447 | Bacteria | 6954 |
| 679 | Ga0436361_0832413 | 3300039447 | Bacteria | 5350 |
| 680 | Ga0436361_1136783 | 3300039447 | Bacteria | 7625 |
| 681 | Ga0436361_1218785 | 3300039447 | Bacteria | 111760 |
| 682 | Ga0439436_0002075 | 3300041404 | Bacteria | 5978 |
| 683 | Ga0439438_000705 | 3300041405 | Bacteria | 14944 |
| 684 | Ga0439447_003922 | 3300041407 | Bacteria | 5212 |
| 685 | Ga0439447_020765 | 3300041407 | Bacteria | 1737 |
| 686 | Ga0439461_0030251 | 3300041410 | Bacteria | 1125 |
| 687 | Ga0439466_0004826 | 3300041411 | Bacteria | 5182 |
| 688 | Ga0439466_0008959 | 3300041411 | Bacteria | 3762 |
| 689 | Ga0451843_1691138 | 3300041509 | Bacteria | 2808 |
| 690 | Ga0439437_000145 | 3300042000 | Bacteria | 5852 |
| 691 | Ga0439442_032513 | 3300042002 | Bacteria | 1090 |
| 692 | Ga0439448_0000099 | 3300042005 | Bacteria | 15433 |
| 693 | Ga0439432_013934 | 3300042006 | Bacteria | 2725 |
| 694 | Ga0439449_0033446 | 3300042007 | Bacteria | 1915 |
| 695 | Ga0439450_002360 | 3300042008 | Bacteria | 2958 |
| 696 | Ga0439451_007568 | 3300042009 | Bacteria | 2210 |
| 697 | Ga0439451_013029 | 3300042009 | Bacteria | 1679 |
| 698 | Ga0439452_000639 | 3300042010 | Bacteria | 17643 |
| 699 | Ga0439456_000539 | 3300042013 | Bacteria | 7977 |
| 700 | Ga0439463_001585 | 3300042016 | Bacteria | 5999 |
| 701 | Ga0450911_000018 | 3300042115 | Bacteria | 104759 |
| 702 | Ga0450923_009679 | 3300042125 | Bacteria | 1692 |
| 703 | Ga0450904_001458 | 3300042139 | Bacteria | 3305 |
| 704 | Ga0450905_000366 | 3300042142 | Bacteria | 5418 |
| 705 | Ga0450905_003143 | 3300042142 | Bacteria | 2160 |
| 706 | Ga0439446_0000261 | 3300042156 | Bacteria | 9812 |
| 707 | Ga0439446_0003402 | 3300042156 | Bacteria | 3946 |
| 708 | Ga0439434_0002153 | 3300042435 | Bacteria | 5707 |
| 709 | Ga0439464_0004654 | 3300042439 | Bacteria | 3516 |
| 710 | Ga0439460_0004961 | 3300042461 | Bacteria | 3251 |
| 711 | Ga0450901_001568 | 3300042533 | Bacteria | 2588 |
| 712 | Ga0451577_0304333 | 3300042876 | Bacteria | 1444 |
| 713 | Ga0451577_0500264 | 3300042876 | Bacteria | 1103 |
| 714 | Ga0439440_0009344 | 3300042993 | Bacteria | 2030 |
| 715 | Ga0466969_0006033 | 3300044656 | Bacteria | 6446 |
| 716 | Ga0466969_0034753 | 3300044656 | Bacteria | 2553 |
| 717 | Ga0466969_0051856 | 3300044656 | Bacteria | 2017 |
| 718 | Ga0466972_0000359 | 3300044658 | Bacteria | 24761 |
| 719 | Ga0466972_0016650 | 3300044658 | Bacteria | 3675 |
| 720 | Ga0453683_0061956 | 3300044673 | Bacteria | 2339 |
| 721 | Ga0453683_0134717 | 3300044673 | Bacteria | 1557 |
| 722 | Ga0453683_0415733 | 3300044673 | Bacteria | 868 |
| 723 | Ga0466965_0024588 | 3300044683 | Bacteria | 2914 |
| 724 | Ga0466965_0026547 | 3300044683 | Bacteria | 2807 |
| 725 | Ga0466965_0041682 | 3300044683 | Bacteria | 2262 |
| 726 | Ga0466965_0164028 | 3300044683 | Bacteria | 1166 |
| 727 | Ga0466966_0005044 | 3300044684 | Bacteria | 8680 |
| 728 | Ga0466966_0025197 | 3300044684 | Bacteria | 3886 |
| 729 | Ga0466961_0000260 | 3300044693 | Bacteria | 35189 |
| 730 | Ga0466961_0006689 | 3300044693 | Bacteria | 7333 |
| 731 | Ga0466961_0107351 | 3300044693 | Bacteria | 1757 |
| 732 | Ga0466963_0022166 | 3300044694 | Bacteria | 4020 |
| 733 | Ga0466964_0000517 | 3300044706 | Bacteria | 12049 |
| 734 | Ga0466964_0003220 | 3300044706 | Bacteria | 5941 |
| 735 | Ga0466964_0004695 | 3300044706 | Bacteria | 5050 |
| 736 | Ga0466964_0023589 | 3300044706 | Bacteria | 2392 |
| 737 | Ga0453684_0000142 | 3300044712 | Bacteria | 316405 |
| 738 | Ga0453684_0000158 | 3300044712 | Bacteria | 302033 |
| 739 | Ga0453684_0025204 | 3300044712 | Bacteria | 8646 |
| 740 | Ga0453684_0029140 | 3300044712 | Bacteria | 7851 |
| 741 | Ga0453684_0030951 | 3300044712 | Bacteria | 7541 |
| 742 | Ga0453684_0151971 | 3300044712 | Bacteria | 2750 |
| 743 | Ga0453684_0217168 | 3300044712 | Bacteria | 2218 |
| 744 | Ga0466971_0087119 | 3300044719 | Bacteria | 1427 |
| 745 | Ga0466971_0206999 | 3300044719 | Bacteria | 927 |
| 746 | Ga0466968_0000899 | 3300044735 | Bacteria | 10470 |
| 747 | Ga0466968_0005369 | 3300044735 | Bacteria | 4797 |
| 748 | Ga0466968_0050008 | 3300044735 | Bacteria | 1782 |
| 749 | Ga0466970_0061050 | 3300044765 | Bacteria | 2019 |
| 750 | Ga0466957_0002970 | 3300044842 | Bacteria | 9204 |
| 751 | Ga0466957_0206142 | 3300044842 | Bacteria | 1293 |
| 752 | Ga0466957_0232654 | 3300044842 | Bacteria | 1220 |
| 753 | Ga0466959_0006393 | 3300045049 | Bacteria | 8158 |
| 754 | Ga0466959_0016513 | 3300045049 | Bacteria | 5395 |
| 755 | Ga0466959_0020955 | 3300045049 | Bacteria | 4819 |
| 756 | Ga0466959_0086836 | 3300045049 | Bacteria | 2250 |
| 757 | Ga0466959_0125723 | 3300045049 | Bacteria | 1820 |
| 758 | Ga0466959_0181562 | 3300045049 | Bacteria | 1471 |
| 759 | Ga0466959_0315335 | 3300045049 | Bacteria | 1069 |
| 760 | Ga0451576_0006384 | 3300045051 | Bacteria | 14478 |
| 761 | Ga0451576_0063755 | 3300045051 | Bacteria | 3840 |
| 762 | Ga0451576_0067833 | 3300045051 | Bacteria | 3713 |
| 763 | Ga0451576_0085745 | 3300045051 | Bacteria | 3276 |
| 764 | Ga0451576_0198517 | 3300045051 | Bacteria | 2095 |
| 765 | Ga0466958_0066239 | 3300045836 | Bacteria | 2205 |
| 766 | Ga0466967_0017377 | 3300045976 | Bacteria | 5709 |
| 767 | Ga0495617_000027 | 3300046452 | Bacteria | 157385 |
| 768 | Ga0495617_000466 | 3300046452 | Bacteria | 21733 |
| 769 | Ga0495617_001485 | 3300046452 | Bacteria | 10254 |
| 770 | Ga0495617_002660 | 3300046452 | Bacteria | 6954 |
| 771 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 772 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 773 | Ga0495627_000277 | 3300046453 | Bacteria | 51556 |
| 774 | Ga0495627_000694 | 3300046453 | Bacteria | 25749 |
| 775 | Ga0495627_002842 | 3300046453 | Bacteria | 8004 |
| 776 | Ga0495627_004813 | 3300046453 | Bacteria | 5575 |
| 777 | Ga0495627_007437 | 3300046453 | Bacteria | 4194 |
| 778 | Ga0495627_008570 | 3300046453 | Bacteria | 3820 |
| 779 | Ga0495627_020864 | 3300046453 | Bacteria | 2178 |
| 780 | Ga0495627_056033 | 3300046453 | Bacteria | 1176 |
| 781 | Ga0495592_0036756 | 3300046454 | Bacteria | 3687 |
| 782 | Ga0495603_0009876 | 3300046455 | Bacteria | 5777 |
| 783 | Ga0495603_0025025 | 3300046455 | Bacteria | 3610 |
| 784 | Ga0495603_0048475 | 3300046455 | Bacteria | 2529 |
| 785 | Ga0495603_0063173 | 3300046455 | Bacteria | 2185 |
| 786 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 787 | Ga0495590_0000544 | 3300046457 | Bacteria | 18083 |
| 788 | Ga0495590_0007474 | 3300046457 | Bacteria | 4213 |
| 789 | Ga0495590_0015377 | 3300046457 | Bacteria | 2779 |
| 790 | Ga0495590_0036439 | 3300046457 | Bacteria | 1716 |
| 791 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 792 | Ga0495591_000616 | 3300046458 | Bacteria | 26709 |
| 793 | Ga0495591_001313 | 3300046458 | Bacteria | 15663 |
| 794 | Ga0495591_005620 | 3300046458 | Bacteria | 5751 |
| 795 | Ga0495591_011566 | 3300046458 | Bacteria | 3332 |
| 796 | Ga0495591_027194 | 3300046458 | Bacteria | 1767 |
| 797 | Ga0495629_0014675 | 3300046459 | Bacteria | 5634 |
| 798 | Ga0495629_0036710 | 3300046459 | Bacteria | 3457 |
| 799 | Ga0495629_0129424 | 3300046459 | Bacteria | 1758 |
| 800 | Ga0495638_0003336 | 3300046460 | Bacteria | 12664 |
| 801 | Ga0495638_0004087 | 3300046460 | Bacteria | 11176 |
| 802 | Ga0495638_0007859 | 3300046460 | Bacteria | 7609 |
| 803 | Ga0495638_0010020 | 3300046460 | Bacteria | 6607 |
| 804 | Ga0495638_0012287 | 3300046460 | Bacteria | 5873 |
| 805 | Ga0495638_0063316 | 3300046460 | Bacteria | 2280 |
| 806 | Ga0495638_0241892 | 3300046460 | Bacteria | 999 |
| 807 | Ga0495638_0318791 | 3300046460 | Bacteria | 831 |
| 808 | Ga0495651_0003918 | 3300046462 | Bacteria | 11381 |
| 809 | Ga0495651_0287656 | 3300046462 | Bacteria | 1107 |
| 810 | Ga0495653_0000313 | 3300046463 | Bacteria | 39510 |
| 811 | Ga0495653_0004554 | 3300046463 | Bacteria | 11203 |
| 812 | Ga0495653_0008977 | 3300046463 | Bacteria | 8175 |
| 813 | Ga0495653_0014418 | 3300046463 | Bacteria | 6448 |
| 814 | Ga0495653_0040360 | 3300046463 | Bacteria | 3647 |
| 815 | Ga0495653_0042162 | 3300046463 | Bacteria | 3557 |
| 816 | Ga0495650_0000251 | 3300046471 | Bacteria | 105577 |
| 817 | Ga0495650_0000431 | 3300046471 | Bacteria | 67716 |
| 818 | Ga0495650_0000582 | 3300046471 | Bacteria | 51082 |
| 819 | Ga0495650_0002001 | 3300046471 | Bacteria | 17881 |
| 820 | Ga0495650_0002200 | 3300046471 | Bacteria | 16466 |
| 821 | Ga0495650_0002310 | 3300046471 | Bacteria | 15812 |
| 822 | Ga0495650_0002792 | 3300046471 | Bacteria | 13424 |
| 823 | Ga0495650_0003052 | 3300046471 | Bacteria | 12610 |
| 824 | Ga0495650_0004232 | 3300046471 | Bacteria | 9936 |
| 825 | Ga0495650_0018979 | 3300046471 | Bacteria | 3401 |
| 826 | Ga0495650_0019731 | 3300046471 | Bacteria | 3307 |
| 827 | Ga0495580_0014963 | 3300046472 | Bacteria | 5873 |
| 828 | Ga0495580_0075326 | 3300046472 | Bacteria | 2354 |
| 829 | Ga0495582_0005379 | 3300046473 | Bacteria | 7145 |
| 830 | Ga0495582_0072833 | 3300046473 | Bacteria | 1901 |
| 831 | Ga0495582_0083844 | 3300046473 | Bacteria | 1771 |
| 832 | Ga0495605_0000061 | 3300046474 | Bacteria | 145286 |
| 833 | Ga0495605_0000095 | 3300046474 | Bacteria | 112622 |
| 834 | Ga0495605_0000135 | 3300046474 | Bacteria | 95104 |
| 835 | Ga0495605_0000210 | 3300046474 | Bacteria | 71875 |
| 836 | Ga0495605_0000287 | 3300046474 | Bacteria | 55659 |
| 837 | Ga0495605_0000815 | 3300046474 | Bacteria | 22270 |
| 838 | Ga0495605_0001165 | 3300046474 | Bacteria | 17447 |
| 839 | Ga0495605_0003898 | 3300046474 | Bacteria | 8840 |
| 840 | Ga0495605_0004070 | 3300046474 | Bacteria | 8634 |
| 841 | Ga0495605_0004819 | 3300046474 | Bacteria | 7892 |
| 842 | Ga0495605_0006784 | 3300046474 | Bacteria | 6543 |
| 843 | Ga0495605_0012293 | 3300046474 | Bacteria | 4752 |
| 844 | Ga0495605_0017922 | 3300046474 | Bacteria | 3803 |
| 845 | Ga0495605_0018104 | 3300046474 | Bacteria | 3782 |
| 846 | Ga0495605_0018632 | 3300046474 | Bacteria | 3717 |
| 847 | Ga0495605_0028357 | 3300046474 | Bacteria | 2890 |
| 848 | Ga0495605_0043047 | 3300046474 | Bacteria | 2241 |
| 849 | Ga0495605_0059235 | 3300046474 | Bacteria | 1839 |
| 850 | Ga0495605_0200745 | 3300046474 | Bacteria | 869 |
| 851 | Ga0495639_0034531 | 3300046475 | Bacteria | 2263 |
| 852 | Ga0495639_0125911 | 3300046475 | Bacteria | 1224 |
| 853 | Ga0495662_0153763 | 3300046476 | Bacteria | 1133 |
| 854 | Ga0495664_0060436 | 3300046477 | Bacteria | 2256 |
| 855 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 856 | Ga0495584_0001526 | 3300046491 | Bacteria | 13771 |
| 857 | Ga0495584_0002496 | 3300046491 | Bacteria | 10423 |
| 858 | Ga0495584_0003202 | 3300046491 | Bacteria | 9107 |
| 859 | Ga0495584_0005016 | 3300046491 | Bacteria | 7048 |
| 860 | Ga0495584_0008160 | 3300046491 | Bacteria | 5439 |
| 861 | Ga0495584_0012854 | 3300046491 | Bacteria | 4272 |
| 862 | Ga0495584_0014909 | 3300046491 | Bacteria | 3959 |
| 863 | Ga0495584_0029283 | 3300046491 | Bacteria | 2790 |
| 864 | Ga0495584_0041697 | 3300046491 | Bacteria | 2316 |
| 865 | Ga0495584_0046583 | 3300046491 | Bacteria | 2187 |
| 866 | Ga0495584_0159452 | 3300046491 | Bacteria | 1146 |
| 867 | Ga0495585_0000238 | 3300046492 | Bacteria | 57003 |
| 868 | Ga0495585_0000277 | 3300046492 | Bacteria | 51354 |
| 869 | Ga0495585_0002047 | 3300046492 | Bacteria | 14867 |
| 870 | Ga0495585_0005810 | 3300046492 | Bacteria | 7737 |
| 871 | Ga0495585_0006567 | 3300046492 | Bacteria | 7191 |
| 872 | Ga0495585_0007203 | 3300046492 | Bacteria | 6834 |
| 873 | Ga0495585_0007306 | 3300046492 | Bacteria | 6779 |
| 874 | Ga0495585_0007413 | 3300046492 | Bacteria | 6718 |
| 875 | Ga0495585_0010334 | 3300046492 | Bacteria | 5563 |
| 876 | Ga0495585_0013630 | 3300046492 | Bacteria | 4753 |
| 877 | Ga0495585_0019262 | 3300046492 | Bacteria | 3936 |
| 878 | Ga0495585_0026231 | 3300046492 | Bacteria | 3328 |
| 879 | Ga0495585_0027300 | 3300046492 | Bacteria | 3258 |
| 880 | Ga0495585_0027620 | 3300046492 | Bacteria | 3238 |
| 881 | Ga0495585_0041082 | 3300046492 | Bacteria | 2594 |
| 882 | Ga0495585_0051733 | 3300046492 | Bacteria | 2275 |
| 883 | Ga0495585_0096763 | 3300046492 | Bacteria | 1583 |
| 884 | Ga0495594_0002420 | 3300046499 | Bacteria | 9721 |
| 885 | Ga0495594_0004751 | 3300046499 | Bacteria | 7000 |
| 886 | Ga0495594_0007475 | 3300046499 | Bacteria | 5623 |
| 887 | Ga0495594_0008695 | 3300046499 | Bacteria | 5235 |
| 888 | Ga0495594_0017449 | 3300046499 | Bacteria | 3793 |
| 889 | Ga0495594_0019462 | 3300046499 | Bacteria | 3607 |
| 890 | Ga0495594_0019945 | 3300046499 | Bacteria | 3567 |
| 891 | Ga0495594_0027947 | 3300046499 | Bacteria | 3042 |
| 892 | Ga0495594_0074625 | 3300046499 | Bacteria | 1889 |
| 893 | Ga0495594_0195976 | 3300046499 | Bacteria | 1151 |
| 894 | Ga0495594_0234190 | 3300046499 | Bacteria | 1046 |
| 895 | Ga0495596_0002220 | 3300046500 | Bacteria | 10583 |
| 896 | Ga0495596_0002744 | 3300046500 | Bacteria | 9244 |
| 897 | Ga0495596_0003179 | 3300046500 | Bacteria | 8463 |
| 898 | Ga0495596_0006538 | 3300046500 | Bacteria | 5353 |
| 899 | Ga0495596_0006811 | 3300046500 | Bacteria | 5215 |
| 900 | Ga0495596_0009327 | 3300046500 | Bacteria | 4318 |
| 901 | Ga0495596_0009431 | 3300046500 | Bacteria | 4291 |
| 902 | Ga0495596_0019527 | 3300046500 | Bacteria | 2782 |
| 903 | Ga0495596_0031673 | 3300046500 | Bacteria | 2110 |
| 904 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 905 | Ga0495607_0000983 | 3300046501 | Bacteria | 26447 |
| 906 | Ga0495607_0001148 | 3300046501 | Bacteria | 23968 |
| 907 | Ga0495607_0002749 | 3300046501 | Bacteria | 14027 |
| 908 | Ga0495607_0003003 | 3300046501 | Bacteria | 13172 |
| 909 | Ga0495607_0003245 | 3300046501 | Bacteria | 12535 |
| 910 | Ga0495607_0003593 | 3300046501 | Bacteria | 11788 |
| 911 | Ga0495607_0005409 | 3300046501 | Bacteria | 9144 |
| 912 | Ga0495607_0006203 | 3300046501 | Bacteria | 8437 |
| 913 | Ga0495607_0008558 | 3300046501 | Bacteria | 6988 |
| 914 | Ga0495607_0010786 | 3300046501 | Bacteria | 6118 |
| 915 | Ga0495607_0013867 | 3300046501 | Bacteria | 5266 |
| 916 | Ga0495607_0016351 | 3300046501 | Bacteria | 4787 |
| 917 | Ga0495607_0024541 | 3300046501 | Bacteria | 3757 |
| 918 | Ga0495607_0033727 | 3300046501 | Bacteria | 3113 |
| 919 | Ga0495607_0042439 | 3300046501 | Bacteria | 2695 |
| 920 | Ga0495607_0050478 | 3300046501 | Bacteria | 2421 |
| 921 | Ga0495607_0055848 | 3300046501 | Bacteria | 2269 |
| 922 | Ga0495607_0077811 | 3300046501 | Bacteria | 1831 |
| 923 | Ga0495607_0094518 | 3300046501 | Bacteria | 1612 |
| 924 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 925 | Ga0495583_0000158 | 3300046506 | Bacteria | 113645 |
| 926 | Ga0495583_0000214 | 3300046506 | Bacteria | 97639 |
| 927 | Ga0495583_0000779 | 3300046506 | Bacteria | 39867 |
| 928 | Ga0495583_0000947 | 3300046506 | Bacteria | 33746 |
| 929 | Ga0495583_0001239 | 3300046506 | Bacteria | 27114 |
| 930 | Ga0495583_0005046 | 3300046506 | Bacteria | 9122 |
| 931 | Ga0495583_0005144 | 3300046506 | Bacteria | 9012 |
| 932 | Ga0495583_0005773 | 3300046506 | Bacteria | 8276 |
| 933 | Ga0495583_0006211 | 3300046506 | Bacteria | 7863 |
| 934 | Ga0495583_0007334 | 3300046506 | Bacteria | 6957 |
| 935 | Ga0495583_0008544 | 3300046506 | Bacteria | 6243 |
| 936 | Ga0495583_0014775 | 3300046506 | Bacteria | 4282 |
| 937 | Ga0495583_0019297 | 3300046506 | Bacteria | 3562 |
| 938 | Ga0495583_0020702 | 3300046506 | Bacteria | 3400 |
| 939 | Ga0495583_0024718 | 3300046506 | Bacteria | 3013 |
| 940 | Ga0495583_0025072 | 3300046506 | Bacteria | 2985 |
| 941 | Ga0495583_0067726 | 3300046506 | Bacteria | 1576 |
| 942 | Ga0495583_0159784 | 3300046506 | Bacteria | 930 |
| 943 | Ga0495606_0000090 | 3300046507 | Bacteria | 154737 |
| 944 | Ga0495606_0000120 | 3300046507 | Bacteria | 133907 |
| 945 | Ga0495606_0000447 | 3300046507 | Bacteria | 67335 |
| 946 | Ga0495606_0001053 | 3300046507 | Bacteria | 39877 |
| 947 | Ga0495606_0001278 | 3300046507 | Bacteria | 34873 |
| 948 | Ga0495606_0003666 | 3300046507 | Bacteria | 16088 |
| 949 | Ga0495606_0004932 | 3300046507 | Bacteria | 13057 |
| 950 | Ga0495606_0006821 | 3300046507 | Bacteria | 10426 |
| 951 | Ga0495606_0006937 | 3300046507 | Bacteria | 10301 |
| 952 | Ga0495606_0007094 | 3300046507 | Bacteria | 10133 |
| 953 | Ga0495606_0008015 | 3300046507 | Bacteria | 9282 |
| 954 | Ga0495606_0009951 | 3300046507 | Bacteria | 7954 |
| 955 | Ga0495606_0015316 | 3300046507 | Bacteria | 5915 |
| 956 | Ga0495606_0016358 | 3300046507 | Bacteria | 5662 |
| 957 | Ga0495606_0016681 | 3300046507 | Bacteria | 5586 |
| 958 | Ga0495606_0017490 | 3300046507 | Bacteria | 5417 |
| 959 | Ga0495606_0038321 | 3300046507 | Bacteria | 3244 |
| 960 | Ga0495606_0173371 | 3300046507 | Bacteria | 1249 |
| 961 | Ga0495606_0182316 | 3300046507 | Bacteria | 1209 |
| 962 | Ga0495608_0004039 | 3300046511 | Bacteria | 10532 |
| 963 | Ga0495608_0016194 | 3300046511 | Bacteria | 5158 |
| 964 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 965 | Ga0495610_0015524 | 3300046512 | Bacteria | 4420 |
| 966 | Ga0495610_0025321 | 3300046512 | Bacteria | 3185 |
| 967 | Ga0495616_0001092 | 3300046513 | Bacteria | 19273 |
| 968 | Ga0495616_0001261 | 3300046513 | Bacteria | 17787 |
| 969 | Ga0495616_0001563 | 3300046513 | Bacteria | 15771 |
| 970 | Ga0495616_0005938 | 3300046513 | Bacteria | 7445 |
| 971 | Ga0495616_0009383 | 3300046513 | Bacteria | 5731 |
| 972 | Ga0495616_0010379 | 3300046513 | Bacteria | 5394 |
| 973 | Ga0495616_0015513 | 3300046513 | Bacteria | 4236 |
| 974 | Ga0495616_0018791 | 3300046513 | Bacteria | 3785 |
| 975 | Ga0495616_0019317 | 3300046513 | Bacteria | 3719 |
| 976 | Ga0495616_0043053 | 3300046513 | Bacteria | 2295 |
| 977 | Ga0495616_0050041 | 3300046513 | Bacteria | 2091 |
| 978 | Ga0495616_0184103 | 3300046513 | Bacteria | 926 |
| 979 | Ga0495620_0000042 | 3300046515 | Bacteria | 112107 |
| 980 | Ga0495620_0000146 | 3300046515 | Bacteria | 57888 |
| 981 | Ga0495620_0002809 | 3300046515 | Bacteria | 10009 |
| 982 | Ga0495620_0018263 | 3300046515 | Bacteria | 3475 |
| 983 | Ga0495620_0024957 | 3300046515 | Bacteria | 2836 |
| 984 | Ga0495620_0027170 | 3300046515 | Bacteria | 2681 |
| 985 | Ga0495628_0002401 | 3300046516 | Bacteria | 16892 |
| 986 | Ga0495628_0004370 | 3300046516 | Bacteria | 12536 |
| 987 | Ga0495628_0008265 | 3300046516 | Bacteria | 8944 |
| 988 | Ga0495630_0040193 | 3300046517 | Bacteria | 3495 |
| 989 | Ga0495631_0005014 | 3300046518 | Bacteria | 6973 |
| 990 | Ga0495631_0006359 | 3300046518 | Bacteria | 6110 |
| 991 | Ga0495631_0008278 | 3300046518 | Bacteria | 5242 |
| 992 | Ga0495631_0012371 | 3300046518 | Bacteria | 4169 |
| 993 | Ga0495631_0019676 | 3300046518 | Bacteria | 3165 |
| 994 | Ga0495631_0022032 | 3300046518 | Bacteria | 2963 |
| 995 | Ga0495631_0022053 | 3300046518 | Bacteria | 2961 |
| 996 | Ga0495631_0037637 | 3300046518 | Bacteria | 2154 |
| 997 | Ga0495631_0170180 | 3300046518 | Bacteria | 934 |
| 998 | Ga0495632_0001074 | 3300046519 | Bacteria | 23458 |
| 999 | Ga0495632_0001637 | 3300046519 | Bacteria | 18338 |
| 1000 | Ga0495632_0001728 | 3300046519 | Bacteria | 17741 |
| 1001 | Ga0495632_0002651 | 3300046519 | Bacteria | 13436 |
| 1002 | Ga0495632_0003276 | 3300046519 | Bacteria | 11566 |
| 1003 | Ga0495632_0007442 | 3300046519 | Bacteria | 6876 |
| 1004 | Ga0495632_0028128 | 3300046519 | Bacteria | 2936 |
| 1005 | Ga0495632_0139103 | 3300046519 | Bacteria | 1127 |
| 1006 | Ga0495637_0000515 | 3300046520 | Bacteria | 28094 |
| 1007 | Ga0495637_0001117 | 3300046520 | Bacteria | 16430 |
| 1008 | Ga0495637_0001430 | 3300046520 | Bacteria | 14075 |
| 1009 | Ga0495637_0002408 | 3300046520 | Bacteria | 10351 |
| 1010 | Ga0495637_0005705 | 3300046520 | Bacteria | 6313 |
| 1011 | Ga0495643_0000175 | 3300046522 | Bacteria | 102200 |
| 1012 | Ga0495643_0000455 | 3300046522 | Bacteria | 52002 |
| 1013 | Ga0495643_0000675 | 3300046522 | Bacteria | 40184 |
| 1014 | Ga0495643_0000908 | 3300046522 | Bacteria | 31233 |
| 1015 | Ga0495643_0000930 | 3300046522 | Bacteria | 30503 |
| 1016 | Ga0495643_0001824 | 3300046522 | Bacteria | 18120 |
| 1017 | Ga0495643_0002067 | 3300046522 | Bacteria | 16628 |
| 1018 | Ga0495643_0002344 | 3300046522 | Bacteria | 15206 |
| 1019 | Ga0495643_0009119 | 3300046522 | Bacteria | 6208 |
| 1020 | Ga0495643_0012110 | 3300046522 | Bacteria | 5215 |
| 1021 | Ga0495643_0015824 | 3300046522 | Bacteria | 4445 |
| 1022 | Ga0495643_0022084 | 3300046522 | Bacteria | 3637 |
| 1023 | Ga0495643_0033177 | 3300046522 | Bacteria | 2859 |
| 1024 | Ga0495643_0121836 | 3300046522 | Bacteria | 1317 |
| 1025 | Ga0495644_0002948 | 3300046523 | Bacteria | 6762 |
| 1026 | Ga0495644_0003375 | 3300046523 | Bacteria | 6310 |
| 1027 | Ga0495644_0005497 | 3300046523 | Bacteria | 4945 |
| 1028 | Ga0495644_0006022 | 3300046523 | Bacteria | 4723 |
| 1029 | Ga0495644_0013726 | 3300046523 | Bacteria | 3105 |
| 1030 | Ga0495644_0015700 | 3300046523 | Bacteria | 2903 |
| 1031 | Ga0495644_0017503 | 3300046523 | Bacteria | 2739 |
| 1032 | Ga0495644_0032409 | 3300046523 | Bacteria | 1974 |
| 1033 | Ga0495644_0036566 | 3300046523 | Bacteria | 1852 |
| 1034 | Ga0495644_0042546 | 3300046523 | Bacteria | 1710 |
| 1035 | Ga0495644_0055027 | 3300046523 | Bacteria | 1494 |
| 1036 | Ga0495648_0000168 | 3300046524 | Bacteria | 75736 |
| 1037 | Ga0495648_0000183 | 3300046524 | Bacteria | 72118 |
| 1038 | Ga0495648_0002908 | 3300046524 | Bacteria | 15401 |
| 1039 | Ga0495648_0002984 | 3300046524 | Bacteria | 15180 |
| 1040 | Ga0495648_0004633 | 3300046524 | Bacteria | 11682 |
| 1041 | Ga0495648_0004932 | 3300046524 | Bacteria | 11218 |
| 1042 | Ga0495648_0007325 | 3300046524 | Bacteria | 8844 |
| 1043 | Ga0495648_0011240 | 3300046524 | Bacteria | 6759 |
| 1044 | Ga0495648_0017788 | 3300046524 | Bacteria | 5067 |
| 1045 | Ga0495648_0020900 | 3300046524 | Bacteria | 4552 |
| 1046 | Ga0495648_0024858 | 3300046524 | Bacteria | 4067 |
| 1047 | Ga0495648_0034007 | 3300046524 | Bacteria | 3323 |
| 1048 | Ga0495648_0034012 | 3300046524 | Bacteria | 3323 |
| 1049 | Ga0495648_0041657 | 3300046524 | Bacteria | 2897 |
| 1050 | Ga0495648_0085646 | 3300046524 | Bacteria | 1779 |
| 1051 | Ga0495648_0104119 | 3300046524 | Bacteria | 1559 |
| 1052 | Ga0495663_0001620 | 3300046525 | Bacteria | 7036 |
| 1053 | Ga0495663_0004246 | 3300046525 | Bacteria | 4043 |
| 1054 | Ga0495663_0061576 | 3300046525 | Bacteria | 1181 |
| 1055 | Ga0495663_0096622 | 3300046525 | Bacteria | 968 |
| 1056 | Ga0495666_0015846 | 3300046526 | Bacteria | 3754 |
| 1057 | Ga0495666_0016390 | 3300046526 | Bacteria | 3690 |
| 1058 | Ga0495642_0000587 | 3300046528 | Bacteria | 18236 |
| 1059 | Ga0495642_0000876 | 3300046528 | Bacteria | 14202 |
| 1060 | Ga0495642_0001506 | 3300046528 | Bacteria | 10368 |
| 1061 | Ga0495642_0002007 | 3300046528 | Bacteria | 8487 |
| 1062 | Ga0495642_0003631 | 3300046528 | Bacteria | 6056 |
| 1063 | Ga0495642_0013311 | 3300046528 | Bacteria | 3180 |
| 1064 | Ga0495642_0016497 | 3300046528 | Bacteria | 2879 |
| 1065 | Ga0495642_0026994 | 3300046528 | Bacteria | 2283 |
| 1066 | Ga0495642_0028689 | 3300046528 | Bacteria | 2218 |
| 1067 | Ga0495642_0051203 | 3300046528 | Bacteria | 1698 |
| 1068 | Ga0495652_0007905 | 3300046529 | Bacteria | 9763 |
| 1069 | Ga0495652_0008714 | 3300046529 | Bacteria | 9243 |
| 1070 | Ga0495652_0032735 | 3300046529 | Bacteria | 4544 |
| 1071 | Ga0495652_0035636 | 3300046529 | Bacteria | 4330 |
| 1072 | Ga0495652_0041809 | 3300046529 | Bacteria | 3954 |
| 1073 | Ga0495652_0081403 | 3300046529 | Bacteria | 2670 |
| 1074 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 1075 | Ga0495654_0000906 | 3300046530 | Bacteria | 22097 |
| 1076 | Ga0495654_0010226 | 3300046530 | Bacteria | 5111 |
| 1077 | Ga0495654_0013265 | 3300046530 | Bacteria | 4413 |
| 1078 | Ga0495654_0018980 | 3300046530 | Bacteria | 3598 |
| 1079 | Ga0495654_0030579 | 3300046530 | Bacteria | 2738 |
| 1080 | Ga0495654_0154595 | 3300046530 | Bacteria | 1012 |
| 1081 | Ga0495665_0009613 | 3300046531 | Bacteria | 5239 |
| 1082 | Ga0495665_0014977 | 3300046531 | Bacteria | 4177 |
| 1083 | Ga0495665_0021786 | 3300046531 | Bacteria | 3446 |
| 1084 | Ga0495665_0032396 | 3300046531 | Bacteria | 2795 |
| 1085 | Ga0495640_0013804 | 3300046533 | Bacteria | 6136 |
| 1086 | Ga0495586_0001555 | 3300046535 | Bacteria | 12666 |
| 1087 | Ga0495586_0017975 | 3300046535 | Bacteria | 3760 |
| 1088 | Ga0495586_0021446 | 3300046535 | Bacteria | 3444 |
| 1089 | Ga0495586_0079390 | 3300046535 | Bacteria | 1801 |
| 1090 | Ga0495587_0073539 | 3300046536 | Bacteria | 1985 |
| 1091 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 1092 | Ga0495609_0000053 | 3300046538 | Bacteria | 149126 |
| 1093 | Ga0495609_0000102 | 3300046538 | Bacteria | 100762 |
| 1094 | Ga0495609_0000133 | 3300046538 | Bacteria | 79787 |
| 1095 | Ga0495609_0001519 | 3300046538 | Bacteria | 15282 |
| 1096 | Ga0495609_0002547 | 3300046538 | Bacteria | 11152 |
| 1097 | Ga0495609_0002784 | 3300046538 | Bacteria | 10519 |
| 1098 | Ga0495609_0003217 | 3300046538 | Bacteria | 9474 |
| 1099 | Ga0495609_0007980 | 3300046538 | Bacteria | 5228 |
| 1100 | Ga0495609_0010452 | 3300046538 | Bacteria | 4448 |
| 1101 | Ga0495609_0012437 | 3300046538 | Bacteria | 4037 |
| 1102 | Ga0495609_0027527 | 3300046538 | Bacteria | 2597 |
| 1103 | Ga0495609_0032381 | 3300046538 | Bacteria | 2374 |
| 1104 | Ga0495609_0059039 | 3300046538 | Bacteria | 1696 |
| 1105 | Ga0495609_0070427 | 3300046538 | Bacteria | 1537 |
| 1106 | Ga0495609_0075686 | 3300046538 | Bacteria | 1475 |
| 1107 | Ga0495597_0000068 | 3300046542 | Bacteria | 90143 |
| 1108 | Ga0495597_0000907 | 3300046542 | Bacteria | 22980 |
| 1109 | Ga0495597_0002989 | 3300046542 | Bacteria | 10218 |
| 1110 | Ga0495597_0003023 | 3300046542 | Bacteria | 10143 |
| 1111 | Ga0495597_0003385 | 3300046542 | Bacteria | 9346 |
| 1112 | Ga0495597_0005581 | 3300046542 | Bacteria | 6640 |
| 1113 | Ga0495597_0005707 | 3300046542 | Bacteria | 6544 |
| 1114 | Ga0495597_0006706 | 3300046542 | Bacteria | 5927 |
| 1115 | Ga0495597_0008370 | 3300046542 | Bacteria | 5185 |
| 1116 | Ga0495597_0009251 | 3300046542 | Bacteria | 4879 |
| 1117 | Ga0495597_0010738 | 3300046542 | Bacteria | 4463 |
| 1118 | Ga0495597_0042028 | 3300046542 | Bacteria | 2039 |
| 1119 | Ga0495597_0043540 | 3300046542 | Bacteria | 1999 |
| 1120 | Ga0495597_0050403 | 3300046542 | Bacteria | 1838 |
| 1121 | Ga0495645_0074549 | 3300046543 | Bacteria | 2443 |
| 1122 | Ga0495645_0111173 | 3300046543 | Bacteria | 1938 |
| 1123 | Ga0495622_0002486 | 3300046557 | Bacteria | 8917 |
| 1124 | Ga0495622_0002494 | 3300046557 | Bacteria | 8898 |
| 1125 | Ga0495622_0017175 | 3300046557 | Bacteria | 3369 |
| 1126 | Ga0495622_0109043 | 3300046557 | Bacteria | 1267 |
| 1127 | Ga0495622_0159298 | 3300046557 | Bacteria | 1018 |
| 1128 | Ga0495633_0000115 | 3300046558 | Bacteria | 108676 |
| 1129 | Ga0495633_0002814 | 3300046558 | Bacteria | 12035 |
| 1130 | Ga0495633_0002851 | 3300046558 | Bacteria | 11880 |
| 1131 | Ga0495633_0004074 | 3300046558 | Bacteria | 9437 |
| 1132 | Ga0495633_0006023 | 3300046558 | Bacteria | 7278 |
| 1133 | Ga0495633_0006720 | 3300046558 | Bacteria | 6769 |
| 1134 | Ga0495633_0007463 | 3300046558 | Bacteria | 6289 |
| 1135 | Ga0495633_0008007 | 3300046558 | Bacteria | 6019 |
| 1136 | Ga0495633_0008646 | 3300046558 | Bacteria | 5716 |
| 1137 | Ga0495633_0014098 | 3300046558 | Bacteria | 4190 |
| 1138 | Ga0495633_0026789 | 3300046558 | Bacteria | 2824 |
| 1139 | Ga0495633_0046632 | 3300046558 | Bacteria | 2049 |
| 1140 | Ga0495633_0062757 | 3300046558 | Bacteria | 1739 |
| 1141 | Ga0495633_0077343 | 3300046558 | Bacteria | 1549 |
| 1142 | Ga0495667_0056292 | 3300046559 | Bacteria | 2586 |
| 1143 | Ga0495656_0001760 | 3300046615 | Bacteria | 7105 |
| 1144 | Ga0495656_0017319 | 3300046615 | Bacteria | 2748 |
| 1145 | Ga0495656_0021883 | 3300046615 | Bacteria | 2495 |
| 1146 | Ga0495656_0047268 | 3300046615 | Bacteria | 1824 |
| 1147 | Ga0495656_0307701 | 3300046615 | Bacteria | 813 |
| 1148 | Ga0495668_0000343 | 3300046616 | Bacteria | 61962 |
| 1149 | Ga0495668_0001087 | 3300046616 | Bacteria | 28336 |
| 1150 | Ga0495668_0001732 | 3300046616 | Bacteria | 20089 |
| 1151 | Ga0495668_0003183 | 3300046616 | Bacteria | 12580 |
| 1152 | Ga0495668_0003908 | 3300046616 | Bacteria | 10886 |
| 1153 | Ga0495668_0004561 | 3300046616 | Bacteria | 9753 |
| 1154 | Ga0495668_0005358 | 3300046616 | Bacteria | 8748 |
| 1155 | Ga0495668_0005407 | 3300046616 | Bacteria | 8679 |
| 1156 | Ga0495668_0009136 | 3300046616 | Bacteria | 6108 |
| 1157 | Ga0495668_0017136 | 3300046616 | Bacteria | 4207 |
| 1158 | Ga0495668_0032297 | 3300046616 | Bacteria | 2946 |
| 1159 | Ga0495668_0037723 | 3300046616 | Bacteria | 2703 |
| 1160 | Ga0495668_0049740 | 3300046616 | Bacteria | 2324 |
| 1161 | Ga0495668_0054847 | 3300046616 | Bacteria | 2201 |
| 1162 | Ga0495668_0086461 | 3300046616 | Bacteria | 1719 |
| 1163 | Ga0495668_0100225 | 3300046616 | Bacteria | 1584 |
| 1164 | Ga0495634_0009917 | 3300046642 | Bacteria | 7000 |
| 1165 | Ga0495611_0001456 | 3300046648 | Bacteria | 11774 |
| 1166 | Ga0495611_0001664 | 3300046648 | Bacteria | 10772 |
| 1167 | Ga0495611_0013168 | 3300046648 | Bacteria | 3518 |
| 1168 | Ga0495611_0016564 | 3300046648 | Bacteria | 3151 |
| 1169 | Ga0495611_0022060 | 3300046648 | Bacteria | 2753 |
| 1170 | Ga0495611_0045159 | 3300046648 | Bacteria | 1972 |
| 1171 | Ga0495625_0000086 | 3300046660 | Bacteria | 151735 |
| 1172 | Ga0495625_0003347 | 3300046660 | Bacteria | 16136 |
| 1173 | Ga0495625_0006637 | 3300046660 | Bacteria | 10271 |
| 1174 | Ga0495625_0007014 | 3300046660 | Bacteria | 9921 |
| 1175 | Ga0495625_0007415 | 3300046660 | Bacteria | 9551 |
| 1176 | Ga0495625_0007684 | 3300046660 | Bacteria | 9335 |
| 1177 | Ga0495625_0013314 | 3300046660 | Bacteria | 6614 |
| 1178 | Ga0495625_0015335 | 3300046660 | Bacteria | 6072 |
| 1179 | Ga0495625_0035107 | 3300046660 | Bacteria | 3697 |
| 1180 | Ga0495625_0047992 | 3300046660 | Bacteria | 3076 |
| 1181 | Ga0495625_0092102 | 3300046660 | Bacteria | 2095 |
| 1182 | Ga0495625_0388953 | 3300046660 | Bacteria | 873 |
| 1183 | Ga0495635_0031660 | 3300046663 | Bacteria | 3670 |
| 1184 | Ga0495635_0053923 | 3300046663 | Bacteria | 2769 |
| 1185 | Ga0495659_0001316 | 3300046664 | Bacteria | 8531 |
| 1186 | Ga0495659_0004057 | 3300046664 | Bacteria | 4632 |
| 1187 | Ga0495659_0011058 | 3300046664 | Bacteria | 2906 |
| 1188 | Ga0495659_0012089 | 3300046664 | Bacteria | 2790 |
| 1189 | Ga0495659_0049601 | 3300046664 | Bacteria | 1525 |
| 1190 | Ga0495659_0137873 | 3300046664 | Bacteria | 972 |
| 1191 | Ga0495661_0000058 | 3300046665 | Bacteria | 133316 |
| 1192 | Ga0495661_0000212 | 3300046665 | Bacteria | 67078 |
| 1193 | Ga0495661_0000346 | 3300046665 | Bacteria | 50529 |
| 1194 | Ga0495661_0000788 | 3300046665 | Bacteria | 30104 |
| 1195 | Ga0495661_0001039 | 3300046665 | Bacteria | 24633 |
| 1196 | Ga0495661_0004283 | 3300046665 | Bacteria | 10356 |
| 1197 | Ga0495661_0005323 | 3300046665 | Bacteria | 9153 |
| 1198 | Ga0495661_0007508 | 3300046665 | Bacteria | 7599 |
| 1199 | Ga0495661_0008231 | 3300046665 | Bacteria | 7223 |
| 1200 | Ga0495661_0010573 | 3300046665 | Bacteria | 6293 |
| 1201 | Ga0495661_0026189 | 3300046665 | Bacteria | 3758 |
| 1202 | Ga0495661_0027932 | 3300046665 | Bacteria | 3618 |
| 1203 | Ga0495661_0030098 | 3300046665 | Bacteria | 3459 |
| 1204 | Ga0495661_0033613 | 3300046665 | Bacteria | 3233 |
| 1205 | Ga0495661_0034461 | 3300046665 | Bacteria | 3185 |
| 1206 | Ga0495661_0037884 | 3300046665 | Bacteria | 3007 |
| 1207 | Ga0495661_0057480 | 3300046665 | Bacteria | 2322 |
| 1208 | Ga0495661_0065346 | 3300046665 | Bacteria | 2144 |
| 1209 | Ga0495661_0081724 | 3300046665 | Bacteria | 1861 |
| 1210 | Ga0495661_0085830 | 3300046665 | Bacteria | 1803 |
| 1211 | Ga0495588_0000147 | 3300046674 | Bacteria | 100948 |
| 1212 | Ga0495588_0011107 | 3300046674 | Bacteria | 4216 |
| 1213 | Ga0495588_0014594 | 3300046674 | Bacteria | 3762 |
| 1214 | Ga0495588_0017622 | 3300046674 | Bacteria | 3473 |
| 1215 | Ga0495588_0022311 | 3300046674 | Bacteria | 3128 |
| 1216 | Ga0495588_0033805 | 3300046674 | Bacteria | 2584 |
| 1217 | Ga0495588_0043042 | 3300046674 | Bacteria | 2310 |
| 1218 | Ga0495588_0058718 | 3300046674 | Bacteria | 1988 |
| 1219 | Ga0495588_0060865 | 3300046674 | Bacteria | 1954 |
| 1220 | Ga0495588_0064041 | 3300046674 | Bacteria | 1907 |
| 1221 | Ga0495588_0089576 | 3300046674 | Bacteria | 1611 |
| 1222 | Ga0495588_0106232 | 3300046674 | Bacteria | 1477 |
| 1223 | Ga0495588_0151507 | 3300046674 | Bacteria | 1225 |
| 1224 | Ga0495588_0221072 | 3300046674 | Bacteria | 1000 |
| 1225 | Ga0495599_0005211 | 3300046678 | Bacteria | 7754 |
| 1226 | Ga0495623_0014300 | 3300046679 | Bacteria | 5140 |
| 1227 | Ga0495646_0008367 | 3300046680 | Bacteria | 6577 |
| 1228 | Ga0495646_0023778 | 3300046680 | Bacteria | 3857 |
| 1229 | Ga0495669_0000073 | 3300046684 | Bacteria | 66387 |
| 1230 | Ga0495669_0002254 | 3300046684 | Bacteria | 7906 |
| 1231 | Ga0495669_0007961 | 3300046684 | Bacteria | 4446 |
| 1232 | Ga0495669_0013268 | 3300046684 | Bacteria | 3509 |
| 1233 | Ga0495669_0013494 | 3300046684 | Bacteria | 3482 |
| 1234 | Ga0495613_0045730 | 3300046689 | Bacteria | 3237 |
| 1235 | Ga0495624_0011275 | 3300046690 | Bacteria | 6145 |
| 1236 | Ga0495624_0022700 | 3300046690 | Bacteria | 4143 |
| 1237 | Ga0495624_0042991 | 3300046690 | Bacteria | 2884 |
| 1238 | Ga0495670_0001254 | 3300046691 | Bacteria | 12410 |
| 1239 | Ga0495670_0004528 | 3300046691 | Bacteria | 6812 |
| 1240 | Ga0495670_0005953 | 3300046691 | Bacteria | 5969 |
| 1241 | Ga0495670_0009328 | 3300046691 | Bacteria | 4829 |
| 1242 | Ga0495670_0010129 | 3300046691 | Bacteria | 4638 |
| 1243 | Ga0495670_0038805 | 3300046691 | Bacteria | 2375 |
| 1244 | Ga0495670_0049309 | 3300046691 | Bacteria | 2106 |
| 1245 | Ga0495670_0053103 | 3300046691 | Bacteria | 2029 |
| 1246 | Ga0495670_0102139 | 3300046691 | Bacteria | 1477 |
| 1247 | Ga0495670_0212428 | 3300046691 | Bacteria | 1026 |
| 1248 | Ga0495670_0308568 | 3300046691 | Bacteria | 849 |
| 1249 | Ga0495671_0000026 | 3300046692 | Bacteria | 237110 |
| 1250 | Ga0495671_0001460 | 3300046692 | Bacteria | 15858 |
| 1251 | Ga0495671_0001961 | 3300046692 | Bacteria | 13207 |
| 1252 | Ga0495671_0005885 | 3300046692 | Bacteria | 7136 |
| 1253 | Ga0495671_0006589 | 3300046692 | Bacteria | 6697 |
| 1254 | Ga0495671_0007537 | 3300046692 | Bacteria | 6195 |
| 1255 | Ga0495671_0009894 | 3300046692 | Bacteria | 5305 |
| 1256 | Ga0495671_0010452 | 3300046692 | Bacteria | 5141 |
| 1257 | Ga0495671_0022149 | 3300046692 | Bacteria | 3331 |
| 1258 | Ga0495671_0024992 | 3300046692 | Bacteria | 3107 |
| 1259 | Ga0495671_0033940 | 3300046692 | Bacteria | 2597 |
| 1260 | Ga0495671_0038113 | 3300046692 | Bacteria | 2430 |
| 1261 | Ga0495671_0146567 | 3300046692 | Bacteria | 1149 |
| 1262 | Ga0495649_0000186 | 3300046694 | Bacteria | 54356 |
| 1263 | Ga0495649_0000839 | 3300046694 | Bacteria | 24685 |
| 1264 | Ga0495649_0001335 | 3300046694 | Bacteria | 18749 |
| 1265 | Ga0495649_0004497 | 3300046694 | Bacteria | 9101 |
| 1266 | Ga0495649_0018456 | 3300046694 | Bacteria | 3925 |
| 1267 | Ga0495649_0019957 | 3300046694 | Bacteria | 3761 |
| 1268 | Ga0495649_0031678 | 3300046694 | Bacteria | 2914 |
| 1269 | Ga0495649_0034553 | 3300046694 | Bacteria | 2781 |
| 1270 | Ga0495649_0061289 | 3300046694 | Bacteria | 2022 |
| 1271 | Ga0495649_0067756 | 3300046694 | Bacteria | 1915 |
| 1272 | Ga0495649_0079750 | 3300046694 | Bacteria | 1750 |
| 1273 | Ga0495589_0000744 | 3300046794 | Bacteria | 20973 |
| 1274 | Ga0495589_0002015 | 3300046794 | Bacteria | 11503 |
| 1275 | Ga0495589_0002358 | 3300046794 | Bacteria | 10595 |
| 1276 | Ga0495589_0011232 | 3300046794 | Bacteria | 4649 |
| 1277 | Ga0495589_0020733 | 3300046794 | Bacteria | 3360 |
| 1278 | Ga0495589_0030555 | 3300046794 | Bacteria | 2712 |
| 1279 | Ga0495589_0038733 | 3300046794 | Bacteria | 2384 |
| 1280 | Ga0495589_0055292 | 3300046794 | Bacteria | 1956 |
| 1281 | Ga0495589_0061523 | 3300046794 | Bacteria | 1842 |
| 1282 | Ga0495589_0083801 | 3300046794 | Bacteria | 1549 |
| 1283 | Ga0495600_0000574 | 3300046809 | Bacteria | 19018 |
| 1284 | Ga0495600_0022926 | 3300046809 | Bacteria | 4013 |
| 1285 | Ga0495600_0025351 | 3300046809 | Bacteria | 3822 |
| 1286 | Ga0495600_0032124 | 3300046809 | Bacteria | 3404 |
| 1287 | Ga0495600_0211469 | 3300046809 | Bacteria | 1243 |
| 1288 | Ga0495660_0000101 | 3300046810 | Bacteria | 91466 |
| 1289 | Ga0495660_0001103 | 3300046810 | Bacteria | 19288 |
| 1290 | Ga0495660_0002130 | 3300046810 | Bacteria | 12786 |
| 1291 | Ga0495660_0005483 | 3300046810 | Bacteria | 7599 |
| 1292 | Ga0495660_0009610 | 3300046810 | Bacteria | 5637 |
| 1293 | Ga0495660_0010073 | 3300046810 | Bacteria | 5498 |
| 1294 | Ga0495660_0025181 | 3300046810 | Bacteria | 3381 |
| 1295 | Ga0495660_0029272 | 3300046810 | Bacteria | 3108 |
| 1296 | Ga0495660_0031405 | 3300046810 | Bacteria | 2985 |
| 1297 | Ga0495660_0046547 | 3300046810 | Bacteria | 2378 |
| 1298 | Ga0495660_0047713 | 3300046810 | Bacteria | 2344 |
| 1299 | Ga0495660_0068129 | 3300046810 | Bacteria | 1894 |
| 1300 | Ga0495660_0088565 | 3300046810 | Bacteria | 1612 |
| 1301 | Ga0495660_0088690 | 3300046810 | Bacteria | 1611 |
| 1302 | Ga0495660_0097211 | 3300046810 | Bacteria | 1520 |
| 1303 | Ga0495581_0010383 | 3300047315 | Bacteria | 5387 |
| 1304 | Ga0495581_0038882 | 3300047315 | Bacteria | 2754 |
| 1305 | Ga0495604_0006351 | 3300047317 | Bacteria | 9372 |
| 1306 | Ga0495604_0104107 | 3300047317 | Bacteria | 2080 |
| 1307 | Ga0495604_0111832 | 3300047317 | Bacteria | 1990 |
| 1308 | Ga0495636_0001420 | 3300047318 | Bacteria | 9056 |
| 1309 | Ga0495636_0002442 | 3300047318 | Bacteria | 7127 |
| 1310 | Ga0495636_0004292 | 3300047318 | Bacteria | 5594 |
| 1311 | Ga0495636_0006432 | 3300047318 | Bacteria | 4616 |
| 1312 | Ga0495636_0012427 | 3300047318 | Bacteria | 3371 |
| 1313 | Ga0495674_0001181 | 3300047319 | Bacteria | 25219 |
| 1314 | Ga0495674_0090508 | 3300047319 | Bacteria | 2614 |
| 1315 | Ga0495674_0104664 | 3300047319 | Bacteria | 2406 |
| 1316 | Ga0495672_0000340 | 3300047320 | Bacteria | 59814 |
| 1317 | Ga0495672_0000348 | 3300047320 | Bacteria | 59143 |
| 1318 | Ga0495672_0001839 | 3300047320 | Bacteria | 20263 |
| 1319 | Ga0495672_0003352 | 3300047320 | Bacteria | 13800 |
| 1320 | Ga0495672_0003446 | 3300047320 | Bacteria | 13529 |
| 1321 | Ga0495672_0004309 | 3300047320 | Bacteria | 11720 |
| 1322 | Ga0495672_0007196 | 3300047320 | Bacteria | 8407 |
| 1323 | Ga0495672_0029277 | 3300047320 | Bacteria | 3471 |
| 1324 | Ga0495672_0042744 | 3300047320 | Bacteria | 2730 |
| 1325 | Ga0495672_0051068 | 3300047320 | Bacteria | 2437 |
| 1326 | Ga0495676_0000022 | 3300047321 | Bacteria | 163719 |
| 1327 | Ga0495676_0000221 | 3300047321 | Bacteria | 45708 |
| 1328 | Ga0495676_0024269 | 3300047321 | Bacteria | 5254 |
| 1329 | Ga0495676_0029806 | 3300047321 | Bacteria | 4640 |
| 1330 | Ga0495676_0044680 | 3300047321 | Bacteria | 3613 |
| 1331 | Ga0495676_0217029 | 3300047321 | Bacteria | 1320 |
| 1332 | Ga0495676_0219987 | 3300047321 | Bacteria | 1309 |
| 1333 | Ga0495680_0011792 | 3300047322 | Bacteria | 7720 |
| 1334 | Ga0495680_0048458 | 3300047322 | Bacteria | 3336 |
| 1335 | Ga0495680_0209144 | 3300047322 | Bacteria | 1397 |
| 1336 | Ga0495683_0000030 | 3300047323 | Bacteria | 150551 |
| 1337 | Ga0495683_0000044 | 3300047323 | Bacteria | 133747 |
| 1338 | Ga0495683_0001121 | 3300047323 | Bacteria | 18461 |
| 1339 | Ga0495683_0001282 | 3300047323 | Bacteria | 17017 |
| 1340 | Ga0495683_0003427 | 3300047323 | Bacteria | 9251 |
| 1341 | Ga0495683_0019747 | 3300047323 | Bacteria | 3476 |
| 1342 | Ga0495683_0025662 | 3300047323 | Bacteria | 3019 |
| 1343 | Ga0495683_0037847 | 3300047323 | Bacteria | 2443 |
| 1344 | Ga0495683_0107345 | 3300047323 | Bacteria | 1336 |
| 1345 | Ga0495683_0118344 | 3300047323 | Bacteria | 1259 |
| 1346 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 1347 | Ga0495687_000030 | 3300047443 | Bacteria | 279992 |
| 1348 | Ga0495687_000120 | 3300047443 | Bacteria | 120987 |
| 1349 | Ga0495687_000374 | 3300047443 | Bacteria | 55800 |
| 1350 | Ga0495687_000814 | 3300047443 | Bacteria | 33460 |
| 1351 | Ga0495687_002263 | 3300047443 | Bacteria | 15785 |
| 1352 | Ga0495687_005069 | 3300047443 | Bacteria | 8551 |
| 1353 | Ga0495687_005087 | 3300047443 | Bacteria | 8535 |
| 1354 | Ga0495687_005249 | 3300047443 | Bacteria | 8325 |
| 1355 | Ga0495687_006481 | 3300047443 | Bacteria | 7160 |
| 1356 | Ga0495687_006723 | 3300047443 | Bacteria | 6970 |
| 1357 | Ga0495687_018413 | 3300047443 | Bacteria | 3452 |
| 1358 | Ga0495675_0007931 | 3300047444 | Bacteria | 6562 |
| 1359 | Ga0495675_0014225 | 3300047444 | Bacteria | 5030 |
| 1360 | Ga0495677_0000045 | 3300047445 | Bacteria | 73995 |
| 1361 | Ga0495677_0001255 | 3300047445 | Bacteria | 10158 |
| 1362 | Ga0495677_0001897 | 3300047445 | Bacteria | 8351 |
| 1363 | Ga0495677_0002978 | 3300047445 | Bacteria | 6589 |
| 1364 | Ga0495677_0003654 | 3300047445 | Bacteria | 5954 |
| 1365 | Ga0495677_0003854 | 3300047445 | Bacteria | 5798 |
| 1366 | Ga0495677_0005291 | 3300047445 | Bacteria | 4899 |
| 1367 | Ga0495677_0030911 | 3300047445 | Bacteria | 1949 |
| 1368 | Ga0495677_0033917 | 3300047445 | Bacteria | 1861 |
| 1369 | Ga0495677_0036059 | 3300047445 | Bacteria | 1805 |
| 1370 | Ga0495677_0046008 | 3300047445 | Bacteria | 1601 |
| 1371 | Ga0495677_0053556 | 3300047445 | Bacteria | 1488 |
| 1372 | Ga0495679_000212 | 3300047446 | Bacteria | 49948 |
| 1373 | Ga0495679_000736 | 3300047446 | Bacteria | 21003 |
| 1374 | Ga0495679_002165 | 3300047446 | Bacteria | 10314 |
| 1375 | Ga0495679_003747 | 3300047446 | Bacteria | 7231 |
| 1376 | Ga0495679_013607 | 3300047446 | Bacteria | 3045 |
| 1377 | Ga0495679_020712 | 3300047446 | Bacteria | 2285 |
| 1378 | Ga0495685_000505 | 3300047447 | Bacteria | 12081 |
| 1379 | Ga0495685_001117 | 3300047447 | Bacteria | 8204 |
| 1380 | Ga0495685_044866 | 3300047447 | Bacteria | 1507 |
| 1381 | Ga0495673_0000179 | 3300047469 | Bacteria | 102128 |
| 1382 | Ga0495673_0000201 | 3300047469 | Bacteria | 92885 |
| 1383 | Ga0495673_0000391 | 3300047469 | Bacteria | 51513 |
| 1384 | Ga0495673_0004747 | 3300047469 | Bacteria | 8420 |
| 1385 | Ga0495673_0010934 | 3300047469 | Bacteria | 4909 |
| 1386 | Ga0495673_0022072 | 3300047469 | Bacteria | 3126 |
| 1387 | Ga0495673_0028308 | 3300047469 | Bacteria | 2655 |
| 1388 | Ga0495673_0033851 | 3300047469 | Bacteria | 2366 |
| 1389 | Ga0495681_0002281 | 3300047470 | Bacteria | 13792 |
| 1390 | Ga0495681_0004090 | 3300047470 | Bacteria | 10030 |
| 1391 | Ga0495681_0005170 | 3300047470 | Bacteria | 8780 |
| 1392 | Ga0495681_0005907 | 3300047470 | Bacteria | 8121 |
| 1393 | Ga0495681_0005937 | 3300047470 | Bacteria | 8100 |
| 1394 | Ga0495681_0017127 | 3300047470 | Bacteria | 4036 |
| 1395 | Ga0495681_0020045 | 3300047470 | Bacteria | 3636 |
| 1396 | Ga0495681_0027137 | 3300047470 | Bacteria | 2968 |
| 1397 | Ga0495681_0032542 | 3300047470 | Bacteria | 2624 |
| 1398 | Ga0495681_0035175 | 3300047470 | Bacteria | 2489 |
| 1399 | Ga0495681_0036810 | 3300047470 | Bacteria | 2417 |
| 1400 | Ga0495681_0051141 | 3300047470 | Bacteria | 1944 |
| 1401 | Ga0495681_0055757 | 3300047470 | Bacteria | 1841 |
| 1402 | Ga0495681_0112950 | 3300047470 | Bacteria | 1174 |
| 1403 | Ga0495681_0114113 | 3300047470 | Bacteria | 1166 |
| 1404 | Ga0495686_0000793 | 3300047472 | Bacteria | 41237 |
| 1405 | Ga0495686_0001487 | 3300047472 | Bacteria | 25415 |
| 1406 | Ga0495686_0002313 | 3300047472 | Bacteria | 18221 |
| 1407 | Ga0495686_0007032 | 3300047472 | Bacteria | 8497 |
| 1408 | Ga0495686_0012729 | 3300047472 | Bacteria | 5871 |
| 1409 | Ga0495686_0016478 | 3300047472 | Bacteria | 5011 |
| 1410 | Ga0495686_0021328 | 3300047472 | Bacteria | 4304 |
| 1411 | Ga0495686_0058084 | 3300047472 | Bacteria | 2412 |
| 1412 | Ga0495686_0077016 | 3300047472 | Bacteria | 2042 |
| 1413 | Ga0495686_0099123 | 3300047472 | Bacteria | 1759 |
| 1414 | Ga0495593_0011040 | 3300047673 | Bacteria | 5199 |
| 1415 | Ga0495593_0025631 | 3300047673 | Bacteria | 3263 |
| 1416 | Ga0495593_0025956 | 3300047673 | Bacteria | 3239 |
| 1417 | Ga0495602_0003238 | 3300048088 | Bacteria | 16812 |
| 1418 | Ga0495602_0024518 | 3300048088 | Bacteria | 5852 |
| 1419 | Ga0495602_0087339 | 3300048088 | Bacteria | 2599 |
| 1420 | Ga0495602_0170950 | 3300048088 | Bacteria | 1687 |
| 1421 | Ga0495614_0034086 | 3300048089 | Bacteria | 2189 |
| 1422 | Ga0495626_0000022 | 3300048091 | Bacteria | 216166 |
| 1423 | Ga0495626_0000039 | 3300048091 | Bacteria | 175454 |
| 1424 | Ga0495626_0000105 | 3300048091 | Bacteria | 109725 |
| 1425 | Ga0495626_0001496 | 3300048091 | Bacteria | 18442 |
| 1426 | Ga0495626_0001817 | 3300048091 | Bacteria | 16083 |
| 1427 | Ga0495626_0002464 | 3300048091 | Bacteria | 12814 |
| 1428 | Ga0495626_0004240 | 3300048091 | Bacteria | 8859 |
| 1429 | Ga0495626_0009776 | 3300048091 | Bacteria | 5163 |
| 1430 | Ga0495626_0011488 | 3300048091 | Bacteria | 4682 |
| 1431 | Ga0495626_0025600 | 3300048091 | Bacteria | 2884 |
| 1432 | Ga0495626_0027200 | 3300048091 | Bacteria | 2782 |
| 1433 | Ga0495626_0035334 | 3300048091 | Bacteria | 2385 |
| 1434 | Ga0495626_0046884 | 3300048091 | Bacteria | 2010 |
| 1435 | Ga0495626_0047022 | 3300048091 | Bacteria | 2007 |
| 1436 | Ga0495626_0048178 | 3300048091 | Bacteria | 1978 |
| 1437 | Ga0495626_0049362 | 3300048091 | Bacteria | 1948 |
| 1438 | Ga0495626_0074510 | 3300048091 | Bacteria | 1518 |
| 1439 | Ga0496100_0026304 | 3300048903 | Bacteria | 3567 |
| 1440 | Ga0496100_0071368 | 3300048903 | Bacteria | 2318 |
| 1441 | Ga0496100_0152475 | 3300048903 | Bacteria | 1650 |
| 1442 | Ga0496101_0012306 | 3300048904 | Bacteria | 5706 |
| 1443 | Ga0496102_0000836 | 3300048905 | Bacteria | 29566 |
| 1444 | Ga0496102_0001960 | 3300048905 | Bacteria | 17748 |
| 1445 | Ga0496102_0116493 | 3300048905 | Bacteria | 2493 |
| 1446 | Ga0496102_0159383 | 3300048905 | Bacteria | 2122 |
| 1447 | Ga0496102_0249210 | 3300048905 | Bacteria | 1674 |
| 1448 | Ga0496103_0035508 | 3300048906 | Bacteria | 3052 |
| 1449 | Ga0496103_0056784 | 3300048906 | Bacteria | 2430 |
| 1450 | Ga0496103_0066831 | 3300048906 | Bacteria | 2244 |
| 1451 | Ga0496103_0405502 | 3300048906 | Bacteria | 876 |
| 1452 | Ga0496104_0706501 | 3300048907 | Bacteria | 916 |
| 1453 | Ga0496105_0122864 | 3300048908 | Bacteria | 2141 |
| 1454 | Ga0496106_0007806 | 3300048909 | Bacteria | 7915 |
| 1455 | Ga0496106_0030116 | 3300048909 | Bacteria | 4046 |
| 1456 | Ga0496106_0142191 | 3300048909 | Bacteria | 1888 |
| 1457 | Ga0496107_0037389 | 3300048910 | Bacteria | 3483 |
| 1458 | Ga0496107_0075472 | 3300048910 | Bacteria | 2454 |
| 1459 | Ga0496107_0125500 | 3300048910 | Bacteria | 1893 |
| 1460 | Ga0496107_0329708 | 3300048910 | Bacteria | 1136 |
| 1461 | Ga0496107_0531092 | 3300048910 | Bacteria | 872 |
| 1462 | Ga0496108_0337275 | 3300048911 | Bacteria | 1315 |
| 1463 | Ga0496109_0019163 | 3300048912 | Bacteria | 6027 |
| 1464 | Ga0496109_0024376 | 3300048912 | Bacteria | 5378 |
| 1465 | Ga0496109_0180887 | 3300048912 | Bacteria | 1980 |
| 1466 | Ga0496110_0003614 | 3300048913 | Bacteria | 11901 |
| 1467 | Ga0496110_0054436 | 3300048913 | Bacteria | 3519 |
| 1468 | Ga0496110_0068198 | 3300048913 | Bacteria | 3148 |
| 1469 | Ga0496110_0106607 | 3300048913 | Bacteria | 2515 |
| 1470 | Ga0496110_0183492 | 3300048913 | Bacteria | 1900 |
| 1471 | Ga0496110_0366094 | 3300048913 | Bacteria | 1313 |
| 1472 | Ga0496111_0035112 | 3300048914 | Bacteria | 3582 |
| 1473 | Ga0496113_0007466 | 3300048916 | Bacteria | 7039 |
| 1474 | Ga0496113_0075979 | 3300048916 | Bacteria | 2565 |
| 1475 | Ga0496114_0096118 | 3300048917 | Bacteria | 2522 |
| 1476 | Ga0496114_0102792 | 3300048917 | Bacteria | 2441 |
| 1477 | Ga0496114_0569376 | 3300048917 | Bacteria | 1000 |
| 1478 | Ga0496115_0031619 | 3300048918 | Bacteria | 4170 |
| 1479 | Ga0496116_0000008 | 3300048919 | Bacteria | 726753 |
| 1480 | Ga0496116_0000667 | 3300048919 | Bacteria | 44735 |
| 1481 | Ga0496116_0057003 | 3300048919 | Bacteria | 2557 |
| 1482 | Ga0496116_0161931 | 3300048919 | Bacteria | 1226 |
| 1483 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1484 | Ga0496117_0000385 | 3300048920 | Bacteria | 75873 |
| 1485 | Ga0496117_0003287 | 3300048920 | Bacteria | 18948 |
| 1486 | Ga0496117_0006460 | 3300048920 | Bacteria | 11854 |
| 1487 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 1488 | Ga0496118_0002475 | 3300048921 | Bacteria | 24791 |
| 1489 | Ga0496118_0003109 | 3300048921 | Bacteria | 21275 |
| 1490 | Ga0496118_0119068 | 3300048921 | Bacteria | 1727 |
| 1491 | Ga0496119_0000060 | 3300048922 | Bacteria | 172646 |
| 1492 | Ga0496120_0003085 | 3300048923 | Bacteria | 15703 |
| 1493 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 1494 | Ga0496121_0004115 | 3300048924 | Bacteria | 19938 |
| 1495 | Ga0496121_0006040 | 3300048924 | Bacteria | 15254 |
| 1496 | Ga0496121_0011729 | 3300048924 | Bacteria | 9671 |
| 1497 | Ga0496121_0014995 | 3300048924 | Bacteria | 8159 |
| 1498 | Ga0496121_0023622 | 3300048924 | Bacteria | 5912 |
| 1499 | Ga0496121_0027645 | 3300048924 | Bacteria | 5303 |
| 1500 | Ga0496121_0048724 | 3300048924 | Bacteria | 3602 |
| 1501 | Ga0496121_0064564 | 3300048924 | Bacteria | 2984 |
| 1502 | Ga0496122_0001366 | 3300048925 | Bacteria | 39678 |
| 1503 | Ga0496122_0002458 | 3300048925 | Bacteria | 26220 |
| 1504 | Ga0496122_0003525 | 3300048925 | Bacteria | 20479 |
| 1505 | Ga0496122_0004630 | 3300048925 | Bacteria | 16923 |
| 1506 | Ga0496122_0010326 | 3300048925 | Bacteria | 9656 |
| 1507 | Ga0496122_0011135 | 3300048925 | Bacteria | 9161 |
| 1508 | Ga0496122_0030996 | 3300048925 | Bacteria | 4463 |
| 1509 | Ga0496123_0000717 | 3300048926 | Bacteria | 54100 |
| 1510 | Ga0496123_0001033 | 3300048926 | Bacteria | 42272 |
| 1511 | Ga0496123_0003683 | 3300048926 | Bacteria | 16896 |
| 1512 | Ga0496123_0006523 | 3300048926 | Bacteria | 11271 |
| 1513 | Ga0496123_0013096 | 3300048926 | Bacteria | 6997 |
| 1514 | Ga0496123_0014932 | 3300048926 | Bacteria | 6402 |
| 1515 | Ga0496123_0016214 | 3300048926 | Bacteria | 6064 |
| 1516 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 1517 | Ga0496124_0000120 | 3300048927 | Bacteria | 163899 |
| 1518 | Ga0496124_0003062 | 3300048927 | Bacteria | 20837 |
| 1519 | Ga0496124_0003568 | 3300048927 | Bacteria | 18917 |
| 1520 | Ga0496124_0004471 | 3300048927 | Bacteria | 16316 |
| 1521 | Ga0496124_0007303 | 3300048927 | Bacteria | 11787 |
| 1522 | Ga0496124_0010350 | 3300048927 | Bacteria | 9456 |
| 1523 | Ga0496124_0010787 | 3300048927 | Bacteria | 9208 |
| 1524 | Ga0496124_0012015 | 3300048927 | Bacteria | 8608 |
| 1525 | Ga0496124_0050716 | 3300048927 | Bacteria | 3534 |
| 1526 | Ga0496124_0073013 | 3300048927 | Bacteria | 2840 |
| 1527 | Ga0496124_0140991 | 3300048927 | Bacteria | 1902 |
| 1528 | Ga0496124_0148322 | 3300048927 | Bacteria | 1843 |
| 1529 | Ga0496124_0186639 | 3300048927 | Bacteria | 1591 |
| 1530 | Ga0496124_0272975 | 3300048927 | Bacteria | 1237 |
| 1531 | Ga0496124_0309621 | 3300048927 | Bacteria | 1136 |
| 1532 | Ga0496125_0001735 | 3300048928 | Bacteria | 30307 |
| 1533 | Ga0496125_0005087 | 3300048928 | Bacteria | 14812 |
| 1534 | Ga0496125_0007226 | 3300048928 | Bacteria | 11838 |
| 1535 | Ga0496125_0008517 | 3300048928 | Bacteria | 10719 |
| 1536 | Ga0496125_0009631 | 3300048928 | Bacteria | 9878 |
| 1537 | Ga0496125_0019456 | 3300048928 | Bacteria | 6402 |
| 1538 | Ga0496125_0038131 | 3300048928 | Bacteria | 4165 |
| 1539 | Ga0496126_0012840 | 3300048929 | Bacteria | 8560 |
| 1540 | Ga0496126_0031712 | 3300048929 | Bacteria | 4987 |
| 1541 | Ga0496126_0225901 | 3300048929 | Bacteria | 1570 |
| 1542 | Ga0501308_001808 | 3300049128 | Bacteria | 1788 |
| 1543 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1544 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 1545 | Ga0495678_000190 | 3300049459 | Bacteria | 71878 |
| 1546 | Ga0495678_000774 | 3300049459 | Bacteria | 28808 |
| 1547 | Ga0495678_001665 | 3300049459 | Bacteria | 16901 |
| 1548 | Ga0495678_001755 | 3300049459 | Bacteria | 16084 |
| 1549 | Ga0495678_002527 | 3300049459 | Bacteria | 12310 |
| 1550 | Ga0495678_006438 | 3300049459 | Bacteria | 6248 |
| 1551 | Ga0495678_007129 | 3300049459 | Bacteria | 5840 |
| 1552 | Ga0495678_010503 | 3300049459 | Bacteria | 4498 |
| 1553 | Ga0495678_019199 | 3300049459 | Bacteria | 3055 |
| 1554 | Ga0495678_035133 | 3300049459 | Bacteria | 2057 |
| 1555 | Ga0495678_071648 | 3300049459 | Bacteria | 1268 |
| 1556 | Ga0495682_0000264 | 3300049460 | Bacteria | 41397 |
| 1557 | Ga0495682_0000527 | 3300049460 | Bacteria | 26345 |
| 1558 | Ga0495682_0001034 | 3300049460 | Bacteria | 16403 |
| 1559 | Ga0495682_0005671 | 3300049460 | Bacteria | 5157 |
| 1560 | Ga0495682_0024552 | 3300049460 | Bacteria | 2246 |
| 1561 | Ga0495682_0045630 | 3300049460 | Bacteria | 1600 |
| 1562 | Ga0501290_001453 | 3300049513 | Bacteria | 3238 |
| 1563 | Ga0501031_0020689 | 3300049568 | Bacteria | 4289 |
| 1564 | Ga0501032_0025216 | 3300049569 | Bacteria | 4100 |
| 1565 | Ga0501033_0008191 | 3300049570 | Bacteria | 8096 |
| 1566 | Ga0501034_0000576 | 3300049571 | Bacteria | 58021 |
| 1567 | Ga0501034_0083131 | 3300049571 | Bacteria | 3203 |
| 1568 | Ga0501034_0154875 | 3300049571 | Bacteria | 2266 |
| 1569 | Ga0501034_0170472 | 3300049571 | Bacteria | 2144 |
| 1570 | Ga0501036_0000484 | 3300049572 | Bacteria | 28401 |
| 1571 | Ga0501036_0173451 | 3300049572 | Bacteria | 1816 |
| 1572 | Ga0501037_0001076 | 3300049573 | Bacteria | 20246 |
| 1573 | Ga0501037_0315923 | 3300049573 | Bacteria | 1082 |
| 1574 | Ga0501038_0009984 | 3300049574 | Bacteria | 8692 |
| 1575 | Ga0501038_0013559 | 3300049574 | Bacteria | 7427 |
| 1576 | Ga0501038_0017565 | 3300049574 | Bacteria | 6467 |
| 1577 | Ga0501038_0050136 | 3300049574 | Bacteria | 3608 |
| 1578 | Ga0501039_0026382 | 3300049575 | Bacteria | 4464 |
| 1579 | Ga0501043_0210509 | 3300049579 | Bacteria | 1507 |
| 1580 | Ga0501047_0020371 | 3300049581 | Bacteria | 6370 |
| 1581 | Ga0501047_0067479 | 3300049581 | Bacteria | 3447 |
| 1582 | Ga0501068_0007074 | 3300049584 | Bacteria | 6215 |
| 1583 | Ga0501072_0401611 | 3300049588 | Bacteria | 1087 |
| 1584 | Ga0501207_020312 | 3300049654 | Bacteria | 1060 |
| 1585 | Ga0501230_002213 | 3300049667 | Bacteria | 2454 |
| 1586 | Ga0501238_004739 | 3300049671 | Bacteria | 1708 |
| 1587 | Ga0501249_003941 | 3300049679 | Bacteria | 3004 |
| 1588 | Ga0501269_000416 | 3300049766 | Bacteria | 9697 |
| 1589 | Ga0501279_008716 | 3300049775 | Bacteria | 1357 |
| 1590 | Ga0501035_0006430 | 3300049822 | Bacteria | 11037 |
| 1591 | Ga0501044_0000066 | 3300049823 | Bacteria | 128533 |
| 1592 | Ga0501044_0019977 | 3300049823 | Bacteria | 7152 |
| 1593 | Ga0501044_0244029 | 3300049823 | Bacteria | 1739 |
| 1594 | Ga0501044_0605967 | 3300049823 | Bacteria | 988 |
| 1595 | Ga0501045_0027707 | 3300049824 | Bacteria | 4085 |
| 1596 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 1597 | nmdc:mga0yw44_34389_c1 | 3300050492 | Bacteria | 2970 |
| 1598 | nmdc:mga0k408_42919_c1 | 3300050493 | Bacteria | 2605 |
| 1599 | nmdc:mga04h51_3065_c1 | 3300050495 | Bacteria | 4029 |
| 1600 | nmdc:mga07m45_91940_c1 | 3300050496 | Bacteria | 1739 |
| 1601 | nmdc:mga08y16_405438_c1 | 3300050511 | Bacteria | 1395 |
| 1602 | nmdc:mga0n895_34016_c1 | 3300050512 | Bacteria | 4903 |
| 1603 | nmdc:mga0a205_203132_c1 | 3300050515 | Bacteria | 1872 |
| 1604 | Ga0495601_0009638 | 3300053077 | Bacteria | 5717 |
| 1605 | Ga0495601_0033773 | 3300053077 | Bacteria | 3188 |
| 1606 | Ga0500650_0000173 | 3300053098 | Bacteria | 16349 |
| 1607 | Ga0500572_016555 | 3300053111 | Bacteria | 1880 |
| 1608 | Ga0500594_0006183 | 3300053118 | Bacteria | 2683 |
| 1609 | Ga0500595_001801 | 3300053119 | Bacteria | 11110 |
| 1610 | Ga0500618_000364 | 3300053125 | Bacteria | 31481 |
| 1611 | Ga0500618_003165 | 3300053125 | Bacteria | 5780 |
| 1612 | Ga0500618_004967 | 3300053125 | Bacteria | 4120 |
| 1613 | Ga0500659_0000765 | 3300053135 | Bacteria | 20671 |
| 1614 | Ga0500564_015033 | 3300053138 | Bacteria | 3491 |
| 1615 | Ga0500574_002852 | 3300053141 | Bacteria | 2940 |
| 1616 | Ga0500586_002898 | 3300053145 | Bacteria | 3966 |
| 1617 | Ga0500586_021361 | 3300053145 | Bacteria | 2040 |
| 1618 | Ga0500619_000766 | 3300053154 | Bacteria | 5495 |
| 1619 | Ga0500634_0123624 | 3300053161 | Bacteria | 1255 |
| 1620 | Ga0587093_007139 | 3300059478 | Bacteria | 1238 |
| 1621 | Ga0587077_016481 | 3300059493 | Bacteria | 1245 |
| 1622 | Ga0587082_014811 | 3300059504 | Bacteria | 1195 |
| 1623 | Ga0587083_0022915 | 3300059505 | Bacteria | 1174 |
| 1624 | Ga0587083_0025900 | 3300059505 | Bacteria | 1128 |
| 1625 | Ga0587085_008539 | 3300059506 | Bacteria | 1310 |
| 1626 | Ga0587090_010604 | 3300059510 | Bacteria | 1280 |
| 1627 | Ga0587090_011356 | 3300059510 | Bacteria | 1251 |
| 1628 | Ga0587091_040564 | 3300059511 | Bacteria | 916 |
| 1629 | Ga0587092_010749 | 3300059512 | Bacteria | 1259 |
| 1630 | Ga0587062_004270 | 3300059639 | Bacteria | 1507 |
| 1631 | Ga0587068_004766 | 3300059641 | Bacteria | 1812 |
| 1632 | Ga0587068_008736 | 3300059641 | Bacteria | 1476 |
| 1633 | Ga0587072_020222 | 3300059643 | Bacteria | 1171 |
| 1634 | Ga0587072_021628 | 3300059643 | Bacteria | 1143 |
| 1635 | Ga0587076_035377 | 3300059645 | Bacteria | 908 |
| 1636 | Ga0587079_026495 | 3300059647 | Bacteria | 1084 |
| 1637 | Ga0587111_0007637 | 3300060346 | Bacteria | 1764 |
| 1638 | Ga0466962_0013955 | 3300061719 | Bacteria | 3870 |
| 1639 | Ga0466962_0031666 | 3300061719 | Bacteria | 2532 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0201854 | Ga0316584_0201854_40_678 | 212 |
| 2 | 3300046523 | Ga0495644_0002948 | Ga0495644_0002948_793_1518 | 241 |
| 3 | 3300005563 | Ga0068855_100132978 | Ga0068855_1001329782 | 242 |
| 4 | 3300005614 | Ga0068856_100039033 | Ga0068856_1000390334 | 242 |
| 5 | 3300005842 | Ga0068858_100006205 | Ga0068858_1000062054 | 242 |
| 6 | 3300009551 | Ga0105238_10236152 | Ga0105238_102361522 | 242 |
| 7 | 3300014325 | Ga0163163_10012524 | Ga0163163_100125245 | 242 |
| 8 | 3300014968 | Ga0157379_10103371 | Ga0157379_101033712 | 242 |
| 9 | 3300025949 | Ga0207667_10141020 | Ga0207667_101410202 | 242 |
| 10 | 3300026035 | Ga0207703_10009193 | Ga0207703_100091936 | 242 |
| 11 | 3300003578 | Ga0006562J51391_1024911 | Ga0006562J51391_10249113 | 243 |
| 12 | 3300005331 | Ga0070670_100139271 | Ga0070670_1001392711 | 243 |
| 13 | 3300005458 | Ga0070681_10159163 | Ga0070681_101591633 | 243 |
| 14 | 3300006042 | Ga0075368_10002887 | Ga0075368_100028875 | 243 |
| 15 | 3300006048 | Ga0075363_100005456 | Ga0075363_1000054565 | 243 |
| 16 | 3300006051 | Ga0075364_10035001 | Ga0075364_100350013 | 243 |
| 17 | 3300006178 | Ga0075367_10003131 | Ga0075367_100031318 | 243 |
| 18 | 3300006186 | Ga0075369_10010363 | Ga0075369_100103633 | 243 |
| 19 | 3300006195 | Ga0075366_10001060 | Ga0075366_100010606 | 243 |
| 20 | 3300006353 | Ga0075370_10026031 | Ga0075370_100260313 | 243 |
| 21 | 3300013100 | Ga0157373_10139519 | Ga0157373_101395192 | 243 |
| 22 | 3300025915 | Ga0207693_10035205 | Ga0207693_100352054 | 243 |
| 23 | 3300025925 | Ga0207650_10100131 | Ga0207650_101001313 | 243 |
| 24 | 3300026078 | Ga0207702_10280934 | Ga0207702_102809342 | 243 |
| 25 | 3300027512 | Ga0209179_1000427 | Ga0209179_10004273 | 243 |
| 26 | 3300027671 | Ga0209588_1016338 | Ga0209588_10163383 | 243 |
| 27 | 3300027866 | Ga0209813_10000948 | Ga0209813_100009482 | 243 |
| 28 | 3300031241 | Ga0265325_10010023 | Ga0265325_100100234 | 243 |
| 29 | 3300033179 | Ga0307507_10124839 | Ga0307507_101248391 | 243 |
| 30 | 3300035111 | Ga0373923_0015386 | Ga0373923_0015386_1874_2605 | 243 |
| 31 | 3300035113 | Ga0373936_0165467 | Ga0373936_0165467_71_802 | 243 |
| 32 | 3300035725 | Ga0373947_0092428 | Ga0373947_0092428_983_1714 | 243 |
| 33 | 3300038443 | Ga0395901_0357010 | Ga0395901_0357010_374_1105 | 243 |
| 34 | 3300038443 | Ga0395901_0681271 | Ga0395901_0681271_24_755 | 243 |
| 35 | 3300041410 | Ga0439461_0030251 | Ga0439461_0030251_143_874 | 243 |
| 36 | 3300042876 | Ga0451577_0304333 | Ga0451577_0304333_392_1123 | 243 |
| 37 | 3300044673 | Ga0453683_0061956 | Ga0453683_0061956_910_1641 | 243 |
| 38 | 3300044673 | Ga0453683_0134717 | Ga0453683_0134717_672_1403 | 243 |
| 39 | 3300044673 | Ga0453683_0415733 | Ga0453683_0415733_120_851 | 243 |
| 40 | 3300044712 | Ga0453684_0000142 | Ga0453684_0000142_267975_268706 | 243 |
| 41 | 3300044712 | Ga0453684_0000158 | Ga0453684_0000158_265350_266081 | 243 |
| 42 | 3300044712 | Ga0453684_0025204 | Ga0453684_0025204_2607_3338 | 243 |
| 43 | 3300044712 | Ga0453684_0151971 | Ga0453684_0151971_500_1231 | 243 |
| 44 | 3300044712 | Ga0453684_0217168 | Ga0453684_0217168_421_1152 | 243 |
| 45 | 3300045051 | Ga0451576_0006384 | Ga0451576_0006384_2392_3123 | 243 |
| 46 | 3300045051 | Ga0451576_0063755 | Ga0451576_0063755_181_912 | 243 |
| 47 | 3300045051 | Ga0451576_0067833 | Ga0451576_0067833_22_753 | 243 |
| 48 | 3300045051 | Ga0451576_0085745 | Ga0451576_0085745_75_806 | 243 |
| 49 | 3300046455 | Ga0495603_0063173 | Ga0495603_0063173_67_798 | 243 |
| 50 | 3300046457 | Ga0495590_0007474 | Ga0495590_0007474_2652_3383 | 243 |
| 51 | 3300046459 | Ga0495629_0129424 | Ga0495629_0129424_110_841 | 243 |
| 52 | 3300046463 | Ga0495653_0008977 | Ga0495653_0008977_103_834 | 243 |
| 53 | 3300046463 | Ga0495653_0014418 | Ga0495653_0014418_307_1038 | 243 |
| 54 | 3300046472 | Ga0495580_0075326 | Ga0495580_0075326_181_912 | 243 |
| 55 | 3300046473 | Ga0495582_0005379 | Ga0495582_0005379_4440_5171 | 243 |
| 56 | 3300046473 | Ga0495582_0072833 | Ga0495582_0072833_522_1253 | 243 |
| 57 | 3300046475 | Ga0495639_0125911 | Ga0495639_0125911_181_912 | 243 |
| 58 | 3300046477 | Ga0495664_0060436 | Ga0495664_0060436_346_1077 | 243 |
| 59 | 3300046499 | Ga0495594_0019945 | Ga0495594_0019945_1394_2125 | 243 |
| 60 | 3300046499 | Ga0495594_0074625 | Ga0495594_0074625_1083_1814 | 243 |
| 61 | 3300046500 | Ga0495596_0006811 | Ga0495596_0006811_291_1022 | 243 |
| 62 | 3300046501 | Ga0495607_0094518 | Ga0495607_0094518_303_1034 | 243 |
| 63 | 3300046513 | Ga0495616_0050041 | Ga0495616_0050041_685_1416 | 243 |
| 64 | 3300046516 | Ga0495628_0008265 | Ga0495628_0008265_2159_2890 | 243 |
| 65 | 3300046517 | Ga0495630_0040193 | Ga0495630_0040193_271_1002 | 243 |
| 66 | 3300046523 | Ga0495644_0013726 | Ga0495644_0013726_1293_2024 | 243 |
| 67 | 3300046526 | Ga0495666_0015846 | Ga0495666_0015846_1642_2373 | 243 |
| 68 | 3300046526 | Ga0495666_0016390 | Ga0495666_0016390_375_1106 | 243 |
| 69 | 3300046528 | Ga0495642_0013311 | Ga0495642_0013311_257_988 | 243 |
| 70 | 3300046528 | Ga0495642_0016497 | Ga0495642_0016497_217_948 | 243 |
| 71 | 3300046529 | Ga0495652_0008714 | Ga0495652_0008714_1796_2527 | 243 |
| 72 | 3300046529 | Ga0495652_0035636 | Ga0495652_0035636_2683_3414 | 243 |
| 73 | 3300046531 | Ga0495665_0009613 | Ga0495665_0009613_478_1209 | 243 |
| 74 | 3300046531 | Ga0495665_0021786 | Ga0495665_0021786_900_1631 | 243 |
| 75 | 3300046533 | Ga0495640_0013804 | Ga0495640_0013804_1386_2117 | 243 |
| 76 | 3300046535 | Ga0495586_0001555 | Ga0495586_0001555_5803_6534 | 243 |
| 77 | 3300046535 | Ga0495586_0079390 | Ga0495586_0079390_146_877 | 243 |
| 78 | 3300046536 | Ga0495587_0073539 | Ga0495587_0073539_229_960 | 243 |
| 79 | 3300046542 | Ga0495597_0009251 | Ga0495597_0009251_2912_3643 | 243 |
| 80 | 3300046616 | Ga0495668_0032297 | Ga0495668_0032297_1119_1850 | 243 |
| 81 | 3300046642 | Ga0495634_0009917 | Ga0495634_0009917_4003_4734 | 243 |
| 82 | 3300046663 | Ga0495635_0031660 | Ga0495635_0031660_455_1186 | 243 |
| 83 | 3300046665 | Ga0495661_0001039 | Ga0495661_0001039_5568_6299 | 243 |
| 84 | 3300046674 | Ga0495588_0011107 | Ga0495588_0011107_1353_2084 | 243 |
| 85 | 3300046674 | Ga0495588_0221072 | Ga0495588_0221072_16_747 | 243 |
| 86 | 3300046679 | Ga0495623_0014300 | Ga0495623_0014300_2552_3316 | 243 |
| 87 | 3300046684 | Ga0495669_0000073 | Ga0495669_0000073_56057_56788 | 243 |
| 88 | 3300046691 | Ga0495670_0038805 | Ga0495670_0038805_1049_1780 | 243 |
| 89 | 3300046694 | Ga0495649_0067756 | Ga0495649_0067756_306_1037 | 243 |
| 90 | 3300046809 | Ga0495600_0025351 | Ga0495600_0025351_1442_2173 | 243 |
| 91 | 3300047317 | Ga0495604_0104107 | Ga0495604_0104107_1083_1814 | 243 |
| 92 | 3300047321 | Ga0495676_0000221 | Ga0495676_0000221_34883_35614 | 243 |
| 93 | 3300047322 | Ga0495680_0048458 | Ga0495680_0048458_2588_3319 | 243 |
| 94 | 3300047443 | Ga0495687_005249 | Ga0495687_005249_64_795 | 243 |
| 95 | 3300047444 | Ga0495675_0007931 | Ga0495675_0007931_2924_3655 | 243 |
| 96 | 3300047444 | Ga0495675_0014225 | Ga0495675_0014225_1667_2398 | 243 |
| 97 | 3300047445 | Ga0495677_0046008 | Ga0495677_0046008_761_1492 | 243 |
| 98 | 3300047470 | Ga0495681_0114113 | Ga0495681_0114113_396_1127 | 243 |
| 99 | 3300047673 | Ga0495593_0011040 | Ga0495593_0011040_567_1298 | 243 |
| 100 | 3300048088 | Ga0495602_0003238 | Ga0495602_0003238_3188_3919 | 243 |
| 101 | 3300048089 | Ga0495614_0034086 | Ga0495614_0034086_1093_1824 | 243 |
| 102 | 3300048091 | Ga0495626_0011488 | Ga0495626_0011488_3719_4450 | 243 |
| 103 | 3300048903 | Ga0496100_0026304 | Ga0496100_0026304_705_1436 | 243 |
| 104 | 3300048906 | Ga0496103_0405502 | Ga0496103_0405502_32_763 | 243 |
| 105 | 3300048908 | Ga0496105_0122864 | Ga0496105_0122864_601_1332 | 243 |
| 106 | 3300048909 | Ga0496106_0030116 | Ga0496106_0030116_696_1427 | 243 |
| 107 | 3300048910 | Ga0496107_0075472 | Ga0496107_0075472_92_823 | 243 |
| 108 | 3300048917 | Ga0496114_0096118 | Ga0496114_0096118_771_1502 | 243 |
| 109 | 3300048929 | Ga0496126_0225901 | Ga0496126_0225901_709_1440 | 243 |
| 110 | 3300049568 | Ga0501031_0020689 | Ga0501031_0020689_1090_1821 | 243 |
| 111 | 3300049570 | Ga0501033_0008191 | Ga0501033_0008191_6549_7280 | 243 |
| 112 | 3300049571 | Ga0501034_0154875 | Ga0501034_0154875_1127_1858 | 243 |
| 113 | 3300049572 | Ga0501036_0000484 | Ga0501036_0000484_8423_9154 | 243 |
| 114 | 3300049572 | Ga0501036_0173451 | Ga0501036_0173451_739_1470 | 243 |
| 115 | 3300049573 | Ga0501037_0001076 | Ga0501037_0001076_768_1499 | 243 |
| 116 | 3300049573 | Ga0501037_0315923 | Ga0501037_0315923_12_743 | 243 |
| 117 | 3300049574 | Ga0501038_0009984 | Ga0501038_0009984_368_1099 | 243 |
| 118 | 3300049574 | Ga0501038_0013559 | Ga0501038_0013559_4147_4878 | 243 |
| 119 | 3300049574 | Ga0501038_0017565 | Ga0501038_0017565_2414_3145 | 243 |
| 120 | 3300049575 | Ga0501039_0026382 | Ga0501039_0026382_3325_4056 | 243 |
| 121 | 3300049581 | Ga0501047_0020371 | Ga0501047_0020371_5033_5764 | 243 |
| 122 | 3300049581 | Ga0501047_0067479 | Ga0501047_0067479_2409_3140 | 243 |
| 123 | 3300049584 | Ga0501068_0007074 | Ga0501068_0007074_1116_1847 | 243 |
| 124 | 3300049588 | Ga0501072_0401611 | Ga0501072_0401611_270_1004 | 243 |
| 125 | 3300049822 | Ga0501035_0006430 | Ga0501035_0006430_4524_5255 | 243 |
| 126 | 3300049823 | Ga0501044_0000066 | Ga0501044_0000066_88311_89042 | 243 |
| 127 | 3300049823 | Ga0501044_0019977 | Ga0501044_0019977_3072_3803 | 243 |
| 128 | 3300049823 | Ga0501044_0244029 | Ga0501044_0244029_95_826 | 243 |
| 129 | 3300049824 | Ga0501045_0027707 | Ga0501045_0027707_849_1580 | 243 |
| 130 | 3300050492 | nmdc:mga0yw44_34389_c1 | nmdc:mga0yw44_34389_c1_790_1521 | 243 |
| 131 | 3300050493 | nmdc:mga0k408_42919_c1 | nmdc:mga0k408_42919_c1_656_1387 | 243 |
| 132 | 3300050495 | nmdc:mga04h51_3065_c1 | nmdc:mga04h51_3065_c1_1881_2612 | 243 |
| 133 | 3300050496 | nmdc:mga07m45_91940_c1 | nmdc:mga07m45_91940_c1_512_1243 | 243 |
| 134 | 3300053077 | Ga0495601_0033773 | Ga0495601_0033773_2402_3133 | 243 |
| 135 | 3300002705 | JGI25156J39149_1000267 | JGI25156J39149_100026712 | 244 |
| 136 | 3300002705 | JGI25156J39149_1002692 | JGI25156J39149_10026925 | 244 |
| 137 | 3300002737 | JGI25162J39368_1000040 | JGI25162J39368_1000040155 | 244 |
| 138 | 3300002737 | JGI25162J39368_1006805 | JGI25162J39368_10068052 | 244 |
| 139 | 3300002738 | JGI25154J39366_1000739 | JGI25154J39366_10007394 | 244 |
| 140 | 3300002738 | JGI25154J39366_1002155 | JGI25154J39366_10021555 | 244 |
| 141 | 3300002739 | JGI25158J39367_1014308 | JGI25158J39367_10143082 | 244 |
| 142 | 3300002741 | JGI25157J39369_1000372 | JGI25157J39369_100037219 | 244 |
| 143 | 3300002741 | JGI25157J39369_1000495 | JGI25157J39369_100049513 | 244 |
| 144 | 3300002771 | JGI25163J39215_1004713 | JGI25163J39215_10047131 | 244 |
| 145 | 3300002773 | JGI25152J39213_1003789 | JGI25152J39213_10037896 | 244 |
| 146 | 3300002987 | JGI25159J45721_1003356 | JGI25159J45721_10033567 | 244 |
| 147 | 3300002987 | JGI25159J45721_1010497 | JGI25159J45721_10104972 | 244 |
| 148 | 3300002987 | JGI25159J45721_1024725 | JGI25159J45721_10247251 | 244 |
| 149 | 3300003214 | JGI25165J46597_1000051 | JGI25165J46597_100005144 | 244 |
| 150 | 3300003215 | JGI25153J46596_10003428 | JGI25153J46596_100034288 | 244 |
| 151 | 3300003354 | JGI25160J50197_1017779 | JGI25160J50197_10177792 | 244 |
| 152 | 3300003374 | JGI25161J50226_1001939 | JGI25161J50226_10019397 | 244 |
| 153 | 3300003374 | JGI25161J50226_1011958 | JGI25161J50226_10119582 | 244 |
| 154 | 3300003693 | Ga0032354_1037465 | Ga0032354_10374651 | 244 |
| 155 | 3300003751 | Ga0055538_1000025 | Ga0055538_1000025189 | 244 |
| 156 | 3300003751 | Ga0055538_1000062 | Ga0055538_100006275 | 244 |
| 157 | 3300003752 | Ga0055539_1000032 | Ga0055539_100003244 | 244 |
| 158 | 3300003752 | Ga0055539_1000093 | Ga0055539_100009375 | 244 |
| 159 | 3300003756 | Ga0055533_1000042 | Ga0055533_1000042189 | 244 |
| 160 | 3300003756 | Ga0055533_1000105 | Ga0055533_100010575 | 244 |
| 161 | 3300003758 | Ga0055532_1000034 | Ga0055532_100003419 | 244 |
| 162 | 3300003759 | Ga0055525_1000018 | Ga0055525_1000018225 | 244 |
| 163 | 3300003759 | Ga0055525_1000050 | Ga0055525_1000050189 | 244 |
| 164 | 3300003759 | Ga0055525_1000137 | Ga0055525_100013775 | 244 |
| 165 | 3300003761 | Ga0055535_1003795 | Ga0055535_10037954 | 244 |
| 166 | 3300003762 | Ga0055542_1004530 | Ga0055542_10045303 | 244 |
| 167 | 3300003771 | Ga0055526_1000045 | Ga0055526_100004586 | 244 |
| 168 | 3300003771 | Ga0055526_1000481 | Ga0055526_100048129 | 244 |
| 169 | 3300003771 | Ga0055526_1002752 | Ga0055526_10027526 | 244 |
| 170 | 3300003771 | Ga0055526_1009931 | Ga0055526_10099312 | 244 |
| 171 | 3300003773 | Ga0055537_1000626 | Ga0055537_100062615 | 244 |
| 172 | 3300003773 | Ga0055537_1003160 | Ga0055537_10031605 | 244 |
| 173 | 3300003775 | Ga0055524_1000024 | Ga0055524_100002495 | 244 |
| 174 | 3300003775 | Ga0055524_1006833 | Ga0055524_10068331 | 244 |
| 175 | 3300003775 | Ga0055524_1013987 | Ga0055524_10139872 | 244 |
| 176 | 3300003775 | Ga0055524_1018011 | Ga0055524_10180115 | 244 |
| 177 | 3300003784 | Ga0055534_1000557 | Ga0055534_10005578 | 244 |
| 178 | 3300003790 | Ga0055528_1000252 | Ga0055528_10002528 | 244 |
| 179 | 3300003790 | Ga0055528_1011419 | Ga0055528_10114197 | 244 |
| 180 | 3300003841 | Ga0055541_1000023 | Ga0055541_1000023188 | 244 |
| 181 | 3300003841 | Ga0055541_1000063 | Ga0055541_100006375 | 244 |
| 182 | 3300004625 | Ga0055543_1002659 | Ga0055543_10026591 | 244 |
| 183 | 3300005262 | Ga0065165_1000379 | Ga0065165_100037918 | 244 |
| 184 | 3300005262 | Ga0065165_1000936 | Ga0065165_100093630 | 244 |
| 185 | 3300005262 | Ga0065165_1006940 | Ga0065165_10069401 | 244 |
| 186 | 3300005293 | Ga0065715_10361477 | Ga0065715_103614771 | 244 |
| 187 | 3300005327 | Ga0070658_10065716 | Ga0070658_100657161 | 244 |
| 188 | 3300005327 | Ga0070658_10114609 | Ga0070658_101146092 | 244 |
| 189 | 3300005331 | Ga0070670_100084312 | Ga0070670_1000843124 | 244 |
| 190 | 3300005339 | Ga0070660_100003755 | Ga0070660_1000037557 | 244 |
| 191 | 3300005339 | Ga0070660_100061598 | Ga0070660_1000615982 | 244 |
| 192 | 3300005344 | Ga0070661_100005481 | Ga0070661_1000054818 | 244 |
| 193 | 3300005366 | Ga0070659_100001965 | Ga0070659_1000019657 | 244 |
| 194 | 3300005435 | Ga0070714_100029472 | Ga0070714_1000294723 | 244 |
| 195 | 3300005455 | Ga0070663_100239210 | Ga0070663_1002392101 | 244 |
| 196 | 3300005457 | Ga0070662_100175405 | Ga0070662_1001754052 | 244 |
| 197 | 3300005467 | Ga0070706_100057979 | Ga0070706_1000579794 | 244 |
| 198 | 3300005536 | Ga0070697_100702760 | Ga0070697_1007027601 | 244 |
| 199 | 3300005563 | Ga0068855_100102548 | Ga0068855_1001025484 | 244 |
| 200 | 3300005563 | Ga0068855_100560194 | Ga0068855_1005601942 | 244 |
| 201 | 3300005564 | Ga0070664_100078682 | Ga0070664_1000786822 | 244 |
| 202 | 3300005564 | Ga0070664_100290271 | Ga0070664_1002902712 | 244 |
| 203 | 3300005564 | Ga0070664_100547781 | Ga0070664_1005477811 | 244 |
| 204 | 3300005577 | Ga0068857_100086731 | Ga0068857_1000867312 | 244 |
| 205 | 3300005578 | Ga0068854_100064390 | Ga0068854_1000643902 | 244 |
| 206 | 3300005578 | Ga0068854_100667834 | Ga0068854_1006678341 | 244 |
| 207 | 3300005616 | Ga0068852_100031182 | Ga0068852_1000311824 | 244 |
| 208 | 3300005834 | Ga0068851_10102682 | Ga0068851_101026822 | 244 |
| 209 | 3300006028 | Ga0070717_10035845 | Ga0070717_100358454 | 244 |
| 210 | 3300006852 | Ga0075433_10553656 | Ga0075433_105536561 | 244 |
| 211 | 3300006871 | Ga0075434_100048649 | Ga0075434_1000486493 | 244 |
| 212 | 3300006948 | Ga0099826_10000010 | Ga0099826_10000010164 | 244 |
| 213 | 3300009036 | Ga0105244_10000639 | Ga0105244_1000063910 | 244 |
| 214 | 3300009036 | Ga0105244_10002229 | Ga0105244_100022298 | 244 |
| 215 | 3300009036 | Ga0105244_10014131 | Ga0105244_100141312 | 244 |
| 216 | 3300009093 | Ga0105240_10001608 | Ga0105240_1000160821 | 244 |
| 217 | 3300009093 | Ga0105240_10026829 | Ga0105240_100268295 | 244 |
| 218 | 3300009093 | Ga0105240_10043423 | Ga0105240_100434235 | 244 |
| 219 | 3300009098 | Ga0105245_10077129 | Ga0105245_100771292 | 244 |
| 220 | 3300009148 | Ga0105243_10007642 | Ga0105243_100076424 | 244 |
| 221 | 3300009545 | Ga0105237_10096738 | Ga0105237_100967383 | 244 |
| 222 | 3300009551 | Ga0105238_10000763 | Ga0105238_1000076318 | 244 |
| 223 | 3300009551 | Ga0105238_10061370 | Ga0105238_100613702 | 244 |
| 224 | 3300010375 | Ga0105239_10009911 | Ga0105239_100099114 | 244 |
| 225 | 3300010375 | Ga0105239_10195939 | Ga0105239_101959392 | 244 |
| 226 | 3300010375 | Ga0105239_10407477 | Ga0105239_104074772 | 244 |
| 227 | 3300010375 | Ga0105239_11222117 | Ga0105239_112221171 | 244 |
| 228 | 3300011119 | Ga0105246_10181268 | Ga0105246_101812683 | 244 |
| 229 | 3300013100 | Ga0157373_10199167 | Ga0157373_101991671 | 244 |
| 230 | 3300013105 | Ga0157369_10354798 | Ga0157369_103547981 | 244 |
| 231 | 3300013306 | Ga0163162_10049541 | Ga0163162_100495414 | 244 |
| 232 | 3300013307 | Ga0157372_11507295 | Ga0157372_115072951 | 244 |
| 233 | 3300014497 | Ga0182008_10004382 | Ga0182008_100043822 | 244 |
| 234 | 3300014497 | Ga0182008_10005360 | Ga0182008_100053603 | 244 |
| 235 | 3300014497 | Ga0182008_10044122 | Ga0182008_100441224 | 244 |
| 236 | 3300015261 | Ga0182006_1000033 | Ga0182006_1000033169 | 244 |
| 237 | 3300015261 | Ga0182006_1000141 | Ga0182006_100014167 | 244 |
| 238 | 3300015261 | Ga0182006_1008100 | Ga0182006_10081004 | 244 |
| 239 | 3300015261 | Ga0182006_1027033 | Ga0182006_10270332 | 244 |
| 240 | 3300015261 | Ga0182006_1030859 | Ga0182006_10308592 | 244 |
| 241 | 3300015262 | Ga0182007_10001557 | Ga0182007_100015578 | 244 |
| 242 | 3300015262 | Ga0182007_10026404 | Ga0182007_100264042 | 244 |
| 243 | 3300015265 | Ga0182005_1000016 | Ga0182005_1000016190 | 244 |
| 244 | 3300015265 | Ga0182005_1000024 | Ga0182005_100002453 | 244 |
| 245 | 3300015265 | Ga0182005_1001902 | Ga0182005_10019026 | 244 |
| 246 | 3300017792 | Ga0163161_10015922 | Ga0163161_100159224 | 244 |
| 247 | 3300017792 | Ga0163161_10025047 | Ga0163161_100250476 | 244 |
| 248 | 3300020077 | Ga0206351_10464379 | Ga0206351_104643791 | 244 |
| 249 | 3300021361 | Ga0213872_10000005 | Ga0213872_10000005104 | 244 |
| 250 | 3300021361 | Ga0213872_10001171 | Ga0213872_1000117113 | 244 |
| 251 | 3300021361 | Ga0213872_10002039 | Ga0213872_1000203910 | 244 |
| 252 | 3300021361 | Ga0213872_10007513 | Ga0213872_100075133 | 244 |
| 253 | 3300021361 | Ga0213872_10010335 | Ga0213872_100103354 | 244 |
| 254 | 3300021361 | Ga0213872_10021029 | Ga0213872_100210293 | 244 |
| 255 | 3300025206 | Ga0209435_100007 | Ga0209435_10000719 | 244 |
| 256 | 3300025206 | Ga0209435_100176 | Ga0209435_10017611 | 244 |
| 257 | 3300025208 | Ga0209436_100287 | Ga0209436_1002878 | 244 |
| 258 | 3300025208 | Ga0209436_102115 | Ga0209436_1021151 | 244 |
| 259 | 3300025224 | Ga0209784_100010 | Ga0209784_100010567 | 244 |
| 260 | 3300025224 | Ga0209784_100021 | Ga0209784_100021365 | 244 |
| 261 | 3300025225 | Ga0209566_100008 | Ga0209566_100008567 | 244 |
| 262 | 3300025225 | Ga0209566_100119 | Ga0209566_10011917 | 244 |
| 263 | 3300025226 | Ga0209674_100019 | Ga0209674_100019567 | 244 |
| 264 | 3300025226 | Ga0209674_100036 | Ga0209674_100036365 | 244 |
| 265 | 3300025229 | Ga0209147_100017 | Ga0209147_100017453 | 244 |
| 266 | 3300025230 | Ga0209563_100011 | Ga0209563_100011866 | 244 |
| 267 | 3300025230 | Ga0209563_100021 | Ga0209563_100021567 | 244 |
| 268 | 3300025230 | Ga0209563_100040 | Ga0209563_100040365 | 244 |
| 269 | 3300025231 | Ga0207427_102072 | Ga0207427_1020722 | 244 |
| 270 | 3300025233 | Ga0209437_100019 | Ga0209437_100019567 | 244 |
| 271 | 3300025233 | Ga0209437_100332 | Ga0209437_10033219 | 244 |
| 272 | 3300025242 | Ga0209258_100115 | Ga0209258_1001158 | 244 |
| 273 | 3300025245 | Ga0207425_1000021 | Ga0207425_1000021120 | 244 |
| 274 | 3300025245 | Ga0207425_1000170 | Ga0207425_100017026 | 244 |
| 275 | 3300025245 | Ga0207425_1002098 | Ga0207425_10020982 | 244 |
| 276 | 3300025246 | Ga0209646_1000044 | Ga0209646_1000044294 | 244 |
| 277 | 3300025246 | Ga0209646_1000068 | Ga0209646_1000068124 | 244 |
| 278 | 3300025246 | Ga0209646_1000107 | Ga0209646_1000107129 | 244 |
| 279 | 3300025250 | Ga0209026_1000063 | Ga0209026_100006319 | 244 |
| 280 | 3300025250 | Ga0209026_1002108 | Ga0209026_10021085 | 244 |
| 281 | 3300025250 | Ga0209026_1008584 | Ga0209026_10085842 | 244 |
| 282 | 3300025253 | Ga0209677_100011 | Ga0209677_100011567 | 244 |
| 283 | 3300025253 | Ga0209677_100023 | Ga0209677_100023365 | 244 |
| 284 | 3300025253 | Ga0209677_102948 | Ga0209677_1029484 | 244 |
| 285 | 3300025254 | Ga0209148_1001117 | Ga0209148_100111713 | 244 |
| 286 | 3300025256 | Ga0209759_1000048 | Ga0209759_100004819 | 244 |
| 287 | 3300025256 | Ga0209759_1000198 | Ga0209759_100019873 | 244 |
| 288 | 3300025258 | Ga0209129_1000020 | Ga0209129_1000020191 | 244 |
| 289 | 3300025258 | Ga0209129_1004970 | Ga0209129_10049704 | 244 |
| 290 | 3300025258 | Ga0209129_1023052 | Ga0209129_10230522 | 244 |
| 291 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025567 | 244 |
| 292 | 3300025261 | Ga0209233_1051831 | Ga0209233_10518311 | 244 |
| 293 | 3300025263 | Ga0209565_1000123 | Ga0209565_100012316 | 244 |
| 294 | 3300025263 | Ga0209565_1000632 | Ga0209565_10006326 | 244 |
| 295 | 3300025263 | Ga0209565_1000689 | Ga0209565_100068920 | 244 |
| 296 | 3300025263 | Ga0209565_1011339 | Ga0209565_10113392 | 244 |
| 297 | 3300025263 | Ga0209565_1023449 | Ga0209565_10234492 | 244 |
| 298 | 3300025272 | Ga0209455_1000070 | Ga0209455_1000070166 | 244 |
| 299 | 3300025272 | Ga0209455_1001196 | Ga0209455_10011969 | 244 |
| 300 | 3300025273 | Ga0209673_1000040 | Ga0209673_1000040204 | 244 |
| 301 | 3300025273 | Ga0209673_1008854 | Ga0209673_10088542 | 244 |
| 302 | 3300025284 | Ga0209130_1000589 | Ga0209130_100058930 | 244 |
| 303 | 3300025284 | Ga0209130_1002447 | Ga0209130_10024476 | 244 |
| 304 | 3300025284 | Ga0209130_1003581 | Ga0209130_10035812 | 244 |
| 305 | 3300025291 | Ga0209675_1000117 | Ga0209675_100011789 | 244 |
| 306 | 3300025291 | Ga0209675_1000567 | Ga0209675_100056721 | 244 |
| 307 | 3300025295 | Ga0209564_1000027 | Ga0209564_1000027229 | 244 |
| 308 | 3300025295 | Ga0209564_1000047 | Ga0209564_1000047134 | 244 |
| 309 | 3300025295 | Ga0209564_1000063 | Ga0209564_1000063253 | 244 |
| 310 | 3300025295 | Ga0209564_1000121 | Ga0209564_100012199 | 244 |
| 311 | 3300025295 | Ga0209564_1001500 | Ga0209564_10015008 | 244 |
| 312 | 3300025295 | Ga0209564_1024695 | Ga0209564_10246952 | 244 |
| 313 | 3300025297 | Ga0209758_1000077 | Ga0209758_1000077144 | 244 |
| 314 | 3300025297 | Ga0209758_1000394 | Ga0209758_100039441 | 244 |
| 315 | 3300025298 | Ga0209050_1000050 | Ga0209050_1000050126 | 244 |
| 316 | 3300025298 | Ga0209050_1001569 | Ga0209050_10015698 | 244 |
| 317 | 3300025299 | Ga0209256_1000054 | Ga0209256_1000054157 | 244 |
| 318 | 3300025299 | Ga0209256_1000288 | Ga0209256_100028870 | 244 |
| 319 | 3300025299 | Ga0209256_1001035 | Ga0209256_10010355 | 244 |
| 320 | 3300025299 | Ga0209256_1001444 | Ga0209256_10014448 | 244 |
| 321 | 3300025299 | Ga0209256_1001988 | Ga0209256_100198820 | 244 |
| 322 | 3300025302 | Ga0207426_1000956 | Ga0207426_100095611 | 244 |
| 323 | 3300025304 | Ga0209257_1000075 | Ga0209257_1000075126 | 244 |
| 324 | 3300025728 | Ga0207655_1004059 | Ga0207655_100405911 | 244 |
| 325 | 3300025728 | Ga0207655_1014363 | Ga0207655_10143633 | 244 |
| 326 | 3300025909 | Ga0207705_10060456 | Ga0207705_100604562 | 244 |
| 327 | 3300025910 | Ga0207684_10035065 | Ga0207684_100350653 | 244 |
| 328 | 3300025912 | Ga0207707_10141988 | Ga0207707_101419882 | 244 |
| 329 | 3300025913 | Ga0207695_10003613 | Ga0207695_1000361313 | 244 |
| 330 | 3300025913 | Ga0207695_10004696 | Ga0207695_100046964 | 244 |
| 331 | 3300025913 | Ga0207695_10019466 | Ga0207695_100194665 | 244 |
| 332 | 3300025914 | Ga0207671_10043537 | Ga0207671_100435372 | 244 |
| 333 | 3300025917 | Ga0207660_10172548 | Ga0207660_101725482 | 244 |
| 334 | 3300025919 | Ga0207657_10005929 | Ga0207657_100059295 | 244 |
| 335 | 3300025919 | Ga0207657_10014161 | Ga0207657_100141619 | 244 |
| 336 | 3300025919 | Ga0207657_10046922 | Ga0207657_100469222 | 244 |
| 337 | 3300025920 | Ga0207649_10072113 | Ga0207649_100721133 | 244 |
| 338 | 3300025924 | Ga0207694_10000343 | Ga0207694_1000034311 | 244 |
| 339 | 3300025924 | Ga0207694_10193957 | Ga0207694_101939572 | 244 |
| 340 | 3300025928 | Ga0207700_10761438 | Ga0207700_107614382 | 244 |
| 341 | 3300025929 | Ga0207664_10011629 | Ga0207664_100116294 | 244 |
| 342 | 3300025932 | Ga0207690_10001518 | Ga0207690_100015188 | 244 |
| 343 | 3300025932 | Ga0207690_10189335 | Ga0207690_101893352 | 244 |
| 344 | 3300025933 | Ga0207706_10088647 | Ga0207706_100886475 | 244 |
| 345 | 3300025933 | Ga0207706_10283716 | Ga0207706_102837162 | 244 |
| 346 | 3300025935 | Ga0207709_10018345 | Ga0207709_100183453 | 244 |
| 347 | 3300025937 | Ga0207669_10123372 | Ga0207669_101233723 | 244 |
| 348 | 3300025945 | Ga0207679_10010792 | Ga0207679_100107924 | 244 |
| 349 | 3300025945 | Ga0207679_10014950 | Ga0207679_100149504 | 244 |
| 350 | 3300025949 | Ga0207667_10000912 | Ga0207667_1000091218 | 244 |
| 351 | 3300025949 | Ga0207667_10007366 | Ga0207667_1000736611 | 244 |
| 352 | 3300025949 | Ga0207667_10011221 | Ga0207667_100112218 | 244 |
| 353 | 3300025981 | Ga0207640_10044348 | Ga0207640_100443482 | 244 |
| 354 | 3300025981 | Ga0207640_10568425 | Ga0207640_105684252 | 244 |
| 355 | 3300026067 | Ga0207678_10097937 | Ga0207678_100979371 | 244 |
| 356 | 3300026142 | Ga0207698_10009503 | Ga0207698_100095034 | 244 |
| 357 | 3300027111 | Ga0209281_1008759 | Ga0209281_10087592 | 244 |
| 358 | 3300027666 | Ga0209282_1000009 | Ga0209282_1000009163 | 244 |
| 359 | 3300030735 | Ga0316178_1035927 | Ga0316178_10359272 | 244 |
| 360 | 3300030745 | Ga0316182_1261839 | Ga0316182_12618392 | 244 |
| 361 | 3300031238 | Ga0265332_10000026 | Ga0265332_10000026115 | 244 |
| 362 | 3300031548 | Ga0307408_100001156 | Ga0307408_10000115612 | 244 |
| 363 | 3300031548 | Ga0307408_100001884 | Ga0307408_1000018847 | 244 |
| 364 | 3300031548 | Ga0307408_100011848 | Ga0307408_1000118484 | 244 |
| 365 | 3300031548 | Ga0307408_100261484 | Ga0307408_1002614842 | 244 |
| 366 | 3300031548 | Ga0307408_100537858 | Ga0307408_1005378582 | 244 |
| 367 | 3300031711 | Ga0265314_10138880 | Ga0265314_101388802 | 244 |
| 368 | 3300032002 | Ga0307416_100010124 | Ga0307416_1000101242 | 244 |
| 369 | 3300032002 | Ga0307416_100373505 | Ga0307416_1003735051 | 244 |
| 370 | 3300032004 | Ga0307414_10205232 | Ga0307414_102052322 | 244 |
| 371 | 3300035691 | Ga0373931_0177872 | Ga0373931_0177872_190_924 | 244 |
| 372 | 3300035692 | Ga0373935_0356469 | Ga0373935_0356469_108_842 | 244 |
| 373 | 3300036401 | Ga0373937_0902321 | Ga0373937_0902321_40_774 | 244 |
| 374 | 3300037312 | Ga0395899_0000386 | Ga0395899_0000386_48305_49039 | 244 |
| 375 | 3300037312 | Ga0395899_0011613 | Ga0395899_0011613_1980_2714 | 244 |
| 376 | 3300037312 | Ga0395899_0015194 | Ga0395899_0015194_4325_5059 | 244 |
| 377 | 3300037312 | Ga0395899_0037924 | Ga0395899_0037924_2087_2821 | 244 |
| 378 | 3300037418 | Ga0395900_0000715 | Ga0395900_0000715_34565_35299 | 244 |
| 379 | 3300037418 | Ga0395900_0001341 | Ga0395900_0001341_21188_21922 | 244 |
| 380 | 3300037418 | Ga0395900_0048659 | Ga0395900_0048659_735_1469 | 244 |
| 381 | 3300037418 | Ga0395900_0055574 | Ga0395900_0055574_1750_2484 | 244 |
| 382 | 3300037418 | Ga0395900_0087488 | Ga0395900_0087488_2114_2848 | 244 |
| 383 | 3300037418 | Ga0395900_0113741 | Ga0395900_0113741_1949_2683 | 244 |
| 384 | 3300037418 | Ga0395900_0172432 | Ga0395900_0172432_959_1693 | 244 |
| 385 | 3300037418 | Ga0395900_0357081 | Ga0395900_0357081_379_1113 | 244 |
| 386 | 3300037466 | Ga0395898_0007625 | Ga0395898_0007625_3669_4403 | 244 |
| 387 | 3300037466 | Ga0395898_0065139 | Ga0395898_0065139_2339_3073 | 244 |
| 388 | 3300037466 | Ga0395898_0777034 | Ga0395898_0777034_77_811 | 244 |
| 389 | 3300037471 | Ga0395905_0000242 | Ga0395905_0000242_39169_39951 | 244 |
| 390 | 3300037471 | Ga0395905_0081547 | Ga0395905_0081547_891_1625 | 244 |
| 391 | 3300037471 | Ga0395905_0276633 | Ga0395905_0276633_292_1026 | 244 |
| 392 | 3300037471 | Ga0395905_0461668 | Ga0395905_0461668_323_1057 | 244 |
| 393 | 3300037471 | Ga0395905_0463854 | Ga0395905_0463854_67_801 | 244 |
| 394 | 3300037471 | Ga0395905_0624659 | Ga0395905_0624659_137_871 | 244 |
| 395 | 3300037471 | Ga0395905_0775665 | Ga0395905_0775665_36_770 | 244 |
| 396 | 3300038443 | Ga0395901_0000943 | Ga0395901_0000943_13240_13974 | 244 |
| 397 | 3300038443 | Ga0395901_0005142 | Ga0395901_0005142_4959_5693 | 244 |
| 398 | 3300038443 | Ga0395901_0147921 | Ga0395901_0147921_173_907 | 244 |
| 399 | 3300038443 | Ga0395901_0151300 | Ga0395901_0151300_1242_1976 | 244 |
| 400 | 3300039447 | Ga0436361_0042090 | Ga0436361_0042090_1195_1929 | 244 |
| 401 | 3300039447 | Ga0436361_0089100 | Ga0436361_0089100_7914_8648 | 244 |
| 402 | 3300039447 | Ga0436361_0089479 | Ga0436361_0089479_46986_47720 | 244 |
| 403 | 3300039447 | Ga0436361_0303014 | Ga0436361_0303014_13030_13764 | 244 |
| 404 | 3300039447 | Ga0436361_0531483 | Ga0436361_0531483_2199_2933 | 244 |
| 405 | 3300039447 | Ga0436361_0675827 | Ga0436361_0675827_120_854 | 244 |
| 406 | 3300039447 | Ga0436361_0832413 | Ga0436361_0832413_2292_3026 | 244 |
| 407 | 3300039447 | Ga0436361_1218785 | Ga0436361_1218785_45913_46647 | 244 |
| 408 | 3300041509 | Ga0451843_1691138 | Ga0451843_1691138_1357_2094 | 244 |
| 409 | 3300042002 | Ga0439442_032513 | Ga0439442_032513_340_1074 | 244 |
| 410 | 3300042005 | Ga0439448_0000099 | Ga0439448_0000099_8575_9309 | 244 |
| 411 | 3300042007 | Ga0439449_0033446 | Ga0439449_0033446_746_1480 | 244 |
| 412 | 3300042008 | Ga0439450_002360 | Ga0439450_002360_986_1720 | 244 |
| 413 | 3300042139 | Ga0450904_001458 | Ga0450904_001458_94_828 | 244 |
| 414 | 3300042876 | Ga0451577_0500264 | Ga0451577_0500264_31_765 | 244 |
| 415 | 3300044656 | Ga0466969_0034753 | Ga0466969_0034753_1043_1777 | 244 |
| 416 | 3300044656 | Ga0466969_0051856 | Ga0466969_0051856_1157_1891 | 244 |
| 417 | 3300044658 | Ga0466972_0000359 | Ga0466972_0000359_20266_21000 | 244 |
| 418 | 3300044658 | Ga0466972_0016650 | Ga0466972_0016650_1102_1836 | 244 |
| 419 | 3300044683 | Ga0466965_0024588 | Ga0466965_0024588_1801_2535 | 244 |
| 420 | 3300044683 | Ga0466965_0026547 | Ga0466965_0026547_28_762 | 244 |
| 421 | 3300044683 | Ga0466965_0041682 | Ga0466965_0041682_707_1441 | 244 |
| 422 | 3300044683 | Ga0466965_0164028 | Ga0466965_0164028_199_933 | 244 |
| 423 | 3300044684 | Ga0466966_0005044 | Ga0466966_0005044_2286_3020 | 244 |
| 424 | 3300044684 | Ga0466966_0025197 | Ga0466966_0025197_2649_3383 | 244 |
| 425 | 3300044693 | Ga0466961_0006689 | Ga0466961_0006689_2701_3435 | 244 |
| 426 | 3300044693 | Ga0466961_0107351 | Ga0466961_0107351_671_1405 | 244 |
| 427 | 3300044694 | Ga0466963_0022166 | Ga0466963_0022166_2309_3043 | 244 |
| 428 | 3300044706 | Ga0466964_0000517 | Ga0466964_0000517_5704_6438 | 244 |
| 429 | 3300044706 | Ga0466964_0003220 | Ga0466964_0003220_1332_2066 | 244 |
| 430 | 3300044706 | Ga0466964_0004695 | Ga0466964_0004695_3543_4277 | 244 |
| 431 | 3300044706 | Ga0466964_0023589 | Ga0466964_0023589_975_1751 | 244 |
| 432 | 3300044712 | Ga0453684_0029140 | Ga0453684_0029140_5200_5937 | 244 |
| 433 | 3300044719 | Ga0466971_0087119 | Ga0466971_0087119_451_1185 | 244 |
| 434 | 3300044719 | Ga0466971_0206999 | Ga0466971_0206999_65_799 | 244 |
| 435 | 3300044735 | Ga0466968_0000899 | Ga0466968_0000899_4218_4952 | 244 |
| 436 | 3300044735 | Ga0466968_0005369 | Ga0466968_0005369_1946_2680 | 244 |
| 437 | 3300044735 | Ga0466968_0050008 | Ga0466968_0050008_931_1665 | 244 |
| 438 | 3300044765 | Ga0466970_0061050 | Ga0466970_0061050_979_1713 | 244 |
| 439 | 3300044842 | Ga0466957_0002970 | Ga0466957_0002970_5097_5831 | 244 |
| 440 | 3300044842 | Ga0466957_0206142 | Ga0466957_0206142_279_1013 | 244 |
| 441 | 3300044842 | Ga0466957_0232654 | Ga0466957_0232654_53_787 | 244 |
| 442 | 3300045049 | Ga0466959_0006393 | Ga0466959_0006393_6232_6966 | 244 |
| 443 | 3300045049 | Ga0466959_0016513 | Ga0466959_0016513_2322_3056 | 244 |
| 444 | 3300045049 | Ga0466959_0086836 | Ga0466959_0086836_1011_1745 | 244 |
| 445 | 3300045049 | Ga0466959_0125723 | Ga0466959_0125723_389_1123 | 244 |
| 446 | 3300045049 | Ga0466959_0181562 | Ga0466959_0181562_238_972 | 244 |
| 447 | 3300045049 | Ga0466959_0315335 | Ga0466959_0315335_30_764 | 244 |
| 448 | 3300045051 | Ga0451576_0198517 | Ga0451576_0198517_106_843 | 244 |
| 449 | 3300045836 | Ga0466958_0066239 | Ga0466958_0066239_98_832 | 244 |
| 450 | 3300045976 | Ga0466967_0017377 | Ga0466967_0017377_1357_2091 | 244 |
| 451 | 3300046452 | Ga0495617_000027 | Ga0495617_000027_142665_143399 | 244 |
| 452 | 3300046452 | Ga0495617_000466 | Ga0495617_000466_15008_15742 | 244 |
| 453 | 3300046452 | Ga0495617_002660 | Ga0495617_002660_2642_3376 | 244 |
| 454 | 3300046453 | Ga0495627_000011 | Ga0495627_000011_232456_233190 | 244 |
| 455 | 3300046453 | Ga0495627_000277 | Ga0495627_000277_2706_3440 | 244 |
| 456 | 3300046453 | Ga0495627_002842 | Ga0495627_002842_1333_2067 | 244 |
| 457 | 3300046453 | Ga0495627_008570 | Ga0495627_008570_1737_2471 | 244 |
| 458 | 3300046453 | Ga0495627_020864 | Ga0495627_020864_106_840 | 244 |
| 459 | 3300046454 | Ga0495592_0036756 | Ga0495592_0036756_1999_2733 | 244 |
| 460 | 3300046455 | Ga0495603_0009876 | Ga0495603_0009876_2168_2902 | 244 |
| 461 | 3300046455 | Ga0495603_0025025 | Ga0495603_0025025_2478_3212 | 244 |
| 462 | 3300046455 | Ga0495603_0048475 | Ga0495603_0048475_1389_2123 | 244 |
| 463 | 3300046457 | Ga0495590_0000020 | Ga0495590_0000020_205558_206292 | 244 |
| 464 | 3300046457 | Ga0495590_0000544 | Ga0495590_0000544_3479_4213 | 244 |
| 465 | 3300046457 | Ga0495590_0015377 | Ga0495590_0015377_1881_2615 | 244 |
| 466 | 3300046457 | Ga0495590_0036439 | Ga0495590_0036439_643_1377 | 244 |
| 467 | 3300046458 | Ga0495591_000616 | Ga0495591_000616_12164_12898 | 244 |
| 468 | 3300046459 | Ga0495629_0014675 | Ga0495629_0014675_468_1202 | 244 |
| 469 | 3300046459 | Ga0495629_0036710 | Ga0495629_0036710_116_850 | 244 |
| 470 | 3300046460 | Ga0495638_0003336 | Ga0495638_0003336_6048_6782 | 244 |
| 471 | 3300046460 | Ga0495638_0004087 | Ga0495638_0004087_6905_7639 | 244 |
| 472 | 3300046460 | Ga0495638_0010020 | Ga0495638_0010020_5008_5742 | 244 |
| 473 | 3300046460 | Ga0495638_0063316 | Ga0495638_0063316_189_923 | 244 |
| 474 | 3300046460 | Ga0495638_0241892 | Ga0495638_0241892_157_891 | 244 |
| 475 | 3300046460 | Ga0495638_0318791 | Ga0495638_0318791_41_775 | 244 |
| 476 | 3300046462 | Ga0495651_0003918 | Ga0495651_0003918_4649_5383 | 244 |
| 477 | 3300046462 | Ga0495651_0287656 | Ga0495651_0287656_332_1066 | 244 |
| 478 | 3300046463 | Ga0495653_0000313 | Ga0495653_0000313_37819_38553 | 244 |
| 479 | 3300046463 | Ga0495653_0004554 | Ga0495653_0004554_9565_10299 | 244 |
| 480 | 3300046463 | Ga0495653_0040360 | Ga0495653_0040360_2025_2759 | 244 |
| 481 | 3300046463 | Ga0495653_0042162 | Ga0495653_0042162_471_1205 | 244 |
| 482 | 3300046471 | Ga0495650_0000251 | Ga0495650_0000251_50496_51230 | 244 |
| 483 | 3300046471 | Ga0495650_0000431 | Ga0495650_0000431_5789_6523 | 244 |
| 484 | 3300046471 | Ga0495650_0000582 | Ga0495650_0000582_45092_45826 | 244 |
| 485 | 3300046471 | Ga0495650_0002001 | Ga0495650_0002001_6111_6875 | 244 |
| 486 | 3300046471 | Ga0495650_0002200 | Ga0495650_0002200_6061_6795 | 244 |
| 487 | 3300046471 | Ga0495650_0002792 | Ga0495650_0002792_5655_6389 | 244 |
| 488 | 3300046471 | Ga0495650_0019731 | Ga0495650_0019731_2525_3259 | 244 |
| 489 | 3300046473 | Ga0495582_0083844 | Ga0495582_0083844_244_978 | 244 |
| 490 | 3300046474 | Ga0495605_0000061 | Ga0495605_0000061_6060_6830 | 244 |
| 491 | 3300046474 | Ga0495605_0000135 | Ga0495605_0000135_13915_14649 | 244 |
| 492 | 3300046474 | Ga0495605_0000287 | Ga0495605_0000287_53193_53927 | 244 |
| 493 | 3300046474 | Ga0495605_0003898 | Ga0495605_0003898_2753_3487 | 244 |
| 494 | 3300046474 | Ga0495605_0006784 | Ga0495605_0006784_888_1622 | 244 |
| 495 | 3300046474 | Ga0495605_0012293 | Ga0495605_0012293_1599_2333 | 244 |
| 496 | 3300046474 | Ga0495605_0017922 | Ga0495605_0017922_2383_3117 | 244 |
| 497 | 3300046474 | Ga0495605_0018104 | Ga0495605_0018104_2182_2916 | 244 |
| 498 | 3300046474 | Ga0495605_0018632 | Ga0495605_0018632_923_1657 | 244 |
| 499 | 3300046474 | Ga0495605_0028357 | Ga0495605_0028357_1858_2592 | 244 |
| 500 | 3300046474 | Ga0495605_0043047 | Ga0495605_0043047_204_938 | 244 |
| 501 | 3300046474 | Ga0495605_0200745 | Ga0495605_0200745_45_779 | 244 |
| 502 | 3300046491 | Ga0495584_0000005 | Ga0495584_0000005_94626_95360 | 244 |
| 503 | 3300046491 | Ga0495584_0001526 | Ga0495584_0001526_2940_3674 | 244 |
| 504 | 3300046491 | Ga0495584_0002496 | Ga0495584_0002496_2557_3291 | 244 |
| 505 | 3300046491 | Ga0495584_0003202 | Ga0495584_0003202_5577_6311 | 244 |
| 506 | 3300046491 | Ga0495584_0005016 | Ga0495584_0005016_2120_2854 | 244 |
| 507 | 3300046491 | Ga0495584_0008160 | Ga0495584_0008160_2040_2774 | 244 |
| 508 | 3300046491 | Ga0495584_0012854 | Ga0495584_0012854_899_1633 | 244 |
| 509 | 3300046491 | Ga0495584_0014909 | Ga0495584_0014909_1791_2525 | 244 |
| 510 | 3300046491 | Ga0495584_0041697 | Ga0495584_0041697_1386_2120 | 244 |
| 511 | 3300046491 | Ga0495584_0046583 | Ga0495584_0046583_1072_1806 | 244 |
| 512 | 3300046491 | Ga0495584_0159452 | Ga0495584_0159452_140_874 | 244 |
| 513 | 3300046492 | Ga0495585_0000238 | Ga0495585_0000238_50405_51139 | 244 |
| 514 | 3300046492 | Ga0495585_0000277 | Ga0495585_0000277_43799_44533 | 244 |
| 515 | 3300046492 | Ga0495585_0002047 | Ga0495585_0002047_7583_8317 | 244 |
| 516 | 3300046492 | Ga0495585_0005810 | Ga0495585_0005810_5072_5806 | 244 |
| 517 | 3300046492 | Ga0495585_0006567 | Ga0495585_0006567_2643_3377 | 244 |
| 518 | 3300046492 | Ga0495585_0007203 | Ga0495585_0007203_2855_3589 | 244 |
| 519 | 3300046492 | Ga0495585_0007306 | Ga0495585_0007306_4257_4991 | 244 |
| 520 | 3300046492 | Ga0495585_0007413 | Ga0495585_0007413_4153_4887 | 244 |
| 521 | 3300046492 | Ga0495585_0010334 | Ga0495585_0010334_2656_3390 | 244 |
| 522 | 3300046492 | Ga0495585_0013630 | Ga0495585_0013630_1797_2531 | 244 |
| 523 | 3300046492 | Ga0495585_0019262 | Ga0495585_0019262_1063_1797 | 244 |
| 524 | 3300046492 | Ga0495585_0026231 | Ga0495585_0026231_1195_1929 | 244 |
| 525 | 3300046492 | Ga0495585_0027620 | Ga0495585_0027620_1434_2168 | 244 |
| 526 | 3300046492 | Ga0495585_0051733 | Ga0495585_0051733_759_1493 | 244 |
| 527 | 3300046499 | Ga0495594_0002420 | Ga0495594_0002420_3279_4013 | 244 |
| 528 | 3300046499 | Ga0495594_0004751 | Ga0495594_0004751_1077_1811 | 244 |
| 529 | 3300046499 | Ga0495594_0007475 | Ga0495594_0007475_2251_2985 | 244 |
| 530 | 3300046499 | Ga0495594_0017449 | Ga0495594_0017449_2702_3436 | 244 |
| 531 | 3300046499 | Ga0495594_0019462 | Ga0495594_0019462_1346_2080 | 244 |
| 532 | 3300046499 | Ga0495594_0027947 | Ga0495594_0027947_170_904 | 244 |
| 533 | 3300046499 | Ga0495594_0195976 | Ga0495594_0195976_47_781 | 244 |
| 534 | 3300046499 | Ga0495594_0234190 | Ga0495594_0234190_53_787 | 244 |
| 535 | 3300046500 | Ga0495596_0002220 | Ga0495596_0002220_4799_5533 | 244 |
| 536 | 3300046500 | Ga0495596_0002744 | Ga0495596_0002744_7756_8490 | 244 |
| 537 | 3300046500 | Ga0495596_0003179 | Ga0495596_0003179_5871_6605 | 244 |
| 538 | 3300046500 | Ga0495596_0006538 | Ga0495596_0006538_29_763 | 244 |
| 539 | 3300046500 | Ga0495596_0009431 | Ga0495596_0009431_2456_3190 | 244 |
| 540 | 3300046500 | Ga0495596_0019527 | Ga0495596_0019527_1539_2273 | 244 |
| 541 | 3300046500 | Ga0495596_0031673 | Ga0495596_0031673_484_1218 | 244 |
| 542 | 3300046501 | Ga0495607_0003003 | Ga0495607_0003003_4909_5643 | 244 |
| 543 | 3300046501 | Ga0495607_0003245 | Ga0495607_0003245_10395_11129 | 244 |
| 544 | 3300046501 | Ga0495607_0006203 | Ga0495607_0006203_5817_6551 | 244 |
| 545 | 3300046501 | Ga0495607_0010786 | Ga0495607_0010786_2607_3341 | 244 |
| 546 | 3300046501 | Ga0495607_0013867 | Ga0495607_0013867_1816_2550 | 244 |
| 547 | 3300046501 | Ga0495607_0016351 | Ga0495607_0016351_2788_3522 | 244 |
| 548 | 3300046501 | Ga0495607_0033727 | Ga0495607_0033727_1461_2195 | 244 |
| 549 | 3300046501 | Ga0495607_0042439 | Ga0495607_0042439_796_1530 | 244 |
| 550 | 3300046501 | Ga0495607_0055848 | Ga0495607_0055848_1150_1884 | 244 |
| 551 | 3300046506 | Ga0495583_0000158 | Ga0495583_0000158_7093_7857 | 244 |
| 552 | 3300046506 | Ga0495583_0000214 | Ga0495583_0000214_33411_34145 | 244 |
| 553 | 3300046506 | Ga0495583_0000947 | Ga0495583_0000947_5870_6604 | 244 |
| 554 | 3300046506 | Ga0495583_0001239 | Ga0495583_0001239_52_786 | 244 |
| 555 | 3300046506 | Ga0495583_0005046 | Ga0495583_0005046_5904_6638 | 244 |
| 556 | 3300046506 | Ga0495583_0005144 | Ga0495583_0005144_5448_6182 | 244 |
| 557 | 3300046506 | Ga0495583_0005773 | Ga0495583_0005773_7411_8145 | 244 |
| 558 | 3300046506 | Ga0495583_0006211 | Ga0495583_0006211_6939_7673 | 244 |
| 559 | 3300046506 | Ga0495583_0007334 | Ga0495583_0007334_2866_3600 | 244 |
| 560 | 3300046506 | Ga0495583_0014775 | Ga0495583_0014775_741_1475 | 244 |
| 561 | 3300046506 | Ga0495583_0020702 | Ga0495583_0020702_2241_2975 | 244 |
| 562 | 3300046506 | Ga0495583_0024718 | Ga0495583_0024718_658_1392 | 244 |
| 563 | 3300046506 | Ga0495583_0025072 | Ga0495583_0025072_1673_2407 | 244 |
| 564 | 3300046506 | Ga0495583_0159784 | Ga0495583_0159784_145_879 | 244 |
| 565 | 3300046507 | Ga0495606_0000090 | Ga0495606_0000090_5759_6493 | 244 |
| 566 | 3300046507 | Ga0495606_0000120 | Ga0495606_0000120_6201_6935 | 244 |
| 567 | 3300046507 | Ga0495606_0003666 | Ga0495606_0003666_6395_7129 | 244 |
| 568 | 3300046507 | Ga0495606_0004932 | Ga0495606_0004932_9423_10157 | 244 |
| 569 | 3300046507 | Ga0495606_0006821 | Ga0495606_0006821_3903_4637 | 244 |
| 570 | 3300046507 | Ga0495606_0006937 | Ga0495606_0006937_4302_5036 | 244 |
| 571 | 3300046507 | Ga0495606_0007094 | Ga0495606_0007094_3561_4295 | 244 |
| 572 | 3300046507 | Ga0495606_0008015 | Ga0495606_0008015_2143_2877 | 244 |
| 573 | 3300046507 | Ga0495606_0009951 | Ga0495606_0009951_4451_5185 | 244 |
| 574 | 3300046507 | Ga0495606_0016358 | Ga0495606_0016358_2568_3302 | 244 |
| 575 | 3300046507 | Ga0495606_0017490 | Ga0495606_0017490_44_778 | 244 |
| 576 | 3300046507 | Ga0495606_0038321 | Ga0495606_0038321_2417_3181 | 244 |
| 577 | 3300046507 | Ga0495606_0173371 | Ga0495606_0173371_81_815 | 244 |
| 578 | 3300046507 | Ga0495606_0182316 | Ga0495606_0182316_85_819 | 244 |
| 579 | 3300046511 | Ga0495608_0004039 | Ga0495608_0004039_8376_9110 | 244 |
| 580 | 3300046511 | Ga0495608_0016194 | Ga0495608_0016194_2137_2871 | 244 |
| 581 | 3300046512 | Ga0495610_0000017 | Ga0495610_0000017_234275_235009 | 244 |
| 582 | 3300046512 | Ga0495610_0025321 | Ga0495610_0025321_1776_2510 | 244 |
| 583 | 3300046513 | Ga0495616_0001092 | Ga0495616_0001092_5963_6697 | 244 |
| 584 | 3300046513 | Ga0495616_0001261 | Ga0495616_0001261_6435_7169 | 244 |
| 585 | 3300046513 | Ga0495616_0001563 | Ga0495616_0001563_8328_9062 | 244 |
| 586 | 3300046513 | Ga0495616_0005938 | Ga0495616_0005938_5135_5869 | 244 |
| 587 | 3300046513 | Ga0495616_0009383 | Ga0495616_0009383_2815_3549 | 244 |
| 588 | 3300046513 | Ga0495616_0010379 | Ga0495616_0010379_2028_2762 | 244 |
| 589 | 3300046513 | Ga0495616_0015513 | Ga0495616_0015513_2734_3468 | 244 |
| 590 | 3300046513 | Ga0495616_0018791 | Ga0495616_0018791_787_1521 | 244 |
| 591 | 3300046513 | Ga0495616_0019317 | Ga0495616_0019317_604_1338 | 244 |
| 592 | 3300046515 | Ga0495620_0018263 | Ga0495620_0018263_2190_2924 | 244 |
| 593 | 3300046516 | Ga0495628_0002401 | Ga0495628_0002401_7567_8301 | 244 |
| 594 | 3300046516 | Ga0495628_0004370 | Ga0495628_0004370_2770_3504 | 244 |
| 595 | 3300046518 | Ga0495631_0005014 | Ga0495631_0005014_2802_3536 | 244 |
| 596 | 3300046518 | Ga0495631_0006359 | Ga0495631_0006359_4307_5041 | 244 |
| 597 | 3300046518 | Ga0495631_0008278 | Ga0495631_0008278_281_1015 | 244 |
| 598 | 3300046518 | Ga0495631_0019676 | Ga0495631_0019676_68_802 | 244 |
| 599 | 3300046518 | Ga0495631_0022032 | Ga0495631_0022032_1114_1848 | 244 |
| 600 | 3300046518 | Ga0495631_0022053 | Ga0495631_0022053_1860_2594 | 244 |
| 601 | 3300046518 | Ga0495631_0037637 | Ga0495631_0037637_1126_1860 | 244 |
| 602 | 3300046518 | Ga0495631_0170180 | Ga0495631_0170180_137_871 | 244 |
| 603 | 3300046519 | Ga0495632_0001074 | Ga0495632_0001074_12405_13139 | 244 |
| 604 | 3300046519 | Ga0495632_0002651 | Ga0495632_0002651_2291_3025 | 244 |
| 605 | 3300046519 | Ga0495632_0003276 | Ga0495632_0003276_8057_8791 | 244 |
| 606 | 3300046519 | Ga0495632_0007442 | Ga0495632_0007442_2909_3643 | 244 |
| 607 | 3300046519 | Ga0495632_0028128 | Ga0495632_0028128_1909_2643 | 244 |
| 608 | 3300046519 | Ga0495632_0139103 | Ga0495632_0139103_33_767 | 244 |
| 609 | 3300046520 | Ga0495637_0000515 | Ga0495637_0000515_14052_14786 | 244 |
| 610 | 3300046520 | Ga0495637_0001430 | Ga0495637_0001430_7054_7788 | 244 |
| 611 | 3300046520 | Ga0495637_0002408 | Ga0495637_0002408_3474_4208 | 244 |
| 612 | 3300046522 | Ga0495643_0000455 | Ga0495643_0000455_45334_46068 | 244 |
| 613 | 3300046522 | Ga0495643_0000908 | Ga0495643_0000908_5862_6596 | 244 |
| 614 | 3300046522 | Ga0495643_0001824 | Ga0495643_0001824_399_1133 | 244 |
| 615 | 3300046522 | Ga0495643_0002067 | Ga0495643_0002067_6247_6981 | 244 |
| 616 | 3300046522 | Ga0495643_0002344 | Ga0495643_0002344_5174_5908 | 244 |
| 617 | 3300046522 | Ga0495643_0009119 | Ga0495643_0009119_2830_3564 | 244 |
| 618 | 3300046522 | Ga0495643_0012110 | Ga0495643_0012110_2583_3317 | 244 |
| 619 | 3300046522 | Ga0495643_0015824 | Ga0495643_0015824_1108_1842 | 244 |
| 620 | 3300046522 | Ga0495643_0022084 | Ga0495643_0022084_2520_3254 | 244 |
| 621 | 3300046522 | Ga0495643_0121836 | Ga0495643_0121836_560_1294 | 244 |
| 622 | 3300046523 | Ga0495644_0003375 | Ga0495644_0003375_775_1509 | 244 |
| 623 | 3300046523 | Ga0495644_0006022 | Ga0495644_0006022_2989_3723 | 244 |
| 624 | 3300046523 | Ga0495644_0015700 | Ga0495644_0015700_1898_2632 | 244 |
| 625 | 3300046523 | Ga0495644_0017503 | Ga0495644_0017503_350_1084 | 244 |
| 626 | 3300046523 | Ga0495644_0032409 | Ga0495644_0032409_590_1324 | 244 |
| 627 | 3300046523 | Ga0495644_0036566 | Ga0495644_0036566_325_1059 | 244 |
| 628 | 3300046523 | Ga0495644_0042546 | Ga0495644_0042546_609_1343 | 244 |
| 629 | 3300046523 | Ga0495644_0055027 | Ga0495644_0055027_447_1181 | 244 |
| 630 | 3300046524 | Ga0495648_0000168 | Ga0495648_0000168_10060_10794 | 244 |
| 631 | 3300046524 | Ga0495648_0000183 | Ga0495648_0000183_6335_7069 | 244 |
| 632 | 3300046524 | Ga0495648_0002984 | Ga0495648_0002984_2447_3181 | 244 |
| 633 | 3300046524 | Ga0495648_0004633 | Ga0495648_0004633_8109_8843 | 244 |
| 634 | 3300046524 | Ga0495648_0007325 | Ga0495648_0007325_5419_6153 | 244 |
| 635 | 3300046524 | Ga0495648_0011240 | Ga0495648_0011240_2676_3410 | 244 |
| 636 | 3300046524 | Ga0495648_0017788 | Ga0495648_0017788_861_1595 | 244 |
| 637 | 3300046524 | Ga0495648_0020900 | Ga0495648_0020900_1569_2303 | 244 |
| 638 | 3300046524 | Ga0495648_0024858 | Ga0495648_0024858_1300_2034 | 244 |
| 639 | 3300046524 | Ga0495648_0034012 | Ga0495648_0034012_2309_3043 | 244 |
| 640 | 3300046524 | Ga0495648_0041657 | Ga0495648_0041657_2080_2814 | 244 |
| 641 | 3300046524 | Ga0495648_0085646 | Ga0495648_0085646_161_895 | 244 |
| 642 | 3300046524 | Ga0495648_0104119 | Ga0495648_0104119_86_820 | 244 |
| 643 | 3300046525 | Ga0495663_0001620 | Ga0495663_0001620_3859_4593 | 244 |
| 644 | 3300046525 | Ga0495663_0004246 | Ga0495663_0004246_2821_3555 | 244 |
| 645 | 3300046525 | Ga0495663_0061576 | Ga0495663_0061576_59_793 | 244 |
| 646 | 3300046525 | Ga0495663_0096622 | Ga0495663_0096622_143_877 | 244 |
| 647 | 3300046528 | Ga0495642_0000587 | Ga0495642_0000587_13971_14705 | 244 |
| 648 | 3300046528 | Ga0495642_0000876 | Ga0495642_0000876_2894_3628 | 244 |
| 649 | 3300046528 | Ga0495642_0001506 | Ga0495642_0001506_5738_6472 | 244 |
| 650 | 3300046528 | Ga0495642_0002007 | Ga0495642_0002007_5857_6591 | 244 |
| 651 | 3300046528 | Ga0495642_0003631 | Ga0495642_0003631_1383_2117 | 244 |
| 652 | 3300046528 | Ga0495642_0026994 | Ga0495642_0026994_300_1034 | 244 |
| 653 | 3300046528 | Ga0495642_0028689 | Ga0495642_0028689_79_813 | 244 |
| 654 | 3300046528 | Ga0495642_0051203 | Ga0495642_0051203_697_1431 | 244 |
| 655 | 3300046529 | Ga0495652_0007905 | Ga0495652_0007905_7458_8192 | 244 |
| 656 | 3300046529 | Ga0495652_0032735 | Ga0495652_0032735_1225_1959 | 244 |
| 657 | 3300046529 | Ga0495652_0041809 | Ga0495652_0041809_921_1655 | 244 |
| 658 | 3300046529 | Ga0495652_0081403 | Ga0495652_0081403_1220_1954 | 244 |
| 659 | 3300046530 | Ga0495654_0000060 | Ga0495654_0000060_6308_7042 | 244 |
| 660 | 3300046530 | Ga0495654_0010226 | Ga0495654_0010226_1846_2580 | 244 |
| 661 | 3300046530 | Ga0495654_0013265 | Ga0495654_0013265_777_1511 | 244 |
| 662 | 3300046530 | Ga0495654_0018980 | Ga0495654_0018980_1998_2732 | 244 |
| 663 | 3300046531 | Ga0495665_0014977 | Ga0495665_0014977_1860_2594 | 244 |
| 664 | 3300046531 | Ga0495665_0032396 | Ga0495665_0032396_912_1646 | 244 |
| 665 | 3300046535 | Ga0495586_0017975 | Ga0495586_0017975_2668_3402 | 244 |
| 666 | 3300046535 | Ga0495586_0021446 | Ga0495586_0021446_989_1723 | 244 |
| 667 | 3300046538 | Ga0495609_0000007 | Ga0495609_0000007_274024_274758 | 244 |
| 668 | 3300046538 | Ga0495609_0001519 | Ga0495609_0001519_10116_10850 | 244 |
| 669 | 3300046538 | Ga0495609_0002547 | Ga0495609_0002547_5495_6229 | 244 |
| 670 | 3300046538 | Ga0495609_0002784 | Ga0495609_0002784_8238_8972 | 244 |
| 671 | 3300046538 | Ga0495609_0007980 | Ga0495609_0007980_1281_2015 | 244 |
| 672 | 3300046538 | Ga0495609_0010452 | Ga0495609_0010452_1439_2173 | 244 |
| 673 | 3300046538 | Ga0495609_0012437 | Ga0495609_0012437_1976_2710 | 244 |
| 674 | 3300046538 | Ga0495609_0027527 | Ga0495609_0027527_237_971 | 244 |
| 675 | 3300046538 | Ga0495609_0032381 | Ga0495609_0032381_192_926 | 244 |
| 676 | 3300046538 | Ga0495609_0059039 | Ga0495609_0059039_155_889 | 244 |
| 677 | 3300046538 | Ga0495609_0070427 | Ga0495609_0070427_367_1101 | 244 |
| 678 | 3300046538 | Ga0495609_0075686 | Ga0495609_0075686_727_1461 | 244 |
| 679 | 3300046542 | Ga0495597_0000907 | Ga0495597_0000907_12541_13275 | 244 |
| 680 | 3300046542 | Ga0495597_0002989 | Ga0495597_0002989_3459_4193 | 244 |
| 681 | 3300046542 | Ga0495597_0003023 | Ga0495597_0003023_7227_7961 | 244 |
| 682 | 3300046542 | Ga0495597_0003385 | Ga0495597_0003385_2914_3648 | 244 |
| 683 | 3300046542 | Ga0495597_0005581 | Ga0495597_0005581_5541_6275 | 244 |
| 684 | 3300046542 | Ga0495597_0005707 | Ga0495597_0005707_2113_2847 | 244 |
| 685 | 3300046542 | Ga0495597_0006706 | Ga0495597_0006706_2627_3361 | 244 |
| 686 | 3300046542 | Ga0495597_0008370 | Ga0495597_0008370_3115_3849 | 244 |
| 687 | 3300046542 | Ga0495597_0010738 | Ga0495597_0010738_1027_1761 | 244 |
| 688 | 3300046542 | Ga0495597_0042028 | Ga0495597_0042028_1061_1795 | 244 |
| 689 | 3300046542 | Ga0495597_0043540 | Ga0495597_0043540_376_1110 | 244 |
| 690 | 3300046542 | Ga0495597_0050403 | Ga0495597_0050403_19_753 | 244 |
| 691 | 3300046543 | Ga0495645_0074549 | Ga0495645_0074549_689_1423 | 244 |
| 692 | 3300046543 | Ga0495645_0111173 | Ga0495645_0111173_418_1152 | 244 |
| 693 | 3300046557 | Ga0495622_0002486 | Ga0495622_0002486_5826_6560 | 244 |
| 694 | 3300046557 | Ga0495622_0002494 | Ga0495622_0002494_6095_6829 | 244 |
| 695 | 3300046557 | Ga0495622_0159298 | Ga0495622_0159298_154_888 | 244 |
| 696 | 3300046558 | Ga0495633_0002814 | Ga0495633_0002814_2876_3610 | 244 |
| 697 | 3300046558 | Ga0495633_0002851 | Ga0495633_0002851_6716_7450 | 244 |
| 698 | 3300046558 | Ga0495633_0004074 | Ga0495633_0004074_2789_3523 | 244 |
| 699 | 3300046558 | Ga0495633_0006023 | Ga0495633_0006023_514_1248 | 244 |
| 700 | 3300046558 | Ga0495633_0006720 | Ga0495633_0006720_1497_2231 | 244 |
| 701 | 3300046558 | Ga0495633_0007463 | Ga0495633_0007463_2476_3210 | 244 |
| 702 | 3300046558 | Ga0495633_0008007 | Ga0495633_0008007_2788_3522 | 244 |
| 703 | 3300046558 | Ga0495633_0008646 | Ga0495633_0008646_2894_3628 | 244 |
| 704 | 3300046558 | Ga0495633_0014098 | Ga0495633_0014098_707_1441 | 244 |
| 705 | 3300046558 | Ga0495633_0026789 | Ga0495633_0026789_114_848 | 244 |
| 706 | 3300046558 | Ga0495633_0046632 | Ga0495633_0046632_18_752 | 244 |
| 707 | 3300046558 | Ga0495633_0062757 | Ga0495633_0062757_18_752 | 244 |
| 708 | 3300046558 | Ga0495633_0077343 | Ga0495633_0077343_280_1014 | 244 |
| 709 | 3300046559 | Ga0495667_0056292 | Ga0495667_0056292_911_1645 | 244 |
| 710 | 3300046615 | Ga0495656_0001760 | Ga0495656_0001760_4284_5018 | 244 |
| 711 | 3300046615 | Ga0495656_0017319 | Ga0495656_0017319_1997_2731 | 244 |
| 712 | 3300046615 | Ga0495656_0047268 | Ga0495656_0047268_1029_1763 | 244 |
| 713 | 3300046615 | Ga0495656_0307701 | Ga0495656_0307701_62_796 | 244 |
| 714 | 3300046616 | Ga0495668_0000343 | Ga0495668_0000343_5619_6353 | 244 |
| 715 | 3300046616 | Ga0495668_0001087 | Ga0495668_0001087_16026_16760 | 244 |
| 716 | 3300046616 | Ga0495668_0001732 | Ga0495668_0001732_6284_7018 | 244 |
| 717 | 3300046616 | Ga0495668_0003183 | Ga0495668_0003183_9113_9847 | 244 |
| 718 | 3300046616 | Ga0495668_0003908 | Ga0495668_0003908_7470_8204 | 244 |
| 719 | 3300046616 | Ga0495668_0004561 | Ga0495668_0004561_3219_3953 | 244 |
| 720 | 3300046616 | Ga0495668_0005358 | Ga0495668_0005358_6632_7366 | 244 |
| 721 | 3300046616 | Ga0495668_0005407 | Ga0495668_0005407_39_773 | 244 |
| 722 | 3300046616 | Ga0495668_0009136 | Ga0495668_0009136_3436_4170 | 244 |
| 723 | 3300046616 | Ga0495668_0017136 | Ga0495668_0017136_2733_3467 | 244 |
| 724 | 3300046616 | Ga0495668_0037723 | Ga0495668_0037723_1252_1986 | 244 |
| 725 | 3300046616 | Ga0495668_0054847 | Ga0495668_0054847_360_1094 | 244 |
| 726 | 3300046616 | Ga0495668_0100225 | Ga0495668_0100225_777_1511 | 244 |
| 727 | 3300046648 | Ga0495611_0001456 | Ga0495611_0001456_6916_7650 | 244 |
| 728 | 3300046648 | Ga0495611_0013168 | Ga0495611_0013168_2018_2752 | 244 |
| 729 | 3300046648 | Ga0495611_0016564 | Ga0495611_0016564_1143_1877 | 244 |
| 730 | 3300046648 | Ga0495611_0022060 | Ga0495611_0022060_394_1128 | 244 |
| 731 | 3300046648 | Ga0495611_0045159 | Ga0495611_0045159_889_1623 | 244 |
| 732 | 3300046660 | Ga0495625_0003347 | Ga0495625_0003347_9276_10040 | 244 |
| 733 | 3300046660 | Ga0495625_0006637 | Ga0495625_0006637_6754_7488 | 244 |
| 734 | 3300046660 | Ga0495625_0007014 | Ga0495625_0007014_6523_7257 | 244 |
| 735 | 3300046660 | Ga0495625_0007415 | Ga0495625_0007415_26_760 | 244 |
| 736 | 3300046660 | Ga0495625_0007684 | Ga0495625_0007684_6024_6758 | 244 |
| 737 | 3300046660 | Ga0495625_0013314 | Ga0495625_0013314_580_1314 | 244 |
| 738 | 3300046660 | Ga0495625_0015335 | Ga0495625_0015335_2254_2988 | 244 |
| 739 | 3300046660 | Ga0495625_0035107 | Ga0495625_0035107_2866_3600 | 244 |
| 740 | 3300046660 | Ga0495625_0047992 | Ga0495625_0047992_2026_2760 | 244 |
| 741 | 3300046660 | Ga0495625_0092102 | Ga0495625_0092102_1234_1968 | 244 |
| 742 | 3300046660 | Ga0495625_0388953 | Ga0495625_0388953_37_771 | 244 |
| 743 | 3300046663 | Ga0495635_0053923 | Ga0495635_0053923_1124_1858 | 244 |
| 744 | 3300046664 | Ga0495659_0001316 | Ga0495659_0001316_5227_5961 | 244 |
| 745 | 3300046664 | Ga0495659_0004057 | Ga0495659_0004057_2723_3457 | 244 |
| 746 | 3300046664 | Ga0495659_0011058 | Ga0495659_0011058_500_1234 | 244 |
| 747 | 3300046664 | Ga0495659_0012089 | Ga0495659_0012089_1721_2455 | 244 |
| 748 | 3300046664 | Ga0495659_0049601 | Ga0495659_0049601_480_1214 | 244 |
| 749 | 3300046664 | Ga0495659_0137873 | Ga0495659_0137873_176_910 | 244 |
| 750 | 3300046665 | Ga0495661_0000788 | Ga0495661_0000788_23477_24211 | 244 |
| 751 | 3300046665 | Ga0495661_0004283 | Ga0495661_0004283_6834_7568 | 244 |
| 752 | 3300046665 | Ga0495661_0007508 | Ga0495661_0007508_4585_5319 | 244 |
| 753 | 3300046665 | Ga0495661_0008231 | Ga0495661_0008231_1500_2234 | 244 |
| 754 | 3300046665 | Ga0495661_0010573 | Ga0495661_0010573_2564_3298 | 244 |
| 755 | 3300046665 | Ga0495661_0026189 | Ga0495661_0026189_1228_1962 | 244 |
| 756 | 3300046665 | Ga0495661_0027932 | Ga0495661_0027932_1550_2284 | 244 |
| 757 | 3300046665 | Ga0495661_0030098 | Ga0495661_0030098_422_1156 | 244 |
| 758 | 3300046665 | Ga0495661_0033613 | Ga0495661_0033613_1683_2417 | 244 |
| 759 | 3300046665 | Ga0495661_0034461 | Ga0495661_0034461_926_1660 | 244 |
| 760 | 3300046665 | Ga0495661_0037884 | Ga0495661_0037884_719_1453 | 244 |
| 761 | 3300046665 | Ga0495661_0057480 | Ga0495661_0057480_977_1711 | 244 |
| 762 | 3300046665 | Ga0495661_0065346 | Ga0495661_0065346_572_1306 | 244 |
| 763 | 3300046665 | Ga0495661_0085830 | Ga0495661_0085830_861_1595 | 244 |
| 764 | 3300046674 | Ga0495588_0000147 | Ga0495588_0000147_46354_47088 | 244 |
| 765 | 3300046674 | Ga0495588_0014594 | Ga0495588_0014594_1812_2546 | 244 |
| 766 | 3300046674 | Ga0495588_0017622 | Ga0495588_0017622_1938_2672 | 244 |
| 767 | 3300046674 | Ga0495588_0022311 | Ga0495588_0022311_1760_2494 | 244 |
| 768 | 3300046674 | Ga0495588_0033805 | Ga0495588_0033805_1178_1912 | 244 |
| 769 | 3300046674 | Ga0495588_0043042 | Ga0495588_0043042_160_894 | 244 |
| 770 | 3300046674 | Ga0495588_0058718 | Ga0495588_0058718_877_1611 | 244 |
| 771 | 3300046674 | Ga0495588_0060865 | Ga0495588_0060865_450_1214 | 244 |
| 772 | 3300046674 | Ga0495588_0064041 | Ga0495588_0064041_851_1585 | 244 |
| 773 | 3300046674 | Ga0495588_0089576 | Ga0495588_0089576_457_1191 | 244 |
| 774 | 3300046674 | Ga0495588_0106232 | Ga0495588_0106232_390_1124 | 244 |
| 775 | 3300046674 | Ga0495588_0151507 | Ga0495588_0151507_73_807 | 244 |
| 776 | 3300046678 | Ga0495599_0005211 | Ga0495599_0005211_6128_6862 | 244 |
| 777 | 3300046680 | Ga0495646_0008367 | Ga0495646_0008367_731_1465 | 244 |
| 778 | 3300046680 | Ga0495646_0023778 | Ga0495646_0023778_2511_3245 | 244 |
| 779 | 3300046684 | Ga0495669_0007961 | Ga0495669_0007961_2211_2945 | 244 |
| 780 | 3300046684 | Ga0495669_0013268 | Ga0495669_0013268_1902_2636 | 244 |
| 781 | 3300046684 | Ga0495669_0013494 | Ga0495669_0013494_2382_3116 | 244 |
| 782 | 3300046689 | Ga0495613_0045730 | Ga0495613_0045730_1503_2237 | 244 |
| 783 | 3300046690 | Ga0495624_0011275 | Ga0495624_0011275_894_1628 | 244 |
| 784 | 3300046690 | Ga0495624_0022700 | Ga0495624_0022700_546_1280 | 244 |
| 785 | 3300046690 | Ga0495624_0042991 | Ga0495624_0042991_137_871 | 244 |
| 786 | 3300046691 | Ga0495670_0001254 | Ga0495670_0001254_7101_7835 | 244 |
| 787 | 3300046691 | Ga0495670_0004528 | Ga0495670_0004528_2736_3470 | 244 |
| 788 | 3300046691 | Ga0495670_0009328 | Ga0495670_0009328_1480_2214 | 244 |
| 789 | 3300046691 | Ga0495670_0010129 | Ga0495670_0010129_3626_4360 | 244 |
| 790 | 3300046691 | Ga0495670_0049309 | Ga0495670_0049309_951_1685 | 244 |
| 791 | 3300046691 | Ga0495670_0053103 | Ga0495670_0053103_700_1434 | 244 |
| 792 | 3300046691 | Ga0495670_0102139 | Ga0495670_0102139_629_1363 | 244 |
| 793 | 3300046691 | Ga0495670_0212428 | Ga0495670_0212428_258_992 | 244 |
| 794 | 3300046691 | Ga0495670_0308568 | Ga0495670_0308568_23_757 | 244 |
| 795 | 3300046692 | Ga0495671_0000026 | Ga0495671_0000026_12272_13006 | 244 |
| 796 | 3300046692 | Ga0495671_0001460 | Ga0495671_0001460_12367_13101 | 244 |
| 797 | 3300046692 | Ga0495671_0001961 | Ga0495671_0001961_1436_2170 | 244 |
| 798 | 3300046692 | Ga0495671_0005885 | Ga0495671_0005885_2497_3231 | 244 |
| 799 | 3300046692 | Ga0495671_0006589 | Ga0495671_0006589_2532_3266 | 244 |
| 800 | 3300046692 | Ga0495671_0022149 | Ga0495671_0022149_1114_1848 | 244 |
| 801 | 3300046692 | Ga0495671_0024992 | Ga0495671_0024992_239_973 | 244 |
| 802 | 3300046692 | Ga0495671_0033940 | Ga0495671_0033940_1480_2214 | 244 |
| 803 | 3300046692 | Ga0495671_0038113 | Ga0495671_0038113_675_1409 | 244 |
| 804 | 3300046694 | Ga0495649_0001335 | Ga0495649_0001335_13935_14669 | 244 |
| 805 | 3300046694 | Ga0495649_0004497 | Ga0495649_0004497_384_1118 | 244 |
| 806 | 3300046694 | Ga0495649_0018456 | Ga0495649_0018456_531_1265 | 244 |
| 807 | 3300046694 | Ga0495649_0031678 | Ga0495649_0031678_1909_2643 | 244 |
| 808 | 3300046694 | Ga0495649_0034553 | Ga0495649_0034553_1846_2580 | 244 |
| 809 | 3300046694 | Ga0495649_0079750 | Ga0495649_0079750_143_877 | 244 |
| 810 | 3300046794 | Ga0495589_0000744 | Ga0495589_0000744_14217_14951 | 244 |
| 811 | 3300046794 | Ga0495589_0002015 | Ga0495589_0002015_8596_9330 | 244 |
| 812 | 3300046794 | Ga0495589_0002358 | Ga0495589_0002358_3261_3995 | 244 |
| 813 | 3300046794 | Ga0495589_0011232 | Ga0495589_0011232_301_1035 | 244 |
| 814 | 3300046794 | Ga0495589_0030555 | Ga0495589_0030555_958_1692 | 244 |
| 815 | 3300046794 | Ga0495589_0055292 | Ga0495589_0055292_114_848 | 244 |
| 816 | 3300046794 | Ga0495589_0061523 | Ga0495589_0061523_275_1009 | 244 |
| 817 | 3300046794 | Ga0495589_0083801 | Ga0495589_0083801_359_1093 | 244 |
| 818 | 3300046809 | Ga0495600_0000574 | Ga0495600_0000574_9756_10490 | 244 |
| 819 | 3300046809 | Ga0495600_0022926 | Ga0495600_0022926_1700_2434 | 244 |
| 820 | 3300046809 | Ga0495600_0211469 | Ga0495600_0211469_271_1005 | 244 |
| 821 | 3300046810 | Ga0495660_0000101 | Ga0495660_0000101_83645_84379 | 244 |
| 822 | 3300046810 | Ga0495660_0001103 | Ga0495660_0001103_4398_5132 | 244 |
| 823 | 3300046810 | Ga0495660_0002130 | Ga0495660_0002130_1782_2516 | 244 |
| 824 | 3300046810 | Ga0495660_0005483 | Ga0495660_0005483_2695_3429 | 244 |
| 825 | 3300046810 | Ga0495660_0009610 | Ga0495660_0009610_2643_3377 | 244 |
| 826 | 3300046810 | Ga0495660_0010073 | Ga0495660_0010073_2794_3528 | 244 |
| 827 | 3300046810 | Ga0495660_0029272 | Ga0495660_0029272_1071_1805 | 244 |
| 828 | 3300046810 | Ga0495660_0047713 | Ga0495660_0047713_502_1236 | 244 |
| 829 | 3300046810 | Ga0495660_0068129 | Ga0495660_0068129_359_1093 | 244 |
| 830 | 3300046810 | Ga0495660_0088690 | Ga0495660_0088690_80_814 | 244 |
| 831 | 3300046810 | Ga0495660_0097211 | Ga0495660_0097211_381_1115 | 244 |
| 832 | 3300047315 | Ga0495581_0010383 | Ga0495581_0010383_1252_1986 | 244 |
| 833 | 3300047315 | Ga0495581_0038882 | Ga0495581_0038882_370_1104 | 244 |
| 834 | 3300047317 | Ga0495604_0006351 | Ga0495604_0006351_1663_2397 | 244 |
| 835 | 3300047317 | Ga0495604_0111832 | Ga0495604_0111832_658_1392 | 244 |
| 836 | 3300047318 | Ga0495636_0001420 | Ga0495636_0001420_2639_3373 | 244 |
| 837 | 3300047318 | Ga0495636_0002442 | Ga0495636_0002442_5487_6221 | 244 |
| 838 | 3300047318 | Ga0495636_0004292 | Ga0495636_0004292_3149_3883 | 244 |
| 839 | 3300047318 | Ga0495636_0006432 | Ga0495636_0006432_1231_1965 | 244 |
| 840 | 3300047318 | Ga0495636_0012427 | Ga0495636_0012427_1813_2547 | 244 |
| 841 | 3300047319 | Ga0495674_0001181 | Ga0495674_0001181_13673_14407 | 244 |
| 842 | 3300047319 | Ga0495674_0090508 | Ga0495674_0090508_1131_1865 | 244 |
| 843 | 3300047320 | Ga0495672_0000340 | Ga0495672_0000340_3086_3820 | 244 |
| 844 | 3300047320 | Ga0495672_0000348 | Ga0495672_0000348_50058_50792 | 244 |
| 845 | 3300047320 | Ga0495672_0001839 | Ga0495672_0001839_13205_13939 | 244 |
| 846 | 3300047320 | Ga0495672_0003446 | Ga0495672_0003446_9894_10628 | 244 |
| 847 | 3300047320 | Ga0495672_0007196 | Ga0495672_0007196_5540_6274 | 244 |
| 848 | 3300047320 | Ga0495672_0042744 | Ga0495672_0042744_49_783 | 244 |
| 849 | 3300047321 | Ga0495676_0024269 | Ga0495676_0024269_2412_3146 | 244 |
| 850 | 3300047321 | Ga0495676_0029806 | Ga0495676_0029806_1554_2288 | 244 |
| 851 | 3300047321 | Ga0495676_0217029 | Ga0495676_0217029_318_1052 | 244 |
| 852 | 3300047321 | Ga0495676_0219987 | Ga0495676_0219987_552_1286 | 244 |
| 853 | 3300047322 | Ga0495680_0209144 | Ga0495680_0209144_167_901 | 244 |
| 854 | 3300047323 | Ga0495683_0001121 | Ga0495683_0001121_3857_4591 | 244 |
| 855 | 3300047323 | Ga0495683_0001282 | Ga0495683_0001282_10167_10901 | 244 |
| 856 | 3300047323 | Ga0495683_0003427 | Ga0495683_0003427_2865_3599 | 244 |
| 857 | 3300047323 | Ga0495683_0019747 | Ga0495683_0019747_2349_3083 | 244 |
| 858 | 3300047323 | Ga0495683_0037847 | Ga0495683_0037847_822_1556 | 244 |
| 859 | 3300047323 | Ga0495683_0107345 | Ga0495683_0107345_156_890 | 244 |
| 860 | 3300047323 | Ga0495683_0118344 | Ga0495683_0118344_455_1189 | 244 |
| 861 | 3300047443 | Ga0495687_000030 | Ga0495687_000030_112162_112896 | 244 |
| 862 | 3300047443 | Ga0495687_000120 | Ga0495687_000120_98413_99147 | 244 |
| 863 | 3300047443 | Ga0495687_000374 | Ga0495687_000374_48444_49178 | 244 |
| 864 | 3300047443 | Ga0495687_000814 | Ga0495687_000814_5628_6362 | 244 |
| 865 | 3300047443 | Ga0495687_002263 | Ga0495687_002263_7545_8279 | 244 |
| 866 | 3300047443 | Ga0495687_005069 | Ga0495687_005069_6820_7554 | 244 |
| 867 | 3300047443 | Ga0495687_005087 | Ga0495687_005087_1900_2634 | 244 |
| 868 | 3300047443 | Ga0495687_006481 | Ga0495687_006481_5175_5909 | 244 |
| 869 | 3300047443 | Ga0495687_006723 | Ga0495687_006723_845_1579 | 244 |
| 870 | 3300047443 | Ga0495687_018413 | Ga0495687_018413_1358_2092 | 244 |
| 871 | 3300047445 | Ga0495677_0000045 | Ga0495677_0000045_26496_27230 | 244 |
| 872 | 3300047445 | Ga0495677_0001255 | Ga0495677_0001255_4258_4992 | 244 |
| 873 | 3300047445 | Ga0495677_0001897 | Ga0495677_0001897_4054_4788 | 244 |
| 874 | 3300047445 | Ga0495677_0002978 | Ga0495677_0002978_2962_3696 | 244 |
| 875 | 3300047445 | Ga0495677_0003654 | Ga0495677_0003654_3823_4557 | 244 |
| 876 | 3300047445 | Ga0495677_0003854 | Ga0495677_0003854_1932_2666 | 244 |
| 877 | 3300047445 | Ga0495677_0005291 | Ga0495677_0005291_1694_2428 | 244 |
| 878 | 3300047445 | Ga0495677_0030911 | Ga0495677_0030911_34_768 | 244 |
| 879 | 3300047445 | Ga0495677_0033917 | Ga0495677_0033917_292_1026 | 244 |
| 880 | 3300047445 | Ga0495677_0036059 | Ga0495677_0036059_370_1104 | 244 |
| 881 | 3300047445 | Ga0495677_0053556 | Ga0495677_0053556_215_949 | 244 |
| 882 | 3300047446 | Ga0495679_002165 | Ga0495679_002165_3503_4237 | 244 |
| 883 | 3300047446 | Ga0495679_003747 | Ga0495679_003747_2781_3515 | 244 |
| 884 | 3300047446 | Ga0495679_013607 | Ga0495679_013607_106_840 | 244 |
| 885 | 3300047446 | Ga0495679_020712 | Ga0495679_020712_1071_1805 | 244 |
| 886 | 3300047447 | Ga0495685_000505 | Ga0495685_000505_5734_6468 | 244 |
| 887 | 3300047447 | Ga0495685_001117 | Ga0495685_001117_1481_2215 | 244 |
| 888 | 3300047447 | Ga0495685_044866 | Ga0495685_044866_100_834 | 244 |
| 889 | 3300047469 | Ga0495673_0000179 | Ga0495673_0000179_94660_95394 | 244 |
| 890 | 3300047469 | Ga0495673_0000201 | Ga0495673_0000201_974_1708 | 244 |
| 891 | 3300047469 | Ga0495673_0000391 | Ga0495673_0000391_6274_7008 | 244 |
| 892 | 3300047469 | Ga0495673_0010934 | Ga0495673_0010934_707_1441 | 244 |
| 893 | 3300047469 | Ga0495673_0022072 | Ga0495673_0022072_1182_1916 | 244 |
| 894 | 3300047470 | Ga0495681_0002281 | Ga0495681_0002281_9978_10739 | 244 |
| 895 | 3300047470 | Ga0495681_0004090 | Ga0495681_0004090_2157_2891 | 244 |
| 896 | 3300047470 | Ga0495681_0005170 | Ga0495681_0005170_5116_5850 | 244 |
| 897 | 3300047470 | Ga0495681_0005907 | Ga0495681_0005907_4597_5331 | 244 |
| 898 | 3300047470 | Ga0495681_0005937 | Ga0495681_0005937_5437_6171 | 244 |
| 899 | 3300047470 | Ga0495681_0017127 | Ga0495681_0017127_2592_3326 | 244 |
| 900 | 3300047470 | Ga0495681_0020045 | Ga0495681_0020045_2800_3534 | 244 |
| 901 | 3300047470 | Ga0495681_0027137 | Ga0495681_0027137_1567_2301 | 244 |
| 902 | 3300047470 | Ga0495681_0035175 | Ga0495681_0035175_345_1079 | 244 |
| 903 | 3300047470 | Ga0495681_0036810 | Ga0495681_0036810_234_968 | 244 |
| 904 | 3300047470 | Ga0495681_0051141 | Ga0495681_0051141_928_1662 | 244 |
| 905 | 3300047470 | Ga0495681_0055757 | Ga0495681_0055757_495_1229 | 244 |
| 906 | 3300047472 | Ga0495686_0000793 | Ga0495686_0000793_28132_28866 | 244 |
| 907 | 3300047472 | Ga0495686_0001487 | Ga0495686_0001487_13606_14340 | 244 |
| 908 | 3300047472 | Ga0495686_0002313 | Ga0495686_0002313_2570_3304 | 244 |
| 909 | 3300047472 | Ga0495686_0007032 | Ga0495686_0007032_5733_6467 | 244 |
| 910 | 3300047472 | Ga0495686_0012729 | Ga0495686_0012729_1426_2160 | 244 |
| 911 | 3300047472 | Ga0495686_0016478 | Ga0495686_0016478_3308_4042 | 244 |
| 912 | 3300047472 | Ga0495686_0021328 | Ga0495686_0021328_2325_3059 | 244 |
| 913 | 3300047472 | Ga0495686_0077016 | Ga0495686_0077016_226_960 | 244 |
| 914 | 3300047472 | Ga0495686_0099123 | Ga0495686_0099123_146_880 | 244 |
| 915 | 3300047673 | Ga0495593_0025631 | Ga0495593_0025631_2120_2854 | 244 |
| 916 | 3300047673 | Ga0495593_0025956 | Ga0495593_0025956_1828_2562 | 244 |
| 917 | 3300048088 | Ga0495602_0024518 | Ga0495602_0024518_3757_4491 | 244 |
| 918 | 3300048088 | Ga0495602_0087339 | Ga0495602_0087339_717_1451 | 244 |
| 919 | 3300048088 | Ga0495602_0170950 | Ga0495602_0170950_889_1623 | 244 |
| 920 | 3300048091 | Ga0495626_0000022 | Ga0495626_0000022_207527_208261 | 244 |
| 921 | 3300048091 | Ga0495626_0000105 | Ga0495626_0000105_98531_99265 | 244 |
| 922 | 3300048091 | Ga0495626_0001496 | Ga0495626_0001496_7415_8149 | 244 |
| 923 | 3300048091 | Ga0495626_0002464 | Ga0495626_0002464_4463_5197 | 244 |
| 924 | 3300048091 | Ga0495626_0004240 | Ga0495626_0004240_288_1022 | 244 |
| 925 | 3300048091 | Ga0495626_0009776 | Ga0495626_0009776_1626_2360 | 244 |
| 926 | 3300048091 | Ga0495626_0025600 | Ga0495626_0025600_1109_1843 | 244 |
| 927 | 3300048091 | Ga0495626_0027200 | Ga0495626_0027200_1589_2323 | 244 |
| 928 | 3300048091 | Ga0495626_0035334 | Ga0495626_0035334_381_1115 | 244 |
| 929 | 3300048091 | Ga0495626_0046884 | Ga0495626_0046884_955_1689 | 244 |
| 930 | 3300048091 | Ga0495626_0047022 | Ga0495626_0047022_965_1699 | 244 |
| 931 | 3300048091 | Ga0495626_0048178 | Ga0495626_0048178_243_977 | 244 |
| 932 | 3300048091 | Ga0495626_0049362 | Ga0495626_0049362_1181_1915 | 244 |
| 933 | 3300048091 | Ga0495626_0074510 | Ga0495626_0074510_37_771 | 244 |
| 934 | 3300048903 | Ga0496100_0071368 | Ga0496100_0071368_1146_1907 | 244 |
| 935 | 3300048903 | Ga0496100_0152475 | Ga0496100_0152475_689_1423 | 244 |
| 936 | 3300048904 | Ga0496101_0012306 | Ga0496101_0012306_3729_4490 | 244 |
| 937 | 3300048905 | Ga0496102_0000836 | Ga0496102_0000836_7407_8141 | 244 |
| 938 | 3300048905 | Ga0496102_0001960 | Ga0496102_0001960_11072_11806 | 244 |
| 939 | 3300048905 | Ga0496102_0116493 | Ga0496102_0116493_423_1157 | 244 |
| 940 | 3300048905 | Ga0496102_0159383 | Ga0496102_0159383_105_839 | 244 |
| 941 | 3300048905 | Ga0496102_0249210 | Ga0496102_0249210_39_773 | 244 |
| 942 | 3300048906 | Ga0496103_0035508 | Ga0496103_0035508_572_1306 | 244 |
| 943 | 3300048906 | Ga0496103_0056784 | Ga0496103_0056784_1665_2399 | 244 |
| 944 | 3300048906 | Ga0496103_0066831 | Ga0496103_0066831_1326_2060 | 244 |
| 945 | 3300048907 | Ga0496104_0706501 | Ga0496104_0706501_101_835 | 244 |
| 946 | 3300048909 | Ga0496106_0007806 | Ga0496106_0007806_1310_2044 | 244 |
| 947 | 3300048909 | Ga0496106_0142191 | Ga0496106_0142191_265_999 | 244 |
| 948 | 3300048910 | Ga0496107_0037389 | Ga0496107_0037389_522_1256 | 244 |
| 949 | 3300048910 | Ga0496107_0125500 | Ga0496107_0125500_78_812 | 244 |
| 950 | 3300048910 | Ga0496107_0329708 | Ga0496107_0329708_374_1108 | 244 |
| 951 | 3300048910 | Ga0496107_0531092 | Ga0496107_0531092_78_812 | 244 |
| 952 | 3300048911 | Ga0496108_0337275 | Ga0496108_0337275_124_858 | 244 |
| 953 | 3300048912 | Ga0496109_0019163 | Ga0496109_0019163_2597_3358 | 244 |
| 954 | 3300048912 | Ga0496109_0180887 | Ga0496109_0180887_359_1093 | 244 |
| 955 | 3300048913 | Ga0496110_0003614 | Ga0496110_0003614_6552_7286 | 244 |
| 956 | 3300048913 | Ga0496110_0106607 | Ga0496110_0106607_185_919 | 244 |
| 957 | 3300048913 | Ga0496110_0366094 | Ga0496110_0366094_237_971 | 244 |
| 958 | 3300048914 | Ga0496111_0035112 | Ga0496111_0035112_2688_3422 | 244 |
| 959 | 3300048916 | Ga0496113_0007466 | Ga0496113_0007466_3228_3962 | 244 |
| 960 | 3300048917 | Ga0496114_0102792 | Ga0496114_0102792_1278_2012 | 244 |
| 961 | 3300048917 | Ga0496114_0569376 | Ga0496114_0569376_38_772 | 244 |
| 962 | 3300048918 | Ga0496115_0031619 | Ga0496115_0031619_1018_1782 | 244 |
| 963 | 3300048919 | Ga0496116_0161931 | Ga0496116_0161931_31_765 | 244 |
| 964 | 3300048920 | Ga0496117_0000005 | Ga0496117_0000005_594510_595244 | 244 |
| 965 | 3300048921 | Ga0496118_0000031 | Ga0496118_0000031_182225_182959 | 244 |
| 966 | 3300048924 | Ga0496121_0011729 | Ga0496121_0011729_6623_7357 | 244 |
| 967 | 3300048924 | Ga0496121_0023622 | Ga0496121_0023622_3452_4186 | 244 |
| 968 | 3300048924 | Ga0496121_0027645 | Ga0496121_0027645_3514_4248 | 244 |
| 969 | 3300048924 | Ga0496121_0048724 | Ga0496121_0048724_535_1269 | 244 |
| 970 | 3300048924 | Ga0496121_0064564 | Ga0496121_0064564_872_1606 | 244 |
| 971 | 3300048925 | Ga0496122_0003525 | Ga0496122_0003525_1574_2308 | 244 |
| 972 | 3300048925 | Ga0496122_0004630 | Ga0496122_0004630_8362_9096 | 244 |
| 973 | 3300048925 | Ga0496122_0010326 | Ga0496122_0010326_2886_3647 | 244 |
| 974 | 3300048925 | Ga0496122_0011135 | Ga0496122_0011135_3863_4597 | 244 |
| 975 | 3300048925 | Ga0496122_0030996 | Ga0496122_0030996_1552_2286 | 244 |
| 976 | 3300048926 | Ga0496123_0003683 | Ga0496123_0003683_14672_15406 | 244 |
| 977 | 3300048926 | Ga0496123_0006523 | Ga0496123_0006523_7816_8550 | 244 |
| 978 | 3300048926 | Ga0496123_0013096 | Ga0496123_0013096_2778_3539 | 244 |
| 979 | 3300048926 | Ga0496123_0014932 | Ga0496123_0014932_2677_3411 | 244 |
| 980 | 3300048926 | Ga0496123_0016214 | Ga0496123_0016214_3871_4605 | 244 |
| 981 | 3300048927 | Ga0496124_0004471 | Ga0496124_0004471_10115_10849 | 244 |
| 982 | 3300048927 | Ga0496124_0010787 | Ga0496124_0010787_2604_3338 | 244 |
| 983 | 3300048927 | Ga0496124_0012015 | Ga0496124_0012015_670_1404 | 244 |
| 984 | 3300048927 | Ga0496124_0140991 | Ga0496124_0140991_1041_1775 | 244 |
| 985 | 3300048927 | Ga0496124_0148322 | Ga0496124_0148322_138_872 | 244 |
| 986 | 3300048927 | Ga0496124_0186639 | Ga0496124_0186639_179_913 | 244 |
| 987 | 3300048927 | Ga0496124_0272975 | Ga0496124_0272975_158_892 | 244 |
| 988 | 3300048927 | Ga0496124_0309621 | Ga0496124_0309621_49_783 | 244 |
| 989 | 3300048928 | Ga0496125_0005087 | Ga0496125_0005087_12297_13031 | 244 |
| 990 | 3300048928 | Ga0496125_0007226 | Ga0496125_0007226_8985_9719 | 244 |
| 991 | 3300048928 | Ga0496125_0009631 | Ga0496125_0009631_2924_3685 | 244 |
| 992 | 3300048928 | Ga0496125_0038131 | Ga0496125_0038131_2823_3557 | 244 |
| 993 | 3300048929 | Ga0496126_0031712 | Ga0496126_0031712_986_1720 | 244 |
| 994 | 3300049128 | Ga0501308_001808 | Ga0501308_001808_66_800 | 244 |
| 995 | 3300049459 | Ga0495678_000010 | Ga0495678_000010_240758_241492 | 244 |
| 996 | 3300049459 | Ga0495678_000190 | Ga0495678_000190_6470_7204 | 244 |
| 997 | 3300049459 | Ga0495678_000774 | Ga0495678_000774_1556_2290 | 244 |
| 998 | 3300049459 | Ga0495678_002527 | Ga0495678_002527_6051_6785 | 244 |
| 999 | 3300049459 | Ga0495678_007129 | Ga0495678_007129_2408_3142 | 244 |
| 1000 | 3300049459 | Ga0495678_010503 | Ga0495678_010503_805_1539 | 244 |
| 1001 | 3300049459 | Ga0495678_019199 | Ga0495678_019199_1551_2285 | 244 |
| 1002 | 3300049459 | Ga0495678_035133 | Ga0495678_035133_1080_1814 | 244 |
| 1003 | 3300049459 | Ga0495678_071648 | Ga0495678_071648_106_840 | 244 |
| 1004 | 3300049460 | Ga0495682_0001034 | Ga0495682_0001034_3136_3870 | 244 |
| 1005 | 3300049460 | Ga0495682_0005671 | Ga0495682_0005671_1864_2598 | 244 |
| 1006 | 3300049460 | Ga0495682_0045630 | Ga0495682_0045630_508_1242 | 244 |
| 1007 | 3300049513 | Ga0501290_001453 | Ga0501290_001453_231_968 | 244 |
| 1008 | 3300049569 | Ga0501032_0025216 | Ga0501032_0025216_2807_3541 | 244 |
| 1009 | 3300049571 | Ga0501034_0170472 | Ga0501034_0170472_305_1039 | 244 |
| 1010 | 3300049654 | Ga0501207_020312 | Ga0501207_020312_156_890 | 244 |
| 1011 | 3300049667 | Ga0501230_002213 | Ga0501230_002213_57_791 | 244 |
| 1012 | 3300049671 | Ga0501238_004739 | Ga0501238_004739_853_1587 | 244 |
| 1013 | 3300049679 | Ga0501249_003941 | Ga0501249_003941_1082_1816 | 244 |
| 1014 | 3300049766 | Ga0501269_000416 | Ga0501269_000416_7905_8639 | 244 |
| 1015 | 3300049775 | Ga0501279_008716 | Ga0501279_008716_278_1012 | 244 |
| 1016 | 3300050511 | nmdc:mga08y16_405438_c1 | nmdc:mga08y16_405438_c1_275_1009 | 244 |
| 1017 | 3300050512 | nmdc:mga0n895_34016_c1 | nmdc:mga0n895_34016_c1_2394_3128 | 244 |
| 1018 | 3300050515 | nmdc:mga0a205_203132_c1 | nmdc:mga0a205_203132_c1_833_1567 | 244 |
| 1019 | 3300053077 | Ga0495601_0009638 | Ga0495601_0009638_2597_3331 | 244 |
| 1020 | 3300053111 | Ga0500572_016555 | Ga0500572_016555_311_1045 | 244 |
| 1021 | 3300053118 | Ga0500594_0006183 | Ga0500594_0006183_985_1719 | 244 |
| 1022 | 3300053119 | Ga0500595_001801 | Ga0500595_001801_8235_8969 | 244 |
| 1023 | 3300053125 | Ga0500618_000364 | Ga0500618_000364_964_1698 | 244 |
| 1024 | 3300053125 | Ga0500618_003165 | Ga0500618_003165_2932_3666 | 244 |
| 1025 | 3300053125 | Ga0500618_004967 | Ga0500618_004967_1218_1952 | 244 |
| 1026 | 3300053141 | Ga0500574_002852 | Ga0500574_002852_1313_2047 | 244 |
| 1027 | 3300053145 | Ga0500586_002898 | Ga0500586_002898_984_1718 | 244 |
| 1028 | 3300053145 | Ga0500586_021361 | Ga0500586_021361_126_860 | 244 |
| 1029 | 3300053154 | Ga0500619_000766 | Ga0500619_000766_2946_3680 | 244 |
| 1030 | 3300053161 | Ga0500634_0123624 | Ga0500634_0123624_476_1210 | 244 |
| 1031 | 3300059478 | Ga0587093_007139 | Ga0587093_007139_330_1064 | 244 |
| 1032 | 3300059493 | Ga0587077_016481 | Ga0587077_016481_336_1070 | 244 |
| 1033 | 3300059504 | Ga0587082_014811 | Ga0587082_014811_431_1165 | 244 |
| 1034 | 3300059505 | Ga0587083_0022915 | Ga0587083_0022915_139_873 | 244 |
| 1035 | 3300059505 | Ga0587083_0025900 | Ga0587083_0025900_319_1053 | 244 |
| 1036 | 3300059506 | Ga0587085_008539 | Ga0587085_008539_194_928 | 244 |
| 1037 | 3300059510 | Ga0587090_010604 | Ga0587090_010604_217_951 | 244 |
| 1038 | 3300059510 | Ga0587090_011356 | Ga0587090_011356_273_1007 | 244 |
| 1039 | 3300059511 | Ga0587091_040564 | Ga0587091_040564_26_760 | 244 |
| 1040 | 3300059512 | Ga0587092_010749 | Ga0587092_010749_376_1110 | 244 |
| 1041 | 3300059639 | Ga0587062_004270 | Ga0587062_004270_610_1344 | 244 |
| 1042 | 3300059641 | Ga0587068_004766 | Ga0587068_004766_940_1674 | 244 |
| 1043 | 3300059641 | Ga0587068_008736 | Ga0587068_008736_171_905 | 244 |
| 1044 | 3300059643 | Ga0587072_020222 | Ga0587072_020222_159_893 | 244 |
| 1045 | 3300059643 | Ga0587072_021628 | Ga0587072_021628_145_879 | 244 |
| 1046 | 3300059645 | Ga0587076_035377 | Ga0587076_035377_145_879 | 244 |
| 1047 | 3300059647 | Ga0587079_026495 | Ga0587079_026495_228_962 | 244 |
| 1048 | 3300060346 | Ga0587111_0007637 | Ga0587111_0007637_172_906 | 244 |
| 1049 | 3300061719 | Ga0466962_0013955 | Ga0466962_0013955_1699_2433 | 244 |
| 1050 | 3300061719 | Ga0466962_0031666 | Ga0466962_0031666_16_750 | 244 |
| 1051 | iso_pu_bacteria | 2687453129 | 2687577761 | 244 |
| 1052 | iso_pu_bacteria | 8057160832 | 8057162633 | 244 |
| 1053 | 3300005435 | Ga0070714_100038437 | Ga0070714_1000384373 | 245 |
| 1054 | 3300005436 | Ga0070713_100065540 | Ga0070713_1000655403 | 245 |
| 1055 | 3300005458 | Ga0070681_10079256 | Ga0070681_100792563 | 245 |
| 1056 | 3300005539 | Ga0068853_100178370 | Ga0068853_1001783702 | 245 |
| 1057 | 3300005563 | Ga0068855_100003915 | Ga0068855_10000391513 | 245 |
| 1058 | 3300005564 | Ga0070664_100592055 | Ga0070664_1005920552 | 245 |
| 1059 | 3300005614 | Ga0068856_100161565 | Ga0068856_1001615652 | 245 |
| 1060 | 3300006028 | Ga0070717_10293650 | Ga0070717_102936502 | 245 |
| 1061 | 3300009093 | Ga0105240_10019527 | Ga0105240_100195274 | 245 |
| 1062 | 3300009551 | Ga0105238_10551097 | Ga0105238_105510972 | 245 |
| 1063 | 3300013307 | Ga0157372_10072658 | Ga0157372_100726583 | 245 |
| 1064 | 3300021361 | Ga0213872_10018649 | Ga0213872_100186492 | 245 |
| 1065 | 3300025909 | Ga0207705_10330705 | Ga0207705_103307052 | 245 |
| 1066 | 3300025911 | Ga0207654_10092385 | Ga0207654_100923853 | 245 |
| 1067 | 3300025924 | Ga0207694_10515190 | Ga0207694_105151902 | 245 |
| 1068 | 3300025949 | Ga0207667_10001085 | Ga0207667_1000108525 | 245 |
| 1069 | 3300026041 | Ga0207639_10337317 | Ga0207639_103373172 | 245 |
| 1070 | 3300026078 | Ga0207702_10022953 | Ga0207702_100229537 | 245 |
| 1071 | 3300031239 | Ga0265328_10000005 | Ga0265328_10000005147 | 245 |
| 1072 | 3300031344 | Ga0265316_10214386 | Ga0265316_102143862 | 245 |
| 1073 | 3300035118 | Ga0373954_0177355 | Ga0373954_0177355_145_882 | 245 |
| 1074 | 3300039447 | Ga0436361_0133183 | Ga0436361_0133183_28088_28840 | 245 |
| 1075 | 3300039447 | Ga0436361_1136783 | Ga0436361_1136783_2246_2998 | 245 |
| 1076 | 3300044656 | Ga0466969_0006033 | Ga0466969_0006033_1991_2728 | 245 |
| 1077 | 3300044693 | Ga0466961_0000260 | Ga0466961_0000260_18546_19283 | 245 |
| 1078 | 3300044712 | Ga0453684_0030951 | Ga0453684_0030951_4879_5619 | 245 |
| 1079 | 3300045049 | Ga0466959_0020955 | Ga0466959_0020955_1228_1965 | 245 |
| 1080 | 3300046471 | Ga0495650_0004232 | Ga0495650_0004232_1995_2732 | 245 |
| 1081 | 3300049459 | Ga0495678_001665 | Ga0495678_001665_13402_14139 | 245 |
| 1082 | 3300049459 | Ga0495678_006438 | Ga0495678_006438_2502_3239 | 245 |
| 1083 | 3300026142 | Ga0207698_10231225 | Ga0207698_102312252 | 246 |
| 1084 | 3300027424 | Ga0209984_1015393 | Ga0209984_10153932 | 246 |
| 1085 | 3300031730 | Ga0307516_10307486 | Ga0307516_103074862 | 246 |
| 1086 | 3300032005 | Ga0307411_10124650 | Ga0307411_101246502 | 246 |
| 1087 | 3300035120 | Ga0373957_0144322 | Ga0373957_0144322_81_842 | 246 |
| 1088 | 3300035172 | Ga0373955_0145301 | Ga0373955_0145301_448_1209 | 246 |
| 1089 | 3300036401 | Ga0373937_0039003 | Ga0373937_0039003_2128_2889 | 246 |
| 1090 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_381735_382508 | 246 |
| 1091 | iso_pu_bacteria | 2857542790 | 2857544047 | 246 |
| 1092 | 3300031727 | Ga0316576_10105075 | Ga0316576_101050753 | 247 |
| 1093 | 3300035398 | Ga0316574_0005596 | Ga0316574_0005596_5611_6354 | 247 |
| 1094 | 3300037418 | Ga0395900_0042927 | Ga0395900_0042927_1818_2570 | 247 |
| 1095 | iso_pu_bacteria | 2547132181 | 2547698536 | 247 |
| 1096 | iso_pu_bacteria | 2600255257 | 2601541779 | 247 |
| 1097 | iso_pu_bacteria | 2600255310 | 2601760177 | 247 |
| 1098 | iso_pu_bacteria | 2600255311 | 2601765541 | 247 |
| 1099 | iso_pu_bacteria | 2602042046 | 2603641611 | 247 |
| 1100 | iso_pu_bacteria | 2609459761 | 2609914184 | 247 |
| 1101 | iso_pu_bacteria | 2690315857 | 2691332773 | 247 |
| 1102 | iso_pu_bacteria | 2791355010 | 2792314559 | 247 |
| 1103 | iso_pu_bacteria | 2811995292 | 2813731170 | 247 |
| 1104 | iso_pu_bacteria | 2814123068 | 2814698862 | 247 |
| 1105 | iso_pu_bacteria | 2846540461 | 2846542741 | 247 |
| 1106 | iso_pu_bacteria | 2919534386 | 2919537900 | 247 |
| 1107 | iso_pu_bacteria | 2945874760 | 2945874978 | 247 |
| 1108 | iso_pu_bacteria | 8054357960 | 8054358892 | 247 |
| 1109 | iso_pu_bacteria | 8055693939 | 8055694180 | 247 |
| 1110 | 3300005330 | Ga0070690_100269075 | Ga0070690_1002690751 | 248 |
| 1111 | 3300005344 | Ga0070661_100058455 | Ga0070661_1000584552 | 248 |
| 1112 | 3300005458 | Ga0070681_10014570 | Ga0070681_100145702 | 248 |
| 1113 | 3300005539 | Ga0068853_100004343 | Ga0068853_1000043436 | 248 |
| 1114 | 3300005544 | Ga0070686_100211913 | Ga0070686_1002119131 | 248 |
| 1115 | 3300005563 | Ga0068855_100396691 | Ga0068855_1003966912 | 248 |
| 1116 | 3300006173 | Ga0070716_100015793 | Ga0070716_1000157933 | 248 |
| 1117 | 3300006881 | Ga0068865_100057233 | Ga0068865_1000572332 | 248 |
| 1118 | 3300009101 | Ga0105247_10012542 | Ga0105247_100125424 | 248 |
| 1119 | 3300009174 | Ga0105241_10039775 | Ga0105241_100397753 | 248 |
| 1120 | 3300013105 | Ga0157369_10484147 | Ga0157369_104841472 | 248 |
| 1121 | 3300014969 | Ga0157376_10103651 | Ga0157376_101036513 | 248 |
| 1122 | 3300025912 | Ga0207707_10183472 | Ga0207707_101834723 | 248 |
| 1123 | 3300025916 | Ga0207663_10005967 | Ga0207663_100059673 | 248 |
| 1124 | 3300025920 | Ga0207649_10191300 | Ga0207649_101913002 | 248 |
| 1125 | 3300025927 | Ga0207687_10198559 | Ga0207687_101985592 | 248 |
| 1126 | 3300025938 | Ga0207704_10129377 | Ga0207704_101293772 | 248 |
| 1127 | 3300025939 | Ga0207665_10002622 | Ga0207665_100026223 | 248 |
| 1128 | 3300025949 | Ga0207667_10153364 | Ga0207667_101533643 | 248 |
| 1129 | 3300025981 | Ga0207640_10241346 | Ga0207640_102413462 | 248 |
| 1130 | 3300025986 | Ga0207658_10254903 | Ga0207658_102549032 | 248 |
| 1131 | 3300026041 | Ga0207639_10161261 | Ga0207639_101612612 | 248 |
| 1132 | 3300026116 | Ga0207674_10348802 | Ga0207674_103488022 | 248 |
| 1133 | 3300031727 | Ga0316576_10118312 | Ga0316576_101183122 | 248 |
| 1134 | 3300032133 | Ga0316583_10002143 | Ga0316583_100021433 | 248 |
| 1135 | 3300046472 | Ga0495580_0014963 | Ga0495580_0014963_3432_4178 | 248 |
| 1136 | 3300046474 | Ga0495605_0004070 | Ga0495605_0004070_3432_4178 | 248 |
| 1137 | 3300046475 | Ga0495639_0034531 | Ga0495639_0034531_288_1034 | 248 |
| 1138 | 3300046476 | Ga0495662_0153763 | Ga0495662_0153763_246_992 | 248 |
| 1139 | 3300048913 | Ga0496110_0054436 | Ga0496110_0054436_2554_3300 | 248 |
| 1140 | 3300049579 | Ga0501043_0210509 | Ga0501043_0210509_662_1408 | 248 |
| 1141 | 3300049823 | Ga0501044_0605967 | Ga0501044_0605967_74_820 | 248 |
| 1142 | 3300053098 | Ga0500650_0000173 | Ga0500650_0000173_15324_16070 | 248 |
| 1143 | 3300036647 | Ga0316582_0013300 | Ga0316582_0013300_167_916 | 249 |
| 1144 | 3300036712 | Ga0316584_0016947 | Ga0316584_0016947_958_1707 | 249 |
| 1145 | 3300038742 | Ga0400486_14879 | Ga0400486_14879_12703_13452 | 249 |
| 1146 | 3300039062 | Ga0400483_024557 | Ga0400483_024557_10422_11171 | 249 |
| 1147 | 3300047323 | Ga0495683_0025662 | Ga0495683_0025662_583_1371 | 249 |
| 1148 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_182511_183299 | 249 |
| 1149 | 3300053138 | Ga0500564_015033 | Ga0500564_015033_2226_2975 | 249 |
| 1150 | 3300035398 | Ga0316574_0016538 | Ga0316574_0016538_1298_2050 | 250 |
| 1151 | 3300035398 | Ga0316574_0170392 | Ga0316574_0170392_101_856 | 251 |
| 1152 | 3300036712 | Ga0316584_0058617 | Ga0316584_0058617_555_1310 | 251 |
| 1153 | 3300046452 | Ga0495617_001485 | Ga0495617_001485_1128_1883 | 251 |
| 1154 | 3300005347 | Ga0070668_100355067 | Ga0070668_1003550671 | 252 |
| 1155 | 3300005441 | Ga0070700_100047678 | Ga0070700_1000476784 | 252 |
| 1156 | 3300005456 | Ga0070678_100149427 | Ga0070678_1001494272 | 252 |
| 1157 | 3300005539 | Ga0068853_100602475 | Ga0068853_1006024752 | 252 |
| 1158 | 3300005543 | Ga0070672_100303253 | Ga0070672_1003032532 | 252 |
| 1159 | 3300009148 | Ga0105243_10135951 | Ga0105243_101359512 | 252 |
| 1160 | 3300009545 | Ga0105237_10516438 | Ga0105237_105164382 | 252 |
| 1161 | 3300013308 | Ga0157375_10056113 | Ga0157375_100561134 | 252 |
| 1162 | 3300015689 | Ga0183360_10154 | Ga0183360_101542 | 252 |
| 1163 | 3300025899 | Ga0207642_10090366 | Ga0207642_100903662 | 252 |
| 1164 | 3300025938 | Ga0207704_10256567 | Ga0207704_102565672 | 252 |
| 1165 | 3300025940 | Ga0207691_10159973 | Ga0207691_101599731 | 252 |
| 1166 | 3300025972 | Ga0207668_10594829 | Ga0207668_105948291 | 252 |
| 1167 | 3300026035 | Ga0207703_10006804 | Ga0207703_100068049 | 252 |
| 1168 | 3300026075 | Ga0207708_10023225 | Ga0207708_100232255 | 252 |
| 1169 | 3300026121 | Ga0207683_10190397 | Ga0207683_101903973 | 252 |
| 1170 | iso_pu_bacteria | 2510065053 | 2510284631 | 252 |
| 1171 | iso_pu_bacteria | 2510065055 | 2510295656 | 252 |
| 1172 | iso_pu_bacteria | 2510065058 | 2510312009 | 252 |
| 1173 | iso_pu_bacteria | 2511231004 | 2511254766 | 252 |
| 1174 | iso_pu_bacteria | 2511231006 | 2511265578 | 252 |
| 1175 | iso_pu_bacteria | 2511231007 | 2511271092 | 252 |
| 1176 | iso_pu_bacteria | 2511231008 | 2511280562 | 252 |
| 1177 | iso_pu_bacteria | 2511231010 | 2511288830 | 252 |
| 1178 | iso_pu_bacteria | 2511231011 | 2511293927 | 252 |
| 1179 | iso_pu_bacteria | 2511231012 | 2511302360 | 252 |
| 1180 | iso_pu_bacteria | 2511231014 | 2511315211 | 252 |
| 1181 | iso_pu_bacteria | 2511231015 | 2511319198 | 252 |
| 1182 | iso_pu_bacteria | 2511231016 | 2511323599 | 252 |
| 1183 | iso_pu_bacteria | 2511231017 | 2511331034 | 252 |
| 1184 | iso_pu_bacteria | 2511231018 | 2511336380 | 252 |
| 1185 | iso_pu_bacteria | 2511231019 | 2511345744 | 252 |
| 1186 | iso_pu_bacteria | 2511231020 | 2511349058 | 252 |
| 1187 | iso_pu_bacteria | 2511231021 | 2511355950 | 252 |
| 1188 | iso_pu_bacteria | 2511231022 | 2511361439 | 252 |
| 1189 | iso_pu_bacteria | 2511231023 | 2511368582 | 252 |
| 1190 | iso_pu_bacteria | 2511231024 | 2511376105 | 252 |
| 1191 | iso_pu_bacteria | 2511231031 | 2511411269 | 252 |
| 1192 | iso_pu_bacteria | 2511231156 | 2511822388 | 252 |
| 1193 | iso_pu_bacteria | 2512047018 | 2512325910 | 252 |
| 1194 | iso_pu_bacteria | 2554235132 | 2554818109 | 252 |
| 1195 | iso_pu_bacteria | 2554235231 | 2555245034 | 252 |
| 1196 | iso_pu_bacteria | 2554235341 | 2555667373 | 252 |
| 1197 | iso_pu_bacteria | 2582580891 | 2583789849 | 252 |
| 1198 | iso_pu_bacteria | 2597489887 | 2597855617 | 252 |
| 1199 | iso_pu_bacteria | 2597489888 | 2597861620 | 252 |
| 1200 | iso_pu_bacteria | 2597489889 | 2597867342 | 252 |
| 1201 | iso_pu_bacteria | 2599185155 | 2599327464 | 252 |
| 1202 | iso_pu_bacteria | 2599185160 | 2599356596 | 252 |
| 1203 | iso_pu_bacteria | 2599185161 | 2599363374 | 252 |
| 1204 | iso_pu_bacteria | 2599185162 | 2599369674 | 252 |
| 1205 | iso_pu_bacteria | 2599185163 | 2599376483 | 252 |
| 1206 | iso_pu_bacteria | 2599185164 | 2599381701 | 252 |
| 1207 | iso_pu_bacteria | 2599185165 | 2599388155 | 252 |
| 1208 | iso_pu_bacteria | 2599185166 | 2599395321 | 252 |
| 1209 | iso_pu_bacteria | 2599185167 | 2599398899 | 252 |
| 1210 | iso_pu_bacteria | 2599185168 | 2599407086 | 252 |
| 1211 | iso_pu_bacteria | 2599185179 | 2599450954 | 252 |
| 1212 | iso_pu_bacteria | 2599185181 | 2599463429 | 252 |
| 1213 | iso_pu_bacteria | 2599185182 | 2599469221 | 252 |
| 1214 | iso_pu_bacteria | 2599185185 | 2599485519 | 252 |
| 1215 | iso_pu_bacteria | 2599185186 | 2599492446 | 252 |
| 1216 | iso_pu_bacteria | 2599185188 | 2599500169 | 252 |
| 1217 | iso_pu_bacteria | 2599185189 | 2599506387 | 252 |
| 1218 | iso_pu_bacteria | 2599185190 | 2599514100 | 252 |
| 1219 | iso_pu_bacteria | 2599185191 | 2599518701 | 252 |
| 1220 | iso_pu_bacteria | 2599185212 | 2599614523 | 252 |
| 1221 | iso_pu_bacteria | 2599185248 | 2599769350 | 252 |
| 1222 | iso_pu_bacteria | 2599185257 | 2599806648 | 252 |
| 1223 | iso_pu_bacteria | 2599185288 | 2599882613 | 252 |
| 1224 | iso_pu_bacteria | 2599185289 | 2599886770 | 252 |
| 1225 | iso_pu_bacteria | 2599185290 | 2599893565 | 252 |
| 1226 | iso_pu_bacteria | 2599185291 | 2599898099 | 252 |
| 1227 | iso_pu_bacteria | 2599185300 | 2599930833 | 252 |
| 1228 | iso_pu_bacteria | 2599185302 | 2599943644 | 252 |
| 1229 | iso_pu_bacteria | 2599185303 | 2599952155 | 252 |
| 1230 | iso_pu_bacteria | 2599185304 | 2599955954 | 252 |
| 1231 | iso_pu_bacteria | 2599185305 | 2599962101 | 252 |
| 1232 | iso_pu_bacteria | 2599185306 | 2599966871 | 252 |
| 1233 | iso_pu_bacteria | 2599185308 | 2599978318 | 252 |
| 1234 | iso_pu_bacteria | 2599185309 | 2599984648 | 252 |
| 1235 | iso_pu_bacteria | 2599185310 | 2599991199 | 252 |
| 1236 | iso_pu_bacteria | 2599185311 | 2599994909 | 252 |
| 1237 | iso_pu_bacteria | 2599185312 | 2600002270 | 252 |
| 1238 | iso_pu_bacteria | 2599185313 | 2600004802 | 252 |
| 1239 | iso_pu_bacteria | 2599185314 | 2600012462 | 252 |
| 1240 | iso_pu_bacteria | 2599185315 | 2600019036 | 252 |
| 1241 | iso_pu_bacteria | 2599185316 | 2600023909 | 252 |
| 1242 | iso_pu_bacteria | 2599185317 | 2600033069 | 252 |
| 1243 | iso_pu_bacteria | 2599185318 | 2600034732 | 252 |
| 1244 | iso_pu_bacteria | 2599185319 | 2600044903 | 252 |
| 1245 | iso_pu_bacteria | 2599185320 | 2600048010 | 252 |
| 1246 | iso_pu_bacteria | 2599185321 | 2600053264 | 252 |
| 1247 | iso_pu_bacteria | 2599185322 | 2600061259 | 252 |
| 1248 | iso_pu_bacteria | 2599185323 | 2600068180 | 252 |
| 1249 | iso_pu_bacteria | 2599185324 | 2600071731 | 252 |
| 1250 | iso_pu_bacteria | 2599185325 | 2600077602 | 252 |
| 1251 | iso_pu_bacteria | 2599185356 | 2600216058 | 252 |
| 1252 | iso_pu_bacteria | 2600254930 | 2600359151 | 252 |
| 1253 | iso_pu_bacteria | 2600254931 | 2600364927 | 252 |
| 1254 | iso_pu_bacteria | 2600254954 | 2600443934 | 252 |
| 1255 | iso_pu_bacteria | 2600255296 | 2601692299 | 252 |
| 1256 | iso_pu_bacteria | 2600255313 | 2601776225 | 252 |
| 1257 | iso_pu_bacteria | 2600255318 | 2601797788 | 252 |
| 1258 | iso_pu_bacteria | 2600255389 | 2602008582 | 252 |
| 1259 | iso_pu_bacteria | 2603880185 | 2606076729 | 252 |
| 1260 | iso_pu_bacteria | 2603880199 | 2606128857 | 252 |
| 1261 | iso_pu_bacteria | 2606217733 | 2608380590 | 252 |
| 1262 | iso_pu_bacteria | 2619619299 | 2621302219 | 252 |
| 1263 | iso_pu_bacteria | 2623620443 | 2624478175 | 252 |
| 1264 | iso_pu_bacteria | 2623620446 | 2624489718 | 252 |
| 1265 | iso_pu_bacteria | 2643221565 | 2643840935 | 252 |
| 1266 | iso_pu_bacteria | 2643221571 | 2643872664 | 252 |
| 1267 | iso_pu_bacteria | 2643221589 | 2643954959 | 252 |
| 1268 | iso_pu_bacteria | 2643221602 | 2644024597 | 252 |
| 1269 | iso_pu_bacteria | 2643221633 | 2644186077 | 252 |
| 1270 | iso_pu_bacteria | 2643221650 | 2644282122 | 252 |
| 1271 | iso_pu_bacteria | 2643221713 | 2644619605 | 252 |
| 1272 | iso_pu_bacteria | 2651869719 | 2652546251 | 252 |
| 1273 | iso_pu_bacteria | 2667528170 | 2671090862 | 252 |
| 1274 | iso_pu_bacteria | 2667528171 | 2671100014 | 252 |
| 1275 | iso_pu_bacteria | 2667528176 | 2671127278 | 252 |
| 1276 | iso_pu_bacteria | 2671180172 | 2671772299 | 252 |
| 1277 | iso_pu_bacteria | 2675903420 | 2677898259 | 252 |
| 1278 | iso_pu_bacteria | 2675903515 | 2678260930 | 252 |
| 1279 | iso_pu_bacteria | 2713897149 | 2715759544 | 252 |
| 1280 | iso_pu_bacteria | 2718217725 | 2718632115 | 252 |
| 1281 | iso_pu_bacteria | 2721755607 | 2723246511 | 252 |
| 1282 | iso_pu_bacteria | 2728369097 | 2729146677 | 252 |
| 1283 | iso_pu_bacteria | 2738541265 | 2738674876 | 252 |
| 1284 | iso_pu_bacteria | 2738541282 | 2738753269 | 252 |
| 1285 | iso_pu_bacteria | 2738541294 | 2738807960 | 252 |
| 1286 | iso_pu_bacteria | 2738541303 | 2738862835 | 252 |
| 1287 | iso_pu_bacteria | 2738541309 | 2738895320 | 252 |
| 1288 | iso_pu_bacteria | 2738543004 | 2739197980 | 252 |
| 1289 | iso_pu_bacteria | 2738543015 | 2739260354 | 252 |
| 1290 | iso_pu_bacteria | 2738543020 | 2739286990 | 252 |
| 1291 | iso_pu_bacteria | 2738543021 | 2739292303 | 252 |
| 1292 | iso_pu_bacteria | 2738543025 | 2739311236 | 252 |
| 1293 | iso_pu_bacteria | 2740892503 | 2743735033 | 252 |
| 1294 | iso_pu_bacteria | 2744054620 | 2745006242 | 252 |
| 1295 | iso_pu_bacteria | 2765235841 | 2765581583 | 252 |
| 1296 | iso_pu_bacteria | 2773857670 | 2774119604 | 252 |
| 1297 | iso_pu_bacteria | 2773857672 | 2774130689 | 252 |
| 1298 | iso_pu_bacteria | 2773857673 | 2774134693 | 252 |
| 1299 | iso_pu_bacteria | 2784132063 | 2784261094 | 252 |
| 1300 | iso_pu_bacteria | 2784132072 | 2784316321 | 252 |
| 1301 | iso_pu_bacteria | 2791355520 | 2794593931 | 252 |
| 1302 | iso_pu_bacteria | 2806310737 | 2807406212 | 252 |
| 1303 | iso_pu_bacteria | 2806310745 | 2807454564 | 252 |
| 1304 | iso_pu_bacteria | 2808606361 | 2808856519 | 252 |
| 1305 | iso_pu_bacteria | 2808606373 | 2808905479 | 252 |
| 1306 | iso_pu_bacteria | 2808606376 | 2808922802 | 252 |
| 1307 | iso_pu_bacteria | 2808606377 | 2808932135 | 252 |
| 1308 | iso_pu_bacteria | 2808606378 | 2808936578 | 252 |
| 1309 | iso_pu_bacteria | 2808606379 | 2808939729 | 252 |
| 1310 | iso_pu_bacteria | 2808606380 | 2808944489 | 252 |
| 1311 | iso_pu_bacteria | 2808606381 | 2808954264 | 252 |
| 1312 | iso_pu_bacteria | 2808606382 | 2808955814 | 252 |
| 1313 | iso_pu_bacteria | 2808606383 | 2808964906 | 252 |
| 1314 | iso_pu_bacteria | 2808606385 | 2808976710 | 252 |
| 1315 | iso_pu_bacteria | 2808606388 | 2808991852 | 252 |
| 1316 | iso_pu_bacteria | 2808606389 | 2808999798 | 252 |
| 1317 | iso_pu_bacteria | 2808606445 | 2809217934 | 252 |
| 1318 | iso_pu_bacteria | 2811994881 | 2812370136 | 252 |
| 1319 | iso_pu_bacteria | 2816332298 | 2817488367 | 252 |
| 1320 | iso_pu_bacteria | 2818991456 | 2819657184 | 252 |
| 1321 | iso_pu_bacteria | 2818991464 | 2819705170 | 252 |
| 1322 | iso_pu_bacteria | 2823421272 | 2823425559 | 252 |
| 1323 | iso_pu_bacteria | 2825651385 | 2825654313 | 252 |
| 1324 | iso_pu_bacteria | 2826581358 | 2826582492 | 252 |
| 1325 | iso_pu_bacteria | 2834028612 | 2834032254 | 252 |
| 1326 | iso_pu_bacteria | 2842805378 | 2842809043 | 252 |
| 1327 | iso_pu_bacteria | 2842815866 | 2842817663 | 252 |
| 1328 | iso_pu_bacteria | 2842826826 | 2842830669 | 252 |
| 1329 | iso_pu_bacteria | 2842832357 | 2842834116 | 252 |
| 1330 | iso_pu_bacteria | 2842837860 | 2842838574 | 252 |
| 1331 | iso_pu_bacteria | 2842843487 | 2842846409 | 252 |
| 1332 | iso_pu_bacteria | 2842849001 | 2842851620 | 252 |
| 1333 | iso_pu_bacteria | 2842854478 | 2842858780 | 252 |
| 1334 | iso_pu_bacteria | 2844665904 | 2844667854 | 252 |
| 1335 | iso_pu_bacteria | 2852612431 | 2852617028 | 252 |
| 1336 | iso_pu_bacteria | 2852657418 | 2852660497 | 252 |
| 1337 | iso_pu_bacteria | 2852667396 | 2852671983 | 252 |
| 1338 | iso_pu_bacteria | 2860339153 | 2860343684 | 252 |
| 1339 | iso_pu_bacteria | 2860867994 | 2860872879 | 252 |
| 1340 | iso_pu_bacteria | 2878029506 | 2878030120 | 252 |
| 1341 | iso_pu_bacteria | 2880230671 | 2880231067 | 252 |
| 1342 | iso_pu_bacteria | 2904518522 | 2904519526 | 252 |
| 1343 | iso_pu_bacteria | 2904550169 | 2904552289 | 252 |
| 1344 | iso_pu_bacteria | 2908446538 | 2908446985 | 252 |
| 1345 | iso_pu_bacteria | 2912963787 | 2912964152 | 252 |
| 1346 | iso_pu_bacteria | 2913036834 | 2913037228 | 252 |
| 1347 | iso_pu_bacteria | 2917070673 | 2917071124 | 252 |
| 1348 | iso_pu_bacteria | 2917832318 | 2917834393 | 252 |
| 1349 | iso_pu_bacteria | 2919063839 | 2919066198 | 252 |
| 1350 | iso_pu_bacteria | 2919125081 | 2919127946 | 252 |
| 1351 | iso_pu_bacteria | 2919155634 | 2919157561 | 252 |
| 1352 | iso_pu_bacteria | 2919385768 | 2919389821 | 252 |
| 1353 | iso_pu_bacteria | 2919456309 | 2919459941 | 252 |
| 1354 | iso_pu_bacteria | 2919481497 | 2919486832 | 252 |
| 1355 | iso_pu_bacteria | 2919487758 | 2919488753 | 252 |
| 1356 | iso_pu_bacteria | 2919501602 | 2919502295 | 252 |
| 1357 | iso_pu_bacteria | 2919697872 | 2919699003 | 252 |
| 1358 | iso_pu_bacteria | 2923153595 | 2923154028 | 252 |
| 1359 | iso_pu_bacteria | 2923519811 | 2923524227 | 252 |
| 1360 | iso_pu_bacteria | 2923586266 | 2923589725 | 252 |
| 1361 | iso_pu_bacteria | 2926063275 | 2926063968 | 252 |
| 1362 | iso_pu_bacteria | 2929144301 | 2929144759 | 252 |
| 1363 | iso_pu_bacteria | 2929189879 | 2929190258 | 252 |
| 1364 | iso_pu_bacteria | 2931369376 | 2931371907 | 252 |
| 1365 | iso_pu_bacteria | 2931390751 | 2931391330 | 252 |
| 1366 | iso_pu_bacteria | 2931396565 | 2931398792 | 252 |
| 1367 | iso_pu_bacteria | 2935353572 | 2935358952 | 252 |
| 1368 | iso_pu_bacteria | 2939636861 | 2939641054 | 252 |
| 1369 | iso_pu_bacteria | 2939651529 | 2939655269 | 252 |
| 1370 | iso_pu_bacteria | 2945928738 | 2945930219 | 252 |
| 1371 | iso_pu_bacteria | 2946006987 | 2946012554 | 252 |
| 1372 | iso_pu_bacteria | 2947233263 | 2947235129 | 252 |
| 1373 | iso_pu_bacteria | 2969304461 | 2969304914 | 252 |
| 1374 | iso_pu_bacteria | 2974298342 | 2974298460 | 252 |
| 1375 | iso_pu_bacteria | 2984286254 | 2984292031 | 252 |
| 1376 | iso_pu_bacteria | 2984499530 | 2984504162 | 252 |
| 1377 | iso_pu_bacteria | 2984504281 | 2984505859 | 252 |
| 1378 | iso_pu_bacteria | 2988728565 | 2988732151 | 252 |
| 1379 | iso_pu_bacteria | 2990196909 | 2990199620 | 252 |
| 1380 | iso_pu_bacteria | 3007252601 | 3007254671 | 252 |
| 1381 | iso_pu_bacteria | 3007315729 | 3007316551 | 252 |
| 1382 | iso_pu_bacteria | 3007395558 | 3007398041 | 252 |
| 1383 | iso_pu_bacteria | 3007511990 | 3007517850 | 252 |
| 1384 | iso_pu_bacteria | 3007614139 | 3007614615 | 252 |
| 1385 | iso_pu_bacteria | 3007619802 | 3007625032 | 252 |
| 1386 | iso_pu_bacteria | 3007718800 | 3007724359 | 252 |
| 1387 | iso_pu_bacteria | 3007803356 | 3007803712 | 252 |
| 1388 | iso_pu_bacteria | 3007855910 | 3007859655 | 252 |
| 1389 | iso_pu_bacteria | 3007861166 | 3007864377 | 252 |
| 1390 | iso_pu_bacteria | 3007866637 | 3007872084 | 252 |
| 1391 | iso_pu_bacteria | 3007872151 | 3007876667 | 252 |
| 1392 | iso_pu_bacteria | 640427133 | 640486296 | 252 |
| 1393 | iso_pu_bacteria | 651053060 | 651174261 | 252 |
| 1394 | iso_pu_bacteria | 8011350971 | 8011352532 | 252 |
| 1395 | iso_pu_bacteria | 8015687852 | 8015688277 | 252 |
| 1396 | iso_pu_bacteria | 8016728285 | 8016732181 | 252 |
| 1397 | iso_pu_bacteria | 8019769354 | 8019770264 | 252 |
| 1398 | iso_pu_bacteria | 8019775933 | 8019777292 | 252 |
| 1399 | iso_pu_bacteria | 8034962539 | 8034963505 | 252 |
| 1400 | iso_pu_bacteria | 8052494512 | 8052495020 | 252 |
| 1401 | iso_pu_bacteria | 8054285046 | 8054290221 | 252 |
| 1402 | iso_pu_bacteria | 8054347763 | 8054350171 | 252 |
| 1403 | iso_pu_bacteria | 8054503363 | 8054503907 | 252 |
| 1404 | iso_pu_bacteria | 8054929484 | 8054930679 | 252 |
| 1405 | iso_pu_bacteria | 8055770955 | 8055771375 | 252 |
| 1406 | iso_pu_bacteria | 8055817908 | 8055818310 | 252 |
| 1407 | iso_pu_bacteria | 8055878733 | 8055880002 | 252 |
| 1408 | iso_pu_bacteria | 8056115690 | 8056116697 | 252 |
| 1409 | iso_pu_bacteria | 8056120720 | 8056125497 | 252 |
| 1410 | iso_pu_bacteria | 8056125926 | 8056126419 | 252 |
| 1411 | iso_pu_bacteria | 8056131705 | 8056132289 | 252 |
| 1412 | iso_pu_bacteria | 8056137416 | 8056142586 | 252 |
| 1413 | iso_pu_bacteria | 8056143049 | 8056143685 | 252 |
| 1414 | iso_pu_bacteria | 8056148874 | 8056152432 | 252 |
| 1415 | iso_pu_bacteria | 8056155041 | 8056158469 | 252 |
| 1416 | iso_pu_bacteria | 8056161164 | 8056164300 | 252 |
| 1417 | iso_pu_bacteria | 8056166840 | 8056170635 | 252 |
| 1418 | iso_pu_bacteria | 8056172158 | 8056176747 | 252 |
| 1419 | iso_pu_bacteria | 8056177738 | 8056183096 | 252 |
| 1420 | iso_pu_bacteria | 8056569372 | 8056572277 | 252 |
| 1421 | iso_pu_bacteria | 8057798959 | 8057802666 | 252 |
| 1422 | 3300005335 | Ga0070666_10001127 | Ga0070666_100011273 | 253 |
| 1423 | 3300005338 | Ga0068868_100002829 | Ga0068868_1000028299 | 253 |
| 1424 | 3300005340 | Ga0070689_100022500 | Ga0070689_1000225002 | 253 |
| 1425 | 3300005364 | Ga0070673_100074726 | Ga0070673_1000747262 | 253 |
| 1426 | 3300005367 | Ga0070667_100010227 | Ga0070667_1000102274 | 253 |
| 1427 | 3300005457 | Ga0070662_100162552 | Ga0070662_1001625522 | 253 |
| 1428 | 3300005535 | Ga0070684_100145004 | Ga0070684_1001450042 | 253 |
| 1429 | 3300005539 | Ga0068853_100283618 | Ga0068853_1002836182 | 253 |
| 1430 | 3300005544 | Ga0070686_100087636 | Ga0070686_1000876362 | 253 |
| 1431 | 3300005548 | Ga0070665_100018864 | Ga0070665_1000188644 | 253 |
| 1432 | 3300005564 | Ga0070664_100010538 | Ga0070664_1000105383 | 253 |
| 1433 | 3300005615 | Ga0070702_100008784 | Ga0070702_1000087844 | 253 |
| 1434 | 3300005617 | Ga0068859_100005859 | Ga0068859_1000058592 | 253 |
| 1435 | 3300005618 | Ga0068864_100002557 | Ga0068864_10000255710 | 253 |
| 1436 | 3300006931 | Ga0097620_100005859 | Ga0097620_1000058592 | 253 |
| 1437 | 3300009093 | Ga0105240_10061599 | Ga0105240_100615994 | 253 |
| 1438 | 3300009101 | Ga0105247_10004253 | Ga0105247_100042533 | 253 |
| 1439 | 3300009174 | Ga0105241_10055742 | Ga0105241_100557424 | 253 |
| 1440 | 3300009177 | Ga0105248_10002113 | Ga0105248_1000211317 | 253 |
| 1441 | 3300009545 | Ga0105237_10020762 | Ga0105237_100207624 | 253 |
| 1442 | 3300009551 | Ga0105238_10002078 | Ga0105238_1000207819 | 253 |
| 1443 | 3300009551 | Ga0105238_10027792 | Ga0105238_100277924 | 253 |
| 1444 | 3300009553 | Ga0105249_10143100 | Ga0105249_101431002 | 253 |
| 1445 | 3300010375 | Ga0105239_10008100 | Ga0105239_100081004 | 253 |
| 1446 | 3300010375 | Ga0105239_10033547 | Ga0105239_100335472 | 253 |
| 1447 | 3300011119 | Ga0105246_10004799 | Ga0105246_100047994 | 253 |
| 1448 | 3300013105 | Ga0157369_10000537 | Ga0157369_1000053723 | 253 |
| 1449 | 3300013306 | Ga0163162_10016611 | Ga0163162_100166115 | 253 |
| 1450 | 3300014325 | Ga0163163_10003386 | Ga0163163_1000338610 | 253 |
| 1451 | 3300014745 | Ga0157377_10007511 | Ga0157377_100075112 | 253 |
| 1452 | 3300014968 | Ga0157379_10107319 | Ga0157379_101073192 | 253 |
| 1453 | 3300014969 | Ga0157376_10041402 | Ga0157376_100414022 | 253 |
| 1454 | 3300025903 | Ga0207680_10058347 | Ga0207680_100583472 | 253 |
| 1455 | 3300025906 | Ga0207699_10129730 | Ga0207699_101297302 | 253 |
| 1456 | 3300025913 | Ga0207695_10004927 | Ga0207695_1000492716 | 253 |
| 1457 | 3300025914 | Ga0207671_10003371 | Ga0207671_100033717 | 253 |
| 1458 | 3300025914 | Ga0207671_10005095 | Ga0207671_1000509510 | 253 |
| 1459 | 3300025918 | Ga0207662_10314382 | Ga0207662_103143821 | 253 |
| 1460 | 3300025920 | Ga0207649_10011459 | Ga0207649_100114594 | 253 |
| 1461 | 3300025924 | Ga0207694_10002811 | Ga0207694_100028114 | 253 |
| 1462 | 3300025924 | Ga0207694_10027879 | Ga0207694_100278793 | 253 |
| 1463 | 3300025925 | Ga0207650_10044437 | Ga0207650_100444373 | 253 |
| 1464 | 3300025927 | Ga0207687_10030810 | Ga0207687_100308102 | 253 |
| 1465 | 3300025931 | Ga0207644_10018840 | Ga0207644_100188404 | 253 |
| 1466 | 3300025940 | Ga0207691_10570357 | Ga0207691_105703571 | 253 |
| 1467 | 3300025944 | Ga0207661_10107254 | Ga0207661_101072542 | 253 |
| 1468 | 3300025960 | Ga0207651_10116229 | Ga0207651_101162292 | 253 |
| 1469 | 3300025961 | Ga0207712_10090785 | Ga0207712_100907853 | 253 |
| 1470 | 3300026041 | Ga0207639_10342056 | Ga0207639_103420561 | 253 |
| 1471 | 3300026142 | Ga0207698_10401314 | Ga0207698_104013141 | 253 |
| 1472 | 3300028379 | Ga0268266_10014303 | Ga0268266_100143034 | 253 |
| 1473 | 3300028381 | Ga0268264_10020011 | Ga0268264_100200114 | 253 |
| 1474 | 3300031733 | Ga0316577_10081869 | Ga0316577_100818692 | 253 |
| 1475 | 3300032168 | Ga0316593_10001594 | Ga0316593_100015943 | 253 |
| 1476 | 3300036647 | Ga0316582_0014298 | Ga0316582_0014298_2041_2805 | 253 |
| 1477 | 3300036712 | Ga0316584_0013824 | Ga0316584_0013824_3814_4578 | 253 |
| 1478 | 3300037588 | Ga0316581_0073666 | Ga0316581_0073666_230_991 | 253 |
| 1479 | 3300047319 | Ga0495674_0104664 | Ga0495674_0104664_1374_2135 | 253 |
| 1480 | 3300048912 | Ga0496109_0024376 | Ga0496109_0024376_594_1355 | 253 |
| 1481 | 3300048916 | Ga0496113_0075979 | Ga0496113_0075979_10_771 | 253 |
| 1482 | 3300048919 | Ga0496116_0000008 | Ga0496116_0000008_426881_427642 | 253 |
| 1483 | 3300048924 | Ga0496121_0000012 | Ga0496121_0000012_288110_288871 | 253 |
| 1484 | 3300049574 | Ga0501038_0050136 | Ga0501038_0050136_2736_3521 | 253 |
| 1485 | 3300005328 | Ga0070676_10106008 | Ga0070676_101060082 | 254 |
| 1486 | 3300005331 | Ga0070670_100062353 | Ga0070670_1000623532 | 254 |
| 1487 | 3300005340 | Ga0070689_100128199 | Ga0070689_1001281992 | 254 |
| 1488 | 3300005353 | Ga0070669_100026715 | Ga0070669_1000267151 | 254 |
| 1489 | 3300005354 | Ga0070675_100090409 | Ga0070675_1000904093 | 254 |
| 1490 | 3300005459 | Ga0068867_100244163 | Ga0068867_1002441632 | 254 |
| 1491 | 3300006881 | Ga0068865_100074790 | Ga0068865_1000747902 | 254 |
| 1492 | 3300025907 | Ga0207645_10090148 | Ga0207645_100901482 | 254 |
| 1493 | 3300025908 | Ga0207643_10081658 | Ga0207643_100816582 | 254 |
| 1494 | 3300025923 | Ga0207681_10057803 | Ga0207681_100578034 | 254 |
| 1495 | 3300025925 | Ga0207650_10213466 | Ga0207650_102134662 | 254 |
| 1496 | 3300025936 | Ga0207670_10102381 | Ga0207670_101023812 | 254 |
| 1497 | 3300025940 | Ga0207691_10110359 | Ga0207691_101103593 | 254 |
| 1498 | 3300026089 | Ga0207648_10093658 | Ga0207648_100936583 | 254 |
| 1499 | 3300026121 | Ga0207683_10002493 | Ga0207683_100024934 | 254 |
| 1500 | 2124908027 | MRS2a_Contig_1652 | MRS2a_00514420 | 256 |
| 1501 | 3300002737 | JGI25162J39368_1000098 | JGI25162J39368_100009819 | 256 |
| 1502 | 3300002737 | JGI25162J39368_1000129 | JGI25162J39368_10001294 | 256 |
| 1503 | 3300002772 | JGI25164J39214_1000076 | JGI25164J39214_100007672 | 256 |
| 1504 | 3300002772 | JGI25164J39214_1000101 | JGI25164J39214_100010174 | 256 |
| 1505 | 3300003214 | JGI25165J46597_1000150 | JGI25165J46597_100015028 | 256 |
| 1506 | 3300003214 | JGI25165J46597_1000180 | JGI25165J46597_100018019 | 256 |
| 1507 | 3300003751 | Ga0055538_1000037 | Ga0055538_1000037141 | 256 |
| 1508 | 3300003752 | Ga0055539_1000048 | Ga0055539_1000048141 | 256 |
| 1509 | 3300003756 | Ga0055533_1000059 | Ga0055533_1000059141 | 256 |
| 1510 | 3300003758 | Ga0055532_1000105 | Ga0055532_100010564 | 256 |
| 1511 | 3300003759 | Ga0055525_1000128 | Ga0055525_100012819 | 256 |
| 1512 | 3300003781 | Ga0055536_1002523 | Ga0055536_10025231 | 256 |
| 1513 | 3300003784 | Ga0055534_1018769 | Ga0055534_10187691 | 256 |
| 1514 | 3300003791 | Ga0055530_10000312 | Ga0055530_1000031212 | 256 |
| 1515 | 3300003791 | Ga0055530_10001569 | Ga0055530_1000156911 | 256 |
| 1516 | 3300003792 | Ga0055540_1000217 | Ga0055540_100021726 | 256 |
| 1517 | 3300003792 | Ga0055540_1000294 | Ga0055540_100029428 | 256 |
| 1518 | 3300003792 | Ga0055540_1001288 | Ga0055540_100128815 | 256 |
| 1519 | 3300003794 | Ga0055531_10000238 | Ga0055531_1000023837 | 256 |
| 1520 | 3300003794 | Ga0055531_10000275 | Ga0055531_1000027527 | 256 |
| 1521 | 3300003841 | Ga0055541_1000035 | Ga0055541_100003519 | 256 |
| 1522 | 3300003856 | Ga0058692_1020622 | Ga0058692_10206221 | 256 |
| 1523 | 3300005288 | Ga0065714_10000282 | Ga0065714_100002824 | 256 |
| 1524 | 3300005288 | Ga0065714_10022826 | Ga0065714_100228261 | 256 |
| 1525 | 3300005288 | Ga0065714_10066311 | Ga0065714_100663113 | 256 |
| 1526 | 3300005289 | Ga0065704_10007693 | Ga0065704_100076933 | 256 |
| 1527 | 3300005289 | Ga0065704_10159285 | Ga0065704_101592851 | 256 |
| 1528 | 3300005290 | Ga0065712_10008788 | Ga0065712_100087883 | 256 |
| 1529 | 3300005290 | Ga0065712_10067807 | Ga0065712_1006780724 | 256 |
| 1530 | 3300005293 | Ga0065715_10145527 | Ga0065715_101455272 | 256 |
| 1531 | 3300005339 | Ga0070660_100383095 | Ga0070660_1003830952 | 256 |
| 1532 | 3300005344 | Ga0070661_100000178 | Ga0070661_1000001782 | 256 |
| 1533 | 3300005353 | Ga0070669_100000265 | Ga0070669_1000002657 | 256 |
| 1534 | 3300005353 | Ga0070669_100005987 | Ga0070669_1000059873 | 256 |
| 1535 | 3300005457 | Ga0070662_100000348 | Ga0070662_10000034824 | 256 |
| 1536 | 3300005457 | Ga0070662_100040368 | Ga0070662_1000403683 | 256 |
| 1537 | 3300005539 | Ga0068853_100000029 | Ga0068853_10000002917 | 256 |
| 1538 | 3300005548 | Ga0070665_100064242 | Ga0070665_1000642426 | 256 |
| 1539 | 3300005564 | Ga0070664_100000680 | Ga0070664_10000068023 | 256 |
| 1540 | 3300005564 | Ga0070664_100064635 | Ga0070664_1000646355 | 256 |
| 1541 | 3300005577 | Ga0068857_100160228 | Ga0068857_1001602283 | 256 |
| 1542 | 3300005834 | Ga0068851_10000024 | Ga0068851_1000002481 | 256 |
| 1543 | 3300006058 | Ga0075432_10006193 | Ga0075432_100061933 | 256 |
| 1544 | 3300006058 | Ga0075432_10155801 | Ga0075432_101558011 | 256 |
| 1545 | 3300006944 | Ga0099823_1000243 | Ga0099823_10002435 | 256 |
| 1546 | 3300006944 | Ga0099823_1041682 | Ga0099823_10416822 | 256 |
| 1547 | 3300006946 | Ga0079104_1000508 | Ga0079104_100050810 | 256 |
| 1548 | 3300006948 | Ga0099826_10022339 | Ga0099826_100223393 | 256 |
| 1549 | 3300009011 | Ga0105251_10000118 | Ga0105251_1000011840 | 256 |
| 1550 | 3300009011 | Ga0105251_10000191 | Ga0105251_1000019128 | 256 |
| 1551 | 3300009011 | Ga0105251_10000327 | Ga0105251_1000032731 | 256 |
| 1552 | 3300009011 | Ga0105251_10000977 | Ga0105251_100009779 | 256 |
| 1553 | 3300009011 | Ga0105251_10002348 | Ga0105251_1000234813 | 256 |
| 1554 | 3300009011 | Ga0105251_10003254 | Ga0105251_100032543 | 256 |
| 1555 | 3300009011 | Ga0105251_10003735 | Ga0105251_100037358 | 256 |
| 1556 | 3300009011 | Ga0105251_10005020 | Ga0105251_100050203 | 256 |
| 1557 | 3300009011 | Ga0105251_10025865 | Ga0105251_100258654 | 256 |
| 1558 | 3300009011 | Ga0105251_10044310 | Ga0105251_100443102 | 256 |
| 1559 | 3300009011 | Ga0105251_10122702 | Ga0105251_101227022 | 256 |
| 1560 | 3300009036 | Ga0105244_10001496 | Ga0105244_1000149617 | 256 |
| 1561 | 3300009036 | Ga0105244_10002769 | Ga0105244_100027692 | 256 |
| 1562 | 3300009036 | Ga0105244_10003018 | Ga0105244_100030183 | 256 |
| 1563 | 3300009036 | Ga0105244_10005078 | Ga0105244_100050784 | 256 |
| 1564 | 3300009036 | Ga0105244_10008540 | Ga0105244_100085406 | 256 |
| 1565 | 3300009036 | Ga0105244_10011004 | Ga0105244_100110043 | 256 |
| 1566 | 3300009036 | Ga0105244_10032077 | Ga0105244_100320771 | 256 |
| 1567 | 3300009036 | Ga0105244_10038657 | Ga0105244_100386573 | 256 |
| 1568 | 3300009036 | Ga0105244_10054229 | Ga0105244_100542293 | 256 |
| 1569 | 3300009092 | Ga0105250_10000251 | Ga0105250_100002511 | 256 |
| 1570 | 3300009092 | Ga0105250_10000487 | Ga0105250_1000048717 | 256 |
| 1571 | 3300009092 | Ga0105250_10019916 | Ga0105250_100199161 | 256 |
| 1572 | 3300009148 | Ga0105243_10000299 | Ga0105243_100002998 | 256 |
| 1573 | 3300009148 | Ga0105243_10005926 | Ga0105243_100059268 | 256 |
| 1574 | 3300009148 | Ga0105243_10009460 | Ga0105243_100094608 | 256 |
| 1575 | 3300009148 | Ga0105243_10118388 | Ga0105243_101183883 | 256 |
| 1576 | 3300009176 | Ga0105242_10001173 | Ga0105242_100011738 | 256 |
| 1577 | 3300009177 | Ga0105248_10024766 | Ga0105248_100247667 | 256 |
| 1578 | 3300009545 | Ga0105237_10002206 | Ga0105237_100022063 | 256 |
| 1579 | 3300009553 | Ga0105249_10038235 | Ga0105249_100382356 | 256 |
| 1580 | 3300009553 | Ga0105249_10888895 | Ga0105249_108888951 | 256 |
| 1581 | 3300010375 | Ga0105239_10515560 | Ga0105239_105155601 | 256 |
| 1582 | 3300011119 | Ga0105246_10000652 | Ga0105246_1000065216 | 256 |
| 1583 | 3300011119 | Ga0105246_10011845 | Ga0105246_100118455 | 256 |
| 1584 | 3300011119 | Ga0105246_10070897 | Ga0105246_100708973 | 256 |
| 1585 | 3300013100 | Ga0157373_10000793 | Ga0157373_1000079317 | 256 |
| 1586 | 3300013100 | Ga0157373_10004410 | Ga0157373_100044109 | 256 |
| 1587 | 3300013102 | Ga0157371_10000238 | Ga0157371_1000023826 | 256 |
| 1588 | 3300013102 | Ga0157371_10087043 | Ga0157371_100870433 | 256 |
| 1589 | 3300013102 | Ga0157371_10118230 | Ga0157371_101182303 | 256 |
| 1590 | 3300013104 | Ga0157370_10127631 | Ga0157370_101276312 | 256 |
| 1591 | 3300013104 | Ga0157370_10129271 | Ga0157370_101292712 | 256 |
| 1592 | 3300013306 | Ga0163162_10142729 | Ga0163162_101427293 | 256 |
| 1593 | 3300013306 | Ga0163162_10183552 | Ga0163162_101835522 | 256 |
| 1594 | 3300013307 | Ga0157372_10006660 | Ga0157372_100066605 | 256 |
| 1595 | 3300013307 | Ga0157372_10049515 | Ga0157372_100495157 | 256 |
| 1596 | 3300013307 | Ga0157372_10229871 | Ga0157372_102298713 | 256 |
| 1597 | 3300014497 | Ga0182008_10001211 | Ga0182008_1000121114 | 256 |
| 1598 | 3300014497 | Ga0182008_10010498 | Ga0182008_100104983 | 256 |
| 1599 | 3300015261 | Ga0182006_1010430 | Ga0182006_10104305 | 256 |
| 1600 | 3300017792 | Ga0163161_10111303 | Ga0163161_101113031 | 256 |
| 1601 | 3300025206 | Ga0209435_100319 | Ga0209435_10031911 | 256 |
| 1602 | 3300025207 | Ga0209760_100080 | Ga0209760_10008040 | 256 |
| 1603 | 3300025207 | Ga0209760_100465 | Ga0209760_1004652 | 256 |
| 1604 | 3300025224 | Ga0209784_100028 | Ga0209784_10002819 | 256 |
| 1605 | 3300025225 | Ga0209566_100028 | Ga0209566_10002819 | 256 |
| 1606 | 3300025226 | Ga0209674_100047 | Ga0209674_10004719 | 256 |
| 1607 | 3300025229 | Ga0209147_100031 | Ga0209147_10003119 | 256 |
| 1608 | 3300025230 | Ga0209563_100050 | Ga0209563_10005019 | 256 |
| 1609 | 3300025230 | Ga0209563_102312 | Ga0209563_1023125 | 256 |
| 1610 | 3300025231 | Ga0207427_100014 | Ga0207427_100014326 | 256 |
| 1611 | 3300025231 | Ga0207427_100016 | Ga0207427_10001694 | 256 |
| 1612 | 3300025233 | Ga0209437_100011 | Ga0209437_100011283 | 256 |
| 1613 | 3300025233 | Ga0209437_100016 | Ga0209437_100016311 | 256 |
| 1614 | 3300025242 | Ga0209258_100460 | Ga0209258_10046028 | 256 |
| 1615 | 3300025246 | Ga0209646_1000183 | Ga0209646_100018364 | 256 |
| 1616 | 3300025253 | Ga0209677_100029 | Ga0209677_10002919 | 256 |
| 1617 | 3300025261 | Ga0209233_1000019 | Ga0209233_1000019283 | 256 |
| 1618 | 3300025261 | Ga0209233_1000036 | Ga0209233_1000036326 | 256 |
| 1619 | 3300025291 | Ga0209675_1010611 | Ga0209675_10106115 | 256 |
| 1620 | 3300025292 | Ga0209676_1000025 | Ga0209676_1000025314 | 256 |
| 1621 | 3300025292 | Ga0209676_1000032 | Ga0209676_1000032307 | 256 |
| 1622 | 3300025292 | Ga0209676_1001206 | Ga0209676_10012063 | 256 |
| 1623 | 3300025292 | Ga0209676_1006288 | Ga0209676_10062883 | 256 |
| 1624 | 3300025298 | Ga0209050_1000025 | Ga0209050_1000025308 | 256 |
| 1625 | 3300025298 | Ga0209050_1000028 | Ga0209050_1000028207 | 256 |
| 1626 | 3300025298 | Ga0209050_1000381 | Ga0209050_100038128 | 256 |
| 1627 | 3300025298 | Ga0209050_1000981 | Ga0209050_10009818 | 256 |
| 1628 | 3300025303 | Ga0209051_1000026 | Ga0209051_1000026109 | 256 |
| 1629 | 3300025303 | Ga0209051_1000080 | Ga0209051_100008040 | 256 |
| 1630 | 3300025303 | Ga0209051_1000299 | Ga0209051_100029937 | 256 |
| 1631 | 3300025304 | Ga0209257_1000034 | Ga0209257_1000034314 | 256 |
| 1632 | 3300025304 | Ga0209257_1004941 | Ga0209257_100494110 | 256 |
| 1633 | 3300025321 | Ga0207656_10000008 | Ga0207656_10000008209 | 256 |
| 1634 | 3300025711 | Ga0207696_1000020 | Ga0207696_100002081 | 256 |
| 1635 | 3300025711 | Ga0207696_1000057 | Ga0207696_1000057142 | 256 |
| 1636 | 3300025711 | Ga0207696_1000074 | Ga0207696_100007441 | 256 |
| 1637 | 3300025711 | Ga0207696_1000084 | Ga0207696_100008478 | 256 |
| 1638 | 3300025711 | Ga0207696_1004990 | Ga0207696_10049904 | 256 |
| 1639 | 3300025728 | Ga0207655_1000014 | Ga0207655_1000014281 | 256 |
| 1640 | 3300025728 | Ga0207655_1000341 | Ga0207655_100034114 | 256 |
| 1641 | 3300025728 | Ga0207655_1000417 | Ga0207655_100041710 | 256 |
| 1642 | 3300025728 | Ga0207655_1000502 | Ga0207655_100050230 | 256 |
| 1643 | 3300025728 | Ga0207655_1000556 | Ga0207655_100055639 | 256 |
| 1644 | 3300025728 | Ga0207655_1001671 | Ga0207655_10016715 | 256 |
| 1645 | 3300025728 | Ga0207655_1003052 | Ga0207655_10030523 | 256 |
| 1646 | 3300025728 | Ga0207655_1004382 | Ga0207655_10043825 | 256 |
| 1647 | 3300025728 | Ga0207655_1009008 | Ga0207655_10090087 | 256 |
| 1648 | 3300025728 | Ga0207655_1019136 | Ga0207655_10191363 | 256 |
| 1649 | 3300025728 | Ga0207655_1031800 | Ga0207655_10318002 | 256 |
| 1650 | 3300025728 | Ga0207655_1047084 | Ga0207655_10470842 | 256 |
| 1651 | 3300025735 | Ga0207713_1000031 | Ga0207713_100003148 | 256 |
| 1652 | 3300025735 | Ga0207713_1000114 | Ga0207713_100011473 | 256 |
| 1653 | 3300025735 | Ga0207713_1000572 | Ga0207713_100057211 | 256 |
| 1654 | 3300025735 | Ga0207713_1001535 | Ga0207713_100153515 | 256 |
| 1655 | 3300025735 | Ga0207713_1001823 | Ga0207713_100182316 | 256 |
| 1656 | 3300025735 | Ga0207713_1002851 | Ga0207713_100285114 | 256 |
| 1657 | 3300025735 | Ga0207713_1002976 | Ga0207713_10029769 | 256 |
| 1658 | 3300025735 | Ga0207713_1003112 | Ga0207713_100311211 | 256 |
| 1659 | 3300025735 | Ga0207713_1005620 | Ga0207713_10056209 | 256 |
| 1660 | 3300025735 | Ga0207713_1026063 | Ga0207713_10260634 | 256 |
| 1661 | 3300025735 | Ga0207713_1026175 | Ga0207713_10261754 | 256 |
| 1662 | 3300025735 | Ga0207713_1028291 | Ga0207713_10282913 | 256 |
| 1663 | 3300025907 | Ga0207645_10196251 | Ga0207645_101962512 | 256 |
| 1664 | 3300025914 | Ga0207671_10000015 | Ga0207671_10000015198 | 256 |
| 1665 | 3300025919 | Ga0207657_10322084 | Ga0207657_103220841 | 256 |
| 1666 | 3300025920 | Ga0207649_10000001 | Ga0207649_10000001289 | 256 |
| 1667 | 3300025923 | Ga0207681_10002623 | Ga0207681_100026238 | 256 |
| 1668 | 3300025923 | Ga0207681_10004161 | Ga0207681_100041618 | 256 |
| 1669 | 3300025925 | Ga0207650_10000239 | Ga0207650_1000023915 | 256 |
| 1670 | 3300025933 | Ga0207706_10000069 | Ga0207706_1000006917 | 256 |
| 1671 | 3300025933 | Ga0207706_10015680 | Ga0207706_100156803 | 256 |
| 1672 | 3300025934 | Ga0207686_10001137 | Ga0207686_100011377 | 256 |
| 1673 | 3300025935 | Ga0207709_10000022 | Ga0207709_10000022309 | 256 |
| 1674 | 3300025935 | Ga0207709_10000164 | Ga0207709_1000016413 | 256 |
| 1675 | 3300025935 | Ga0207709_10011415 | Ga0207709_100114155 | 256 |
| 1676 | 3300025935 | Ga0207709_10017758 | Ga0207709_100177584 | 256 |
| 1677 | 3300025935 | Ga0207709_10138322 | Ga0207709_101383222 | 256 |
| 1678 | 3300025945 | Ga0207679_10000011 | Ga0207679_10000011289 | 256 |
| 1679 | 3300025961 | Ga0207712_10020485 | Ga0207712_100204852 | 256 |
| 1680 | 3300025981 | Ga0207640_10022476 | Ga0207640_100224765 | 256 |
| 1681 | 3300026041 | Ga0207639_10000099 | Ga0207639_1000009927 | 256 |
| 1682 | 3300027111 | Ga0209281_1000026 | Ga0209281_1000026246 | 256 |
| 1683 | 3300027111 | Ga0209281_1000033 | Ga0209281_1000033285 | 256 |
| 1684 | 3300027111 | Ga0209281_1001858 | Ga0209281_100185810 | 256 |
| 1685 | 3300027296 | Ga0209389_1000099 | Ga0209389_100009946 | 256 |
| 1686 | 3300027296 | Ga0209389_1074527 | Ga0209389_10745273 | 256 |
| 1687 | 3300027312 | Ga0209371_1000066 | Ga0209371_1000066181 | 256 |
| 1688 | 3300027312 | Ga0209371_1000653 | Ga0209371_100065311 | 256 |
| 1689 | 3300027312 | Ga0209371_1020557 | Ga0209371_10205573 | 256 |
| 1690 | 3300027312 | Ga0209371_1023115 | Ga0209371_10231152 | 256 |
| 1691 | 3300027395 | Ga0209996_1004612 | Ga0209996_10046122 | 256 |
| 1692 | 3300027462 | Ga0210000_1010807 | Ga0210000_10108071 | 256 |
| 1693 | 3300027471 | Ga0209995_1007635 | Ga0209995_10076353 | 256 |
| 1694 | 3300027543 | Ga0209999_1004223 | Ga0209999_10042232 | 256 |
| 1695 | 3300027665 | Ga0209983_1002700 | Ga0209983_10027004 | 256 |
| 1696 | 3300027666 | Ga0209282_1018395 | Ga0209282_10183953 | 256 |
| 1697 | 3300027876 | Ga0209974_10007762 | Ga0209974_100077623 | 256 |
| 1698 | 3300027907 | Ga0207428_10008430 | Ga0207428_100084307 | 256 |
| 1699 | 3300027907 | Ga0207428_10117153 | Ga0207428_101171532 | 256 |
| 1700 | 3300028379 | Ga0268266_10011009 | Ga0268266_1001100910 | 256 |
| 1701 | 3300028379 | Ga0268266_10040888 | Ga0268266_100408882 | 256 |
| 1702 | 3300030500 | Ga0268256_1000063 | Ga0268256_1000063181 | 256 |
| 1703 | 3300030500 | Ga0268256_1000557 | Ga0268256_100055716 | 256 |
| 1704 | 3300030500 | Ga0268256_1010906 | Ga0268256_10109063 | 256 |
| 1705 | 3300030500 | Ga0268256_1023065 | Ga0268256_10230651 | 256 |
| 1706 | 3300030731 | Ga0316177_1113840 | Ga0316177_11138403 | 256 |
| 1707 | 3300030735 | Ga0316178_1083481 | Ga0316178_108348117 | 256 |
| 1708 | 3300030744 | Ga0316181_1294605 | Ga0316181_12946052 | 256 |
| 1709 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002246 | 256 |
| 1710 | 3300031548 | Ga0307408_100021702 | Ga0307408_1000217024 | 256 |
| 1711 | 3300031731 | Ga0307405_10095274 | Ga0307405_100952742 | 256 |
| 1712 | 3300031824 | Ga0307413_10003639 | Ga0307413_100036393 | 256 |
| 1713 | 3300031824 | Ga0307413_10067409 | Ga0307413_100674093 | 256 |
| 1714 | 3300031901 | Ga0307406_10061018 | Ga0307406_100610183 | 256 |
| 1715 | 3300031911 | Ga0307412_10062698 | Ga0307412_100626983 | 256 |
| 1716 | 3300031911 | Ga0307412_10106730 | Ga0307412_101067302 | 256 |
| 1717 | 3300032002 | Ga0307416_100157677 | Ga0307416_1001576772 | 256 |
| 1718 | 3300032005 | Ga0307411_10109863 | Ga0307411_101098633 | 256 |
| 1719 | 3300033541 | Ga0316596_1009375 | Ga0316596_10093751 | 256 |
| 1720 | 3300035398 | Ga0316574_0148045 | Ga0316574_0148045_149_925 | 256 |
| 1721 | 3300036712 | Ga0316584_0181626 | Ga0316584_0181626_480_1250 | 256 |
| 1722 | 3300041404 | Ga0439436_0002075 | Ga0439436_0002075_4705_5475 | 256 |
| 1723 | 3300041405 | Ga0439438_000705 | Ga0439438_000705_6142_6912 | 256 |
| 1724 | 3300041407 | Ga0439447_003922 | Ga0439447_003922_1599_2369 | 256 |
| 1725 | 3300041407 | Ga0439447_020765 | Ga0439447_020765_376_1146 | 256 |
| 1726 | 3300041411 | Ga0439466_0004826 | Ga0439466_0004826_1104_1874 | 256 |
| 1727 | 3300041411 | Ga0439466_0008959 | Ga0439466_0008959_2104_2919 | 256 |
| 1728 | 3300042000 | Ga0439437_000145 | Ga0439437_000145_2102_2872 | 256 |
| 1729 | 3300042006 | Ga0439432_013934 | Ga0439432_013934_1511_2281 | 256 |
| 1730 | 3300042009 | Ga0439451_007568 | Ga0439451_007568_705_1475 | 256 |
| 1731 | 3300042009 | Ga0439451_013029 | Ga0439451_013029_742_1512 | 256 |
| 1732 | 3300042010 | Ga0439452_000639 | Ga0439452_000639_13768_14538 | 256 |
| 1733 | 3300042013 | Ga0439456_000539 | Ga0439456_000539_1449_2219 | 256 |
| 1734 | 3300042016 | Ga0439463_001585 | Ga0439463_001585_1216_2016 | 256 |
| 1735 | 3300042115 | Ga0450911_000018 | Ga0450911_000018_72255_73025 | 256 |
| 1736 | 3300042125 | Ga0450923_009679 | Ga0450923_009679_576_1346 | 256 |
| 1737 | 3300042142 | Ga0450905_000366 | Ga0450905_000366_3096_3866 | 256 |
| 1738 | 3300042142 | Ga0450905_003143 | Ga0450905_003143_171_941 | 256 |
| 1739 | 3300042156 | Ga0439446_0000261 | Ga0439446_0000261_1446_2225 | 256 |
| 1740 | 3300042156 | Ga0439446_0003402 | Ga0439446_0003402_1278_2048 | 256 |
| 1741 | 3300042435 | Ga0439434_0002153 | Ga0439434_0002153_1738_2508 | 256 |
| 1742 | 3300042439 | Ga0439464_0004654 | Ga0439464_0004654_1432_2202 | 256 |
| 1743 | 3300042461 | Ga0439460_0004961 | Ga0439460_0004961_1527_2297 | 256 |
| 1744 | 3300042533 | Ga0450901_001568 | Ga0450901_001568_1624_2394 | 256 |
| 1745 | 3300042993 | Ga0439440_0009344 | Ga0439440_0009344_822_1592 | 256 |
| 1746 | 3300046453 | Ga0495627_000023 | Ga0495627_000023_137759_138616 | 256 |
| 1747 | 3300046453 | Ga0495627_000694 | Ga0495627_000694_11152_11922 | 256 |
| 1748 | 3300046453 | Ga0495627_004813 | Ga0495627_004813_2406_3281 | 256 |
| 1749 | 3300046453 | Ga0495627_007437 | Ga0495627_007437_565_1365 | 256 |
| 1750 | 3300046453 | Ga0495627_056033 | Ga0495627_056033_349_1149 | 256 |
| 1751 | 3300046458 | Ga0495591_000025 | Ga0495591_000025_83002_83859 | 256 |
| 1752 | 3300046458 | Ga0495591_001313 | Ga0495591_001313_14405_15205 | 256 |
| 1753 | 3300046458 | Ga0495591_005620 | Ga0495591_005620_2264_3139 | 256 |
| 1754 | 3300046458 | Ga0495591_011566 | Ga0495591_011566_1661_2461 | 256 |
| 1755 | 3300046458 | Ga0495591_027194 | Ga0495591_027194_653_1423 | 256 |
| 1756 | 3300046460 | Ga0495638_0007859 | Ga0495638_0007859_5177_5977 | 256 |
| 1757 | 3300046460 | Ga0495638_0012287 | Ga0495638_0012287_839_1609 | 256 |
| 1758 | 3300046471 | Ga0495650_0002310 | Ga0495650_0002310_2889_3689 | 256 |
| 1759 | 3300046471 | Ga0495650_0003052 | Ga0495650_0003052_1724_2584 | 256 |
| 1760 | 3300046471 | Ga0495650_0018979 | Ga0495650_0018979_1079_1879 | 256 |
| 1761 | 3300046474 | Ga0495605_0000095 | Ga0495605_0000095_63360_64160 | 256 |
| 1762 | 3300046474 | Ga0495605_0000210 | Ga0495605_0000210_15980_16780 | 256 |
| 1763 | 3300046474 | Ga0495605_0000815 | Ga0495605_0000815_14606_15463 | 256 |
| 1764 | 3300046474 | Ga0495605_0001165 | Ga0495605_0001165_5739_6539 | 256 |
| 1765 | 3300046474 | Ga0495605_0004819 | Ga0495605_0004819_557_1357 | 256 |
| 1766 | 3300046474 | Ga0495605_0059235 | Ga0495605_0059235_682_1482 | 256 |
| 1767 | 3300046491 | Ga0495584_0029283 | Ga0495584_0029283_654_1454 | 256 |
| 1768 | 3300046492 | Ga0495585_0027300 | Ga0495585_0027300_508_1308 | 256 |
| 1769 | 3300046492 | Ga0495585_0041082 | Ga0495585_0041082_1154_1924 | 256 |
| 1770 | 3300046492 | Ga0495585_0096763 | Ga0495585_0096763_365_1165 | 256 |
| 1771 | 3300046499 | Ga0495594_0008695 | Ga0495594_0008695_3877_4677 | 256 |
| 1772 | 3300046500 | Ga0495596_0009327 | Ga0495596_0009327_1613_2413 | 256 |
| 1773 | 3300046501 | Ga0495607_0000069 | Ga0495607_0000069_91888_92745 | 256 |
| 1774 | 3300046501 | Ga0495607_0000983 | Ga0495607_0000983_5220_6077 | 256 |
| 1775 | 3300046501 | Ga0495607_0001148 | Ga0495607_0001148_5742_6542 | 256 |
| 1776 | 3300046501 | Ga0495607_0002749 | Ga0495607_0002749_1803_2573 | 256 |
| 1777 | 3300046501 | Ga0495607_0003593 | Ga0495607_0003593_10343_11143 | 256 |
| 1778 | 3300046501 | Ga0495607_0005409 | Ga0495607_0005409_1177_1947 | 256 |
| 1779 | 3300046501 | Ga0495607_0008558 | Ga0495607_0008558_2091_2891 | 256 |
| 1780 | 3300046501 | Ga0495607_0024541 | Ga0495607_0024541_2305_3180 | 256 |
| 1781 | 3300046501 | Ga0495607_0050478 | Ga0495607_0050478_1360_2160 | 256 |
| 1782 | 3300046501 | Ga0495607_0077811 | Ga0495607_0077811_488_1288 | 256 |
| 1783 | 3300046506 | Ga0495583_0000015 | Ga0495583_0000015_109382_110182 | 256 |
| 1784 | 3300046506 | Ga0495583_0000779 | Ga0495583_0000779_14562_15422 | 256 |
| 1785 | 3300046506 | Ga0495583_0008544 | Ga0495583_0008544_1650_2450 | 256 |
| 1786 | 3300046506 | Ga0495583_0019297 | Ga0495583_0019297_1082_1852 | 256 |
| 1787 | 3300046506 | Ga0495583_0067726 | Ga0495583_0067726_625_1425 | 256 |
| 1788 | 3300046507 | Ga0495606_0000447 | Ga0495606_0000447_40523_41323 | 256 |
| 1789 | 3300046507 | Ga0495606_0001053 | Ga0495606_0001053_30942_31742 | 256 |
| 1790 | 3300046507 | Ga0495606_0001278 | Ga0495606_0001278_8053_8853 | 256 |
| 1791 | 3300046507 | Ga0495606_0015316 | Ga0495606_0015316_3509_4279 | 256 |
| 1792 | 3300046507 | Ga0495606_0016681 | Ga0495606_0016681_2417_3292 | 256 |
| 1793 | 3300046512 | Ga0495610_0015524 | Ga0495610_0015524_747_1547 | 256 |
| 1794 | 3300046513 | Ga0495616_0043053 | Ga0495616_0043053_959_1759 | 256 |
| 1795 | 3300046513 | Ga0495616_0184103 | Ga0495616_0184103_20_820 | 256 |
| 1796 | 3300046515 | Ga0495620_0000042 | Ga0495620_0000042_23927_24727 | 256 |
| 1797 | 3300046515 | Ga0495620_0000146 | Ga0495620_0000146_40770_41540 | 256 |
| 1798 | 3300046515 | Ga0495620_0002809 | Ga0495620_0002809_8675_9475 | 256 |
| 1799 | 3300046515 | Ga0495620_0024957 | Ga0495620_0024957_1391_2191 | 256 |
| 1800 | 3300046515 | Ga0495620_0027170 | Ga0495620_0027170_995_1765 | 256 |
| 1801 | 3300046518 | Ga0495631_0012371 | Ga0495631_0012371_1984_2754 | 256 |
| 1802 | 3300046519 | Ga0495632_0001637 | Ga0495632_0001637_2324_3184 | 256 |
| 1803 | 3300046519 | Ga0495632_0001728 | Ga0495632_0001728_10321_11091 | 256 |
| 1804 | 3300046520 | Ga0495637_0001117 | Ga0495637_0001117_14450_15250 | 256 |
| 1805 | 3300046520 | Ga0495637_0005705 | Ga0495637_0005705_625_1482 | 256 |
| 1806 | 3300046522 | Ga0495643_0000175 | Ga0495643_0000175_7600_8370 | 256 |
| 1807 | 3300046522 | Ga0495643_0000675 | Ga0495643_0000675_33412_34182 | 256 |
| 1808 | 3300046522 | Ga0495643_0000930 | Ga0495643_0000930_11715_12485 | 256 |
| 1809 | 3300046522 | Ga0495643_0033177 | Ga0495643_0033177_460_1260 | 256 |
| 1810 | 3300046523 | Ga0495644_0005497 | Ga0495644_0005497_2101_2901 | 256 |
| 1811 | 3300046524 | Ga0495648_0002908 | Ga0495648_0002908_10309_11079 | 256 |
| 1812 | 3300046524 | Ga0495648_0004932 | Ga0495648_0004932_1462_2232 | 256 |
| 1813 | 3300046524 | Ga0495648_0034007 | Ga0495648_0034007_1185_1985 | 256 |
| 1814 | 3300046530 | Ga0495654_0000906 | Ga0495654_0000906_2196_2966 | 256 |
| 1815 | 3300046530 | Ga0495654_0030579 | Ga0495654_0030579_1078_1848 | 256 |
| 1816 | 3300046530 | Ga0495654_0154595 | Ga0495654_0154595_83_883 | 256 |
| 1817 | 3300046538 | Ga0495609_0000053 | Ga0495609_0000053_19424_20224 | 256 |
| 1818 | 3300046538 | Ga0495609_0000102 | Ga0495609_0000102_89041_89841 | 256 |
| 1819 | 3300046538 | Ga0495609_0000133 | Ga0495609_0000133_36666_37466 | 256 |
| 1820 | 3300046538 | Ga0495609_0003217 | Ga0495609_0003217_918_1688 | 256 |
| 1821 | 3300046542 | Ga0495597_0000068 | Ga0495597_0000068_57566_58423 | 256 |
| 1822 | 3300046557 | Ga0495622_0017175 | Ga0495622_0017175_2099_2899 | 256 |
| 1823 | 3300046557 | Ga0495622_0109043 | Ga0495622_0109043_248_1018 | 256 |
| 1824 | 3300046558 | Ga0495633_0000115 | Ga0495633_0000115_32415_33215 | 256 |
| 1825 | 3300046615 | Ga0495656_0021883 | Ga0495656_0021883_918_1688 | 256 |
| 1826 | 3300046616 | Ga0495668_0049740 | Ga0495668_0049740_939_1739 | 256 |
| 1827 | 3300046616 | Ga0495668_0086461 | Ga0495668_0086461_625_1425 | 256 |
| 1828 | 3300046648 | Ga0495611_0001664 | Ga0495611_0001664_9348_10148 | 256 |
| 1829 | 3300046660 | Ga0495625_0000086 | Ga0495625_0000086_62470_63270 | 256 |
| 1830 | 3300046665 | Ga0495661_0000058 | Ga0495661_0000058_7930_8790 | 256 |
| 1831 | 3300046665 | Ga0495661_0000212 | Ga0495661_0000212_60319_61119 | 256 |
| 1832 | 3300046665 | Ga0495661_0000346 | Ga0495661_0000346_17774_18574 | 256 |
| 1833 | 3300046665 | Ga0495661_0005323 | Ga0495661_0005323_5974_6849 | 256 |
| 1834 | 3300046665 | Ga0495661_0081724 | Ga0495661_0081724_451_1251 | 256 |
| 1835 | 3300046684 | Ga0495669_0002254 | Ga0495669_0002254_1024_1794 | 256 |
| 1836 | 3300046691 | Ga0495670_0005953 | Ga0495670_0005953_5014_5814 | 256 |
| 1837 | 3300046692 | Ga0495671_0007537 | Ga0495671_0007537_1643_2443 | 256 |
| 1838 | 3300046692 | Ga0495671_0009894 | Ga0495671_0009894_625_1425 | 256 |
| 1839 | 3300046692 | Ga0495671_0010452 | Ga0495671_0010452_479_1249 | 256 |
| 1840 | 3300046692 | Ga0495671_0146567 | Ga0495671_0146567_116_916 | 256 |
| 1841 | 3300046694 | Ga0495649_0000186 | Ga0495649_0000186_1018_1788 | 256 |
| 1842 | 3300046694 | Ga0495649_0000839 | Ga0495649_0000839_5538_6338 | 256 |
| 1843 | 3300046694 | Ga0495649_0019957 | Ga0495649_0019957_2103_2873 | 256 |
| 1844 | 3300046694 | Ga0495649_0061289 | Ga0495649_0061289_656_1456 | 256 |
| 1845 | 3300046794 | Ga0495589_0020733 | Ga0495589_0020733_758_1528 | 256 |
| 1846 | 3300046794 | Ga0495589_0038733 | Ga0495589_0038733_1281_2051 | 256 |
| 1847 | 3300046809 | Ga0495600_0032124 | Ga0495600_0032124_2192_2962 | 256 |
| 1848 | 3300046810 | Ga0495660_0025181 | Ga0495660_0025181_1769_2539 | 256 |
| 1849 | 3300046810 | Ga0495660_0031405 | Ga0495660_0031405_2103_2903 | 256 |
| 1850 | 3300046810 | Ga0495660_0046547 | Ga0495660_0046547_1141_1998 | 256 |
| 1851 | 3300046810 | Ga0495660_0088565 | Ga0495660_0088565_737_1537 | 256 |
| 1852 | 3300047320 | Ga0495672_0003352 | Ga0495672_0003352_11492_12262 | 256 |
| 1853 | 3300047320 | Ga0495672_0004309 | Ga0495672_0004309_9051_9821 | 256 |
| 1854 | 3300047320 | Ga0495672_0029277 | Ga0495672_0029277_1322_2122 | 256 |
| 1855 | 3300047320 | Ga0495672_0051068 | Ga0495672_0051068_567_1367 | 256 |
| 1856 | 3300047321 | Ga0495676_0000022 | Ga0495676_0000022_62997_63797 | 256 |
| 1857 | 3300047321 | Ga0495676_0044680 | Ga0495676_0044680_2057_2857 | 256 |
| 1858 | 3300047322 | Ga0495680_0011792 | Ga0495680_0011792_1699_2469 | 256 |
| 1859 | 3300047323 | Ga0495683_0000030 | Ga0495683_0000030_125466_126266 | 256 |
| 1860 | 3300047323 | Ga0495683_0000044 | Ga0495683_0000044_12178_12978 | 256 |
| 1861 | 3300047446 | Ga0495679_000212 | Ga0495679_000212_2361_3161 | 256 |
| 1862 | 3300047446 | Ga0495679_000736 | Ga0495679_000736_10786_11586 | 256 |
| 1863 | 3300047469 | Ga0495673_0004747 | Ga0495673_0004747_6960_7760 | 256 |
| 1864 | 3300047469 | Ga0495673_0028308 | Ga0495673_0028308_1129_1929 | 256 |
| 1865 | 3300047469 | Ga0495673_0033851 | Ga0495673_0033851_858_1658 | 256 |
| 1866 | 3300047470 | Ga0495681_0032542 | Ga0495681_0032542_1330_2130 | 256 |
| 1867 | 3300047470 | Ga0495681_0112950 | Ga0495681_0112950_184_1059 | 256 |
| 1868 | 3300047472 | Ga0495686_0058084 | Ga0495686_0058084_610_1410 | 256 |
| 1869 | 3300048091 | Ga0495626_0000039 | Ga0495626_0000039_99947_100747 | 256 |
| 1870 | 3300048091 | Ga0495626_0001817 | Ga0495626_0001817_11700_12470 | 256 |
| 1871 | 3300048913 | Ga0496110_0068198 | Ga0496110_0068198_2073_2843 | 256 |
| 1872 | 3300048913 | Ga0496110_0183492 | Ga0496110_0183492_848_1648 | 256 |
| 1873 | 3300048919 | Ga0496116_0000667 | Ga0496116_0000667_33114_33884 | 256 |
| 1874 | 3300048919 | Ga0496116_0057003 | Ga0496116_0057003_1294_2094 | 256 |
| 1875 | 3300048920 | Ga0496117_0000385 | Ga0496117_0000385_36258_37028 | 256 |
| 1876 | 3300048920 | Ga0496117_0003287 | Ga0496117_0003287_11789_12664 | 256 |
| 1877 | 3300048920 | Ga0496117_0006460 | Ga0496117_0006460_9712_10482 | 256 |
| 1878 | 3300048921 | Ga0496118_0002475 | Ga0496118_0002475_13802_14572 | 256 |
| 1879 | 3300048921 | Ga0496118_0003109 | Ga0496118_0003109_10985_11755 | 256 |
| 1880 | 3300048921 | Ga0496118_0119068 | Ga0496118_0119068_432_1307 | 256 |
| 1881 | 3300048922 | Ga0496119_0000060 | Ga0496119_0000060_115933_116703 | 256 |
| 1882 | 3300048923 | Ga0496120_0003085 | Ga0496120_0003085_4019_4789 | 256 |
| 1883 | 3300048924 | Ga0496121_0004115 | Ga0496121_0004115_10612_11412 | 256 |
| 1884 | 3300048924 | Ga0496121_0006040 | Ga0496121_0006040_11596_12396 | 256 |
| 1885 | 3300048924 | Ga0496121_0014995 | Ga0496121_0014995_1431_2201 | 256 |
| 1886 | 3300048925 | Ga0496122_0001366 | Ga0496122_0001366_30022_30822 | 256 |
| 1887 | 3300048925 | Ga0496122_0002458 | Ga0496122_0002458_9099_9869 | 256 |
| 1888 | 3300048926 | Ga0496123_0000717 | Ga0496123_0000717_37674_38444 | 256 |
| 1889 | 3300048926 | Ga0496123_0001033 | Ga0496123_0001033_8599_9399 | 256 |
| 1890 | 3300048927 | Ga0496124_0000120 | Ga0496124_0000120_48112_48912 | 256 |
| 1891 | 3300048927 | Ga0496124_0003062 | Ga0496124_0003062_9675_10445 | 256 |
| 1892 | 3300048927 | Ga0496124_0003568 | Ga0496124_0003568_5757_6527 | 256 |
| 1893 | 3300048927 | Ga0496124_0007303 | Ga0496124_0007303_1999_2799 | 256 |
| 1894 | 3300048927 | Ga0496124_0010350 | Ga0496124_0010350_6371_7246 | 256 |
| 1895 | 3300048927 | Ga0496124_0050716 | Ga0496124_0050716_2095_2865 | 256 |
| 1896 | 3300048927 | Ga0496124_0073013 | Ga0496124_0073013_515_1285 | 256 |
| 1897 | 3300048928 | Ga0496125_0001735 | Ga0496125_0001735_14933_15703 | 256 |
| 1898 | 3300048928 | Ga0496125_0008517 | Ga0496125_0008517_9396_10166 | 256 |
| 1899 | 3300048928 | Ga0496125_0019456 | Ga0496125_0019456_3249_4124 | 256 |
| 1900 | 3300048929 | Ga0496126_0012840 | Ga0496126_0012840_482_1252 | 256 |
| 1901 | 3300049459 | Ga0495678_000017 | Ga0495678_000017_75601_76401 | 256 |
| 1902 | 3300049459 | Ga0495678_001755 | Ga0495678_001755_12323_13123 | 256 |
| 1903 | 3300049460 | Ga0495682_0000264 | Ga0495682_0000264_28558_29328 | 256 |
| 1904 | 3300049460 | Ga0495682_0000527 | Ga0495682_0000527_12261_13061 | 256 |
| 1905 | 3300049460 | Ga0495682_0024552 | Ga0495682_0024552_355_1125 | 256 |
| 1906 | 3300049571 | Ga0501034_0000576 | Ga0501034_0000576_43641_44411 | 256 |
| 1907 | 3300049571 | Ga0501034_0083131 | Ga0501034_0083131_1217_1999 | 256 |
| 1908 | 3300049853 | Ga0501226_000002 | Ga0501226_000002_424621_425391 | 256 |
| 1909 | 3300053135 | Ga0500659_0000765 | Ga0500659_0000765_12643_13413 | 256 |
| 1910 | iso_pu_bacteria | 2599185307 | 2599975297 | 256 |
| 1911 | iso_pu_bacteria | 2600255283 | 2601627232 | 256 |
| 1912 | iso_pu_bacteria | 2713897148 | 2715749162 | 256 |
| 1913 | iso_pu_bacteria | 2738541271 | 2738687622 | 256 |
| 1914 | iso_pu_bacteria | 2738543016 | 2739263243 | 256 |
| 1915 | iso_pu_bacteria | 2945961074 | 2945967549 | 256 |
| 1916 | iso_pu_bacteria | 2974289157 | 2974293393 | 256 |
| 1917 | iso_pu_bacteria | 2998139840 | 2998140410 | 256 |
| 1918 | iso_pu_bacteria | 3007419365 | 3007419969 | 256 |
| 1919 | iso_pu_bacteria | 637000220 | 637317770 | 256 |
| 1920 | iso_pu_bacteria | 8029995093 | 8030000322 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9146 | 36 | 246 |
| 7r6k-assembly1.cif.gz_q | state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region | 0.854 | 61 | 162 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.838 | 57 | 243 |
| 2yxe-assembly1.cif.gz_B | crystal structure of l-isoaspartyl protein carboxyl methyltranferase | 0.8225 | 56 | 171 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8216 | 36 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9858 | 36 | 246 | 3.40.50.150 |
| af_Q3ED65_41_261_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9514 | 37 | 245 | 3.40.50.150 |
| af_C7J169_1_82_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9465 | 45 | 121 | 3.40.50.150 |
| af_Q2FYG5_1_193_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9462 | 62 | 246 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9449 | 37 | 246 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1XRR2-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9886 | 8 | 246 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A7V5PGH2-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9851 | 8 | 206 |
GO:0008425
GO:0009234 GO:0032259 |
| AF-A0A389M0U1-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9823 | 45 | 246 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A2E2SF17-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9769 | 9 | 246 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A6V7WQ93-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.9728 | 9 | 245 |
GO:0008425
GO:0031314 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar