F496045

General Info

Members Datasets Scaffolds Average Seq Length
1913 558 1888 184

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100101800|Ga0070690_1001018002
Length 213
Sequence VADKSFLTDIKTLRERARQHIEKGAVTEGYAADRETVIKLLNEALATEIVCVLRYKRHYFMASGIHAEGVAAEFLQHANEEQGHADEIAGRIVQLGGAPNFSPDGLTSRSHAEYVEGDSLVEMIKEDLVAERIAIDSYREMIQYVGNDDSTTRRMLEGILAMEEEHADDLVSLLEGFGTGSSQAANGLHAARNLSADYADDTNGKEQSAKSKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
8 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
9 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
10 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
11 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
14 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
15 2928963466 Dyella japonica 1073 Isolate Unclassified
16 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
17 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
18 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
19 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
20 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
21 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
22 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
23 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
24 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
25 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
126 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
127 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
145 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
166 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
170 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
179 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
184 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
186 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
192 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
290 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
291 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
292 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
293 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
294 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
295 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
296 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
297 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
298 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
299 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
300 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
301 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
302 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
303 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
304 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
305 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
306 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
307 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
308 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
311 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
312 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
319 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
320 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
321 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
322 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
323 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
324 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
325 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
326 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
327 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
328 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
329 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
330 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
331 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
332 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
333 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
339 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
343 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
344 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
345 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
348 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
349 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
350 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
351 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
352 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
353 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
354 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
355 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
356 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
357 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
358 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
359 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
360 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
361 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
364 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
369 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
370 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
371 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
372 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
373 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
374 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
375 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
376 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
377 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
378 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
379 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
380 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
381 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
382 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
385 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
386 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
387 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
388 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
389 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
390 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
391 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
392 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
393 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
406 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
407 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
414 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
415 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
416 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
417 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
418 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
419 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
420 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
421 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
432 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
433 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
434 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
435 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
438 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
443 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
444 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
445 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
448 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
449 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
450 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
451 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
452 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
453 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
454 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
455 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
456 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
457 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
458 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
459 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
460 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
474 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
475 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
476 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
477 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
478 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
479 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
480 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
481 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
482 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
483 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
484 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
485 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
486 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
487 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
488 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
489 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
490 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
491 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
492 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
493 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
494 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
495 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
496 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
497 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
498 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
499 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
500 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
501 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
502 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
503 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
504 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
505 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
506 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
507 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
508 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
509 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
510 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
511 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
512 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
513 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
514 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
515 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
516 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
517 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
518 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
519 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
520 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
521 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
522 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
523 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
524 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
525 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
526 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
529 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
530 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
531 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
532 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
533 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
534 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
535 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
536 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
537 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
538 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
539 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
540 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
541 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
542 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
543 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
544 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
545 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
546 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
547 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
548 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
549 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
554 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
555 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
556 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
557 8052494512 Pseudomonas putida LD6 Isolate Unclassified
558 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.89
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 2.56
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3096326 2162886007 Bacteria 869
2 SwRhRL2b_contig_3614463 2162886007 Bacteria 2784
3 MBSR1b_contig_1669793 2162886012 Bacteria 815
4 CNAas_1001950 3300000532 Unclassified 1576
5 JGI24034J14986_100823 3300001432 Bacteria 1843
6 JGI24748J21848_1000018 3300002074 Bacteria 129847
7 JGI24034J26672_10000001 3300002239 Bacteria 1118280
8 JGI24742J22300_10028009 3300002244 Bacteria 977
9 JGI24751J29686_10000057 3300002459 Bacteria 62893
10 JGI24751J29686_10000130 3300002459 Bacteria 37822
11 JGI25162J39368_1003124 3300002737 Bacteria 5244
12 JGI25162J39368_1003469 3300002737 Bacteria 4521
13 JGI25151J46595_10000214 3300003187 Bacteria 69921
14 JGI25406J46586_10005622 3300003203 Bacteria 5803
15 JGI25406J46586_10030575 3300003203 Bacteria 2025
16 Ga0032354_1063917 3300003693 Bacteria 2079
17 Ga0055542_1000283 3300003762 Bacteria 56912
18 Ga0055526_1000032 3300003771 Bacteria 143118
19 Ga0055537_1000301 3300003773 Bacteria 34222
20 Ga0055537_1000309 3300003773 Bacteria 33572
21 Ga0055524_1000054 3300003775 Bacteria 143118
22 Ga0055524_1035836 3300003775 Bacteria 1346
23 Ga0055534_1000041 3300003784 Bacteria 101875
24 Ga0055534_1000065 3300003784 Bacteria 81111
25 Ga0055528_1000021 3300003790 Bacteria 143118
26 Ga0055528_1002176 3300003790 Bacteria 10748
27 Ga0055530_10000307 3300003791 Bacteria 44334
28 Ga0055531_10002203 3300003794 Bacteria 13252
29 Ga0055531_10009391 3300003794 Bacteria 4998
30 Ga0058861_11411696 3300004800 Bacteria 753
31 Ga0065714_10002185 3300005288 Bacteria 199213
32 Ga0065704_10074617 3300005289 Bacteria 6093
33 Ga0065704_10239377 3300005289 Bacteria 1020
34 Ga0065704_10285155 3300005289 Bacteria 914
35 Ga0065704_10339599 3300005289 Unclassified 825
36 Ga0065712_10002812 3300005290 Bacteria 6440
37 Ga0065712_10007367 3300005290 Bacteria 2940
38 Ga0065712_10010735 3300005290 Bacteria 2161
39 Ga0065712_10067739 3300005290 Bacteria 87070
40 Ga0065712_10081368 3300005290 Bacteria 3013
41 Ga0065712_10109727 3300005290 Bacteria 1850
42 Ga0065712_10457395 3300005290 Bacteria 681
43 Ga0065712_10488980 3300005290 Bacteria 657
44 Ga0065715_10030381 3300005293 Bacteria 1330
45 Ga0065715_10045500 3300005293 Bacteria 1074
46 Ga0065715_10089411 3300005293 Bacteria 10439
47 Ga0065715_10090291 3300005293 Bacteria 7291
48 Ga0065715_10090385 3300005293 Bacteria 7111
49 Ga0065715_10094446 3300005293 Bacteria 4338
50 Ga0065715_10152254 3300005293 Bacteria 1707
51 Ga0065715_10161576 3300005293 Bacteria 1620
52 Ga0065715_10186679 3300005293 Bacteria 1441
53 Ga0065715_10250944 3300005293 Bacteria 1167
54 Ga0065715_10281888 3300005293 Bacteria 1084
55 Ga0065715_10360854 3300005293 Unclassified 878
56 Ga0065715_10499431 3300005293 Bacteria 781
57 Ga0065707_10015242 3300005295 Bacteria 2361
58 Ga0065707_10109535 3300005295 Bacteria 2465
59 Ga0065707_10110710 3300005295 Unclassified 2419
60 Ga0065707_10327836 3300005295 Bacteria 955
61 Ga0065707_10360262 3300005295 Unclassified 905
62 Ga0065707_10410350 3300005295 Bacteria 842
63 Ga0065707_10430056 3300005295 Bacteria 821
64 Ga0065707_10430364 3300005295 Bacteria 798
65 Ga0070658_10047287 3300005327 Bacteria 3482
66 Ga0070658_10373297 3300005327 Bacteria 1223
67 Ga0070676_10009358 3300005328 Bacteria 5296
68 Ga0070676_10030613 3300005328 Bacteria 3070
69 Ga0070676_10047666 3300005328 Bacteria 2503
70 Ga0070676_10055379 3300005328 Bacteria 2340
71 Ga0070676_10095348 3300005328 Bacteria 1829
72 Ga0070676_10381026 3300005328 Bacteria 977
73 Ga0070683_100113331 3300005329 Bacteria 2559
74 Ga0070683_100363202 3300005329 Bacteria 1379
75 Ga0070683_100369267 3300005329 Bacteria 1367
76 Ga0070690_100000480 3300005330 Bacteria 20113
77 Ga0070690_100002065 3300005330 Bacteria 10724
78 Ga0070690_100006857 3300005330 Bacteria 6481
79 Ga0070690_100014072 3300005330 Bacteria 4742
80 Ga0070690_100099752 3300005330 Bacteria 1924
81 Ga0070690_100101800 3300005330 Unclassified 1905
82 Ga0070690_100218032 3300005330 Bacteria 1336
83 Ga0070670_100000055 3300005331 Bacteria 120693
84 Ga0070670_100009750 3300005331 Bacteria 8202
85 Ga0070670_100013880 3300005331 Bacteria 6908
86 Ga0070670_100015449 3300005331 Bacteria 6558
87 Ga0070670_100019355 3300005331 Bacteria 5841
88 Ga0070670_100064955 3300005331 Unclassified 3131
89 Ga0070670_100075964 3300005331 Bacteria 2886
90 Ga0070670_100096475 3300005331 Bacteria 2543
91 Ga0070670_100142762 3300005331 Bacteria 2071
92 Ga0070670_100173467 3300005331 Bacteria 1871
93 Ga0070670_100597293 3300005331 Bacteria 987
94 Ga0070677_10059101 3300005333 Bacteria 1576
95 Ga0068869_100002415 3300005334 Bacteria 11261
96 Ga0068869_100007284 3300005334 Bacteria 7050
97 Ga0068869_100014158 3300005334 Bacteria 5324
98 Ga0068869_100033429 3300005334 Bacteria 3630
99 Ga0068869_100104425 3300005334 Unclassified 2148
100 Ga0068869_100163454 3300005334 Bacteria 1734
101 Ga0068869_100299998 3300005334 Bacteria 1297
102 Ga0068869_100304790 3300005334 Bacteria 1287
103 Ga0068869_100718050 3300005334 Bacteria 853
104 Ga0068869_101200344 3300005334 Bacteria 667
105 Ga0070666_10002449 3300005335 Bacteria 11224
106 Ga0070666_10004454 3300005335 Bacteria 8530
107 Ga0070666_10009085 3300005335 Bacteria 6197
108 Ga0070666_10187027 3300005335 Bacteria 1454
109 Ga0070666_10231493 3300005335 Bacteria 1305
110 Ga0070680_100000341 3300005336 Bacteria 31343
111 Ga0070680_100009372 3300005336 Bacteria 7522
112 Ga0070680_100123196 3300005336 Bacteria 2165
113 Ga0070680_100173548 3300005336 Bacteria 1815
114 Ga0070680_100242121 3300005336 Bacteria 1525
115 Ga0070680_100564528 3300005336 Bacteria 976
116 Ga0070680_100915538 3300005336 Bacteria 757
117 Ga0070680_100922203 3300005336 Bacteria 754
118 Ga0070682_100004407 3300005337 Bacteria 7813
119 Ga0070682_100011784 3300005337 Bacteria 5001
120 Ga0070682_100265811 3300005337 Bacteria 1244
121 Ga0070682_100481278 3300005337 Bacteria 958
122 Ga0068868_100002004 3300005338 Bacteria 14018
123 Ga0068868_100010297 3300005338 Bacteria 6763
124 Ga0068868_100043128 3300005338 Bacteria 3523
125 Ga0068868_100048098 3300005338 Bacteria 3345
126 Ga0068868_100079907 3300005338 Bacteria 2620
127 Ga0070660_100004078 3300005339 Bacteria 10081
128 Ga0070689_100001958 3300005340 Bacteria 13350
129 Ga0070689_100034314 3300005340 Bacteria 3870
130 Ga0070689_100045280 3300005340 Bacteria 3388
131 Ga0070689_100344128 3300005340 Unclassified 1249
132 Ga0070689_100347476 3300005340 Bacteria 1243
133 Ga0070689_100444625 3300005340 Bacteria 1102
134 Ga0070689_100823240 3300005340 Bacteria 818
135 Ga0070689_101155234 3300005340 Bacteria 694
136 Ga0070687_100000386 3300005343 Bacteria 14990
137 Ga0070687_100201307 3300005343 Unclassified 1207
138 Ga0070687_100223290 3300005343 Bacteria 1155
139 Ga0070687_100280283 3300005343 Bacteria 1049
140 Ga0070661_100001835 3300005344 Bacteria 14705
141 Ga0070661_100142704 3300005344 Bacteria 1806
142 Ga0070661_100256768 3300005344 Bacteria 1350
143 Ga0070661_100257591 3300005344 Bacteria 1348
144 Ga0070661_100762972 3300005344 Bacteria 792
145 Ga0070692_10000988 3300005345 Bacteria 9728
146 Ga0070692_10017064 3300005345 Bacteria 3464
147 Ga0070692_10033730 3300005345 Bacteria 2581
148 Ga0070692_10047463 3300005345 Bacteria 2222
149 Ga0070692_10105990 3300005345 Bacteria 1548
150 Ga0070692_10128233 3300005345 Bacteria 1423
151 Ga0070668_100031091 3300005347 Bacteria 4062
152 Ga0070668_100057797 3300005347 Bacteria 2999
153 Ga0070668_100078425 3300005347 Bacteria 2583
154 Ga0070668_100087108 3300005347 Bacteria 2457
155 Ga0070668_100205905 3300005347 Bacteria 1616
156 Ga0070668_100219177 3300005347 Bacteria 1568
157 Ga0070668_100618357 3300005347 Bacteria 949
158 Ga0070668_100773872 3300005347 Bacteria 851
159 Ga0070668_100802323 3300005347 Bacteria 836
160 Ga0070669_100007482 3300005353 Bacteria 7825
161 Ga0070669_100014632 3300005353 Bacteria 5584
162 Ga0070669_100060659 3300005353 Bacteria 2779
163 Ga0070669_100131975 3300005353 Bacteria 1917
164 Ga0070669_100450112 3300005353 Unclassified 1061
165 Ga0070669_100547174 3300005353 Bacteria 965
166 Ga0070669_100571762 3300005353 Bacteria 944
167 Ga0070669_100665407 3300005353 Bacteria 877
168 Ga0070675_100004808 3300005354 Bacteria 10305
169 Ga0070675_100309335 3300005354 Bacteria 1394
170 Ga0070675_100325683 3300005354 Bacteria 1358
171 Ga0070675_100941589 3300005354 Bacteria 792
172 Ga0070671_100012201 3300005355 Bacteria 6914
173 Ga0070671_100017960 3300005355 Bacteria 5738
174 Ga0070671_100033349 3300005355 Bacteria 4257
175 Ga0070671_100051022 3300005355 Bacteria 3441
176 Ga0070671_100079927 3300005355 Bacteria 2733
177 Ga0070671_100472066 3300005355 Bacteria 1077
178 Ga0070674_100006790 3300005356 Bacteria 6705
179 Ga0070674_100106629 3300005356 Bacteria 2051
180 Ga0070674_100312747 3300005356 Bacteria 1256
181 Ga0070674_100321430 3300005356 Bacteria 1241
182 Ga0070674_100476947 3300005356 Bacteria 1035
183 Ga0070674_100572188 3300005356 Bacteria 951
184 Ga0070674_101062977 3300005356 Bacteria 713
185 Ga0070673_100000406 3300005364 Bacteria 22758
186 Ga0070673_100004195 3300005364 Bacteria 9085
187 Ga0070673_100008677 3300005364 Bacteria 6775
188 Ga0070673_100090652 3300005364 Bacteria 2497
189 Ga0070673_100103961 3300005364 Bacteria 2344
190 Ga0070673_100172297 3300005364 Bacteria 1848
191 Ga0070673_100271960 3300005364 Bacteria 1483
192 Ga0070673_100356003 3300005364 Bacteria 1300
193 Ga0070688_100016468 3300005365 Bacteria 4227
194 Ga0070688_100025103 3300005365 Bacteria 3525
195 Ga0070688_100074012 3300005365 Unclassified 2186
196 Ga0070688_100833753 3300005365 Bacteria 723
197 Ga0070659_100005957 3300005366 Bacteria 8788
198 Ga0070659_100017613 3300005366 Bacteria 5381
199 Ga0070659_100043492 3300005366 Bacteria 3513
200 Ga0070659_100584300 3300005366 Bacteria 959
201 Ga0070659_100595045 3300005366 Bacteria 950
202 Ga0070667_100006866 3300005367 Bacteria 9458
203 Ga0070667_100006931 3300005367 Bacteria 9414
204 Ga0070667_100023195 3300005367 Bacteria 5148
205 Ga0070667_100967020 3300005367 Bacteria 794
206 Ga0070703_10027520 3300005406 Bacteria 1695
207 Ga0070709_10091114 3300005434 Bacteria 2011
208 Ga0070709_10131797 3300005434 Bacteria 1707
209 Ga0070709_10267205 3300005434 Bacteria 1238
210 Ga0070709_10440148 3300005434 Bacteria 980
211 Ga0070714_100002547 3300005435 Bacteria 13430
212 Ga0070714_100003501 3300005435 Bacteria 11714
213 Ga0070713_100013486 3300005436 Bacteria 6037
214 Ga0070713_101123560 3300005436 Bacteria 760
215 Ga0070710_10490186 3300005437 Bacteria 840
216 Ga0070701_10024099 3300005438 Bacteria 2940
217 Ga0070701_10064031 3300005438 Unclassified 1947
218 Ga0070701_10123420 3300005438 Bacteria 1462
219 Ga0070701_10205619 3300005438 Bacteria 1166
220 Ga0070701_10215987 3300005438 Unclassified 1141
221 Ga0070701_10340913 3300005438 Bacteria 933
222 Ga0070701_10531861 3300005438 Unclassified 768
223 Ga0070711_100023095 3300005439 Bacteria 4040
224 Ga0070705_100007721 3300005440 Bacteria 5307
225 Ga0070705_100019704 3300005440 Bacteria 3554
226 Ga0070705_100048691 3300005440 Bacteria 2456
227 Ga0070705_100062029 3300005440 Bacteria 2224
228 Ga0070705_100124441 3300005440 Bacteria 1671
229 Ga0070705_100171787 3300005440 Bacteria 1460
230 Ga0070705_100220164 3300005440 Bacteria 1314
231 Ga0070705_100456577 3300005440 Bacteria 960
232 Ga0070705_100465295 3300005440 Bacteria 952
233 Ga0070705_100868116 3300005440 Bacteria 723
234 Ga0070700_100000226 3300005441 Bacteria 31294
235 Ga0070700_100041569 3300005441 Bacteria 2819
236 Ga0070700_100047000 3300005441 Bacteria 2669
237 Ga0070700_100058060 3300005441 Bacteria 2430
238 Ga0070700_100180380 3300005441 Bacteria 1469
239 Ga0070700_100205862 3300005441 Bacteria 1385
240 Ga0070700_100353826 3300005441 Bacteria 1090
241 Ga0070700_100383798 3300005441 Bacteria 1051
242 Ga0070694_100005406 3300005444 Bacteria 7730
243 Ga0070694_100007593 3300005444 Bacteria 6618
244 Ga0070694_100011945 3300005444 Bacteria 5389
245 Ga0070694_100014178 3300005444 Bacteria 4987
246 Ga0070694_100059225 3300005444 Bacteria 2608
247 Ga0070694_100070041 3300005444 Bacteria 2414
248 Ga0070694_100082813 3300005444 Bacteria 2235
249 Ga0070694_100083865 3300005444 Bacteria 2222
250 Ga0070694_100123632 3300005444 Bacteria 1860
251 Ga0070694_100444676 3300005444 Bacteria 1022
252 Ga0070694_100463457 3300005444 Bacteria 1003
253 Ga0070694_100495295 3300005444 Bacteria 972
254 Ga0070694_100635790 3300005444 Bacteria 862
255 Ga0070694_100842012 3300005444 Bacteria 754
256 Ga0070708_100000103 3300005445 Bacteria 56127
257 Ga0070708_100041676 3300005445 Bacteria 4026
258 Ga0070708_100110237 3300005445 Bacteria 2529
259 Ga0070678_100000191 3300005456 Bacteria 26919
260 Ga0070678_100024274 3300005456 Bacteria 4056
261 Ga0070662_100005620 3300005457 Bacteria 8018
262 Ga0070662_100025003 3300005457 Bacteria 4120
263 Ga0070662_100059982 3300005457 Bacteria 2773
264 Ga0070662_100070834 3300005457 Bacteria 2569
265 Ga0070662_100117726 3300005457 Bacteria 2032
266 Ga0070662_100154827 3300005457 Bacteria 1788
267 Ga0070662_100867410 3300005457 Bacteria 769
268 Ga0070681_10000526 3300005458 Bacteria 31355
269 Ga0070681_10003631 3300005458 Bacteria 14470
270 Ga0070681_10003978 3300005458 Bacteria 13945
271 Ga0070681_10099457 3300005458 Unclassified 2854
272 Ga0068867_100007154 3300005459 Bacteria 7886
273 Ga0068867_100033133 3300005459 Bacteria 3739
274 Ga0068867_100042479 3300005459 Bacteria 3326
275 Ga0068867_100042871 3300005459 Bacteria 3311
276 Ga0068867_100062424 3300005459 Bacteria 2768
277 Ga0068867_100145651 3300005459 Bacteria 1856
278 Ga0068867_100158883 3300005459 Bacteria 1781
279 Ga0068867_100385531 3300005459 Bacteria 1178
280 Ga0070685_10009659 3300005466 Bacteria 4994
281 Ga0070685_10060237 3300005466 Bacteria 2219
282 Ga0070706_100000126 3300005467 Bacteria 94634
283 Ga0070706_100001194 3300005467 Bacteria 27840
284 Ga0070706_100003451 3300005467 Bacteria 15570
285 Ga0070706_100009351 3300005467 Bacteria 9129
286 Ga0070706_100028319 3300005467 Bacteria 5158
287 Ga0070706_100046268 3300005467 Bacteria 4017
288 Ga0070706_100130418 3300005467 Bacteria 2345
289 Ga0070706_100413562 3300005467 Unclassified 1255
290 Ga0070706_100465976 3300005467 Bacteria 1176
291 Ga0070706_100545345 3300005467 Bacteria 1079
292 Ga0070706_100934018 3300005467 Bacteria 801
293 Ga0070707_100119128 3300005468 Unclassified 2562
294 Ga0070707_100135740 3300005468 Bacteria 2393
295 Ga0070707_100184260 3300005468 Bacteria 2035
296 Ga0070707_100203238 3300005468 Bacteria 1931
297 Ga0070707_100473316 3300005468 Bacteria 1214
298 Ga0070707_100578974 3300005468 Bacteria 1085
299 Ga0070698_100004063 3300005471 Bacteria 16096
300 Ga0070698_100007367 3300005471 Bacteria 11912
301 Ga0070698_100019004 3300005471 Bacteria 7227
302 Ga0070698_100037444 3300005471 Bacteria 5001
303 Ga0070698_100082658 3300005471 Bacteria 3203
304 Ga0070698_100195434 3300005471 Bacteria 1960
305 Ga0070699_100001144 3300005518 Bacteria 24667
306 Ga0070699_100004289 3300005518 Bacteria 12606
307 Ga0070699_100015896 3300005518 Bacteria 6462
308 Ga0070699_100135686 3300005518 Bacteria 2171
309 Ga0070699_100175131 3300005518 Bacteria 1902
310 Ga0070699_100331872 3300005518 Bacteria 1368
311 Ga0070699_100456654 3300005518 Bacteria 1158
312 Ga0070699_100682419 3300005518 Bacteria 938
313 Ga0070679_100002522 3300005530 Bacteria 16592
314 Ga0070679_100137625 3300005530 Bacteria 2423
315 Ga0070679_100246984 3300005530 Bacteria 1741
316 Ga0070679_100616601 3300005530 Bacteria 1028
317 Ga0070684_100021581 3300005535 Bacteria 5362
318 Ga0070684_100048729 3300005535 Bacteria 3676
319 Ga0070684_100074293 3300005535 Bacteria 2997
320 Ga0070684_101293266 3300005535 Bacteria 686
321 Ga0070697_100000207 3300005536 Bacteria 48241
322 Ga0070697_100024260 3300005536 Bacteria 4827
323 Ga0070697_100030158 3300005536 Bacteria 4355
324 Ga0070697_100064730 3300005536 Bacteria 2986
325 Ga0070697_100068253 3300005536 Bacteria 2910
326 Ga0070697_100080708 3300005536 Bacteria 2680
327 Ga0070697_100089074 3300005536 Bacteria 2549
328 Ga0070697_100141900 3300005536 Bacteria 2021
329 Ga0068853_100090304 3300005539 Bacteria 2692
330 Ga0068853_100153962 3300005539 Bacteria 2070
331 Ga0068853_100510979 3300005539 Bacteria 1135
332 Ga0068853_100565056 3300005539 Bacteria 1078
333 Ga0068853_100634912 3300005539 Bacteria 1016
334 Ga0068853_100877269 3300005539 Bacteria 861
335 Ga0068853_101065997 3300005539 Bacteria 779
336 Ga0070672_100008446 3300005543 Bacteria 7042
337 Ga0070672_100010329 3300005543 Bacteria 6473
338 Ga0070672_100114443 3300005543 Bacteria 2202
339 Ga0070672_100186079 3300005543 Bacteria 1732
340 Ga0070672_100196237 3300005543 Bacteria 1687
341 Ga0070672_100203658 3300005543 Unclassified 1655
342 Ga0070672_100851492 3300005543 Bacteria 804
343 Ga0070672_100965004 3300005543 Bacteria 754
344 Ga0070672_101118128 3300005543 Bacteria 700
345 Ga0070686_100008969 3300005544 Bacteria 5603
346 Ga0070686_100113356 3300005544 Bacteria 1851
347 Ga0070686_100295384 3300005544 Bacteria 1200
348 Ga0070695_100032453 3300005545 Bacteria 3265
349 Ga0070695_100048535 3300005545 Bacteria 2715
350 Ga0070695_100071121 3300005545 Bacteria 2277
351 Ga0070695_100173653 3300005545 Bacteria 1522
352 Ga0070695_100193513 3300005545 Bacteria 1449
353 Ga0070695_100217545 3300005545 Bacteria 1375
354 Ga0070695_100258689 3300005545 Bacteria 1270
355 Ga0070695_100269985 3300005545 Bacteria 1246
356 Ga0070695_100300337 3300005545 Bacteria 1186
357 Ga0070695_100312562 3300005545 Bacteria 1165
358 Ga0070695_100377912 3300005545 Bacteria 1068
359 Ga0070695_100398757 3300005545 Bacteria 1042
360 Ga0070695_100407901 3300005545 Bacteria 1032
361 Ga0070695_100816478 3300005545 Unclassified 748
362 Ga0070695_100831977 3300005545 Bacteria 742
363 Ga0070696_100013718 3300005546 Bacteria 5441
364 Ga0070696_100118397 3300005546 Bacteria 1915
365 Ga0070696_100155890 3300005546 Bacteria 1679
366 Ga0070696_100208756 3300005546 Bacteria 1461
367 Ga0070696_100249571 3300005546 Bacteria 1341
368 Ga0070696_100280658 3300005546 Bacteria 1270
369 Ga0070696_100335133 3300005546 Bacteria 1168
370 Ga0070696_100464529 3300005546 Bacteria 1001
371 Ga0070693_100005496 3300005547 Bacteria 6096
372 Ga0070693_100009978 3300005547 Bacteria 4740
373 Ga0070693_100081854 3300005547 Bacteria 1926
374 Ga0070693_100207381 3300005547 Bacteria 1277
375 Ga0070693_100242349 3300005547 Bacteria 1191
376 Ga0070693_100459919 3300005547 Bacteria 895
377 Ga0070693_100642672 3300005547 Bacteria 771
378 Ga0070665_100004101 3300005548 Bacteria 15324
379 Ga0070665_100009320 3300005548 Bacteria 9935
380 Ga0070704_100044483 3300005549 Bacteria 3085
381 Ga0070704_100047394 3300005549 Bacteria 3004
382 Ga0070704_100095965 3300005549 Bacteria 2222
383 Ga0070704_100096176 3300005549 Bacteria 2220
384 Ga0070704_100182936 3300005549 Bacteria 1678
385 Ga0070704_100191714 3300005549 Bacteria 1643
386 Ga0070704_100272847 3300005549 Bacteria 1398
387 Ga0070704_100298109 3300005549 Bacteria 1342
388 Ga0070704_100362530 3300005549 Bacteria 1226
389 Ga0070704_100378599 3300005549 Bacteria 1202
390 Ga0070704_100390636 3300005549 Bacteria 1185
391 Ga0070704_100402797 3300005549 Bacteria 1168
392 Ga0070704_100407478 3300005549 Bacteria 1162
393 Ga0070704_101263994 3300005549 Bacteria 675
394 Ga0070704_101576339 3300005549 Bacteria 605
395 Ga0068855_100030461 3300005563 Bacteria 6454
396 Ga0068855_100665666 3300005563 Bacteria 1117
397 Ga0070664_100003363 3300005564 Bacteria 12933
398 Ga0070664_100007225 3300005564 Bacteria 8962
399 Ga0070664_100051255 3300005564 Bacteria 3494
400 Ga0070664_100125978 3300005564 Bacteria 2247
401 Ga0070664_100261390 3300005564 Bacteria 1558
402 Ga0070664_100270624 3300005564 Bacteria 1530
403 Ga0068857_100025679 3300005577 Bacteria 5187
404 Ga0068857_100107557 3300005577 Bacteria 2505
405 Ga0068857_100252633 3300005577 Bacteria 1617
406 Ga0068857_100277757 3300005577 Bacteria 1540
407 Ga0068857_100361200 3300005577 Unclassified 1346
408 Ga0068857_100495583 3300005577 Bacteria 1146
409 Ga0068857_100912917 3300005577 Bacteria 842
410 Ga0068854_100008103 3300005578 Bacteria 6740
411 Ga0068854_100051060 3300005578 Bacteria 2962
412 Ga0068856_100070365 3300005614 Bacteria 3461
413 Ga0068856_100084702 3300005614 Bacteria 3149
414 Ga0068856_101054940 3300005614 Bacteria 830
415 Ga0070702_100009239 3300005615 Bacteria 4817
416 Ga0070702_100026599 3300005615 Bacteria 3111
417 Ga0070702_100039702 3300005615 Bacteria 2628
418 Ga0070702_100041529 3300005615 Bacteria 2580
419 Ga0070702_100055986 3300005615 Bacteria 2276
420 Ga0070702_100059126 3300005615 Bacteria 2223
421 Ga0070702_100084317 3300005615 Unclassified 1911
422 Ga0070702_100153156 3300005615 Bacteria 1482
423 Ga0070702_100319123 3300005615 Bacteria 1082
424 Ga0070702_101125949 3300005615 Bacteria 629
425 Ga0068852_100050644 3300005616 Bacteria 3560
426 Ga0068852_100221286 3300005616 Bacteria 1800
427 Ga0068852_100363303 3300005616 Unclassified 1416
428 Ga0068859_100006511 3300005617 Bacteria 11857
429 Ga0068859_100007211 3300005617 Bacteria 11279
430 Ga0068859_100008957 3300005617 Bacteria 10106
431 Ga0068859_100014358 3300005617 Bacteria 7945
432 Ga0068859_100017046 3300005617 Bacteria 7293
433 Ga0068859_100053562 3300005617 Unclassified 4058
434 Ga0068859_100059971 3300005617 Bacteria 3834
435 Ga0068859_100071456 3300005617 Bacteria 3506
436 Ga0068859_100141890 3300005617 Bacteria 2476
437 Ga0068859_100152678 3300005617 Unclassified 2385
438 Ga0068859_100171464 3300005617 Bacteria 2251
439 Ga0068859_100272593 3300005617 Bacteria 1784
440 Ga0068859_100320644 3300005617 Bacteria 1644
441 Ga0068859_100375919 3300005617 Bacteria 1516
442 Ga0068859_100416025 3300005617 Bacteria 1441
443 Ga0068859_100516508 3300005617 Bacteria 1289
444 Ga0068859_100590063 3300005617 Bacteria 1204
445 Ga0068859_100755120 3300005617 Bacteria 1061
446 Ga0068859_100764985 3300005617 Bacteria 1054
447 Ga0068864_100005931 3300005618 Bacteria 10016
448 Ga0068864_100007406 3300005618 Bacteria 9035
449 Ga0068864_100008896 3300005618 Bacteria 8276
450 Ga0068864_100013371 3300005618 Bacteria 6802
451 Ga0068864_100087841 3300005618 Bacteria 2738
452 Ga0068864_100110094 3300005618 Bacteria 2452
453 Ga0068864_100161674 3300005618 Bacteria 2036
454 Ga0068864_100197086 3300005618 Bacteria 1848
455 Ga0068864_100405752 3300005618 Bacteria 1296
456 Ga0068864_100515920 3300005618 Bacteria 1152
457 Ga0068864_100574891 3300005618 Bacteria 1091
458 Ga0068864_100577984 3300005618 Bacteria 1088
459 Ga0068864_100680074 3300005618 Unclassified 1004
460 Ga0068864_100708128 3300005618 Bacteria 984
461 Ga0068866_10030947 3300005718 Bacteria 2573
462 Ga0068866_10040321 3300005718 Bacteria 2311
463 Ga0068866_10058763 3300005718 Bacteria 1987
464 Ga0068866_10164459 3300005718 Bacteria 1297
465 Ga0068861_100000948 3300005719 Bacteria 17621
466 Ga0068861_100012199 3300005719 Bacteria 5991
467 Ga0068861_100029416 3300005719 Bacteria 4019
468 Ga0068861_100038155 3300005719 Bacteria 3575
469 Ga0068861_100071859 3300005719 Bacteria 2683
470 Ga0068861_100157220 3300005719 Bacteria 1871
471 Ga0068861_100393943 3300005719 Bacteria 1227
472 Ga0068861_100768584 3300005719 Bacteria 901
473 Ga0068861_100835378 3300005719 Bacteria 867
474 Ga0068861_101048201 3300005719 Bacteria 781
475 Ga0068851_10000606 3300005834 Bacteria 15431
476 Ga0068851_10156860 3300005834 Bacteria 1248
477 Ga0068851_10482217 3300005834 Bacteria 741
478 Ga0068870_10042336 3300005840 Bacteria 2371
479 Ga0068870_10069559 3300005840 Bacteria 1915
480 Ga0068870_10086474 3300005840 Unclassified 1744
481 Ga0068870_10308248 3300005840 Bacteria 1002
482 Ga0068870_10467303 3300005840 Bacteria 835
483 Ga0068870_10663627 3300005840 Bacteria 716
484 Ga0068863_100000618 3300005841 Bacteria 36046
485 Ga0068863_100005806 3300005841 Bacteria 12097
486 Ga0068863_100095061 3300005841 Bacteria 2828
487 Ga0068863_100101319 3300005841 Bacteria 2738
488 Ga0068863_100142442 3300005841 Bacteria 2291
489 Ga0068863_100196471 3300005841 Bacteria 1939
490 Ga0068863_100238438 3300005841 Bacteria 1755
491 Ga0068863_100276489 3300005841 Bacteria 1626
492 Ga0068863_100611887 3300005841 Bacteria 1079
493 Ga0068863_100769103 3300005841 Bacteria 959
494 Ga0068863_101624824 3300005841 Bacteria 656
495 Ga0068858_100000005 3300005842 Bacteria 305830
496 Ga0068858_100001007 3300005842 Bacteria 29040
497 Ga0068858_100002751 3300005842 Bacteria 17683
498 Ga0068858_100010380 3300005842 Bacteria 8824
499 Ga0068858_100048188 3300005842 Bacteria 3949
500 Ga0068858_100064499 3300005842 Bacteria 3390
501 Ga0068858_100071501 3300005842 Bacteria 3218
502 Ga0068858_100118948 3300005842 Bacteria 2470
503 Ga0068858_100220050 3300005842 Bacteria 1798
504 Ga0068858_100263330 3300005842 Bacteria 1639
505 Ga0068858_100401797 3300005842 Bacteria 1316
506 Ga0068858_100605206 3300005842 Bacteria 1063
507 Ga0068860_100000744 3300005843 Bacteria 37099
508 Ga0068860_100005674 3300005843 Bacteria 12603
509 Ga0068860_100033025 3300005843 Bacteria 4968
510 Ga0068860_100063248 3300005843 Bacteria 3515
511 Ga0068860_100131765 3300005843 Bacteria 2399
512 Ga0068860_100150024 3300005843 Bacteria 2244
513 Ga0068860_100291757 3300005843 Bacteria 1596
514 Ga0068860_100414454 3300005843 Bacteria 1334
515 Ga0068860_100480003 3300005843 Bacteria 1239
516 Ga0068860_100759503 3300005843 Bacteria 982
517 Ga0068860_100828147 3300005843 Bacteria 939
518 Ga0068860_101085476 3300005843 Unclassified 819
519 Ga0068862_100002302 3300005844 Bacteria 17063
520 Ga0068862_100003048 3300005844 Bacteria 14602
521 Ga0068862_100011674 3300005844 Bacteria 7248
522 Ga0068862_100024312 3300005844 Bacteria 5083
523 Ga0068862_100111621 3300005844 Bacteria 2400
524 Ga0068862_100197701 3300005844 Bacteria 1812
525 Ga0068862_100210648 3300005844 Unclassified 1756
526 Ga0068862_100416112 3300005844 Bacteria 1260
527 Ga0068862_100661008 3300005844 Bacteria 1009
528 Ga0068862_100747706 3300005844 Bacteria 951
529 Ga0068862_100987105 3300005844 Bacteria 832
530 Ga0081455_10309573 3300005937 Bacteria 1129
531 Ga0081539_10000067 3300005985 Bacteria 246361
532 Ga0081539_10000600 3300005985 Bacteria 73358
533 Ga0081539_10080395 3300005985 Bacteria 1715
534 Ga0081539_10249012 3300005985 Bacteria 791
535 Ga0070717_10918110 3300006028 Bacteria 797
536 Ga0075364_10083504 3300006051 Bacteria 2114
537 Ga0075364_10265256 3300006051 Bacteria 1168
538 Ga0075432_10077121 3300006058 Bacteria 1204
539 Ga0070715_10000016 3300006163 Bacteria 134692
540 Ga0070716_100000001 3300006173 Bacteria 400668
541 Ga0070716_100053746 3300006173 Bacteria 2298
542 Ga0070716_100162739 3300006173 Bacteria 1448
543 Ga0070716_100361819 3300006173 Bacteria 1031
544 Ga0070716_100538552 3300006173 Bacteria 868
545 Ga0070712_100266566 3300006175 Bacteria 1374
546 Ga0075366_10270047 3300006195 Bacteria 1039
547 Ga0097621_100006203 3300006237 Bacteria 8475
548 Ga0097621_100103357 3300006237 Bacteria 2400
549 Ga0097621_100150815 3300006237 Bacteria 1993
550 Ga0097621_100669554 3300006237 Bacteria 953
551 Ga0097621_100720775 3300006237 Bacteria 919
552 Ga0097621_100923885 3300006237 Bacteria 814
553 Ga0075370_10177479 3300006353 Bacteria 1253
554 Ga0068871_100000995 3300006358 Bacteria 18969
555 Ga0068871_100001151 3300006358 Bacteria 17740
556 Ga0068871_100005662 3300006358 Bacteria 8765
557 Ga0068871_100035254 3300006358 Bacteria 3974
558 Ga0068871_100219565 3300006358 Bacteria 1646
559 Ga0068871_100396305 3300006358 Bacteria 1229
560 Ga0068871_100925233 3300006358 Bacteria 809
561 Ga0075428_100044431 3300006844 Bacteria 4883
562 Ga0075428_100168990 3300006844 Bacteria 2371
563 Ga0075428_100169324 3300006844 Bacteria 2369
564 Ga0075428_100182798 3300006844 Bacteria 2269
565 Ga0075428_100247604 3300006844 Bacteria 1921
566 Ga0075428_100751151 3300006844 Bacteria 1038
567 Ga0075428_100837598 3300006844 Bacteria 977
568 Ga0075428_101370193 3300006844 Bacteria 743
569 Ga0075430_100023157 3300006846 Bacteria 5282
570 Ga0075430_100037277 3300006846 Bacteria 4121
571 Ga0075430_100066882 3300006846 Bacteria 3017
572 Ga0075430_100077544 3300006846 Bacteria 2785
573 Ga0075430_100168991 3300006846 Bacteria 1819
574 Ga0075431_100013466 3300006847 Bacteria 8260
575 Ga0075431_100050985 3300006847 Bacteria 4267
576 Ga0075431_101201576 3300006847 Bacteria 721
577 Ga0075433_10013418 3300006852 Bacteria 6660
578 Ga0075433_10049371 3300006852 Bacteria 3661
579 Ga0075433_10066961 3300006852 Bacteria 3151
580 Ga0075433_10089697 3300006852 Bacteria 2717
581 Ga0075433_10119755 3300006852 Bacteria 2337
582 Ga0075433_10141368 3300006852 Bacteria 2140
583 Ga0075433_10177138 3300006852 Bacteria 1897
584 Ga0075434_100071224 3300006871 Bacteria 3468
585 Ga0075434_100078719 3300006871 Bacteria 3292
586 Ga0075434_100131135 3300006871 Bacteria 2525
587 Ga0075434_100250460 3300006871 Bacteria 1791
588 Ga0075434_100282443 3300006871 Bacteria 1679
589 Ga0075434_100787087 3300006871 Bacteria 967
590 Ga0075434_100788970 3300006871 Unclassified 966
591 Ga0075429_100000233 3300006880 Bacteria 38047
592 Ga0075429_100035316 3300006880 Bacteria 4348
593 Ga0075429_100413736 3300006880 Bacteria 1181
594 Ga0068865_100061840 3300006881 Bacteria 2626
595 Ga0068865_100082047 3300006881 Bacteria 2317
596 Ga0068865_100198776 3300006881 Bacteria 1555
597 Ga0068865_100214921 3300006881 Unclassified 1500
598 Ga0068865_100647812 3300006881 Bacteria 897
599 Ga0068865_100719585 3300006881 Bacteria 855
600 Ga0075436_100148916 3300006914 Bacteria 1646
601 Ga0097620_100006512 3300006931 Bacteria 11857
602 Ga0097620_100007211 3300006931 Bacteria 11279
603 Ga0097620_100008957 3300006931 Bacteria 10106
604 Ga0097620_100014358 3300006931 Bacteria 7945
605 Ga0097620_100017046 3300006931 Bacteria 7293
606 Ga0097620_100053562 3300006931 Unclassified 4058
607 Ga0097620_100059970 3300006931 Bacteria 3834
608 Ga0097620_100071458 3300006931 Bacteria 3506
609 Ga0097620_100141883 3300006931 Bacteria 2476
610 Ga0097620_100152683 3300006931 Unclassified 2385
611 Ga0097620_100171463 3300006931 Bacteria 2251
612 Ga0097620_100272582 3300006931 Bacteria 1784
613 Ga0097620_100320627 3300006931 Bacteria 1644
614 Ga0097620_100375903 3300006931 Bacteria 1516
615 Ga0097620_100416017 3300006931 Bacteria 1441
616 Ga0097620_100516474 3300006931 Bacteria 1289
617 Ga0097620_100590066 3300006931 Bacteria 1204
618 Ga0097620_100755085 3300006931 Bacteria 1061
619 Ga0097620_100764964 3300006931 Bacteria 1054
620 Ga0075435_100013579 3300007076 Bacteria 6064
621 Ga0075435_100133137 3300007076 Bacteria 2081
622 Ga0105251_10001834 3300009011 Bacteria 17487
623 Ga0105251_10115592 3300009011 Bacteria 1220
624 Ga0105251_10248362 3300009011 Bacteria 802
625 Ga0105244_10012604 3300009036 Bacteria 4987
626 Ga0105244_10064937 3300009036 Bacteria 1829
627 Ga0105250_10045142 3300009092 Bacteria 1767
628 Ga0105240_10007842 3300009093 Bacteria 15409
629 Ga0105240_10056814 3300009093 Bacteria 4895
630 Ga0105240_10066617 3300009093 Bacteria 4466
631 Ga0105240_10276896 3300009093 Bacteria 1929
632 Ga0105240_10801154 3300009093 Bacteria 1020
633 Ga0105240_11831455 3300009093 Bacteria 632
634 Ga0111539_10000660 3300009094 Bacteria 44559
635 Ga0111539_10008323 3300009094 Bacteria 13201
636 Ga0111539_10064405 3300009094 Bacteria 4336
637 Ga0111539_10066866 3300009094 Bacteria 4245
638 Ga0111539_10069922 3300009094 Bacteria 4144
639 Ga0111539_10129689 3300009094 Bacteria 2953
640 Ga0111539_10345548 3300009094 Bacteria 1732
641 Ga0111539_10347332 3300009094 Bacteria 1727
642 Ga0111539_11474405 3300009094 Bacteria 789
643 Ga0111539_11980174 3300009094 Bacteria 676
644 Ga0111539_12030869 3300009094 Bacteria 667
645 Ga0105245_10015758 3300009098 Bacteria 6593
646 Ga0105245_10021971 3300009098 Bacteria 5600
647 Ga0105245_10215450 3300009098 Bacteria 1850
648 Ga0105245_10255941 3300009098 Bacteria 1702
649 Ga0105245_10418195 3300009098 Bacteria 1343
650 Ga0105245_11364201 3300009098 Bacteria 759
651 Ga0105247_10000002 3300009101 Bacteria 724587
652 Ga0105247_10007400 3300009101 Bacteria 6740
653 Ga0105247_10009144 3300009101 Bacteria 6031
654 Ga0105247_10153395 3300009101 Bacteria 1519
655 Ga0105247_10182518 3300009101 Bacteria 1401
656 Ga0105247_10324197 3300009101 Bacteria 1076
657 Ga0105247_10336459 3300009101 Bacteria 1058
658 Ga0105247_10384078 3300009101 Bacteria 996
659 Ga0105247_10412897 3300009101 Unclassified 965
660 Ga0114129_10011276 3300009147 Bacteria 12739
661 Ga0114129_10029256 3300009147 Bacteria 7802
662 Ga0114129_10033406 3300009147 Bacteria 7270
663 Ga0114129_10050597 3300009147 Bacteria 5836
664 Ga0114129_10071705 3300009147 Bacteria 4830
665 Ga0114129_10080988 3300009147 Bacteria 4513
666 Ga0114129_10084023 3300009147 Bacteria 4421
667 Ga0114129_10111224 3300009147 Bacteria 3780
668 Ga0114129_10170111 3300009147 Bacteria 2971
669 Ga0114129_10228378 3300009147 Bacteria 2508
670 Ga0114129_10283852 3300009147 Bacteria 2211
671 Ga0114129_10361680 3300009147 Bacteria 1920
672 Ga0114129_11935752 3300009147 Bacteria 714
673 Ga0105243_10001184 3300009148 Bacteria 23548
674 Ga0105243_10133691 3300009148 Bacteria 2108
675 Ga0105243_10177975 3300009148 Bacteria 1847
676 Ga0105243_10260413 3300009148 Bacteria 1552
677 Ga0105243_10685994 3300009148 Bacteria 997
678 Ga0105243_11390051 3300009148 Bacteria 722
679 Ga0105241_10005065 3300009174 Bacteria 9716
680 Ga0105241_10011563 3300009174 Bacteria 6472
681 Ga0105241_10093410 3300009174 Unclassified 2377
682 Ga0105241_10110018 3300009174 Bacteria 2204
683 Ga0105241_10209964 3300009174 Bacteria 1631
684 Ga0105241_10332590 3300009174 Bacteria 1313
685 Ga0105241_10475417 3300009174 Bacteria 1110
686 Ga0105241_10562516 3300009174 Bacteria 1025
687 Ga0105241_10708772 3300009174 Bacteria 919
688 Ga0105241_10916610 3300009174 Bacteria 815
689 Ga0105241_10920604 3300009174 Bacteria 813
690 Ga0105242_10002565 3300009176 Bacteria 14222
691 Ga0105242_10006981 3300009176 Bacteria 8716
692 Ga0105242_10122645 3300009176 Unclassified 2233
693 Ga0105242_10176180 3300009176 Bacteria 1883
694 Ga0105242_10191918 3300009176 Bacteria 1809
695 Ga0105242_10303479 3300009176 Bacteria 1458
696 Ga0105242_10384318 3300009176 Bacteria 1306
697 Ga0105248_10001052 3300009177 Bacteria 30554
698 Ga0105248_10002525 3300009177 Bacteria 20367
699 Ga0105248_10017113 3300009177 Bacteria 7987
700 Ga0105248_10018104 3300009177 Bacteria 7777
701 Ga0105248_10030262 3300009177 Bacteria 6044
702 Ga0105248_10073995 3300009177 Bacteria 3829
703 Ga0105248_10087370 3300009177 Bacteria 3509
704 Ga0105248_10145166 3300009177 Bacteria 2678
705 Ga0105248_10164620 3300009177 Bacteria 2500
706 Ga0105248_10169519 3300009177 Bacteria 2460
707 Ga0105248_10185451 3300009177 Unclassified 2345
708 Ga0105248_10546673 3300009177 Unclassified 1306
709 Ga0105248_10716591 3300009177 Bacteria 1129
710 Ga0105248_10774378 3300009177 Bacteria 1083
711 Ga0105237_10000493 3300009545 Bacteria 55867
712 Ga0105237_10018907 3300009545 Bacteria 7123
713 Ga0105237_10180368 3300009545 Bacteria 2112
714 Ga0105237_10189909 3300009545 Bacteria 2054
715 Ga0105237_10224498 3300009545 Bacteria 1879
716 Ga0105237_10256117 3300009545 Bacteria 1752
717 Ga0105237_10275755 3300009545 Bacteria 1684
718 Ga0105238_10000622 3300009551 Bacteria 37307
719 Ga0105238_10003831 3300009551 Bacteria 14938
720 Ga0105238_10016102 3300009551 Bacteria 7563
721 Ga0105238_10086058 3300009551 Bacteria 3130
722 Ga0105238_10090739 3300009551 Bacteria 3043
723 Ga0105249_10000513 3300009553 Bacteria 35783
724 Ga0105249_10006513 3300009553 Bacteria 10157
725 Ga0105249_10016152 3300009553 Bacteria 6619
726 Ga0105249_10037854 3300009553 Bacteria 4377
727 Ga0105249_10058352 3300009553 Bacteria 3537
728 Ga0105249_10073789 3300009553 Bacteria 3157
729 Ga0105249_10210592 3300009553 Bacteria 1907
730 Ga0105249_10373844 3300009553 Bacteria 1449
731 Ga0105249_10447691 3300009553 Bacteria 1330
732 Ga0105249_10560986 3300009553 Bacteria 1194
733 Ga0105249_10805328 3300009553 Bacteria 1004
734 Ga0105249_10823283 3300009553 Bacteria 993
735 Ga0105249_10867337 3300009553 Bacteria 969
736 Ga0105249_10905650 3300009553 Bacteria 949
737 Ga0105249_11330925 3300009553 Bacteria 790
738 Ga0099796_10016560 3300010159 Bacteria 2179
739 Ga0105239_10044121 3300010375 Bacteria 4888
740 Ga0105239_10104263 3300010375 Bacteria 3140
741 Ga0105239_10134909 3300010375 Bacteria 2748
742 Ga0105239_10263279 3300010375 Bacteria 1938
743 Ga0105239_10316827 3300010375 Bacteria 1758
744 Ga0105239_10454265 3300010375 Bacteria 1454
745 Ga0105239_10487382 3300010375 Bacteria 1401
746 Ga0105239_10510810 3300010375 Unclassified 1367
747 Ga0105239_10618736 3300010375 Bacteria 1236
748 Ga0105239_10635025 3300010375 Bacteria 1219
749 Ga0105239_10957835 3300010375 Bacteria 983
750 Ga0105246_10010041 3300011119 Bacteria 5842
751 Ga0105246_10029811 3300011119 Bacteria 3598
752 Ga0105246_10108732 3300011119 Bacteria 2033
753 Ga0105246_10125676 3300011119 Bacteria 1907
754 Ga0105246_10174519 3300011119 Bacteria 1649
755 Ga0105246_10231013 3300011119 Bacteria 1457
756 Ga0157373_10011744 3300013100 Bacteria 6434
757 Ga0157373_10026055 3300013100 Bacteria 4226
758 Ga0157373_10141382 3300013100 Bacteria 1693
759 Ga0157371_10001931 3300013102 Bacteria 20697
760 Ga0157371_10082683 3300013102 Bacteria 2274
761 Ga0157371_10166935 3300013102 Bacteria 1572
762 Ga0157371_10297099 3300013102 Bacteria 1169
763 Ga0157370_10000086 3300013104 Bacteria 103729
764 Ga0157370_10017321 3300013104 Bacteria 7274
765 Ga0157370_10029507 3300013104 Bacteria 5380
766 Ga0157369_10018020 3300013105 Bacteria 7922
767 Ga0157369_10201919 3300013105 Bacteria 2086
768 Ga0157374_10010521 3300013296 Bacteria 7962
769 Ga0157374_10015160 3300013296 Bacteria 6759
770 Ga0157374_10033129 3300013296 Bacteria 4712
771 Ga0157374_10036684 3300013296 Bacteria 4492
772 Ga0157378_10001035 3300013297 Bacteria 25384
773 Ga0157378_10004449 3300013297 Bacteria 12318
774 Ga0157378_10029854 3300013297 Unclassified 4815
775 Ga0157378_10123997 3300013297 Bacteria 2385
776 Ga0157378_10133166 3300013297 Bacteria 2303
777 Ga0157378_10255489 3300013297 Bacteria 1679
778 Ga0157378_10269344 3300013297 Bacteria 1637
779 Ga0157378_10271656 3300013297 Bacteria 1631
780 Ga0157378_10306537 3300013297 Bacteria 1539
781 Ga0157378_10483422 3300013297 Bacteria 1234
782 Ga0157378_10509168 3300013297 Bacteria 1204
783 Ga0157378_10750497 3300013297 Bacteria 999
784 Ga0157378_10998515 3300013297 Bacteria 871
785 Ga0157378_11139448 3300013297 Bacteria 818
786 Ga0157378_11413992 3300013297 Bacteria 739
787 Ga0163162_10000001 3300013306 Bacteria 751833
788 Ga0163162_10000770 3300013306 Bacteria 29796
789 Ga0163162_10008872 3300013306 Bacteria 9778
790 Ga0163162_10009333 3300013306 Bacteria 9539
791 Ga0163162_10033327 3300013306 Bacteria 5118
792 Ga0163162_10045061 3300013306 Bacteria 4419
793 Ga0163162_10069552 3300013306 Bacteria 3572
794 Ga0163162_10073228 3300013306 Bacteria 3481
795 Ga0163162_10073421 3300013306 Bacteria 3477
796 Ga0163162_10111575 3300013306 Bacteria 2832
797 Ga0163162_10234434 3300013306 Bacteria 1966
798 Ga0163162_10810881 3300013306 Bacteria 1053
799 Ga0163162_11404694 3300013306 Bacteria 794
800 Ga0163162_12207964 3300013306 Bacteria 632
801 Ga0157372_10200359 3300013307 Bacteria 2312
802 Ga0157372_10329288 3300013307 Bacteria 1778
803 Ga0157372_10743699 3300013307 Bacteria 1140
804 Ga0157372_11021025 3300013307 Bacteria 958
805 Ga0157372_12028863 3300013307 Bacteria 661
806 Ga0157375_10003568 3300013308 Bacteria 13508
807 Ga0157375_10027172 3300013308 Bacteria 5346
808 Ga0157375_10060707 3300013308 Bacteria 3751
809 Ga0157375_10123431 3300013308 Bacteria 2702
810 Ga0157375_10179649 3300013308 Unclassified 2267
811 Ga0157375_10199415 3300013308 Unclassified 2157
812 Ga0157375_10263050 3300013308 Bacteria 1887
813 Ga0157375_10409043 3300013308 Bacteria 1523
814 Ga0157375_10520657 3300013308 Bacteria 1352
815 Ga0157375_10588370 3300013308 Bacteria 1273
816 Ga0157375_11500531 3300013308 Bacteria 796
817 Ga0163163_10000370 3300014325 Bacteria 43137
818 Ga0163163_10008460 3300014325 Bacteria 9142
819 Ga0163163_10017425 3300014325 Bacteria 6699
820 Ga0163163_10035487 3300014325 Bacteria 4838
821 Ga0163163_10072569 3300014325 Bacteria 3432
822 Ga0163163_10140888 3300014325 Bacteria 2454
823 Ga0163163_10303861 3300014325 Bacteria 1648
824 Ga0163163_10528768 3300014325 Bacteria 1242
825 Ga0163163_10716635 3300014325 Unclassified 1064
826 Ga0163163_10926633 3300014325 Bacteria 934
827 Ga0157380_10002469 3300014326 Bacteria 12460
828 Ga0157380_10003683 3300014326 Bacteria 10542
829 Ga0157380_10015457 3300014326 Bacteria 5611
830 Ga0157380_10026332 3300014326 Bacteria 4416
831 Ga0157380_10033618 3300014326 Bacteria 3950
832 Ga0157380_10039987 3300014326 Bacteria 3650
833 Ga0157380_10074449 3300014326 Bacteria 2757
834 Ga0157380_10322935 3300014326 Bacteria 1432
835 Ga0157380_10439200 3300014326 Bacteria 1250
836 Ga0157380_10459471 3300014326 Bacteria 1225
837 Ga0157380_11440374 3300014326 Bacteria 740
838 Ga0182008_10033626 3300014497 Bacteria 2572
839 Ga0157377_10088515 3300014745 Bacteria 1824
840 Ga0157377_10093640 3300014745 Bacteria 1779
841 Ga0157377_10125117 3300014745 Bacteria 1563
842 Ga0157377_10218091 3300014745 Bacteria 1220
843 Ga0157377_10344943 3300014745 Bacteria 997
844 Ga0157377_10377252 3300014745 Bacteria 959
845 Ga0157377_10466362 3300014745 Bacteria 875
846 Ga0157379_10000002 3300014968 Bacteria 179727
847 Ga0157379_10011763 3300014968 Bacteria 7642
848 Ga0157379_10029693 3300014968 Bacteria 4861
849 Ga0157379_10031955 3300014968 Bacteria 4690
850 Ga0157379_10047420 3300014968 Bacteria 3833
851 Ga0157379_10127813 3300014968 Bacteria 2287
852 Ga0157379_10164057 3300014968 Bacteria 2005
853 Ga0157379_10274782 3300014968 Unclassified 1533
854 Ga0157376_10034429 3300014969 Bacteria 4090
855 Ga0182006_1008997 3300015261 Bacteria 4498
856 Ga0182006_1136572 3300015261 Bacteria 840
857 Ga0182007_10000593 3300015262 Bacteria 21185
858 Ga0182007_10078466 3300015262 Bacteria 1083
859 Ga0182005_1001301 3300015265 Bacteria 10255
860 Ga0183368_1007 3300015687 Bacteria 405609
861 Ga0163161_10029878 3300017792 Unclassified 3874
862 Ga0163161_10100476 3300017792 Bacteria 2152
863 Ga0197907_10857353 3300020069 Bacteria 1425
864 Ga0206349_1594483 3300020075 Bacteria 1572
865 Ga0206350_10618878 3300020080 Bacteria 665
866 Ga0206354_10497689 3300020081 Bacteria 1427
867 Ga0213872_10271181 3300021361 Bacteria 710
868 Ga0224712_10042402 3300022467 Bacteria 1724
869 Ga0224712_10470768 3300022467 Bacteria 605
870 Ga0207672_1000044 3300025223 Bacteria 16168
871 Ga0207427_101412 3300025231 Bacteria 8775
872 Ga0209437_100385 3300025233 Bacteria 43317
873 Ga0209258_100514 3300025242 Bacteria 37294
874 Ga0209258_101342 3300025242 Bacteria 9032
875 Ga0209646_1003328 3300025246 Bacteria 3202
876 Ga0209148_1000055 3300025254 Bacteria 367500
877 Ga0209565_1000001 3300025263 Bacteria 2950419
878 Ga0209565_1000023 3300025263 Bacteria 388244
879 Ga0209673_1000001 3300025273 Bacteria 3176258
880 Ga0209673_1000308 3300025273 Bacteria 90538
881 Ga0209673_1000853 3300025273 Bacteria 39621
882 Ga0209130_1006582 3300025284 Bacteria 3749
883 Ga0209675_1000001 3300025291 Bacteria 2950293
884 Ga0209675_1000154 3300025291 Bacteria 89426
885 Ga0209676_1000352 3300025292 Bacteria 87022
886 Ga0209676_1003485 3300025292 Bacteria 9646
887 Ga0209025_1000005 3300025294 Bacteria 1272149
888 Ga0209564_1000001 3300025295 Bacteria 3176258
889 Ga0209564_1000106 3300025295 Bacteria 216131
890 Ga0209758_1045517 3300025297 Bacteria 1592
891 Ga0209050_1000436 3300025298 Bacteria 76328
892 Ga0209050_1004931 3300025298 Bacteria 8715
893 Ga0209050_1022114 3300025298 Bacteria 2290
894 Ga0209256_1000002 3300025299 Bacteria 1906740
895 Ga0209256_1001379 3300025299 Bacteria 25429
896 Ga0209256_1013420 3300025299 Bacteria 3040
897 Ga0209051_1011336 3300025303 Bacteria 4408
898 Ga0209257_1000241 3300025304 Bacteria 127802
899 Ga0209257_1000251 3300025304 Bacteria 123796
900 Ga0209257_1005006 3300025304 Bacteria 9662
901 Ga0207697_10010377 3300025315 Unclassified 3985
902 Ga0207697_10011283 3300025315 Bacteria 3784
903 Ga0207656_10000435 3300025321 Bacteria 13993
904 Ga0207656_10069101 3300025321 Bacteria 1566
905 Ga0207655_1056976 3300025728 Bacteria 1537
906 Ga0207655_1065876 3300025728 Bacteria 1372
907 Ga0207713_1004179 3300025735 Bacteria 9471
908 Ga0207653_10007246 3300025885 Bacteria 3459
909 Ga0207653_10066038 3300025885 Bacteria 1229
910 Ga0207682_10004024 3300025893 Bacteria 6252
911 Ga0207692_10458129 3300025898 Bacteria 804
912 Ga0207642_10011549 3300025899 Bacteria 3156
913 Ga0207642_10015514 3300025899 Bacteria 2841
914 Ga0207710_10000002 3300025900 Bacteria 1251998
915 Ga0207710_10000712 3300025900 Bacteria 18499
916 Ga0207710_10021935 3300025900 Bacteria 2739
917 Ga0207710_10218602 3300025900 Bacteria 945
918 Ga0207710_10236004 3300025900 Bacteria 911
919 Ga0207688_10005288 3300025901 Bacteria 7014
920 Ga0207688_10397091 3300025901 Bacteria 855
921 Ga0207680_10007010 3300025903 Bacteria 5471
922 Ga0207680_10013221 3300025903 Bacteria 4233
923 Ga0207680_10018000 3300025903 Bacteria 3744
924 Ga0207680_10299415 3300025903 Unclassified 1121
925 Ga0207680_10342787 3300025903 Bacteria 1048
926 Ga0207647_10009295 3300025904 Bacteria 6989
927 Ga0207647_10242218 3300025904 Bacteria 1035
928 Ga0207647_10256557 3300025904 Bacteria 1002
929 Ga0207647_10361231 3300025904 Bacteria 822
930 Ga0207699_10009459 3300025906 Bacteria 4855
931 Ga0207699_10264667 3300025906 Bacteria 1189
932 Ga0207699_10560035 3300025906 Bacteria 830
933 Ga0207645_10000539 3300025907 Bacteria 31513
934 Ga0207645_10001493 3300025907 Bacteria 19117
935 Ga0207645_10009600 3300025907 Bacteria 6685
936 Ga0207645_10059577 3300025907 Bacteria 2438
937 Ga0207645_10167070 3300025907 Bacteria 1441
938 Ga0207643_10003568 3300025908 Bacteria 8380
939 Ga0207643_10005835 3300025908 Bacteria 6576
940 Ga0207643_10019005 3300025908 Bacteria 3764
941 Ga0207643_10019112 3300025908 Bacteria 3754
942 Ga0207643_10030115 3300025908 Bacteria 3020
943 Ga0207643_10033349 3300025908 Bacteria 2880
944 Ga0207643_10127972 3300025908 Bacteria 1509
945 Ga0207643_10538274 3300025908 Bacteria 749
946 Ga0207705_10046439 3300025909 Bacteria 3121
947 Ga0207705_10447491 3300025909 Bacteria 1001
948 Ga0207684_10000023 3300025910 Bacteria 334838
949 Ga0207684_10000158 3300025910 Bacteria 115693
950 Ga0207684_10006459 3300025910 Bacteria 10690
951 Ga0207684_10059825 3300025910 Bacteria 3235
952 Ga0207684_10153869 3300025910 Bacteria 1979
953 Ga0207684_10187296 3300025910 Bacteria 1784
954 Ga0207684_10395875 3300025910 Bacteria 1187
955 Ga0207684_10869768 3300025910 Bacteria 759
956 Ga0207654_10011787 3300025911 Bacteria 4464
957 Ga0207654_10080890 3300025911 Bacteria 1955
958 Ga0207654_10142977 3300025911 Bacteria 1528
959 Ga0207654_10319338 3300025911 Unclassified 1061
960 Ga0207654_10399469 3300025911 Bacteria 955
961 Ga0207654_10555464 3300025911 Bacteria 816
962 Ga0207707_10000335 3300025912 Bacteria 49647
963 Ga0207707_10006189 3300025912 Bacteria 10456
964 Ga0207707_10103107 3300025912 Unclassified 2494
965 Ga0207695_10022156 3300025913 Bacteria 7224
966 Ga0207695_10047974 3300025913 Bacteria 4513
967 Ga0207695_10081573 3300025913 Bacteria 3273
968 Ga0207695_10213149 3300025913 Bacteria 1841
969 Ga0207695_10257839 3300025913 Bacteria 1642
970 Ga0207671_10148448 3300025914 Bacteria 1810
971 Ga0207671_10213674 3300025914 Bacteria 1509
972 Ga0207671_10538258 3300025914 Bacteria 931
973 Ga0207671_10539411 3300025914 Bacteria 930
974 Ga0207671_10611068 3300025914 Unclassified 869
975 Ga0207693_10114005 3300025915 Bacteria 2121
976 Ga0207663_10280052 3300025916 Bacteria 1238
977 Ga0207660_10022527 3300025917 Bacteria 4245
978 Ga0207660_10131779 3300025917 Unclassified 1903
979 Ga0207660_10252870 3300025917 Bacteria 1391
980 Ga0207660_10395635 3300025917 Bacteria 1112
981 Ga0207662_10005591 3300025918 Bacteria 6718
982 Ga0207662_10008249 3300025918 Bacteria 5699
983 Ga0207662_10066197 3300025918 Bacteria 2177
984 Ga0207662_10095667 3300025918 Bacteria 1833
985 Ga0207662_10198468 3300025918 Bacteria 1297
986 Ga0207662_10315853 3300025918 Bacteria 1042
987 Ga0207657_10000280 3300025919 Bacteria 54274
988 Ga0207657_10007121 3300025919 Bacteria 11483
989 Ga0207649_10009533 3300025920 Bacteria 5315
990 Ga0207649_10111687 3300025920 Bacteria 1827
991 Ga0207649_10237887 3300025920 Bacteria 1306
992 Ga0207652_10001909 3300025921 Bacteria 18056
993 Ga0207652_10104029 3300025921 Bacteria 2511
994 Ga0207652_10991859 3300025921 Bacteria 739
995 Ga0207646_10016557 3300025922 Bacteria 6918
996 Ga0207646_10043621 3300025922 Bacteria 4027
997 Ga0207646_10475172 3300025922 Bacteria 1127
998 Ga0207646_10529836 3300025922 Bacteria 1060
999 Ga0207646_10776394 3300025922 Bacteria 854
1000 Ga0207646_11058558 3300025922 Bacteria 715
1001 Ga0207681_10017485 3300025923 Bacteria 4503
1002 Ga0207681_10021616 3300025923 Bacteria 4093
1003 Ga0207681_10049248 3300025923 Bacteria 2847
1004 Ga0207681_10051584 3300025923 Bacteria 2787
1005 Ga0207681_10425731 3300025923 Unclassified 1076
1006 Ga0207681_10479708 3300025923 Bacteria 1015
1007 Ga0207681_10555322 3300025923 Bacteria 945
1008 Ga0207681_10863039 3300025923 Bacteria 757
1009 Ga0207681_11317037 3300025923 Bacteria 607
1010 Ga0207694_10011354 3300025924 Bacteria 6723
1011 Ga0207694_10012926 3300025924 Bacteria 6287
1012 Ga0207694_10022706 3300025924 Bacteria 4759
1013 Ga0207694_10035107 3300025924 Bacteria 3846
1014 Ga0207694_10135782 3300025924 Bacteria 1975
1015 Ga0207650_10000001 3300025925 Bacteria 1545726
1016 Ga0207650_10017769 3300025925 Bacteria 4981
1017 Ga0207650_10023968 3300025925 Bacteria 4333
1018 Ga0207650_10065538 3300025925 Bacteria 2722
1019 Ga0207650_10099313 3300025925 Bacteria 2238
1020 Ga0207650_10130429 3300025925 Bacteria 1966
1021 Ga0207650_10366411 3300025925 Bacteria 1188
1022 Ga0207650_10379874 3300025925 Bacteria 1166
1023 Ga0207650_10629943 3300025925 Bacteria 903
1024 Ga0207659_10001158 3300025926 Bacteria 15704
1025 Ga0207659_10210393 3300025926 Bacteria 1558
1026 Ga0207659_10292455 3300025926 Bacteria 1335
1027 Ga0207659_10435811 3300025926 Bacteria 1101
1028 Ga0207659_10473252 3300025926 Bacteria 1058
1029 Ga0207687_10073446 3300025927 Bacteria 2449
1030 Ga0207687_10873316 3300025927 Bacteria 769
1031 Ga0207700_10010740 3300025928 Bacteria 5799
1032 Ga0207664_10001362 3300025929 Bacteria 16056
1033 Ga0207664_10092159 3300025929 Bacteria 2486
1034 Ga0207664_11157279 3300025929 Bacteria 691
1035 Ga0207644_10000361 3300025931 Bacteria 29606
1036 Ga0207644_10019459 3300025931 Bacteria 4605
1037 Ga0207644_10030475 3300025931 Bacteria 3752
1038 Ga0207644_10058072 3300025931 Unclassified 2795
1039 Ga0207644_10132251 3300025931 Bacteria 1911
1040 Ga0207644_10470906 3300025931 Bacteria 1034
1041 Ga0207644_10883361 3300025931 Bacteria 749
1042 Ga0207644_10922902 3300025931 Bacteria 732
1043 Ga0207690_10010818 3300025932 Bacteria 5437
1044 Ga0207690_10019422 3300025932 Bacteria 4184
1045 Ga0207690_10399452 3300025932 Bacteria 1096
1046 Ga0207706_10004974 3300025933 Bacteria 12419
1047 Ga0207706_10005309 3300025933 Bacteria 12009
1048 Ga0207706_10021323 3300025933 Bacteria 5821
1049 Ga0207706_10206847 3300025933 Bacteria 1721
1050 Ga0207706_10427526 3300025933 Bacteria 1147
1051 Ga0207706_10563676 3300025933 Bacteria 980
1052 Ga0207706_10604219 3300025933 Bacteria 942
1053 Ga0207706_11103993 3300025933 Bacteria 663
1054 Ga0207686_10023796 3300025934 Bacteria 3540
1055 Ga0207686_10138337 3300025934 Bacteria 1680
1056 Ga0207686_10221772 3300025934 Bacteria 1366
1057 Ga0207709_10009296 3300025935 Bacteria 5413
1058 Ga0207709_10074046 3300025935 Bacteria 2172
1059 Ga0207709_10081560 3300025935 Bacteria 2086
1060 Ga0207709_10116690 3300025935 Bacteria 1795
1061 Ga0207709_10165182 3300025935 Bacteria 1548
1062 Ga0207709_10618375 3300025935 Bacteria 859
1063 Ga0207709_10834704 3300025935 Bacteria 746
1064 Ga0207670_10003486 3300025936 Bacteria 8348
1065 Ga0207670_10041072 3300025936 Bacteria 3040
1066 Ga0207670_10198204 3300025936 Bacteria 1524
1067 Ga0207670_10275205 3300025936 Bacteria 1310
1068 Ga0207670_10293093 3300025936 Bacteria 1272
1069 Ga0207670_10339940 3300025936 Bacteria 1186
1070 Ga0207670_10373555 3300025936 Unclassified 1134
1071 Ga0207670_10614867 3300025936 Bacteria 893
1072 Ga0207670_10759917 3300025936 Bacteria 806
1073 Ga0207669_10009982 3300025937 Bacteria 4550
1074 Ga0207669_10010056 3300025937 Bacteria 4539
1075 Ga0207669_10125459 3300025937 Bacteria 1753
1076 Ga0207669_10280926 3300025937 Bacteria 1255
1077 Ga0207669_11297098 3300025937 Unclassified 618
1078 Ga0207704_10075464 3300025938 Bacteria 2156
1079 Ga0207704_10174347 3300025938 Bacteria 1546
1080 Ga0207704_10283907 3300025938 Unclassified 1260
1081 Ga0207704_10308085 3300025938 Bacteria 1216
1082 Ga0207704_10378055 3300025938 Bacteria 1111
1083 Ga0207665_10000016 3300025939 Bacteria 132853
1084 Ga0207665_10015894 3300025939 Bacteria 4941
1085 Ga0207665_10039326 3300025939 Bacteria 3153
1086 Ga0207665_10066328 3300025939 Bacteria 2456
1087 Ga0207665_10626611 3300025939 Bacteria 841
1088 Ga0207691_10002829 3300025940 Bacteria 16910
1089 Ga0207691_10010724 3300025940 Bacteria 8797
1090 Ga0207691_10034037 3300025940 Bacteria 4741
1091 Ga0207691_10053702 3300025940 Bacteria 3678
1092 Ga0207691_10129329 3300025940 Bacteria 2232
1093 Ga0207691_10162449 3300025940 Bacteria 1959
1094 Ga0207691_10415586 3300025940 Bacteria 1146
1095 Ga0207691_10431558 3300025940 Bacteria 1122
1096 Ga0207691_10528115 3300025940 Bacteria 1001
1097 Ga0207691_10799052 3300025940 Bacteria 793
1098 Ga0207711_10000312 3300025941 Bacteria 51973
1099 Ga0207711_10002786 3300025941 Bacteria 15376
1100 Ga0207711_10009655 3300025941 Bacteria 8040
1101 Ga0207711_10014922 3300025941 Bacteria 6454
1102 Ga0207711_10053183 3300025941 Bacteria 3473
1103 Ga0207711_10081275 3300025941 Bacteria 2832
1104 Ga0207711_10175630 3300025941 Bacteria 1946
1105 Ga0207711_10219526 3300025941 Bacteria 1738
1106 Ga0207711_10275463 3300025941 Bacteria 1549
1107 Ga0207711_10357476 3300025941 Unclassified 1353
1108 Ga0207711_10833699 3300025941 Bacteria 858
1109 Ga0207689_10002240 3300025942 Bacteria 18111
1110 Ga0207689_10007737 3300025942 Bacteria 9406
1111 Ga0207689_10008982 3300025942 Bacteria 8656
1112 Ga0207689_10014962 3300025942 Bacteria 6583
1113 Ga0207689_10047734 3300025942 Bacteria 3533
1114 Ga0207689_10260947 3300025942 Bacteria 1433
1115 Ga0207689_10306925 3300025942 Unclassified 1316
1116 Ga0207689_10375712 3300025942 Bacteria 1183
1117 Ga0207689_10573920 3300025942 Bacteria 948
1118 Ga0207689_10650546 3300025942 Bacteria 888
1119 Ga0207661_10169723 3300025944 Bacteria 1899
1120 Ga0207661_10232684 3300025944 Bacteria 1632
1121 Ga0207679_10039470 3300025945 Bacteria 3371
1122 Ga0207679_10064776 3300025945 Bacteria 2733
1123 Ga0207679_10065737 3300025945 Bacteria 2715
1124 Ga0207679_10122002 3300025945 Bacteria 2076
1125 Ga0207679_10243330 3300025945 Bacteria 1525
1126 Ga0207679_10314926 3300025945 Bacteria 1353
1127 Ga0207679_10521722 3300025945 Bacteria 1062
1128 Ga0207679_10587555 3300025945 Bacteria 1002
1129 Ga0207679_10682112 3300025945 Bacteria 931
1130 Ga0207679_10982190 3300025945 Bacteria 774
1131 Ga0207667_10011264 3300025949 Bacteria 10404
1132 Ga0207667_10073513 3300025949 Bacteria 3552
1133 Ga0207667_10542772 3300025949 Bacteria 1176
1134 Ga0207651_10003639 3300025960 Bacteria 7600
1135 Ga0207651_10051736 3300025960 Bacteria 2797
1136 Ga0207651_10142137 3300025960 Unclassified 1855
1137 Ga0207651_10227926 3300025960 Bacteria 1511
1138 Ga0207651_10272335 3300025960 Bacteria 1395
1139 Ga0207651_10283482 3300025960 Bacteria 1370
1140 Ga0207651_10610584 3300025960 Unclassified 954
1141 Ga0207651_10905057 3300025960 Bacteria 786
1142 Ga0207651_11059092 3300025960 Bacteria 726
1143 Ga0207712_10000062 3300025961 Bacteria 135638
1144 Ga0207712_10016553 3300025961 Bacteria 4778
1145 Ga0207712_10019000 3300025961 Bacteria 4483
1146 Ga0207712_10019879 3300025961 Bacteria 4391
1147 Ga0207712_10110082 3300025961 Bacteria 2064
1148 Ga0207712_10415915 3300025961 Bacteria 1133
1149 Ga0207712_10592224 3300025961 Bacteria 958
1150 Ga0207712_10686745 3300025961 Bacteria 892
1151 Ga0207712_10694436 3300025961 Bacteria 888
1152 Ga0207712_10780480 3300025961 Bacteria 839
1153 Ga0207712_11550712 3300025961 Unclassified 594
1154 Ga0207668_10017990 3300025972 Bacteria 4438
1155 Ga0207668_10028978 3300025972 Bacteria 3626
1156 Ga0207668_10042028 3300025972 Bacteria 3093
1157 Ga0207668_10082119 3300025972 Bacteria 2340
1158 Ga0207668_10108707 3300025972 Bacteria 2076
1159 Ga0207668_10135035 3300025972 Bacteria 1889
1160 Ga0207668_10780272 3300025972 Bacteria 845
1161 Ga0207668_11337251 3300025972 Bacteria 645
1162 Ga0207640_10052014 3300025981 Bacteria 2666
1163 Ga0207640_10993294 3300025981 Bacteria 738
1164 Ga0207658_10014885 3300025986 Bacteria 5330
1165 Ga0207658_10041621 3300025986 Bacteria 3328
1166 Ga0207658_10055866 3300025986 Bacteria 2928
1167 Ga0207658_10075584 3300025986 Bacteria 2563
1168 Ga0207658_10680772 3300025986 Bacteria 928
1169 Ga0207658_10817054 3300025986 Bacteria 847
1170 Ga0207677_10007448 3300026023 Bacteria 6057
1171 Ga0207677_10016511 3300026023 Bacteria 4376
1172 Ga0207677_10051409 3300026023 Bacteria 2794
1173 Ga0207677_10071930 3300026023 Bacteria 2443
1174 Ga0207677_10095043 3300026023 Bacteria 2177
1175 Ga0207677_10518082 3300026023 Unclassified 1034
1176 Ga0207677_10646056 3300026023 Bacteria 933
1177 Ga0207703_10000001 3300026035 Bacteria 822925
1178 Ga0207703_10000984 3300026035 Bacteria 27426
1179 Ga0207703_10022044 3300026035 Bacteria 4990
1180 Ga0207703_10029362 3300026035 Unclassified 4338
1181 Ga0207703_10043116 3300026035 Unclassified 3620
1182 Ga0207703_10153812 3300026035 Bacteria 2008
1183 Ga0207703_10209592 3300026035 Bacteria 1737
1184 Ga0207703_10211205 3300026035 Bacteria 1730
1185 Ga0207703_10298701 3300026035 Bacteria 1468
1186 Ga0207703_10858277 3300026035 Bacteria 868
1187 Ga0207703_11408925 3300026035 Bacteria 670
1188 Ga0207639_10025450 3300026041 Bacteria 4291
1189 Ga0207639_10269115 3300026041 Unclassified 1494
1190 Ga0207639_10304805 3300026041 Bacteria 1409
1191 Ga0207639_11125377 3300026041 Bacteria 736
1192 Ga0207639_11232040 3300026041 Bacteria 702
1193 Ga0207678_10085536 3300026067 Bacteria 2696
1194 Ga0207678_10278868 3300026067 Bacteria 1434
1195 Ga0207708_10000140 3300026075 Bacteria 57251
1196 Ga0207708_10002796 3300026075 Bacteria 12830
1197 Ga0207708_10007857 3300026075 Bacteria 7901
1198 Ga0207708_10013923 3300026075 Bacteria 6011
1199 Ga0207708_10052044 3300026075 Bacteria 3119
1200 Ga0207708_10060870 3300026075 Bacteria 2882
1201 Ga0207708_10214154 3300026075 Bacteria 1541
1202 Ga0207708_10226310 3300026075 Bacteria 1500
1203 Ga0207708_10250131 3300026075 Unclassified 1428
1204 Ga0207708_10562333 3300026075 Bacteria 963
1205 Ga0207708_10748849 3300026075 Bacteria 838
1206 Ga0207708_11342185 3300026075 Bacteria 627
1207 Ga0207702_10029353 3300026078 Bacteria 4576
1208 Ga0207702_10355129 3300026078 Unclassified 1403
1209 Ga0207702_10791688 3300026078 Bacteria 937
1210 Ga0207641_10004827 3300026088 Bacteria 11613
1211 Ga0207641_10009934 3300026088 Bacteria 7833
1212 Ga0207641_10012900 3300026088 Bacteria 6855
1213 Ga0207641_10013946 3300026088 Bacteria 6589
1214 Ga0207641_10034599 3300026088 Bacteria 4204
1215 Ga0207641_10207315 3300026088 Bacteria 1811
1216 Ga0207641_10246039 3300026088 Bacteria 1668
1217 Ga0207641_10255113 3300026088 Bacteria 1639
1218 Ga0207641_10280722 3300026088 Bacteria 1566
1219 Ga0207641_10314545 3300026088 Bacteria 1483
1220 Ga0207641_10443707 3300026088 Bacteria 1253
1221 Ga0207641_10656690 3300026088 Bacteria 1030
1222 Ga0207641_11262398 3300026088 Bacteria 739
1223 Ga0207641_11283787 3300026088 Bacteria 732
1224 Ga0207648_10011645 3300026089 Bacteria 8278
1225 Ga0207648_10014356 3300026089 Bacteria 7322
1226 Ga0207648_10016442 3300026089 Bacteria 6758
1227 Ga0207648_10021375 3300026089 Bacteria 5816
1228 Ga0207648_10063892 3300026089 Bacteria 3208
1229 Ga0207648_10135374 3300026089 Unclassified 2170
1230 Ga0207648_10309172 3300026089 Bacteria 1419
1231 Ga0207648_10350608 3300026089 Bacteria 1330
1232 Ga0207648_10363368 3300026089 Bacteria 1306
1233 Ga0207648_10570433 3300026089 Bacteria 1041
1234 Ga0207648_10975296 3300026089 Bacteria 793
1235 Ga0207648_11089952 3300026089 Bacteria 749
1236 Ga0207648_11577553 3300026089 Bacteria 617
1237 Ga0207676_10003600 3300026095 Bacteria 10955
1238 Ga0207676_10021108 3300026095 Bacteria 4775
1239 Ga0207676_10073035 3300026095 Bacteria 2759
1240 Ga0207676_10093370 3300026095 Bacteria 2477
1241 Ga0207676_10105455 3300026095 Bacteria 2346
1242 Ga0207676_10132636 3300026095 Bacteria 2120
1243 Ga0207676_10171962 3300026095 Bacteria 1888
1244 Ga0207676_10178978 3300026095 Bacteria 1855
1245 Ga0207676_10279097 3300026095 Bacteria 1516
1246 Ga0207676_10312241 3300026095 Bacteria 1440
1247 Ga0207676_10352853 3300026095 Bacteria 1361
1248 Ga0207676_10733658 3300026095 Bacteria 959
1249 Ga0207676_11209690 3300026095 Bacteria 749
1250 Ga0207674_10003855 3300026116 Bacteria 18276
1251 Ga0207674_10004128 3300026116 Bacteria 17568
1252 Ga0207674_10117261 3300026116 Bacteria 2633
1253 Ga0207674_10169193 3300026116 Bacteria 2139
1254 Ga0207674_10176796 3300026116 Bacteria 2087
1255 Ga0207674_10214297 3300026116 Bacteria 1874
1256 Ga0207674_10219803 3300026116 Bacteria 1848
1257 Ga0207674_10256181 3300026116 Bacteria 1697
1258 Ga0207674_10409432 3300026116 Unclassified 1311
1259 Ga0207674_10672246 3300026116 Bacteria 1000
1260 Ga0207674_10676896 3300026116 Bacteria 996
1261 Ga0207675_100007670 3300026118 Bacteria 10186
1262 Ga0207675_100010219 3300026118 Bacteria 8795
1263 Ga0207675_100040134 3300026118 Bacteria 4369
1264 Ga0207675_100041384 3300026118 Bacteria 4303
1265 Ga0207675_100072553 3300026118 Bacteria 3220
1266 Ga0207675_100077302 3300026118 Bacteria 3118
1267 Ga0207675_100186483 3300026118 Bacteria 1988
1268 Ga0207675_100218837 3300026118 Bacteria 1834
1269 Ga0207675_100248374 3300026118 Bacteria 1721
1270 Ga0207675_100272838 3300026118 Bacteria 1642
1271 Ga0207675_100294960 3300026118 Bacteria 1578
1272 Ga0207675_100359216 3300026118 Bacteria 1429
1273 Ga0207675_100380249 3300026118 Bacteria 1388
1274 Ga0207675_100902531 3300026118 Bacteria 900
1275 Ga0207683_10000135 3300026121 Bacteria 61049
1276 Ga0207683_10015495 3300026121 Bacteria 6490
1277 Ga0207683_10021685 3300026121 Bacteria 5505
1278 Ga0207698_10069935 3300026142 Bacteria 2778
1279 Ga0207698_10116124 3300026142 Bacteria 2255
1280 Ga0207698_10222086 3300026142 Bacteria 1708
1281 Ga0207698_10332881 3300026142 Bacteria 1427
1282 Ga0209973_1057456 3300027252 Bacteria 594
1283 Ga0209371_1006007 3300027312 Bacteria 4637
1284 Ga0210000_1004019 3300027462 Bacteria 2127
1285 Ga0209995_1029061 3300027471 Bacteria 923
1286 Ga0209995_1053886 3300027471 Bacteria 683
1287 Ga0209968_1019111 3300027526 Bacteria 1102
1288 Ga0210002_1005955 3300027617 Bacteria 1832
1289 Ga0209983_1002021 3300027665 Bacteria 4486
1290 Ga0209983_1039751 3300027665 Bacteria 1016
1291 Ga0209971_1000911 3300027682 Bacteria 7605
1292 Ga0209966_1025830 3300027695 Bacteria 1167
1293 Ga0209998_10003602 3300027717 Bacteria 3368
1294 Ga0209974_10001075 3300027876 Bacteria 9686
1295 Ga0209974_10001283 3300027876 Bacteria 9036
1296 Ga0209974_10045942 3300027876 Bacteria 1459
1297 Ga0207428_10001041 3300027907 Bacteria 30598
1298 Ga0207428_10003044 3300027907 Bacteria 16504
1299 Ga0207428_10029734 3300027907 Bacteria 4523
1300 Ga0207428_10109001 3300027907 Bacteria 2132
1301 Ga0207428_10373463 3300027907 Bacteria 1047
1302 Ga0268266_10063738 3300028379 Bacteria 3182
1303 Ga0268266_10157774 3300028379 Bacteria 2051
1304 Ga0268266_10726304 3300028379 Bacteria 958
1305 Ga0268266_10779833 3300028379 Bacteria 923
1306 Ga0268266_11063030 3300028379 Bacteria 783
1307 Ga0268266_11583857 3300028379 Bacteria 631
1308 Ga0268265_10021907 3300028380 Bacteria 4484
1309 Ga0268265_10023898 3300028380 Bacteria 4316
1310 Ga0268265_10123230 3300028380 Bacteria 2140
1311 Ga0268265_10125228 3300028380 Bacteria 2125
1312 Ga0268265_10130050 3300028380 Bacteria 2090
1313 Ga0268265_10229980 3300028380 Bacteria 1629
1314 Ga0268265_10458871 3300028380 Bacteria 1192
1315 Ga0268265_10497006 3300028380 Bacteria 1149
1316 Ga0268265_10620971 3300028380 Bacteria 1035
1317 Ga0268265_10673478 3300028380 Bacteria 997
1318 Ga0268265_10939140 3300028380 Bacteria 851
1319 Ga0268265_11006480 3300028380 Bacteria 823
1320 Ga0268265_11076079 3300028380 Bacteria 797
1321 Ga0268265_11440904 3300028380 Bacteria 691
1322 Ga0268264_10008535 3300028381 Bacteria 8515
1323 Ga0268264_10009716 3300028381 Bacteria 7964
1324 Ga0268264_10058444 3300028381 Bacteria 3230
1325 Ga0268264_10081216 3300028381 Bacteria 2770
1326 Ga0268264_10151469 3300028381 Bacteria 2079
1327 Ga0268264_10228572 3300028381 Bacteria 1717
1328 Ga0268264_10301308 3300028381 Bacteria 1509
1329 Ga0268264_10372365 3300028381 Bacteria 1365
1330 Ga0268264_10418952 3300028381 Bacteria 1291
1331 Ga0268264_10905640 3300028381 Bacteria 885
1332 Ga0268264_11240574 3300028381 Bacteria 755
1333 Ga0268264_11381592 3300028381 Bacteria 715
1334 Ga0265337_1005075 3300028556 Bacteria 5313
1335 Ga0265334_10001357 3300028573 Bacteria 11808
1336 Ga0265323_10001423 3300028653 Bacteria 11767
1337 Ga0265338_10016346 3300028800 Bacteria 8082
1338 Ga0265338_10048936 3300028800 Bacteria 3838
1339 Ga0265338_10520583 3300028800 Bacteria 835
1340 Ga0268256_1005994 3300030500 Bacteria 4635
1341 Ga0316176_1130389 3300030732 Bacteria 832
1342 Ga0314311_1028727 3300030733 Bacteria 986
1343 Ga0265328_10000854 3300031239 Bacteria 14135
1344 Ga0265320_10056735 3300031240 Bacteria 1881
1345 Ga0265329_10045459 3300031242 Bacteria 1403
1346 Ga0265340_10000124 3300031247 Bacteria 38152
1347 Ga0265340_10017215 3300031247 Bacteria 3738
1348 Ga0265339_10009415 3300031249 Bacteria 6143
1349 Ga0265331_10000030 3300031250 Bacteria 215032
1350 Ga0265331_10007061 3300031250 Bacteria 6550
1351 Ga0265327_10000072 3300031251 Bacteria 215055
1352 Ga0265316_10115816 3300031344 Bacteria 2026
1353 Ga0307408_100004227 3300031548 Bacteria 9780
1354 Ga0307408_100018526 3300031548 Bacteria 4675
1355 Ga0307408_100032977 3300031548 Bacteria 3615
1356 Ga0307408_100056598 3300031548 Bacteria 2844
1357 Ga0307408_100279032 3300031548 Bacteria 1391
1358 Ga0307408_100689702 3300031548 Bacteria 917
1359 Ga0265313_10118152 3300031595 Bacteria 1159
1360 Ga0265314_10000257 3300031711 Bacteria 77793
1361 Ga0265342_10000305 3300031712 Bacteria 55974
1362 Ga0265342_10013694 3300031712 Bacteria 5422
1363 Ga0307405_10019355 3300031731 Bacteria 3779
1364 Ga0307405_10030805 3300031731 Bacteria 3149
1365 Ga0307405_10113596 3300031731 Bacteria 1839
1366 Ga0307405_10125759 3300031731 Bacteria 1762
1367 Ga0307405_10246354 3300031731 Bacteria 1327
1368 Ga0307405_10608239 3300031731 Bacteria 893
1369 Ga0307405_10838416 3300031731 Bacteria 773
1370 Ga0307413_10002016 3300031824 Bacteria 8075
1371 Ga0307413_10022482 3300031824 Bacteria 3399
1372 Ga0307413_10158269 3300031824 Unclassified 1588
1373 Ga0307413_10591035 3300031824 Bacteria 907
1374 Ga0307410_10000799 3300031852 Bacteria 13313
1375 Ga0307410_10001989 3300031852 Bacteria 9626
1376 Ga0307410_10003886 3300031852 Bacteria 7600
1377 Ga0307410_10449896 3300031852 Bacteria 1050
1378 Ga0307406_10003011 3300031901 Bacteria 9171
1379 Ga0307406_10140290 3300031901 Bacteria 1710
1380 Ga0307406_10212555 3300031901 Unclassified 1432
1381 Ga0307406_10238003 3300031901 Bacteria 1364
1382 Ga0307407_10000206 3300031903 Bacteria 17885
1383 Ga0307407_10165651 3300031903 Bacteria 1451
1384 Ga0307407_10172521 3300031903 Bacteria 1426
1385 Ga0307407_10448961 3300031903 Bacteria 935
1386 Ga0307407_10522356 3300031903 Bacteria 873
1387 Ga0307412_10000200 3300031911 Bacteria 40978
1388 Ga0307412_10004249 3300031911 Bacteria 7986
1389 Ga0307412_10023786 3300031911 Bacteria 3775
1390 Ga0307412_10046598 3300031911 Bacteria 2841
1391 Ga0307412_10141357 3300031911 Bacteria 1763
1392 Ga0307412_10203296 3300031911 Bacteria 1506
1393 Ga0307409_100004602 3300031995 Bacteria 7782
1394 Ga0307409_100237658 3300031995 Bacteria 1656
1395 Ga0307409_100494874 3300031995 Bacteria 1189
1396 Ga0307409_101005683 3300031995 Bacteria 852
1397 Ga0307416_100002359 3300032002 Bacteria 10799
1398 Ga0307416_100038595 3300032002 Bacteria 3686
1399 Ga0307416_100064850 3300032002 Unclassified 2998
1400 Ga0307416_100169924 3300032002 Bacteria 2028
1401 Ga0307416_100225052 3300032002 Bacteria 1803
1402 Ga0307416_100273485 3300032002 Unclassified 1660
1403 Ga0307416_101058246 3300032002 Bacteria 915
1404 Ga0307414_10001197 3300032004 Bacteria 13345
1405 Ga0307414_10006403 3300032004 Bacteria 6564
1406 Ga0307414_10403984 3300032004 Bacteria 1187
1407 Ga0307411_10050420 3300032005 Bacteria 2710
1408 Ga0307411_10050650 3300032005 Bacteria 2705
1409 Ga0307411_10059787 3300032005 Bacteria 2528
1410 Ga0307411_10145246 3300032005 Bacteria 1755
1411 Ga0307411_10279191 3300032005 Bacteria 1328
1412 Ga0307411_10280203 3300032005 Bacteria 1326
1413 Ga0307411_10460458 3300032005 Bacteria 1066
1414 Ga0307415_100001481 3300032126 Bacteria 11254
1415 Ga0307415_100018231 3300032126 Bacteria 4233
1416 Ga0307415_100043193 3300032126 Bacteria 3005
1417 Ga0307415_100058947 3300032126 Bacteria 2645
1418 Ga0307415_100088632 3300032126 Bacteria 2233
1419 Ga0307415_100115495 3300032126 Bacteria 2001
1420 Ga0307415_100196086 3300032126 Unclassified 1598
1421 Ga0307415_100527952 3300032126 Bacteria 1037
1422 Ga0307510_10198234 3300033180 Bacteria 1546
1423 Ga0373950_0000067 3300034818 Bacteria 56062
1424 Ga0373926_0097364 3300035083 Bacteria 1098
1425 Ga0373940_0059544 3300035088 Bacteria 1089
1426 Ga0373949_0098902 3300035090 Bacteria 797
1427 Ga0373951_0001292 3300035091 Bacteria 6617
1428 Ga0373939_0117765 3300035114 Bacteria 933
1429 Ga0373941_0030733 3300035115 Bacteria 1594
1430 Ga0373956_0160274 3300035119 Bacteria 1060
1431 Ga0373956_0196352 3300035119 Bacteria 956
1432 Ga0373955_0216492 3300035172 Bacteria 1143
1433 Ga0373942_0021212 3300035207 Bacteria 1637
1434 Ga0373961_0113941 3300035241 Unclassified 889
1435 Ga0316574_0357761 3300035398 Bacteria 923
1436 Ga0373931_0025971 3300035691 Bacteria 2976
1437 Ga0373931_0236293 3300035691 Bacteria 1106
1438 Ga0373935_0035009 3300035692 Bacteria 3133
1439 Ga0373933_0223920 3300035724 Bacteria 1207
1440 Ga0373933_0480668 3300035724 Bacteria 813
1441 Ga0373947_0239093 3300035725 Unclassified 1198
1442 Ga0373937_0030552 3300036401 Bacteria 4879
1443 Ga0373937_0061917 3300036401 Bacteria 3440
1444 Ga0373937_0088188 3300036401 Bacteria 2872
1445 Ga0373937_0092052 3300036401 Bacteria 2810
1446 Ga0373925_0610009 3300037068 Bacteria 899
1447 Ga0395899_0348609 3300037312 Bacteria 991
1448 Ga0395900_0172055 3300037418 Bacteria 2204
1449 Ga0395898_0159365 3300037466 Bacteria 2158
1450 Ga0395898_0161546 3300037466 Bacteria 2143
1451 Ga0395898_0221400 3300037466 Bacteria 1805
1452 Ga0395898_0441795 3300037466 Bacteria 1239
1453 Ga0395898_1123380 3300037466 Bacteria 719
1454 Ga0395905_0263957 3300037471 Bacteria 1607
1455 Ga0395905_0667009 3300037471 Bacteria 942
1456 Ga0395901_0003929 3300038443 Bacteria 14950
1457 Ga0395901_0238369 3300038443 Bacteria 1897
1458 Ga0242419_000693 3300038698 Bacteria 1893
1459 Ga0242422_06711 3300038699 Bacteria 687
1460 Ga0242420_002252 3300038996 Bacteria 2733
1461 Ga0242420_013632 3300038996 Bacteria 1387
1462 Ga0242420_047502 3300038996 Bacteria 832
1463 Ga0436361_0161734 3300039447 Bacteria 928
1464 Ga0436361_0836520 3300039447 Bacteria 1154
1465 Ga0439439_0127717 3300041406 Bacteria 712
1466 Ga0439447_002680 3300041407 Bacteria 6449
1467 Ga0439453_0037637 3300041408 Bacteria 939
1468 Ga0451793_1159384 3300041452 Bacteria 1219
1469 Ga0451807_0271807 3300041486 Bacteria 3655
1470 Ga0451807_1970214 3300041486 Bacteria 984
1471 Ga0451841_0398296 3300041498 Bacteria 2340
1472 Ga0451843_1130055 3300041509 Bacteria 1936
1473 Ga0439433_0046428 3300041999 Bacteria 1018
1474 Ga0439456_000204 3300042013 Bacteria 16716
1475 Ga0439462_0121958 3300042015 Bacteria 725
1476 Ga0450902_000215 3300042137 Bacteria 6791
1477 Ga0450905_000647 3300042142 Bacteria 4289
1478 Ga0439435_0038734 3300042436 Bacteria 1326
1479 Ga0439464_0103462 3300042439 Bacteria 867
1480 Ga0450901_000065 3300042533 Bacteria 10722
1481 Ga0466957_0046215 3300044842 Bacteria 2643
1482 Ga0451576_0049155 3300045051 Bacteria 4426
1483 Ga0451576_0055959 3300045051 Bacteria 4126
1484 Ga0451576_0662930 3300045051 Bacteria 1096
1485 Ga0451576_0672149 3300045051 Bacteria 1088
1486 Ga0451576_0737216 3300045051 Bacteria 1035
1487 Ga0451576_0904556 3300045051 Bacteria 926
1488 Ga0466958_0176982 3300045836 Bacteria 1353
1489 Ga0466967_0329605 3300045976 Bacteria 1474
1490 Ga0495617_001715 3300046452 Bacteria 9397
1491 Ga0495592_0190801 3300046454 Bacteria 1389
1492 Ga0495590_0086367 3300046457 Bacteria 1108
1493 Ga0495591_004750 3300046458 Bacteria 6508
1494 Ga0495591_010767 3300046458 Bacteria 3516
1495 Ga0495629_0256851 3300046459 Bacteria 1201
1496 Ga0495638_0008515 3300046460 Bacteria 7265
1497 Ga0495650_0000901 3300046471 Bacteria 35007
1498 Ga0495580_0088546 3300046472 Bacteria 2156
1499 Ga0495582_0037392 3300046473 Unclassified 2670
1500 Ga0495605_0003419 3300046474 Bacteria 9452
1501 Ga0495584_0025980 3300046491 Bacteria 2967
1502 Ga0495594_0083139 3300046499 Bacteria 1789
1503 Ga0495594_0263359 3300046499 Bacteria 982
1504 Ga0495594_0405832 3300046499 Bacteria 775
1505 Ga0495596_0113234 3300046500 Bacteria 1053
1506 Ga0495607_0005711 3300046501 Bacteria 8862
1507 Ga0495607_0047857 3300046501 Bacteria 2502
1508 Ga0495607_0245786 3300046501 Bacteria 863
1509 Ga0495583_0001084 3300046506 Bacteria 30185
1510 Ga0495583_0003921 3300046506 Bacteria 11007
1511 Ga0495606_0029497 3300046507 Bacteria 3850
1512 Ga0495610_0003267 3300046512 Bacteria 12788
1513 Ga0495610_0062574 3300046512 Bacteria 1764
1514 Ga0495610_0074588 3300046512 Bacteria 1573
1515 Ga0495616_0024866 3300046513 Bacteria 3206
1516 Ga0495616_0083975 3300046513 Bacteria 1518
1517 Ga0495628_0109190 3300046516 Bacteria 2129
1518 Ga0495631_0004277 3300046518 Bacteria 7625
1519 Ga0495631_0004302 3300046518 Bacteria 7596
1520 Ga0495631_0050778 3300046518 Bacteria 1813
1521 Ga0495632_0021332 3300046519 Bacteria 3491
1522 Ga0495637_0000033 3300046520 Bacteria 128386
1523 Ga0495637_0000471 3300046520 Bacteria 29445
1524 Ga0495643_0005284 3300046522 Bacteria 8771
1525 Ga0495643_0068478 3300046522 Bacteria 1867
1526 Ga0495644_0017017 3300046523 Bacteria 2782
1527 Ga0495648_0003423 3300046524 Bacteria 13941
1528 Ga0495663_0003376 3300046525 Bacteria 4614
1529 Ga0495642_0085544 3300046528 Bacteria 1331
1530 Ga0495654_0034626 3300046530 Bacteria 2546
1531 Ga0495640_0583417 3300046533 Bacteria 676
1532 Ga0495586_0611829 3300046535 Bacteria 629
1533 Ga0495598_0175165 3300046537 Bacteria 762
1534 Ga0495609_0000275 3300046538 Bacteria 47724
1535 Ga0495609_0193957 3300046538 Bacteria 851
1536 Ga0495621_0026687 3300046539 Bacteria 1952
1537 Ga0495621_0030605 3300046539 Bacteria 1841
1538 Ga0495597_0125641 3300046542 Bacteria 1066
1539 Ga0495622_0041234 3300046557 Bacteria 2147
1540 Ga0495656_0083028 3300046615 Bacteria 1450
1541 Ga0495668_0043646 3300046616 Bacteria 2492
1542 Ga0495668_0212002 3300046616 Bacteria 1060
1543 Ga0495611_0004637 3300046648 Bacteria 5908
1544 Ga0495611_0028229 3300046648 Bacteria 2456
1545 Ga0495625_0000082 3300046660 Bacteria 153730
1546 Ga0495625_0551197 3300046660 Bacteria 698
1547 Ga0495661_0000268 3300046665 Bacteria 59809
1548 Ga0495661_0138028 3300046665 Bacteria 1329
1549 Ga0495599_0247522 3300046678 Bacteria 1086
1550 Ga0495658_0050397 3300046683 Bacteria 2355
1551 Ga0495670_0085173 3300046691 Bacteria 1613
1552 Ga0495671_0019471 3300046692 Bacteria 3587
1553 Ga0495671_0021674 3300046692 Bacteria 3371
1554 Ga0495649_0121445 3300046694 Bacteria 1381
1555 Ga0495660_0052247 3300046810 Bacteria 2221
1556 Ga0495660_0203709 3300046810 Bacteria 943
1557 Ga0495604_0138528 3300047317 Bacteria 1741
1558 Ga0495604_0513619 3300047317 Unclassified 776
1559 Ga0495672_0101702 3300047320 Bacteria 1557
1560 Ga0495676_0000057 3300047321 Bacteria 86160
1561 Ga0495680_0120568 3300047322 Bacteria 1937
1562 Ga0495683_0016259 3300047323 Bacteria 3865
1563 Ga0495679_000047 3300047446 Bacteria 128559
1564 Ga0495673_0008702 3300047469 Bacteria 5672
1565 Ga0495673_0012823 3300047469 Bacteria 4424
1566 Ga0495673_0013841 3300047469 Bacteria 4215
1567 Ga0495673_0018774 3300047469 Bacteria 3479
1568 Ga0495673_0081062 3300047469 Bacteria 1344
1569 Ga0495681_0010082 3300047470 Bacteria 5749
1570 Ga0495684_0025690 3300047471 Bacteria 4526
1571 Ga0495686_0093022 3300047472 Bacteria 1828
1572 Ga0495626_0000063 3300048091 Bacteria 142456
1573 Ga0496101_0202849 3300048904 Bacteria 1534
1574 Ga0496102_0039477 3300048905 Bacteria 4266
1575 Ga0496102_0050765 3300048905 Bacteria 3778
1576 Ga0496102_0663809 3300048905 Bacteria 966
1577 Ga0496102_0726601 3300048905 Bacteria 916
1578 Ga0496102_0987272 3300048905 Bacteria 763
1579 Ga0496103_0084302 3300048906 Bacteria 2002
1580 Ga0496103_0188312 3300048906 Bacteria 1327
1581 Ga0496103_0288703 3300048906 Unclassified 1055
1582 Ga0496103_0490099 3300048906 Bacteria 787
1583 Ga0496104_0085809 3300048907 Bacteria 3005
1584 Ga0496104_0138261 3300048907 Bacteria 2341
1585 Ga0496104_0282703 3300048907 Bacteria 1572
1586 Ga0496104_0887866 3300048907 Bacteria 797
1587 Ga0496105_0123271 3300048908 Bacteria 2136
1588 Ga0496105_0488511 3300048908 Bacteria 968
1589 Ga0496106_0103660 3300048909 Bacteria 2208
1590 Ga0496106_0244229 3300048909 Unclassified 1435
1591 Ga0496107_0029503 3300048910 Bacteria 3903
1592 Ga0496107_0184656 3300048910 Bacteria 1549
1593 Ga0496108_0232292 3300048911 Bacteria 1604
1594 Ga0496108_1048287 3300048911 Bacteria 695
1595 Ga0496109_0016646 3300048912 Bacteria 6431
1596 Ga0496109_0176089 3300048912 Bacteria 2008
1597 Ga0496109_0486984 3300048912 Bacteria 1164
1598 Ga0496109_0877594 3300048912 Bacteria 835
1599 Ga0496110_0231470 3300048913 Bacteria 1681
1600 Ga0496110_0332117 3300048913 Bacteria 1385
1601 Ga0496110_0976826 3300048913 Bacteria 754
1602 Ga0496111_0469776 3300048914 Bacteria 927
1603 Ga0496112_0173924 3300048915 Bacteria 2118
1604 Ga0496112_0440478 3300048915 Bacteria 1241
1605 Ga0496112_0793224 3300048915 Bacteria 872
1606 Ga0496112_0871200 3300048915 Bacteria 823
1607 Ga0496112_1005167 3300048915 Bacteria 754
1608 Ga0496112_1082789 3300048915 Bacteria 720
1609 Ga0496113_0038487 3300048916 Bacteria 3517
1610 Ga0496113_0124661 3300048916 Bacteria 2017
1611 Ga0496113_0213745 3300048916 Bacteria 1536
1612 Ga0496113_0394737 3300048916 Bacteria 1111
1613 Ga0496113_0802832 3300048916 Bacteria 748
1614 Ga0496114_0109384 3300048917 Bacteria 2367
1615 Ga0496114_0109587 3300048917 Bacteria 2365
1616 Ga0496114_0348858 3300048917 Bacteria 1309
1617 Ga0496115_0068613 3300048918 Bacteria 2871
1618 Ga0496116_0020428 3300048919 Bacteria 5029
1619 Ga0496116_0055085 3300048919 Bacteria 2614
1620 Ga0496116_0058859 3300048919 Bacteria 2502
1621 Ga0496116_0112871 3300048919 Bacteria 1591
1622 Ga0496117_0013761 3300048920 Bacteria 7026
1623 Ga0496118_0006054 3300048921 Bacteria 13473
1624 Ga0496118_0036137 3300048921 Bacteria 4000
1625 Ga0496118_0198232 3300048921 Bacteria 1192
1626 Ga0496118_0207996 3300048921 Bacteria 1151
1627 Ga0496119_0001070 3300048922 Bacteria 34682
1628 Ga0496120_0000716 3300048923 Bacteria 48669
1629 Ga0496121_0019793 3300048924 Bacteria 6707
1630 Ga0496121_0113622 3300048924 Bacteria 2060
1631 Ga0496121_0496248 3300048924 Bacteria 776
1632 Ga0496122_0000498 3300048925 Bacteria 81668
1633 Ga0496122_0003158 3300048925 Bacteria 22033
1634 Ga0496122_0021341 3300048925 Bacteria 5801
1635 Ga0496123_0000390 3300048926 Bacteria 82150
1636 Ga0496123_0010900 3300048926 Bacteria 7957
1637 Ga0496123_0028737 3300048926 Bacteria 4110
1638 Ga0496124_0011269 3300048927 Bacteria 8952
1639 Ga0496124_0018455 3300048927 Bacteria 6532
1640 Ga0496124_0284803 3300048927 Bacteria 1202
1641 Ga0496124_0334408 3300048927 Bacteria 1078
1642 Ga0496125_0003520 3300048928 Bacteria 18898
1643 Ga0496125_0019301 3300048928 Bacteria 6436
1644 Ga0496125_0032385 3300048928 Bacteria 4644
1645 Ga0496125_0168538 3300048928 Bacteria 1476
1646 Ga0496126_0033945 3300048929 Bacteria 4798
1647 Ga0496126_0039425 3300048929 Bacteria 4383
1648 Ga0496126_0061625 3300048929 Bacteria 3369
1649 Ga0495678_000168 3300049459 Bacteria 76210
1650 Ga0495678_005330 3300049459 Bacteria 7130
1651 Ga0495678_010978 3300049459 Bacteria 4361
1652 Ga0495678_092402 3300049459 Bacteria 1063
1653 Ga0501290_047347 3300049513 Bacteria 661
1654 Ga0501291_004115 3300049514 Bacteria 1842
1655 Ga0501291_016208 3300049514 Bacteria 1135
1656 Ga0501292_003109 3300049515 Bacteria 2195
1657 Ga0501292_004100 3300049515 Bacteria 1976
1658 Ga0501293_000866 3300049516 Unclassified 2276
1659 Ga0501295_026587 3300049518 Bacteria 1109
1660 Ga0501296_002821 3300049519 Bacteria 1839
1661 Ga0501296_006247 3300049519 Bacteria 1347
1662 Ga0501297_003203 3300049520 Bacteria 1618
1663 Ga0501297_003302 3300049520 Unclassified 1599
1664 Ga0501298_000903 3300049521 Bacteria 4210
1665 Ga0501298_016772 3300049521 Bacteria 1331
1666 Ga0501298_117794 3300049521 Bacteria 622
1667 Ga0501299_001032 3300049522 Bacteria 3461
1668 Ga0501299_036713 3300049522 Bacteria 968
1669 Ga0501303_001306 3300049526 Unclassified 1858
1670 Ga0501317_064519 3300049533 Bacteria 607
1671 Ga0501335_032941 3300049551 Bacteria 591
1672 Ga0501032_0153683 3300049569 Bacteria 1512
1673 Ga0501034_0001637 3300049571 Bacteria 28960
1674 Ga0501034_0203610 3300049571 Bacteria 1936
1675 Ga0501036_0474141 3300049572 Bacteria 1042
1676 Ga0501039_0073576 3300049575 Bacteria 2655
1677 Ga0501040_0068626 3300049576 Bacteria 2445
1678 Ga0501040_0534254 3300049576 Bacteria 846
1679 Ga0501040_0681836 3300049576 Bacteria 743
1680 Ga0501041_0025160 3300049577 Bacteria 3578
1681 Ga0501041_0157371 3300049577 Bacteria 1420
1682 Ga0501042_0730144 3300049578 Bacteria 720
1683 Ga0501043_0001404 3300049579 Bacteria 21041
1684 Ga0501046_0037906 3300049580 Bacteria 3872
1685 Ga0501047_0039864 3300049581 Bacteria 4543
1686 Ga0501048_0008293 3300049582 Bacteria 7860
1687 Ga0501070_0001105 3300049586 Bacteria 24213
1688 Ga0501071_0041941 3300049587 Bacteria 3277
1689 Ga0501072_0000374 3300049588 Bacteria 31938
1690 Ga0501072_0008532 3300049588 Bacteria 7771
1691 Ga0501072_0888955 3300049588 Bacteria 696
1692 Ga0501073_0001666 3300049589 Bacteria 16467
1693 Ga0501073_0393996 3300049589 Bacteria 957
1694 Ga0501074_0019385 3300049590 Bacteria 4941
1695 Ga0501075_0069093 3300049591 Bacteria 2669
1696 Ga0501075_0118270 3300049591 Bacteria 2015
1697 Ga0501076_0001139 3300049592 Bacteria 17608
1698 Ga0501076_0301662 3300049592 Bacteria 1313
1699 Ga0501077_0031627 3300049593 Bacteria 3368
1700 Ga0501198_005139 3300049649 Bacteria 1834
1701 Ga0501198_016538 3300049649 Bacteria 1141
1702 Ga0501199_012462 3300049650 Bacteria 929
1703 Ga0501201_002710 3300049651 Bacteria 1620
1704 Ga0501202_000495 3300049652 Bacteria 5661
1705 Ga0501202_004022 3300049652 Bacteria 2554
1706 Ga0501202_009648 3300049652 Bacteria 1779
1707 Ga0501202_140957 3300049652 Bacteria 623
1708 Ga0501202_154852 3300049652 Bacteria 602
1709 Ga0501206_002594 3300049653 Unclassified 2277
1710 Ga0501206_007186 3300049653 Bacteria 1458
1711 Ga0501207_000159 3300049654 Bacteria 6272
1712 Ga0501208_004728 3300049655 Bacteria 1626
1713 Ga0501209_018149 3300049656 Bacteria 1620
1714 Ga0501209_078939 3300049656 Bacteria 946
1715 Ga0501214_013098 3300049659 Bacteria 956
1716 Ga0501216_006308 3300049660 Bacteria 1815
1717 Ga0501216_007014 3300049660 Unclassified 1743
1718 Ga0501216_012881 3300049660 Bacteria 1379
1719 Ga0501216_015025 3300049660 Bacteria 1300
1720 Ga0501217_000993 3300049661 Bacteria 5119
1721 Ga0501217_004261 3300049661 Bacteria 2932
1722 Ga0501217_004888 3300049661 Bacteria 2776
1723 Ga0501217_012178 3300049661 Bacteria 1914
1724 Ga0501223_001016 3300049663 Bacteria 6631
1725 Ga0501223_026919 3300049663 Bacteria 1119
1726 Ga0501223_034208 3300049663 Bacteria 988
1727 Ga0501224_000580 3300049664 Bacteria 4503
1728 Ga0501224_003979 3300049664 Bacteria 2081
1729 Ga0501224_028763 3300049664 Bacteria 832
1730 Ga0501227_002026 3300049665 Bacteria 4496
1731 Ga0501227_018874 3300049665 Bacteria 1568
1732 Ga0501230_003396 3300049667 Bacteria 2114
1733 Ga0501230_014788 3300049667 Bacteria 1286
1734 Ga0501230_022557 3300049667 Bacteria 1113
1735 Ga0501230_054091 3300049667 Bacteria 802
1736 Ga0501233_003063 3300049668 Bacteria 2987
1737 Ga0501233_003286 3300049668 Bacteria 2904
1738 Ga0501233_019041 3300049668 Bacteria 1450
1739 Ga0501233_035393 3300049668 Bacteria 1151
1740 Ga0501235_011130 3300049669 Bacteria 1970
1741 Ga0501235_040064 3300049669 Bacteria 1070
1742 Ga0501235_044273 3300049669 Bacteria 1022
1743 Ga0501236_013070 3300049670 Bacteria 1130
1744 Ga0501236_023450 3300049670 Bacteria 929
1745 Ga0501236_024666 3300049670 Bacteria 914
1746 Ga0501238_029156 3300049671 Bacteria 795
1747 Ga0501239_024015 3300049672 Bacteria 766
1748 Ga0501239_048721 3300049672 Bacteria 607
1749 Ga0501243_002081 3300049675 Bacteria 2912
1750 Ga0501243_006636 3300049675 Bacteria 1757
1751 Ga0501243_090328 3300049675 Bacteria 607
1752 Ga0501247_011094 3300049677 Bacteria 1082
1753 Ga0501249_005865 3300049679 Bacteria 2513
1754 Ga0501249_012720 3300049679 Unclassified 1781
1755 Ga0501249_029526 3300049679 Bacteria 1219
1756 Ga0501256_003405 3300049685 Bacteria 1321
1757 Ga0501256_028920 3300049685 Bacteria 616
1758 Ga0501257_006949 3300049686 Bacteria 2521
1759 Ga0501259_079329 3300049688 Bacteria 718
1760 Ga0501259_124398 3300049688 Bacteria 616
1761 Ga0501260_007769 3300049689 Bacteria 1050
1762 Ga0501219_009680 3300049703 Bacteria 716
1763 Ga0501221_006347 3300049704 Bacteria 1997
1764 Ga0501221_034026 3300049704 Bacteria 1079
1765 Ga0501221_037179 3300049704 Bacteria 1047
1766 Ga0501221_157040 3300049704 Bacteria 607
1767 Ga0501225_0003735 3300049705 Bacteria 4583
1768 Ga0501225_0015602 3300049705 Bacteria 2114
1769 Ga0501225_0038461 3300049705 Bacteria 1318
1770 Ga0501225_0064310 3300049705 Bacteria 1035
1771 Ga0501229_009149 3300049706 Bacteria 1243
1772 Ga0501229_021164 3300049706 Bacteria 862
1773 Ga0501234_004733 3300049707 Bacteria 2134
1774 Ga0501234_015274 3300049707 Bacteria 1208
1775 Ga0501079_0000964 3300049741 Bacteria 19846
1776 Ga0501079_0098561 3300049741 Bacteria 2265
1777 Ga0501079_0194617 3300049741 Bacteria 1583
1778 Ga0501079_0466811 3300049741 Bacteria 992
1779 Ga0501080_0021611 3300049742 Bacteria 5957
1780 Ga0501080_0337359 3300049742 Bacteria 1362
1781 Ga0501081_0014012 3300049743 Bacteria 5280
1782 Ga0501081_0229605 3300049743 Bacteria 1351
1783 Ga0501241_031018 3300049758 Bacteria 1010
1784 Ga0501263_038682 3300049760 Bacteria 695
1785 Ga0501264_011341 3300049761 Bacteria 866
1786 Ga0501265_045254 3300049762 Bacteria 677
1787 Ga0501268_092984 3300049765 Bacteria 637
1788 Ga0501269_046627 3300049766 Bacteria 588
1789 Ga0501273_002267 3300049770 Unclassified 1943
1790 Ga0501274_037803 3300049771 Bacteria 569
1791 Ga0501279_006371 3300049775 Bacteria 1558
1792 Ga0501279_014792 3300049775 Bacteria 1077
1793 Ga0501283_000823 3300049779 Bacteria 4076
1794 Ga0501283_005213 3300049779 Bacteria 1779
1795 Ga0501283_007508 3300049779 Bacteria 1554
1796 Ga0501283_009547 3300049779 Unclassified 1416
1797 Ga0501035_0023035 3300049822 Bacteria 5716
1798 Ga0501044_0005101 3300049823 Bacteria 14651
1799 Ga0501045_0282056 3300049824 Bacteria 1237
1800 Ga0501212_012466 3300049851 Bacteria 1237
1801 Ga0501212_014682 3300049851 Bacteria 1161
1802 Ga0501226_002034 3300049853 Bacteria 2513
1803 nmdc:mga00v17_528875_c1 3300050491 Bacteria 763
1804 nmdc:mga00v17_59186_c1 3300050491 Bacteria 2349
1805 nmdc:mga00v17_70184_c1 3300050491 Bacteria 2169
1806 nmdc:mga00v17_95767_c1 3300050491 Bacteria 1869
1807 nmdc:mga00v17_97591_c1 3300050491 Bacteria 1852
1808 nmdc:mga05p37_129348_c1 3300050507 Bacteria 3099
1809 nmdc:mga05p37_210285_c1 3300050507 Bacteria 2352
1810 nmdc:mga05p37_215389_c1 3300050507 Bacteria 2320
1811 nmdc:mga05p37_291211_c1 3300050507 Bacteria 1943
1812 nmdc:mga05p37_292983_c1 3300050507 Bacteria 1936
1813 nmdc:mga05p37_40425_c1 3300050507 Bacteria 5727
1814 nmdc:mga05p37_44653_c1 3300050507 Bacteria 5452
1815 nmdc:mga05p37_478470_c1 3300050507 Bacteria 1435
1816 nmdc:mga05p37_522147_c1 3300050507 Bacteria 1358
1817 nmdc:mga05p37_68458_c2 3300050507 Bacteria 1572
1818 nmdc:mga05p37_90114_c1 3300050507 Bacteria 3780
1819 nmdc:mga05p37_9043_c1 3300050507 Bacteria 11777
1820 nmdc:mga05p37_9215_c2 3300050507 Bacteria 11074
1821 nmdc:mga09592_100656_c1 3300050508 Bacteria 2475
1822 nmdc:mga09592_114041_c1 3300050508 Bacteria 2319
1823 nmdc:mga09592_176407_c1 3300050508 Bacteria 1848
1824 nmdc:mga09592_487_c1 3300050508 Bacteria 29737
1825 nmdc:mga09592_687476_c1 3300050508 Unclassified 871
1826 nmdc:mga09592_843651_c1 3300050508 Bacteria 773
1827 nmdc:mga0qj67_10316_c1 3300050509 Bacteria 6976
1828 nmdc:mga0qj67_260138_c1 3300050509 Bacteria 1408
1829 nmdc:mga0qj67_370654_c1 3300050509 Bacteria 1156
1830 nmdc:mga06r32_237871_c1 3300050510 Bacteria 1809
1831 nmdc:mga06r32_319559_c1 3300050510 Bacteria 1538
1832 nmdc:mga06r32_67173_c1 3300050510 Bacteria 3461
1833 nmdc:mga06r32_704538_c1 3300050510 Bacteria 975
1834 nmdc:mga06r32_776833_c1 3300050510 Bacteria 920
1835 nmdc:mga06r32_929031_c1 3300050510 Bacteria 825
1836 nmdc:mga08y16_1100_c1 3300050511 Bacteria 26629
1837 nmdc:mga08y16_197181_c1 3300050511 Bacteria 2087
1838 nmdc:mga08y16_29980_c1 3300050511 Bacteria 5729
1839 nmdc:mga08y16_328000_c1 3300050511 Bacteria 1575
1840 nmdc:mga08y16_476308_c1 3300050511 Bacteria 1271
1841 nmdc:mga08y16_49145_c1 3300050511 Bacteria 4414
1842 nmdc:mga08y16_55014_c1 3300050511 Bacteria 4159
1843 nmdc:mga08y16_6735_c1 3300050511 Bacteria 12046
1844 nmdc:mga0n895_1014101_c1 3300050512 Bacteria 811
1845 nmdc:mga0n895_1224906_c1 3300050512 Bacteria 724
1846 nmdc:mga0n895_125202_c1 3300050512 Bacteria 2593
1847 nmdc:mga0n895_534865_c1 3300050512 Bacteria 1179
1848 nmdc:mga0n895_69738_c1 3300050512 Bacteria 3483
1849 nmdc:mga0n895_73201_c1 3300050512 Bacteria 3401
1850 nmdc:mga0n895_74962_c1 3300050512 Bacteria 3362
1851 nmdc:mga0rr50_102433_c1 3300050513 Bacteria 2252
1852 nmdc:mga0rr50_239722_c1 3300050513 Bacteria 1503
1853 nmdc:mga0rr50_40020_c1 3300050513 Bacteria 3405
1854 nmdc:mga08x19_23014_c2 3300050514 Bacteria 1586
1855 nmdc:mga0a205_100052_c1 3300050515 Bacteria 2798
1856 nmdc:mga0a205_1124588_c1 3300050515 Bacteria 633
1857 nmdc:mga0a205_117553_c1 3300050515 Bacteria 2557
1858 nmdc:mga0a205_156563_c1 3300050515 Bacteria 2177
1859 nmdc:mga0a205_22271_c1 3300050515 Bacteria 6000
1860 nmdc:mga0a205_24199_c1 3300050515 Bacteria 5769
1861 nmdc:mga0a205_426536_c1 3300050515 Bacteria 1188
1862 nmdc:mga0a205_587112_c1 3300050515 Unclassified 968
1863 nmdc:mga0a205_64748_c1 3300050515 Bacteria 3531
1864 nmdc:mga0a205_6702_c1 3300050515 Bacteria 10419
1865 Ga0495601_0086354 3300053077 Bacteria 2016
1866 Ga0495595_0008948 3300053084 Bacteria 4128
1867 Ga0495619_0002138 3300053085 Bacteria 13106
1868 Ga0495619_0155140 3300053085 Bacteria 1580
1869 Ga0500641_0001203 3300053096 Bacteria 9231
1870 Ga0500565_001697 3300053734 Bacteria 1532
1871 Ga0501084_0000684 3300054114 Bacteria 25888
1872 Ga0501084_0008917 3300054114 Bacteria 8298
1873 Ga0501084_0204294 3300054114 Bacteria 1667
1874 Ga0501084_0874960 3300054114 Bacteria 756
1875 Ga0501084_1012670 3300054114 Bacteria 698
1876 Ga0587073_0008701 3300059492 Bacteria 1651
1877 Ga0587073_0056194 3300059492 Bacteria 908
1878 Ga0587077_094669 3300059493 Unclassified 708
1879 Ga0587083_0130129 3300059505 Bacteria 660
1880 Ga0587088_086960 3300059508 Bacteria 678
1881 Ga0587128_012103 3300059630 Bacteria 1193
1882 Ga0587114_002881 3300059655 Bacteria 1654
1883 Ga0501082_0003596 3300060353 Bacteria 13544
1884 Ga0501082_0026741 3300060353 Bacteria 4972
1885 Ga0530510_0006180 3300061734 Bacteria 8322
1886 Ga0530510_0112879 3300061734 Bacteria 1991
1887 Ga0530510_0399562 3300061734 Bacteria 1036
1888 Ga0530510_0460838 3300061734 Bacteria 962

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034818 Ga0373950_0000067 Ga0373950_0000067_16423_17019 163
2 3300049571 Ga0501034_0001637 Ga0501034_0001637_15796_16392 163
3 3300049579 Ga0501043_0001404 Ga0501043_0001404_10455_11051 163
4 3300049582 Ga0501048_0008293 Ga0501048_0008293_4253_4849 163
5 3300049586 Ga0501070_0001105 Ga0501070_0001105_11415_12011 163
6 3300049588 Ga0501072_0000374 Ga0501072_0000374_7412_8008 163
7 3300049589 Ga0501073_0001666 Ga0501073_0001666_3205_3801 163
8 3300049590 Ga0501074_0019385 Ga0501074_0019385_3160_3756 163
9 3300049741 Ga0501079_0000964 Ga0501079_0000964_5364_5960 163
10 3300054114 Ga0501084_0000684 Ga0501084_0000684_15560_16156 163
11 3300060353 Ga0501082_0003596 Ga0501082_0003596_380_976 163
12 3300060353 Ga0501082_0026741 Ga0501082_0026741_3185_3781 163
13 3300005547 Ga0070693_100459919 Ga0070693_1004599192 168
14 3300028380 Ga0268265_10497006 Ga0268265_104970061 168
15 3300031548 Ga0307408_100689702 Ga0307408_1006897021 168
16 3300049578 Ga0501042_0730144 Ga0501042_0730144_86_700 169
17 3300049741 Ga0501079_0466811 Ga0501079_0466811_130_744 169
18 3300005334 Ga0068869_100304790 Ga0068869_1003047902 170
19 3300005364 Ga0070673_100271960 Ga0070673_1002719603 170
20 3300006881 Ga0068865_100719585 Ga0068865_1007195852 170
21 3300014745 Ga0157377_10466362 Ga0157377_104663621 170
22 3300036401 Ga0373937_0061917 Ga0373937_0061917_2716_3282 170
23 3300044842 Ga0466957_0046215 Ga0466957_0046215_333_950 170
24 3300005356 Ga0070674_100572188 Ga0070674_1005721881 171
25 3300005457 Ga0070662_100059982 Ga0070662_1000599821 171
26 3300006852 Ga0075433_10049371 Ga0075433_100493712 171
27 3300009147 Ga0114129_10033406 Ga0114129_100334066 171
28 3300025938 Ga0207704_10378055 Ga0207704_103780552 171
29 3300026089 Ga0207648_10014356 Ga0207648_100143565 171
30 3300050507 nmdc:mga05p37_40425_c1 nmdc:mga05p37_40425_c1_2166_2705 171
31 3300050515 nmdc:mga0a205_100052_c1 nmdc:mga0a205_100052_c1_2031_2570 171
32 3300005336 Ga0070680_100564528 Ga0070680_1005645281 172
33 3300005530 Ga0070679_100137625 Ga0070679_1001376252 172
34 3300025921 Ga0207652_10991859 Ga0207652_109918591 172
35 3300041509 Ga0451843_1130055 Ga0451843_1130055_1226_1828 172
36 3300049516 Ga0501293_000866 Ga0501293_000866_938_1456 172
37 iso_pu_bacteria 2842805378 2842807334 172
38 iso_pu_bacteria 2912963787 2912964311 172
39 iso_pu_bacteria 2916699645 2916702196 172
40 iso_pu_bacteria 2939651529 2939655918 172
41 iso_pu_bacteria 3007718800 3007720407 172
42 iso_pu_bacteria 8052494512 8052495176 172
43 iso_pu_bacteria 8056172158 8056176569 172
44 3300035119 Ga0373956_0196352 Ga0373956_0196352_363_908 173
45 3300038443 Ga0395901_0003929 Ga0395901_0003929_3892_4509 173
46 3300041452 Ga0451793_1159384 Ga0451793_1159384_435_1037 173
47 3300041486 Ga0451807_0271807 Ga0451807_0271807_1285_1887 173
48 iso_pu_bacteria 2728369097 2729146031 173
49 iso_pu_bacteria 640427133 640487048 173
50 iso_pu_bacteria 651053060 651174920 173
51 3300002737 JGI25162J39368_1003124 JGI25162J39368_10031244 174
52 3300002737 JGI25162J39368_1003469 JGI25162J39368_10034695 174
53 3300003762 Ga0055542_1000283 Ga0055542_100028326 174
54 3300005563 Ga0068855_100665666 Ga0068855_1006656662 174
55 3300006847 Ga0075431_101201576 Ga0075431_1012015761 174
56 iso_pu_bacteria 2808606384 2808973066 174
57 iso_pu_bacteria 2808606390 2809008106 174
58 iso_pu_bacteria 2808606391 2809014909 174
59 iso_pu_bacteria 2928963466 2928966664 174
60 3300005356 Ga0070674_100476947 Ga0070674_1004769471 175
61 3300025231 Ga0207427_101412 Ga0207427_1014127 175
62 3300025233 Ga0209437_100385 Ga0209437_10038515 175
63 3300025242 Ga0209258_101342 Ga0209258_1013427 175
64 3300025254 Ga0209148_1000055 Ga0209148_1000055311 175
65 3300025910 Ga0207684_10869768 Ga0207684_108697682 175
66 3300041486 Ga0451807_1970214 Ga0451807_1970214_32_574 175
67 3300053096 Ga0500641_0001203 Ga0500641_0001203_4725_5267 175
68 3300005295 Ga0065707_10360262 Ga0065707_103602622 176
69 3300005347 Ga0070668_100087108 Ga0070668_1000871082 176
70 3300005353 Ga0070669_100014632 Ga0070669_1000146325 176
71 3300005356 Ga0070674_101062977 Ga0070674_1010629771 176
72 3300005719 Ga0068861_100768584 Ga0068861_1007685842 176
73 3300009148 Ga0105243_10685994 Ga0105243_106859941 176
74 3300009177 Ga0105248_10001052 Ga0105248_1000105229 176
75 3300013104 Ga0157370_10000086 Ga0157370_1000008673 176
76 3300013306 Ga0163162_10234434 Ga0163162_102344343 176
77 3300014325 Ga0163163_10926633 Ga0163163_109266332 176
78 3300014326 Ga0157380_10074449 Ga0157380_100744493 176
79 3300014968 Ga0157379_10000002 Ga0157379_1000000231 176
80 3300025923 Ga0207681_10049248 Ga0207681_100492484 176
81 3300025937 Ga0207669_11297098 Ga0207669_112970981 176
82 3300025941 Ga0207711_10000312 Ga0207711_1000031248 176
83 3300025972 Ga0207668_10108707 Ga0207668_101087072 176
84 3300026035 Ga0207703_10000001 Ga0207703_10000001155 176
85 3300042137 Ga0450902_000215 Ga0450902_000215_5032_5562 176
86 3300042142 Ga0450905_000647 Ga0450905_000647_3679_4209 176
87 3300042533 Ga0450901_000065 Ga0450901_000065_4741_5271 176
88 3300046522 Ga0495643_0005284 Ga0495643_0005284_4185_4715 176
89 3300046542 Ga0495597_0125641 Ga0495597_0125641_84_614 176
90 3300046694 Ga0495649_0121445 Ga0495649_0121445_762_1292 176
91 3300046810 Ga0495660_0203709 Ga0495660_0203709_387_917 176
92 3300049459 Ga0495678_092402 Ga0495678_092402_466_996 176
93 3300061734 Ga0530510_0399562 Ga0530510_0399562_320_874 176
94 3300003693 Ga0032354_1063917 Ga0032354_10639172 177
95 3300005444 Ga0070694_100123632 Ga0070694_1001236321 177
96 3300005467 Ga0070706_100003451 Ga0070706_10000345113 177
97 3300005467 Ga0070706_100545345 Ga0070706_1005453452 177
98 3300005536 Ga0070697_100064730 Ga0070697_1000647302 177
99 3300005545 Ga0070695_100258689 Ga0070695_1002586892 177
100 3300005617 Ga0068859_100516508 Ga0068859_1005165082 177
101 3300006195 Ga0075366_10270047 Ga0075366_102700472 177
102 3300006353 Ga0075370_10177479 Ga0075370_101774791 177
103 3300006844 Ga0075428_100837598 Ga0075428_1008375982 177
104 3300006880 Ga0075429_100413736 Ga0075429_1004137362 177
105 3300006931 Ga0097620_100516474 Ga0097620_1005164742 177
106 3300009147 Ga0114129_11935752 Ga0114129_119357521 177
107 3300009553 Ga0105249_10058352 Ga0105249_100583525 177
108 3300013308 Ga0157375_11500531 Ga0157375_115005311 177
109 3300025910 Ga0207684_10000158 Ga0207684_1000015898 177
110 3300025910 Ga0207684_10153869 Ga0207684_101538693 177
111 3300025931 Ga0207644_10883361 Ga0207644_108833611 177
112 3300027876 Ga0209974_10045942 Ga0209974_100459421 177
113 3300028556 Ga0265337_1005075 Ga0265337_10050755 177
114 3300028653 Ga0265323_10001423 Ga0265323_100014237 177
115 3300028800 Ga0265338_10016346 Ga0265338_100163467 177
116 3300031240 Ga0265320_10056735 Ga0265320_100567352 177
117 3300031242 Ga0265329_10045459 Ga0265329_100454592 177
118 3300031247 Ga0265340_10000124 Ga0265340_1000012412 177
119 3300031249 Ga0265339_10009415 Ga0265339_100094155 177
120 3300031250 Ga0265331_10007061 Ga0265331_100070612 177
121 3300031344 Ga0265316_10115816 Ga0265316_101158162 177
122 3300031595 Ga0265313_10118152 Ga0265313_101181521 177
123 3300031711 Ga0265314_10000257 Ga0265314_1000025721 177
124 3300031712 Ga0265342_10000305 Ga0265342_1000030539 177
125 3300031712 Ga0265342_10013694 Ga0265342_100136943 177
126 3300032002 Ga0307416_100169924 Ga0307416_1001699244 177
127 3300032005 Ga0307411_10279191 Ga0307411_102791911 177
128 3300033180 Ga0307510_10198234 Ga0307510_101982342 177
129 3300041408 Ga0439453_0037637 Ga0439453_0037637_302_850 177
130 3300046452 Ga0495617_001715 Ga0495617_001715_4488_5021 177
131 3300046457 Ga0495590_0086367 Ga0495590_0086367_389_922 177
132 3300046458 Ga0495591_004750 Ga0495591_004750_2408_2941 177
133 3300046458 Ga0495591_010767 Ga0495591_010767_120_653 177
134 3300046471 Ga0495650_0000901 Ga0495650_0000901_10405_10938 177
135 3300046474 Ga0495605_0003419 Ga0495605_0003419_648_1181 177
136 3300046491 Ga0495584_0025980 Ga0495584_0025980_2384_2917 177
137 3300046500 Ga0495596_0113234 Ga0495596_0113234_470_1003 177
138 3300046501 Ga0495607_0005711 Ga0495607_0005711_5466_5999 177
139 3300046501 Ga0495607_0047857 Ga0495607_0047857_390_923 177
140 3300046501 Ga0495607_0245786 Ga0495607_0245786_240_773 177
141 3300046506 Ga0495583_0001084 Ga0495583_0001084_10259_10792 177
142 3300046506 Ga0495583_0003921 Ga0495583_0003921_4718_5251 177
143 3300046512 Ga0495610_0062574 Ga0495610_0062574_152_685 177
144 3300046512 Ga0495610_0074588 Ga0495610_0074588_701_1234 177
145 3300046513 Ga0495616_0024866 Ga0495616_0024866_2536_3069 177
146 3300046513 Ga0495616_0083975 Ga0495616_0083975_963_1496 177
147 3300046518 Ga0495631_0004277 Ga0495631_0004277_5236_5769 177
148 3300046518 Ga0495631_0050778 Ga0495631_0050778_285_818 177
149 3300046519 Ga0495632_0021332 Ga0495632_0021332_94_627 177
150 3300046520 Ga0495637_0000033 Ga0495637_0000033_11115_11648 177
151 3300046520 Ga0495637_0000471 Ga0495637_0000471_9972_10505 177
152 3300046522 Ga0495643_0068478 Ga0495643_0068478_664_1197 177
153 3300046523 Ga0495644_0017017 Ga0495644_0017017_1070_1603 177
154 3300046524 Ga0495648_0003423 Ga0495648_0003423_7662_8195 177
155 3300046530 Ga0495654_0034626 Ga0495654_0034626_1765_2298 177
156 3300046538 Ga0495609_0000275 Ga0495609_0000275_37111_37644 177
157 3300046557 Ga0495622_0041234 Ga0495622_0041234_413_946 177
158 3300046616 Ga0495668_0043646 Ga0495668_0043646_1361_1894 177
159 3300046616 Ga0495668_0212002 Ga0495668_0212002_414_947 177
160 3300046648 Ga0495611_0004637 Ga0495611_0004637_4477_5010 177
161 3300046648 Ga0495611_0028229 Ga0495611_0028229_562_1095 177
162 3300046660 Ga0495625_0000082 Ga0495625_0000082_37516_38049 177
163 3300046665 Ga0495661_0000268 Ga0495661_0000268_37438_37971 177
164 3300046665 Ga0495661_0138028 Ga0495661_0138028_784_1317 177
165 3300046692 Ga0495671_0019471 Ga0495671_0019471_1526_2059 177
166 3300046692 Ga0495671_0021674 Ga0495671_0021674_2650_3183 177
167 3300046810 Ga0495660_0052247 Ga0495660_0052247_1092_1625 177
168 3300047320 Ga0495672_0101702 Ga0495672_0101702_392_925 177
169 3300047321 Ga0495676_0000057 Ga0495676_0000057_48188_48721 177
170 3300047323 Ga0495683_0016259 Ga0495683_0016259_412_945 177
171 3300047446 Ga0495679_000047 Ga0495679_000047_89352_89885 177
172 3300047469 Ga0495673_0008702 Ga0495673_0008702_1650_2183 177
173 3300047469 Ga0495673_0012823 Ga0495673_0012823_2697_3230 177
174 3300047469 Ga0495673_0013841 Ga0495673_0013841_2073_2606 177
175 3300047469 Ga0495673_0018774 Ga0495673_0018774_321_854 177
176 3300047469 Ga0495673_0081062 Ga0495673_0081062_715_1248 177
177 3300047470 Ga0495681_0010082 Ga0495681_0010082_345_878 177
178 3300047472 Ga0495686_0093022 Ga0495686_0093022_266_799 177
179 3300048091 Ga0495626_0000063 Ga0495626_0000063_104617_105150 177
180 3300049459 Ga0495678_000168 Ga0495678_000168_34826_35359 177
181 3300049459 Ga0495678_005330 Ga0495678_005330_1784_2317 177
182 3300049459 Ga0495678_010978 Ga0495678_010978_2276_2809 177
183 3300050491 nmdc:mga00v17_59186_c1 nmdc:mga00v17_59186_c1_898_1476 177
184 3300050507 nmdc:mga05p37_292983_c1 nmdc:mga05p37_292983_c1_615_1163 177
185 3300050509 nmdc:mga0qj67_370654_c1 nmdc:mga0qj67_370654_c1_21_557 177
186 2162886007 SwRhRL2b_contig_3614463 SwRhRL2b_0050.00006740 178
187 3300001432 JGI24034J14986_100823 JGI24034J14986_1008231 178
188 3300002074 JGI24748J21848_1000018 JGI24748J21848_100001860 178
189 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001471 178
190 3300002244 JGI24742J22300_10028009 JGI24742J22300_100280092 178
191 3300002459 JGI24751J29686_10000057 JGI24751J29686_1000005718 178
192 3300002459 JGI24751J29686_10000130 JGI24751J29686_1000013021 178
193 3300003203 JGI25406J46586_10005622 JGI25406J46586_100056225 178
194 3300003203 JGI25406J46586_10030575 JGI25406J46586_100305752 178
195 3300004800 Ga0058861_11411696 Ga0058861_114116961 178
196 3300005288 Ga0065714_10002185 Ga0065714_1000218565 178
197 3300005289 Ga0065704_10239377 Ga0065704_102393771 178
198 3300005290 Ga0065712_10002812 Ga0065712_100028123 178
199 3300005290 Ga0065712_10007367 Ga0065712_100073672 178
200 3300005290 Ga0065712_10010735 Ga0065712_100107352 178
201 3300005290 Ga0065712_10067739 Ga0065712_1006773963 178
202 3300005290 Ga0065712_10081368 Ga0065712_100813682 178
203 3300005290 Ga0065712_10109727 Ga0065712_101097272 178
204 3300005290 Ga0065712_10457395 Ga0065712_104573951 178
205 3300005290 Ga0065712_10488980 Ga0065712_104889801 178
206 3300005293 Ga0065715_10030381 Ga0065715_100303812 178
207 3300005293 Ga0065715_10045500 Ga0065715_100455001 178
208 3300005293 Ga0065715_10089411 Ga0065715_100894112 178
209 3300005293 Ga0065715_10090291 Ga0065715_100902917 178
210 3300005293 Ga0065715_10094446 Ga0065715_100944463 178
211 3300005293 Ga0065715_10152254 Ga0065715_101522542 178
212 3300005293 Ga0065715_10161576 Ga0065715_101615762 178
213 3300005293 Ga0065715_10186679 Ga0065715_101866792 178
214 3300005293 Ga0065715_10360854 Ga0065715_103608542 178
215 3300005293 Ga0065715_10499431 Ga0065715_104994311 178
216 3300005295 Ga0065707_10015242 Ga0065707_100152422 178
217 3300005295 Ga0065707_10110710 Ga0065707_101107102 178
218 3300005295 Ga0065707_10327836 Ga0065707_103278362 178
219 3300005295 Ga0065707_10410350 Ga0065707_104103501 178
220 3300005295 Ga0065707_10430056 Ga0065707_104300561 178
221 3300005327 Ga0070658_10373297 Ga0070658_103732971 178
222 3300005328 Ga0070676_10055379 Ga0070676_100553792 178
223 3300005328 Ga0070676_10381026 Ga0070676_103810261 178
224 3300005329 Ga0070683_100113331 Ga0070683_1001133312 178
225 3300005330 Ga0070690_100002065 Ga0070690_1000020658 178
226 3300005330 Ga0070690_100101800 Ga0070690_1001018002 178
227 3300005330 Ga0070690_100218032 Ga0070690_1002180321 178
228 3300005331 Ga0070670_100000055 Ga0070670_1000000558 178
229 3300005331 Ga0070670_100009750 Ga0070670_1000097502 178
230 3300005331 Ga0070670_100015449 Ga0070670_1000154495 178
231 3300005331 Ga0070670_100075964 Ga0070670_1000759643 178
232 3300005331 Ga0070670_100096475 Ga0070670_1000964752 178
233 3300005331 Ga0070670_100173467 Ga0070670_1001734672 178
234 3300005331 Ga0070670_100597293 Ga0070670_1005972932 178
235 3300005334 Ga0068869_100014158 Ga0068869_1000141586 178
236 3300005334 Ga0068869_100104425 Ga0068869_1001044252 178
237 3300005334 Ga0068869_100163454 Ga0068869_1001634542 178
238 3300005334 Ga0068869_100299998 Ga0068869_1002999982 178
239 3300005334 Ga0068869_100718050 Ga0068869_1007180501 178
240 3300005334 Ga0068869_101200344 Ga0068869_1012003441 178
241 3300005335 Ga0070666_10231493 Ga0070666_102314932 178
242 3300005336 Ga0070680_100009372 Ga0070680_1000093723 178
243 3300005336 Ga0070680_100173548 Ga0070680_1001735481 178
244 3300005336 Ga0070680_100915538 Ga0070680_1009155381 178
245 3300005336 Ga0070680_100922203 Ga0070680_1009222032 178
246 3300005337 Ga0070682_100004407 Ga0070682_1000044075 178
247 3300005337 Ga0070682_100011784 Ga0070682_1000117842 178
248 3300005337 Ga0070682_100481278 Ga0070682_1004812782 178
249 3300005338 Ga0068868_100048098 Ga0068868_1000480983 178
250 3300005340 Ga0070689_100001958 Ga0070689_1000019588 178
251 3300005340 Ga0070689_100344128 Ga0070689_1003441282 178
252 3300005340 Ga0070689_100444625 Ga0070689_1004446252 178
253 3300005340 Ga0070689_100823240 Ga0070689_1008232401 178
254 3300005343 Ga0070687_100201307 Ga0070687_1002013072 178
255 3300005343 Ga0070687_100223290 Ga0070687_1002232902 178
256 3300005343 Ga0070687_100280283 Ga0070687_1002802832 178
257 3300005344 Ga0070661_100256768 Ga0070661_1002567682 178
258 3300005344 Ga0070661_100762972 Ga0070661_1007629721 178
259 3300005345 Ga0070692_10000988 Ga0070692_100009882 178
260 3300005345 Ga0070692_10047463 Ga0070692_100474631 178
261 3300005345 Ga0070692_10128233 Ga0070692_101282333 178
262 3300005347 Ga0070668_100057797 Ga0070668_1000577973 178
263 3300005347 Ga0070668_100618357 Ga0070668_1006183572 178
264 3300005347 Ga0070668_100773872 Ga0070668_1007738721 178
265 3300005347 Ga0070668_100802323 Ga0070668_1008023231 178
266 3300005353 Ga0070669_100547174 Ga0070669_1005471741 178
267 3300005353 Ga0070669_100571762 Ga0070669_1005717621 178
268 3300005353 Ga0070669_100665407 Ga0070669_1006654071 178
269 3300005354 Ga0070675_100325683 Ga0070675_1003256832 178
270 3300005354 Ga0070675_100941589 Ga0070675_1009415891 178
271 3300005355 Ga0070671_100079927 Ga0070671_1000799272 178
272 3300005356 Ga0070674_100321430 Ga0070674_1003214301 178
273 3300005364 Ga0070673_100004195 Ga0070673_1000041957 178
274 3300005364 Ga0070673_100103961 Ga0070673_1001039612 178
275 3300005364 Ga0070673_100172297 Ga0070673_1001722972 178
276 3300005365 Ga0070688_100016468 Ga0070688_1000164684 178
277 3300005365 Ga0070688_100833753 Ga0070688_1008337531 178
278 3300005366 Ga0070659_100005957 Ga0070659_1000059575 178
279 3300005366 Ga0070659_100017613 Ga0070659_1000176133 178
280 3300005366 Ga0070659_100584300 Ga0070659_1005843001 178
281 3300005366 Ga0070659_100595045 Ga0070659_1005950451 178
282 3300005367 Ga0070667_100967020 Ga0070667_1009670201 178
283 3300005406 Ga0070703_10027520 Ga0070703_100275202 178
284 3300005434 Ga0070709_10091114 Ga0070709_100911142 178
285 3300005434 Ga0070709_10131797 Ga0070709_101317973 178
286 3300005434 Ga0070709_10267205 Ga0070709_102672051 178
287 3300005435 Ga0070714_100003501 Ga0070714_1000035014 178
288 3300005436 Ga0070713_100013486 Ga0070713_1000134862 178
289 3300005437 Ga0070710_10490186 Ga0070710_104901862 178
290 3300005438 Ga0070701_10064031 Ga0070701_100640312 178
291 3300005438 Ga0070701_10123420 Ga0070701_101234202 178
292 3300005438 Ga0070701_10205619 Ga0070701_102056191 178
293 3300005438 Ga0070701_10340913 Ga0070701_103409132 178
294 3300005438 Ga0070701_10531861 Ga0070701_105318612 178
295 3300005439 Ga0070711_100023095 Ga0070711_1000230955 178
296 3300005440 Ga0070705_100007721 Ga0070705_1000077213 178
297 3300005440 Ga0070705_100019704 Ga0070705_1000197042 178
298 3300005440 Ga0070705_100048691 Ga0070705_1000486913 178
299 3300005440 Ga0070705_100062029 Ga0070705_1000620292 178
300 3300005440 Ga0070705_100124441 Ga0070705_1001244412 178
301 3300005440 Ga0070705_100220164 Ga0070705_1002201642 178
302 3300005440 Ga0070705_100456577 Ga0070705_1004565771 178
303 3300005440 Ga0070705_100868116 Ga0070705_1008681161 178
304 3300005441 Ga0070700_100000226 Ga0070700_10000022619 178
305 3300005441 Ga0070700_100353826 Ga0070700_1003538262 178
306 3300005441 Ga0070700_100383798 Ga0070700_1003837981 178
307 3300005444 Ga0070694_100005406 Ga0070694_1000054069 178
308 3300005444 Ga0070694_100007593 Ga0070694_1000075935 178
309 3300005444 Ga0070694_100011945 Ga0070694_1000119455 178
310 3300005444 Ga0070694_100014178 Ga0070694_1000141785 178
311 3300005444 Ga0070694_100082813 Ga0070694_1000828132 178
312 3300005444 Ga0070694_100444676 Ga0070694_1004446762 178
313 3300005444 Ga0070694_100495295 Ga0070694_1004952951 178
314 3300005444 Ga0070694_100635790 Ga0070694_1006357902 178
315 3300005445 Ga0070708_100000103 Ga0070708_10000010345 178
316 3300005445 Ga0070708_100110237 Ga0070708_1001102373 178
317 3300005457 Ga0070662_100025003 Ga0070662_1000250035 178
318 3300005457 Ga0070662_100154827 Ga0070662_1001548272 178
319 3300005457 Ga0070662_100867410 Ga0070662_1008674101 178
320 3300005458 Ga0070681_10003978 Ga0070681_1000397811 178
321 3300005458 Ga0070681_10099457 Ga0070681_100994572 178
322 3300005459 Ga0068867_100033133 Ga0068867_1000331332 178
323 3300005459 Ga0068867_100145651 Ga0068867_1001456512 178
324 3300005459 Ga0068867_100158883 Ga0068867_1001588832 178
325 3300005467 Ga0070706_100000126 Ga0070706_10000012669 178
326 3300005467 Ga0070706_100001194 Ga0070706_10000119419 178
327 3300005467 Ga0070706_100009351 Ga0070706_1000093518 178
328 3300005467 Ga0070706_100046268 Ga0070706_1000462684 178
329 3300005467 Ga0070706_100130418 Ga0070706_1001304182 178
330 3300005467 Ga0070706_100465976 Ga0070706_1004659761 178
331 3300005468 Ga0070707_100119128 Ga0070707_1001191282 178
332 3300005468 Ga0070707_100135740 Ga0070707_1001357402 178
333 3300005468 Ga0070707_100184260 Ga0070707_1001842602 178
334 3300005468 Ga0070707_100473316 Ga0070707_1004733162 178
335 3300005471 Ga0070698_100007367 Ga0070698_1000073674 178
336 3300005471 Ga0070698_100082658 Ga0070698_1000826581 178
337 3300005471 Ga0070698_100195434 Ga0070698_1001954342 178
338 3300005518 Ga0070699_100001144 Ga0070699_10000114417 178
339 3300005518 Ga0070699_100004289 Ga0070699_10000428912 178
340 3300005518 Ga0070699_100015896 Ga0070699_1000158963 178
341 3300005518 Ga0070699_100135686 Ga0070699_1001356861 178
342 3300005518 Ga0070699_100175131 Ga0070699_1001751312 178
343 3300005518 Ga0070699_100331872 Ga0070699_1003318722 178
344 3300005518 Ga0070699_100682419 Ga0070699_1006824192 178
345 3300005530 Ga0070679_100616601 Ga0070679_1006166011 178
346 3300005535 Ga0070684_100048729 Ga0070684_1000487292 178
347 3300005535 Ga0070684_101293266 Ga0070684_1012932661 178
348 3300005536 Ga0070697_100024260 Ga0070697_1000242602 178
349 3300005536 Ga0070697_100030158 Ga0070697_1000301581 178
350 3300005536 Ga0070697_100068253 Ga0070697_1000682532 178
351 3300005536 Ga0070697_100089074 Ga0070697_1000890742 178
352 3300005539 Ga0068853_100090304 Ga0068853_1000903045 178
353 3300005539 Ga0068853_100510979 Ga0068853_1005109792 178
354 3300005539 Ga0068853_100877269 Ga0068853_1008772691 178
355 3300005539 Ga0068853_101065997 Ga0068853_1010659971 178
356 3300005543 Ga0070672_100196237 Ga0070672_1001962371 178
357 3300005543 Ga0070672_100965004 Ga0070672_1009650041 178
358 3300005544 Ga0070686_100113356 Ga0070686_1001133562 178
359 3300005545 Ga0070695_100071121 Ga0070695_1000711212 178
360 3300005545 Ga0070695_100173653 Ga0070695_1001736532 178
361 3300005545 Ga0070695_100193513 Ga0070695_1001935131 178
362 3300005545 Ga0070695_100217545 Ga0070695_1002175452 178
363 3300005545 Ga0070695_100269985 Ga0070695_1002699852 178
364 3300005545 Ga0070695_100300337 Ga0070695_1003003372 178
365 3300005545 Ga0070695_100398757 Ga0070695_1003987572 178
366 3300005546 Ga0070696_100013718 Ga0070696_1000137183 178
367 3300005546 Ga0070696_100155890 Ga0070696_1001558902 178
368 3300005546 Ga0070696_100208756 Ga0070696_1002087562 178
369 3300005546 Ga0070696_100280658 Ga0070696_1002806581 178
370 3300005546 Ga0070696_100335133 Ga0070696_1003351332 178
371 3300005546 Ga0070696_100464529 Ga0070696_1004645292 178
372 3300005547 Ga0070693_100005496 Ga0070693_1000054966 178
373 3300005547 Ga0070693_100081854 Ga0070693_1000818542 178
374 3300005547 Ga0070693_100642672 Ga0070693_1006426721 178
375 3300005549 Ga0070704_100095965 Ga0070704_1000959652 178
376 3300005549 Ga0070704_100182936 Ga0070704_1001829362 178
377 3300005549 Ga0070704_100191714 Ga0070704_1001917142 178
378 3300005549 Ga0070704_100272847 Ga0070704_1002728472 178
379 3300005549 Ga0070704_100362530 Ga0070704_1003625301 178
380 3300005549 Ga0070704_100390636 Ga0070704_1003906361 178
381 3300005549 Ga0070704_100407478 Ga0070704_1004074781 178
382 3300005549 Ga0070704_101576339 Ga0070704_1015763391 178
383 3300005564 Ga0070664_100051255 Ga0070664_1000512552 178
384 3300005564 Ga0070664_100125978 Ga0070664_1001259783 178
385 3300005564 Ga0070664_100270624 Ga0070664_1002706242 178
386 3300005577 Ga0068857_100252633 Ga0068857_1002526332 178
387 3300005577 Ga0068857_100277757 Ga0068857_1002777572 178
388 3300005577 Ga0068857_100495583 Ga0068857_1004955832 178
389 3300005577 Ga0068857_100912917 Ga0068857_1009129171 178
390 3300005578 Ga0068854_100008103 Ga0068854_1000081035 178
391 3300005615 Ga0070702_100009239 Ga0070702_1000092394 178
392 3300005615 Ga0070702_100059126 Ga0070702_1000591261 178
393 3300005615 Ga0070702_100084317 Ga0070702_1000843172 178
394 3300005615 Ga0070702_100153156 Ga0070702_1001531562 178
395 3300005615 Ga0070702_100319123 Ga0070702_1003191232 178
396 3300005615 Ga0070702_101125949 Ga0070702_1011259491 178
397 3300005616 Ga0068852_100050644 Ga0068852_1000506443 178
398 3300005616 Ga0068852_100363303 Ga0068852_1003633032 178
399 3300005617 Ga0068859_100008957 Ga0068859_1000089574 178
400 3300005617 Ga0068859_100017046 Ga0068859_1000170464 178
401 3300005617 Ga0068859_100053562 Ga0068859_1000535623 178
402 3300005617 Ga0068859_100059971 Ga0068859_1000599713 178
403 3300005617 Ga0068859_100071456 Ga0068859_1000714564 178
404 3300005617 Ga0068859_100152678 Ga0068859_1001526782 178
405 3300005617 Ga0068859_100272593 Ga0068859_1002725932 178
406 3300005617 Ga0068859_100320644 Ga0068859_1003206442 178
407 3300005617 Ga0068859_100375919 Ga0068859_1003759192 178
408 3300005617 Ga0068859_100590063 Ga0068859_1005900632 178
409 3300005617 Ga0068859_100755120 Ga0068859_1007551201 178
410 3300005617 Ga0068859_100764985 Ga0068859_1007649852 178
411 3300005618 Ga0068864_100007406 Ga0068864_1000074064 178
412 3300005618 Ga0068864_100013371 Ga0068864_1000133713 178
413 3300005618 Ga0068864_100087841 Ga0068864_1000878412 178
414 3300005618 Ga0068864_100110094 Ga0068864_1001100942 178
415 3300005618 Ga0068864_100161674 Ga0068864_1001616742 178
416 3300005618 Ga0068864_100197086 Ga0068864_1001970862 178
417 3300005618 Ga0068864_100405752 Ga0068864_1004057522 178
418 3300005618 Ga0068864_100515920 Ga0068864_1005159202 178
419 3300005618 Ga0068864_100574891 Ga0068864_1005748912 178
420 3300005618 Ga0068864_100577984 Ga0068864_1005779842 178
421 3300005719 Ga0068861_100000948 Ga0068861_10000094810 178
422 3300005719 Ga0068861_100038155 Ga0068861_1000381552 178
423 3300005719 Ga0068861_100393943 Ga0068861_1003939431 178
424 3300005719 Ga0068861_100835378 Ga0068861_1008353781 178
425 3300005719 Ga0068861_101048201 Ga0068861_1010482011 178
426 3300005834 Ga0068851_10000606 Ga0068851_1000060610 178
427 3300005834 Ga0068851_10156860 Ga0068851_101568602 178
428 3300005840 Ga0068870_10308248 Ga0068870_103082481 178
429 3300005840 Ga0068870_10467303 Ga0068870_104673032 178
430 3300005840 Ga0068870_10663627 Ga0068870_106636271 178
431 3300005841 Ga0068863_100101319 Ga0068863_1001013192 178
432 3300005841 Ga0068863_100142442 Ga0068863_1001424422 178
433 3300005841 Ga0068863_100238438 Ga0068863_1002384381 178
434 3300005841 Ga0068863_100611887 Ga0068863_1006118871 178
435 3300005841 Ga0068863_100769103 Ga0068863_1007691032 178
436 3300005841 Ga0068863_101624824 Ga0068863_1016248241 178
437 3300005842 Ga0068858_100000005 Ga0068858_100000005271 178
438 3300005842 Ga0068858_100010380 Ga0068858_1000103805 178
439 3300005842 Ga0068858_100071501 Ga0068858_1000715013 178
440 3300005842 Ga0068858_100118948 Ga0068858_1001189482 178
441 3300005842 Ga0068858_100220050 Ga0068858_1002200502 178
442 3300005842 Ga0068858_100263330 Ga0068858_1002633302 178
443 3300005842 Ga0068858_100401797 Ga0068858_1004017972 178
444 3300005843 Ga0068860_100005674 Ga0068860_1000056748 178
445 3300005843 Ga0068860_100033025 Ga0068860_1000330253 178
446 3300005843 Ga0068860_100131765 Ga0068860_1001317652 178
447 3300005843 Ga0068860_100150024 Ga0068860_1001500242 178
448 3300005843 Ga0068860_100414454 Ga0068860_1004144542 178
449 3300005843 Ga0068860_100480003 Ga0068860_1004800032 178
450 3300005843 Ga0068860_100759503 Ga0068860_1007595032 178
451 3300005843 Ga0068860_100828147 Ga0068860_1008281472 178
452 3300005843 Ga0068860_101085476 Ga0068860_1010854761 178
453 3300005844 Ga0068862_100003048 Ga0068862_1000030484 178
454 3300005844 Ga0068862_100197701 Ga0068862_1001977012 178
455 3300005844 Ga0068862_100210648 Ga0068862_1002106481 178
456 3300005844 Ga0068862_100416112 Ga0068862_1004161123 178
457 3300005844 Ga0068862_100661008 Ga0068862_1006610082 178
458 3300005844 Ga0068862_100987105 Ga0068862_1009871051 178
459 3300005985 Ga0081539_10000067 Ga0081539_1000006710 178
460 3300005985 Ga0081539_10000600 Ga0081539_1000060031 178
461 3300005985 Ga0081539_10080395 Ga0081539_100803952 178
462 3300005985 Ga0081539_10249012 Ga0081539_102490121 178
463 3300006028 Ga0070717_10918110 Ga0070717_109181102 178
464 3300006058 Ga0075432_10077121 Ga0075432_100771212 178
465 3300006163 Ga0070715_10000016 Ga0070715_1000001679 178
466 3300006173 Ga0070716_100000001 Ga0070716_10000000120 178
467 3300006173 Ga0070716_100053746 Ga0070716_1000537462 178
468 3300006173 Ga0070716_100162739 Ga0070716_1001627392 178
469 3300006173 Ga0070716_100361819 Ga0070716_1003618192 178
470 3300006173 Ga0070716_100538552 Ga0070716_1005385522 178
471 3300006175 Ga0070712_100266566 Ga0070712_1002665662 178
472 3300006237 Ga0097621_100103357 Ga0097621_1001033573 178
473 3300006237 Ga0097621_100923885 Ga0097621_1009238852 178
474 3300006358 Ga0068871_100001151 Ga0068871_10000115110 178
475 3300006358 Ga0068871_100005662 Ga0068871_1000056622 178
476 3300006358 Ga0068871_100035254 Ga0068871_1000352542 178
477 3300006844 Ga0075428_100169324 Ga0075428_1001693242 178
478 3300006844 Ga0075428_100751151 Ga0075428_1007511512 178
479 3300006844 Ga0075428_101370193 Ga0075428_1013701931 178
480 3300006846 Ga0075430_100023157 Ga0075430_1000231572 178
481 3300006846 Ga0075430_100037277 Ga0075430_1000372774 178
482 3300006846 Ga0075430_100066882 Ga0075430_1000668823 178
483 3300006846 Ga0075430_100168991 Ga0075430_1001689912 178
484 3300006847 Ga0075431_100050985 Ga0075431_1000509853 178
485 3300006852 Ga0075433_10089697 Ga0075433_100896972 178
486 3300006852 Ga0075433_10119755 Ga0075433_101197551 178
487 3300006852 Ga0075433_10141368 Ga0075433_101413682 178
488 3300006852 Ga0075433_10177138 Ga0075433_101771382 178
489 3300006871 Ga0075434_100071224 Ga0075434_1000712242 178
490 3300006871 Ga0075434_100078719 Ga0075434_1000787193 178
491 3300006871 Ga0075434_100131135 Ga0075434_1001311352 178
492 3300006871 Ga0075434_100787087 Ga0075434_1007870871 178
493 3300006871 Ga0075434_100788970 Ga0075434_1007889702 178
494 3300006880 Ga0075429_100035316 Ga0075429_1000353162 178
495 3300006881 Ga0068865_100082047 Ga0068865_1000820472 178
496 3300006881 Ga0068865_100647812 Ga0068865_1006478122 178
497 3300006914 Ga0075436_100148916 Ga0075436_1001489162 178
498 3300006931 Ga0097620_100008957 Ga0097620_1000089574 178
499 3300006931 Ga0097620_100017046 Ga0097620_1000170464 178
500 3300006931 Ga0097620_100053562 Ga0097620_1000535623 178
501 3300006931 Ga0097620_100059970 Ga0097620_1000599703 178
502 3300006931 Ga0097620_100071458 Ga0097620_1000714584 178
503 3300006931 Ga0097620_100152683 Ga0097620_1001526832 178
504 3300006931 Ga0097620_100272582 Ga0097620_1002725821 178
505 3300006931 Ga0097620_100320627 Ga0097620_1003206272 178
506 3300006931 Ga0097620_100375903 Ga0097620_1003759032 178
507 3300006931 Ga0097620_100590066 Ga0097620_1005900662 178
508 3300006931 Ga0097620_100755085 Ga0097620_1007550852 178
509 3300006931 Ga0097620_100764964 Ga0097620_1007649641 178
510 3300007076 Ga0075435_100013579 Ga0075435_1000135794 178
511 3300009011 Ga0105251_10115592 Ga0105251_101155922 178
512 3300009011 Ga0105251_10248362 Ga0105251_102483621 178
513 3300009036 Ga0105244_10012604 Ga0105244_100126042 178
514 3300009092 Ga0105250_10045142 Ga0105250_100451422 178
515 3300009093 Ga0105240_10056814 Ga0105240_100568143 178
516 3300009093 Ga0105240_10066617 Ga0105240_100666172 178
517 3300009093 Ga0105240_10801154 Ga0105240_108011542 178
518 3300009093 Ga0105240_11831455 Ga0105240_118314551 178
519 3300009094 Ga0111539_10000660 Ga0111539_1000066019 178
520 3300009094 Ga0111539_10008323 Ga0111539_100083237 178
521 3300009094 Ga0111539_10064405 Ga0111539_100644053 178
522 3300009094 Ga0111539_10347332 Ga0111539_103473322 178
523 3300009098 Ga0105245_10021971 Ga0105245_100219712 178
524 3300009098 Ga0105245_10255941 Ga0105245_102559412 178
525 3300009101 Ga0105247_10000002 Ga0105247_10000002517 178
526 3300009101 Ga0105247_10007400 Ga0105247_100074003 178
527 3300009101 Ga0105247_10153395 Ga0105247_101533952 178
528 3300009101 Ga0105247_10182518 Ga0105247_101825181 178
529 3300009101 Ga0105247_10324197 Ga0105247_103241972 178
530 3300009101 Ga0105247_10336459 Ga0105247_103364591 178
531 3300009101 Ga0105247_10384078 Ga0105247_103840782 178
532 3300009101 Ga0105247_10412897 Ga0105247_104128971 178
533 3300009147 Ga0114129_10029256 Ga0114129_100292563 178
534 3300009147 Ga0114129_10050597 Ga0114129_100505975 178
535 3300009147 Ga0114129_10111224 Ga0114129_101112243 178
536 3300009147 Ga0114129_10170111 Ga0114129_101701112 178
537 3300009147 Ga0114129_10228378 Ga0114129_102283782 178
538 3300009147 Ga0114129_10361680 Ga0114129_103616801 178
539 3300009148 Ga0105243_10177975 Ga0105243_101779752 178
540 3300009174 Ga0105241_10005065 Ga0105241_100050652 178
541 3300009174 Ga0105241_10093410 Ga0105241_100934102 178
542 3300009174 Ga0105241_10209964 Ga0105241_102099642 178
543 3300009174 Ga0105241_10332590 Ga0105241_103325902 178
544 3300009174 Ga0105241_10475417 Ga0105241_104754172 178
545 3300009174 Ga0105241_10920604 Ga0105241_109206041 178
546 3300009176 Ga0105242_10122645 Ga0105242_101226452 178
547 3300009176 Ga0105242_10176180 Ga0105242_101761802 178
548 3300009177 Ga0105248_10018104 Ga0105248_100181043 178
549 3300009177 Ga0105248_10073995 Ga0105248_100739955 178
550 3300009177 Ga0105248_10087370 Ga0105248_100873702 178
551 3300009177 Ga0105248_10145166 Ga0105248_101451662 178
552 3300009177 Ga0105248_10164620 Ga0105248_101646202 178
553 3300009177 Ga0105248_10169519 Ga0105248_101695192 178
554 3300009177 Ga0105248_10716591 Ga0105248_107165911 178
555 3300009177 Ga0105248_10774378 Ga0105248_107743781 178
556 3300009545 Ga0105237_10000493 Ga0105237_100004935 178
557 3300009545 Ga0105237_10180368 Ga0105237_101803682 178
558 3300009545 Ga0105237_10189909 Ga0105237_101899091 178
559 3300009545 Ga0105237_10275755 Ga0105237_102757552 178
560 3300009551 Ga0105238_10016102 Ga0105238_100161026 178
561 3300009551 Ga0105238_10090739 Ga0105238_100907392 178
562 3300009553 Ga0105249_10000513 Ga0105249_1000051321 178
563 3300009553 Ga0105249_10210592 Ga0105249_102105922 178
564 3300009553 Ga0105249_10447691 Ga0105249_104476912 178
565 3300010159 Ga0099796_10016560 Ga0099796_100165602 178
566 3300010375 Ga0105239_10044121 Ga0105239_100441212 178
567 3300010375 Ga0105239_10104263 Ga0105239_101042632 178
568 3300010375 Ga0105239_10316827 Ga0105239_103168272 178
569 3300010375 Ga0105239_10454265 Ga0105239_104542651 178
570 3300010375 Ga0105239_10635025 Ga0105239_106350251 178
571 3300010375 Ga0105239_10957835 Ga0105239_109578351 178
572 3300011119 Ga0105246_10029811 Ga0105246_100298114 178
573 3300011119 Ga0105246_10108732 Ga0105246_101087322 178
574 3300011119 Ga0105246_10174519 Ga0105246_101745192 178
575 3300011119 Ga0105246_10231013 Ga0105246_102310132 178
576 3300013100 Ga0157373_10141382 Ga0157373_101413822 178
577 3300013102 Ga0157371_10166935 Ga0157371_101669353 178
578 3300013105 Ga0157369_10201919 Ga0157369_102019192 178
579 3300013297 Ga0157378_10123997 Ga0157378_101239972 178
580 3300013297 Ga0157378_10255489 Ga0157378_102554892 178
581 3300013297 Ga0157378_10269344 Ga0157378_102693442 178
582 3300013297 Ga0157378_10306537 Ga0157378_103065373 178
583 3300013297 Ga0157378_10483422 Ga0157378_104834222 178
584 3300013297 Ga0157378_10509168 Ga0157378_105091681 178
585 3300013297 Ga0157378_10998515 Ga0157378_109985152 178
586 3300013297 Ga0157378_11139448 Ga0157378_111394481 178
587 3300013297 Ga0157378_11413992 Ga0157378_114139921 178
588 3300013306 Ga0163162_10000001 Ga0163162_10000001494 178
589 3300013306 Ga0163162_10009333 Ga0163162_100093334 178
590 3300013306 Ga0163162_10069552 Ga0163162_100695524 178
591 3300013306 Ga0163162_11404694 Ga0163162_114046941 178
592 3300013306 Ga0163162_12207964 Ga0163162_122079641 178
593 3300013307 Ga0157372_10329288 Ga0157372_103292881 178
594 3300013307 Ga0157372_10743699 Ga0157372_107436991 178
595 3300013308 Ga0157375_10027172 Ga0157375_100271722 178
596 3300013308 Ga0157375_10199415 Ga0157375_101994153 178
597 3300013308 Ga0157375_10263050 Ga0157375_102630502 178
598 3300013308 Ga0157375_10588370 Ga0157375_105883702 178
599 3300014325 Ga0163163_10000370 Ga0163163_100003705 178
600 3300014325 Ga0163163_10072569 Ga0163163_100725694 178
601 3300014325 Ga0163163_10140888 Ga0163163_101408882 178
602 3300014325 Ga0163163_10303861 Ga0163163_103038612 178
603 3300014325 Ga0163163_10528768 Ga0163163_105287682 178
604 3300014325 Ga0163163_10716635 Ga0163163_107166352 178
605 3300014326 Ga0157380_10003683 Ga0157380_100036833 178
606 3300014326 Ga0157380_10033618 Ga0157380_100336183 178
607 3300014326 Ga0157380_10322935 Ga0157380_103229351 178
608 3300014326 Ga0157380_10439200 Ga0157380_104392002 178
609 3300014326 Ga0157380_10459471 Ga0157380_104594712 178
610 3300014326 Ga0157380_11440374 Ga0157380_114403741 178
611 3300014745 Ga0157377_10125117 Ga0157377_101251172 178
612 3300014745 Ga0157377_10218091 Ga0157377_102180912 178
613 3300014745 Ga0157377_10377252 Ga0157377_103772522 178
614 3300014968 Ga0157379_10029693 Ga0157379_100296933 178
615 3300014968 Ga0157379_10164057 Ga0157379_101640572 178
616 3300015262 Ga0182007_10078466 Ga0182007_100784662 178
617 3300015687 Ga0183368_1007 Ga0183368_100730 178
618 3300021361 Ga0213872_10271181 Ga0213872_102711811 178
619 3300022467 Ga0224712_10470768 Ga0224712_104707681 178
620 3300025223 Ga0207672_1000044 Ga0207672_10000448 178
621 3300025242 Ga0209258_100514 Ga0209258_10051421 178
622 3300025246 Ga0209646_1003328 Ga0209646_10033284 178
623 3300025321 Ga0207656_10000435 Ga0207656_100004352 178
624 3300025321 Ga0207656_10069101 Ga0207656_100691012 178
625 3300025728 Ga0207655_1065876 Ga0207655_10658762 178
626 3300025885 Ga0207653_10007246 Ga0207653_100072462 178
627 3300025898 Ga0207692_10458129 Ga0207692_104581291 178
628 3300025900 Ga0207710_10000002 Ga0207710_10000002517 178
629 3300025900 Ga0207710_10000712 Ga0207710_1000071213 178
630 3300025900 Ga0207710_10218602 Ga0207710_102186022 178
631 3300025900 Ga0207710_10236004 Ga0207710_102360041 178
632 3300025903 Ga0207680_10342787 Ga0207680_103427872 178
633 3300025904 Ga0207647_10009295 Ga0207647_100092952 178
634 3300025904 Ga0207647_10242218 Ga0207647_102422182 178
635 3300025904 Ga0207647_10361231 Ga0207647_103612312 178
636 3300025906 Ga0207699_10009459 Ga0207699_100094592 178
637 3300025906 Ga0207699_10264667 Ga0207699_102646672 178
638 3300025906 Ga0207699_10560035 Ga0207699_105600351 178
639 3300025907 Ga0207645_10167070 Ga0207645_101670701 178
640 3300025908 Ga0207643_10003568 Ga0207643_100035688 178
641 3300025908 Ga0207643_10019112 Ga0207643_100191122 178
642 3300025908 Ga0207643_10033349 Ga0207643_100333491 178
643 3300025908 Ga0207643_10127972 Ga0207643_101279722 178
644 3300025908 Ga0207643_10538274 Ga0207643_105382742 178
645 3300025910 Ga0207684_10000023 Ga0207684_10000023243 178
646 3300025910 Ga0207684_10006459 Ga0207684_100064596 178
647 3300025910 Ga0207684_10059825 Ga0207684_100598252 178
648 3300025910 Ga0207684_10187296 Ga0207684_101872962 178
649 3300025910 Ga0207684_10395875 Ga0207684_103958752 178
650 3300025911 Ga0207654_10011787 Ga0207654_100117874 178
651 3300025911 Ga0207654_10142977 Ga0207654_101429771 178
652 3300025911 Ga0207654_10399469 Ga0207654_103994691 178
653 3300025911 Ga0207654_10555464 Ga0207654_105554642 178
654 3300025912 Ga0207707_10006189 Ga0207707_100061893 178
655 3300025912 Ga0207707_10103107 Ga0207707_101031072 178
656 3300025913 Ga0207695_10022156 Ga0207695_100221567 178
657 3300025913 Ga0207695_10081573 Ga0207695_100815735 178
658 3300025913 Ga0207695_10257839 Ga0207695_102578392 178
659 3300025914 Ga0207671_10213674 Ga0207671_102136741 178
660 3300025914 Ga0207671_10538258 Ga0207671_105382582 178
661 3300025914 Ga0207671_10539411 Ga0207671_105394111 178
662 3300025915 Ga0207693_10114005 Ga0207693_101140052 178
663 3300025916 Ga0207663_10280052 Ga0207663_102800521 178
664 3300025917 Ga0207660_10131779 Ga0207660_101317791 178
665 3300025918 Ga0207662_10066197 Ga0207662_100661972 178
666 3300025918 Ga0207662_10095667 Ga0207662_100956672 178
667 3300025918 Ga0207662_10198468 Ga0207662_101984682 178
668 3300025918 Ga0207662_10315853 Ga0207662_103158531 178
669 3300025919 Ga0207657_10000280 Ga0207657_1000028035 178
670 3300025920 Ga0207649_10009533 Ga0207649_100095331 178
671 3300025920 Ga0207649_10237887 Ga0207649_102378871 178
672 3300025922 Ga0207646_10016557 Ga0207646_100165578 178
673 3300025922 Ga0207646_10043621 Ga0207646_100436215 178
674 3300025922 Ga0207646_10475172 Ga0207646_104751722 178
675 3300025922 Ga0207646_10776394 Ga0207646_107763942 178
676 3300025922 Ga0207646_11058558 Ga0207646_110585581 178
677 3300025923 Ga0207681_10555322 Ga0207681_105553221 178
678 3300025923 Ga0207681_10863039 Ga0207681_108630391 178
679 3300025923 Ga0207681_11317037 Ga0207681_113170371 178
680 3300025924 Ga0207694_10011354 Ga0207694_100113542 178
681 3300025924 Ga0207694_10022706 Ga0207694_100227064 178
682 3300025924 Ga0207694_10035107 Ga0207694_100351072 178
683 3300025925 Ga0207650_10000001 Ga0207650_10000001613 178
684 3300025925 Ga0207650_10023968 Ga0207650_100239685 178
685 3300025925 Ga0207650_10099313 Ga0207650_100993133 178
686 3300025925 Ga0207650_10130429 Ga0207650_101304291 178
687 3300025925 Ga0207650_10366411 Ga0207650_103664111 178
688 3300025925 Ga0207650_10379874 Ga0207650_103798741 178
689 3300025926 Ga0207659_10435811 Ga0207659_104358112 178
690 3300025926 Ga0207659_10473252 Ga0207659_104732521 178
691 3300025927 Ga0207687_10873316 Ga0207687_108733161 178
692 3300025928 Ga0207700_10010740 Ga0207700_100107405 178
693 3300025929 Ga0207664_10001362 Ga0207664_100013629 178
694 3300025929 Ga0207664_11157279 Ga0207664_111572791 178
695 3300025931 Ga0207644_10000361 Ga0207644_100003615 178
696 3300025931 Ga0207644_10058072 Ga0207644_100580723 178
697 3300025931 Ga0207644_10470906 Ga0207644_104709061 178
698 3300025931 Ga0207644_10922902 Ga0207644_109229021 178
699 3300025932 Ga0207690_10010818 Ga0207690_100108184 178
700 3300025932 Ga0207690_10399452 Ga0207690_103994522 178
701 3300025933 Ga0207706_10021323 Ga0207706_100213238 178
702 3300025933 Ga0207706_10206847 Ga0207706_102068471 178
703 3300025933 Ga0207706_10427526 Ga0207706_104275262 178
704 3300025933 Ga0207706_10563676 Ga0207706_105636761 178
705 3300025933 Ga0207706_11103993 Ga0207706_111039931 178
706 3300025934 Ga0207686_10138337 Ga0207686_101383373 178
707 3300025934 Ga0207686_10221772 Ga0207686_102217721 178
708 3300025935 Ga0207709_10009296 Ga0207709_100092964 178
709 3300025935 Ga0207709_10116690 Ga0207709_101166901 178
710 3300025935 Ga0207709_10618375 Ga0207709_106183752 178
711 3300025936 Ga0207670_10003486 Ga0207670_100034863 178
712 3300025936 Ga0207670_10198204 Ga0207670_101982041 178
713 3300025936 Ga0207670_10275205 Ga0207670_102752051 178
714 3300025936 Ga0207670_10373555 Ga0207670_103735551 178
715 3300025936 Ga0207670_10614867 Ga0207670_106148671 178
716 3300025938 Ga0207704_10075464 Ga0207704_100754642 178
717 3300025938 Ga0207704_10174347 Ga0207704_101743472 178
718 3300025939 Ga0207665_10000016 Ga0207665_1000001618 178
719 3300025939 Ga0207665_10015894 Ga0207665_100158943 178
720 3300025939 Ga0207665_10039326 Ga0207665_100393261 178
721 3300025939 Ga0207665_10066328 Ga0207665_100663282 178
722 3300025939 Ga0207665_10626611 Ga0207665_106266111 178
723 3300025940 Ga0207691_10415586 Ga0207691_104155861 178
724 3300025940 Ga0207691_10431558 Ga0207691_104315582 178
725 3300025941 Ga0207711_10009655 Ga0207711_100096556 178
726 3300025941 Ga0207711_10014922 Ga0207711_100149224 178
727 3300025941 Ga0207711_10053183 Ga0207711_100531832 178
728 3300025941 Ga0207711_10081275 Ga0207711_100812752 178
729 3300025941 Ga0207711_10175630 Ga0207711_101756302 178
730 3300025941 Ga0207711_10219526 Ga0207711_102195262 178
731 3300025941 Ga0207711_10275463 Ga0207711_102754631 178
732 3300025941 Ga0207711_10833699 Ga0207711_108336992 178
733 3300025942 Ga0207689_10008982 Ga0207689_100089823 178
734 3300025942 Ga0207689_10047734 Ga0207689_100477342 178
735 3300025942 Ga0207689_10260947 Ga0207689_102609472 178
736 3300025942 Ga0207689_10306925 Ga0207689_103069252 178
737 3300025942 Ga0207689_10375712 Ga0207689_103757122 178
738 3300025942 Ga0207689_10573920 Ga0207689_105739201 178
739 3300025945 Ga0207679_10064776 Ga0207679_100647762 178
740 3300025945 Ga0207679_10065737 Ga0207679_100657373 178
741 3300025945 Ga0207679_10243330 Ga0207679_102433301 178
742 3300025945 Ga0207679_10521722 Ga0207679_105217222 178
743 3300025945 Ga0207679_10982190 Ga0207679_109821902 178
744 3300025949 Ga0207667_10011264 Ga0207667_1001126413 178
745 3300025949 Ga0207667_10542772 Ga0207667_105427721 178
746 3300025960 Ga0207651_10003639 Ga0207651_100036397 178
747 3300025960 Ga0207651_10051736 Ga0207651_100517362 178
748 3300025960 Ga0207651_10227926 Ga0207651_102279262 178
749 3300025960 Ga0207651_10283482 Ga0207651_102834821 178
750 3300025960 Ga0207651_10610584 Ga0207651_106105842 178
751 3300025960 Ga0207651_10905057 Ga0207651_109050571 178
752 3300025960 Ga0207651_11059092 Ga0207651_110590921 178
753 3300025961 Ga0207712_10000062 Ga0207712_1000006294 178
754 3300025961 Ga0207712_10415915 Ga0207712_104159152 178
755 3300025961 Ga0207712_10694436 Ga0207712_106944361 178
756 3300025961 Ga0207712_10780480 Ga0207712_107804801 178
757 3300025972 Ga0207668_10042028 Ga0207668_100420282 178
758 3300025972 Ga0207668_10780272 Ga0207668_107802721 178
759 3300025986 Ga0207658_10055866 Ga0207658_100558662 178
760 3300025986 Ga0207658_10680772 Ga0207658_106807721 178
761 3300026023 Ga0207677_10071930 Ga0207677_100719302 178
762 3300026023 Ga0207677_10646056 Ga0207677_106460562 178
763 3300026035 Ga0207703_10000984 Ga0207703_1000098420 178
764 3300026035 Ga0207703_10153812 Ga0207703_101538121 178
765 3300026035 Ga0207703_10209592 Ga0207703_102095922 178
766 3300026035 Ga0207703_10211205 Ga0207703_102112052 178
767 3300026035 Ga0207703_10298701 Ga0207703_102987011 178
768 3300026035 Ga0207703_10858277 Ga0207703_108582771 178
769 3300026035 Ga0207703_11408925 Ga0207703_114089251 178
770 3300026041 Ga0207639_10025450 Ga0207639_100254505 178
771 3300026041 Ga0207639_10304805 Ga0207639_103048052 178
772 3300026041 Ga0207639_11232040 Ga0207639_112320401 178
773 3300026075 Ga0207708_10000140 Ga0207708_100001408 178
774 3300026075 Ga0207708_10013923 Ga0207708_100139232 178
775 3300026075 Ga0207708_10060870 Ga0207708_100608702 178
776 3300026075 Ga0207708_10226310 Ga0207708_102263102 178
777 3300026075 Ga0207708_10562333 Ga0207708_105623331 178
778 3300026075 Ga0207708_10748849 Ga0207708_107488492 178
779 3300026075 Ga0207708_11342185 Ga0207708_113421851 178
780 3300026088 Ga0207641_10009934 Ga0207641_100099345 178
781 3300026088 Ga0207641_10207315 Ga0207641_102073152 178
782 3300026088 Ga0207641_10280722 Ga0207641_102807222 178
783 3300026088 Ga0207641_10314545 Ga0207641_103145451 178
784 3300026088 Ga0207641_10443707 Ga0207641_104437072 178
785 3300026088 Ga0207641_11262398 Ga0207641_112623981 178
786 3300026088 Ga0207641_11283787 Ga0207641_112837871 178
787 3300026089 Ga0207648_10016442 Ga0207648_100164426 178
788 3300026089 Ga0207648_10135374 Ga0207648_101353743 178
789 3300026089 Ga0207648_10350608 Ga0207648_103506082 178
790 3300026089 Ga0207648_10975296 Ga0207648_109752961 178
791 3300026089 Ga0207648_11089952 Ga0207648_110899521 178
792 3300026089 Ga0207648_11577553 Ga0207648_115775531 178
793 3300026095 Ga0207676_10073035 Ga0207676_100730351 178
794 3300026095 Ga0207676_10093370 Ga0207676_100933703 178
795 3300026095 Ga0207676_10105455 Ga0207676_101054552 178
796 3300026095 Ga0207676_10132636 Ga0207676_101326362 178
797 3300026095 Ga0207676_10178978 Ga0207676_101789782 178
798 3300026095 Ga0207676_10279097 Ga0207676_102790972 178
799 3300026095 Ga0207676_10312241 Ga0207676_103122412 178
800 3300026095 Ga0207676_10733658 Ga0207676_107336582 178
801 3300026095 Ga0207676_11209690 Ga0207676_112096901 178
802 3300026116 Ga0207674_10003855 Ga0207674_100038555 178
803 3300026116 Ga0207674_10117261 Ga0207674_101172611 178
804 3300026116 Ga0207674_10176796 Ga0207674_101767962 178
805 3300026116 Ga0207674_10214297 Ga0207674_102142972 178
806 3300026116 Ga0207674_10219803 Ga0207674_102198031 178
807 3300026116 Ga0207674_10672246 Ga0207674_106722461 178
808 3300026116 Ga0207674_10676896 Ga0207674_106768961 178
809 3300026118 Ga0207675_100010219 Ga0207675_1000102194 178
810 3300026118 Ga0207675_100077302 Ga0207675_1000773022 178
811 3300026118 Ga0207675_100218837 Ga0207675_1002188372 178
812 3300026118 Ga0207675_100272838 Ga0207675_1002728382 178
813 3300026118 Ga0207675_100294960 Ga0207675_1002949602 178
814 3300026118 Ga0207675_100380249 Ga0207675_1003802491 178
815 3300026118 Ga0207675_100902531 Ga0207675_1009025312 178
816 3300026142 Ga0207698_10069935 Ga0207698_100699352 178
817 3300026142 Ga0207698_10332881 Ga0207698_103328812 178
818 3300027907 Ga0207428_10001041 Ga0207428_1000104123 178
819 3300027907 Ga0207428_10003044 Ga0207428_100030448 178
820 3300027907 Ga0207428_10029734 Ga0207428_100297342 178
821 3300028379 Ga0268266_10726304 Ga0268266_107263041 178
822 3300028379 Ga0268266_11583857 Ga0268266_115838571 178
823 3300028380 Ga0268265_10125228 Ga0268265_101252282 178
824 3300028380 Ga0268265_10229980 Ga0268265_102299802 178
825 3300028380 Ga0268265_10458871 Ga0268265_104588711 178
826 3300028380 Ga0268265_11006480 Ga0268265_110064801 178
827 3300028380 Ga0268265_11076079 Ga0268265_110760791 178
828 3300028381 Ga0268264_10008535 Ga0268264_100085353 178
829 3300028381 Ga0268264_10009716 Ga0268264_100097162 178
830 3300028381 Ga0268264_10058444 Ga0268264_100584443 178
831 3300028381 Ga0268264_10081216 Ga0268264_100812162 178
832 3300028381 Ga0268264_10228572 Ga0268264_102285722 178
833 3300028381 Ga0268264_10418952 Ga0268264_104189522 178
834 3300028381 Ga0268264_10905640 Ga0268264_109056402 178
835 3300028381 Ga0268264_11240574 Ga0268264_112405741 178
836 3300028381 Ga0268264_11381592 Ga0268264_113815921 178
837 3300028573 Ga0265334_10001357 Ga0265334_100013574 178
838 3300028800 Ga0265338_10048936 Ga0265338_100489363 178
839 3300028800 Ga0265338_10520583 Ga0265338_105205831 178
840 3300030732 Ga0316176_1130389 Ga0316176_11303891 178
841 3300030733 Ga0314311_1028727 Ga0314311_10287271 178
842 3300031239 Ga0265328_10000854 Ga0265328_100008544 178
843 3300031247 Ga0265340_10017215 Ga0265340_100172152 178
844 3300031250 Ga0265331_10000030 Ga0265331_10000030182 178
845 3300031251 Ga0265327_10000072 Ga0265327_10000072183 178
846 3300031548 Ga0307408_100004227 Ga0307408_10000422710 178
847 3300031548 Ga0307408_100018526 Ga0307408_1000185268 178
848 3300031548 Ga0307408_100032977 Ga0307408_1000329772 178
849 3300031548 Ga0307408_100279032 Ga0307408_1002790321 178
850 3300031731 Ga0307405_10030805 Ga0307405_100308053 178
851 3300031731 Ga0307405_10113596 Ga0307405_101135962 178
852 3300031731 Ga0307405_10125759 Ga0307405_101257592 178
853 3300031731 Ga0307405_10246354 Ga0307405_102463541 178
854 3300031731 Ga0307405_10608239 Ga0307405_106082391 178
855 3300031731 Ga0307405_10838416 Ga0307405_108384162 178
856 3300031824 Ga0307413_10022482 Ga0307413_100224822 178
857 3300031824 Ga0307413_10158269 Ga0307413_101582692 178
858 3300031824 Ga0307413_10591035 Ga0307413_105910351 178
859 3300031852 Ga0307410_10001989 Ga0307410_1000198910 178
860 3300031852 Ga0307410_10003886 Ga0307410_100038867 178
861 3300031901 Ga0307406_10003011 Ga0307406_100030112 178
862 3300031901 Ga0307406_10140290 Ga0307406_101402902 178
863 3300031901 Ga0307406_10212555 Ga0307406_102125551 178
864 3300031901 Ga0307406_10238003 Ga0307406_102380032 178
865 3300031903 Ga0307407_10165651 Ga0307407_101656511 178
866 3300031903 Ga0307407_10448961 Ga0307407_104489611 178
867 3300031903 Ga0307407_10522356 Ga0307407_105223562 178
868 3300031911 Ga0307412_10023786 Ga0307412_100237863 178
869 3300031911 Ga0307412_10046598 Ga0307412_100465982 178
870 3300031911 Ga0307412_10141357 Ga0307412_101413572 178
871 3300031911 Ga0307412_10203296 Ga0307412_102032963 178
872 3300031995 Ga0307409_100237658 Ga0307409_1002376583 178
873 3300031995 Ga0307409_100494874 Ga0307409_1004948742 178
874 3300031995 Ga0307409_101005683 Ga0307409_1010056831 178
875 3300032002 Ga0307416_100002359 Ga0307416_10000235910 178
876 3300032002 Ga0307416_100038595 Ga0307416_1000385954 178
877 3300032002 Ga0307416_100064850 Ga0307416_1000648502 178
878 3300032002 Ga0307416_100225052 Ga0307416_1002250522 178
879 3300032002 Ga0307416_100273485 Ga0307416_1002734852 178
880 3300032002 Ga0307416_101058246 Ga0307416_1010582461 178
881 3300032004 Ga0307414_10001197 Ga0307414_1000119711 178
882 3300032004 Ga0307414_10006403 Ga0307414_100064036 178
883 3300032004 Ga0307414_10403984 Ga0307414_104039841 178
884 3300032005 Ga0307411_10050650 Ga0307411_100506502 178
885 3300032005 Ga0307411_10059787 Ga0307411_100597873 178
886 3300032005 Ga0307411_10280203 Ga0307411_102802032 178
887 3300032005 Ga0307411_10460458 Ga0307411_104604581 178
888 3300032126 Ga0307415_100001481 Ga0307415_1000014812 178
889 3300032126 Ga0307415_100018231 Ga0307415_1000182312 178
890 3300032126 Ga0307415_100058947 Ga0307415_1000589473 178
891 3300032126 Ga0307415_100088632 Ga0307415_1000886323 178
892 3300032126 Ga0307415_100115495 Ga0307415_1001154952 178
893 3300032126 Ga0307415_100196086 Ga0307415_1001960862 178
894 3300032126 Ga0307415_100527952 Ga0307415_1005279521 178
895 3300035088 Ga0373940_0059544 Ga0373940_0059544_49_585 178
896 3300035090 Ga0373949_0098902 Ga0373949_0098902_211_747 178
897 3300035091 Ga0373951_0001292 Ga0373951_0001292_689_1225 178
898 3300035115 Ga0373941_0030733 Ga0373941_0030733_544_1080 178
899 3300035207 Ga0373942_0021212 Ga0373942_0021212_397_933 178
900 3300035398 Ga0316574_0357761 Ga0316574_0357761_135_677 178
901 3300035691 Ga0373931_0236293 Ga0373931_0236293_277_813 178
902 3300037466 Ga0395898_0161546 Ga0395898_0161546_1312_1848 178
903 3300037466 Ga0395898_0221400 Ga0395898_0221400_327_863 178
904 3300037466 Ga0395898_0441795 Ga0395898_0441795_317_853 178
905 3300038443 Ga0395901_0238369 Ga0395901_0238369_171_707 178
906 3300038698 Ga0242419_000693 Ga0242419_000693_364_900 178
907 3300038699 Ga0242422_06711 Ga0242422_06711_74_610 178
908 3300038996 Ga0242420_013632 Ga0242420_013632_72_608 178
909 3300038996 Ga0242420_047502 Ga0242420_047502_132_668 178
910 3300039447 Ga0436361_0161734 Ga0436361_0161734_185_751 178
911 3300041406 Ga0439439_0127717 Ga0439439_0127717_62_604 178
912 3300041999 Ga0439433_0046428 Ga0439433_0046428_43_603 178
913 3300042013 Ga0439456_000204 Ga0439456_000204_6769_7305 178
914 3300042015 Ga0439462_0121958 Ga0439462_0121958_158_700 178
915 3300042436 Ga0439435_0038734 Ga0439435_0038734_355_909 178
916 3300042439 Ga0439464_0103462 Ga0439464_0103462_129_665 178
917 3300045051 Ga0451576_0672149 Ga0451576_0672149_298_867 178
918 3300045836 Ga0466958_0176982 Ga0466958_0176982_766_1338 178
919 3300045976 Ga0466967_0329605 Ga0466967_0329605_78_641 178
920 3300046472 Ga0495580_0088546 Ga0495580_0088546_425_1039 178
921 3300046507 Ga0495606_0029497 Ga0495606_0029497_3253_3807 178
922 3300046539 Ga0495621_0026687 Ga0495621_0026687_836_1375 178
923 3300046615 Ga0495656_0083028 Ga0495656_0083028_743_1282 178
924 3300046660 Ga0495625_0551197 Ga0495625_0551197_63_599 178
925 3300046691 Ga0495670_0085173 Ga0495670_0085173_36_575 178
926 3300048905 Ga0496102_0663809 Ga0496102_0663809_224_760 178
927 3300048905 Ga0496102_0987272 Ga0496102_0987272_195_731 178
928 3300048906 Ga0496103_0084302 Ga0496103_0084302_604_1140 178
929 3300048907 Ga0496104_0138261 Ga0496104_0138261_211_747 178
930 3300048907 Ga0496104_0887866 Ga0496104_0887866_118_654 178
931 3300048910 Ga0496107_0029503 Ga0496107_0029503_945_1481 178
932 3300048911 Ga0496108_0232292 Ga0496108_0232292_266_802 178
933 3300048912 Ga0496109_0877594 Ga0496109_0877594_209_745 178
934 3300048913 Ga0496110_0231470 Ga0496110_0231470_834_1370 178
935 3300048913 Ga0496110_0332117 Ga0496110_0332117_352_888 178
936 3300048914 Ga0496111_0469776 Ga0496111_0469776_277_813 178
937 3300048915 Ga0496112_0440478 Ga0496112_0440478_455_991 178
938 3300048915 Ga0496112_0793224 Ga0496112_0793224_92_628 178
939 3300048915 Ga0496112_0871200 Ga0496112_0871200_268_804 178
940 3300048915 Ga0496112_1005167 Ga0496112_1005167_43_579 178
941 3300048915 Ga0496112_1082789 Ga0496112_1082789_47_583 178
942 3300048916 Ga0496113_0213745 Ga0496113_0213745_958_1494 178
943 3300048916 Ga0496113_0394737 Ga0496113_0394737_28_564 178
944 3300048917 Ga0496114_0109384 Ga0496114_0109384_718_1314 178
945 3300048919 Ga0496116_0055085 Ga0496116_0055085_1892_2440 178
946 3300048919 Ga0496116_0058859 Ga0496116_0058859_525_1073 178
947 3300048924 Ga0496121_0113622 Ga0496121_0113622_675_1223 178
948 3300048925 Ga0496122_0000498 Ga0496122_0000498_45551_46099 178
949 3300048926 Ga0496123_0000390 Ga0496123_0000390_45623_46171 178
950 3300048927 Ga0496124_0334408 Ga0496124_0334408_15_563 178
951 3300048928 Ga0496125_0032385 Ga0496125_0032385_320_868 178
952 3300048929 Ga0496126_0061625 Ga0496126_0061625_2362_2910 178
953 3300049513 Ga0501290_047347 Ga0501290_047347_59_595 178
954 3300049514 Ga0501291_004115 Ga0501291_004115_1252_1788 178
955 3300049515 Ga0501292_003109 Ga0501292_003109_1526_2062 178
956 3300049515 Ga0501292_004100 Ga0501292_004100_570_1106 178
957 3300049519 Ga0501296_002821 Ga0501296_002821_1117_1653 178
958 3300049520 Ga0501297_003203 Ga0501297_003203_228_764 178
959 3300049520 Ga0501297_003302 Ga0501297_003302_770_1306 178
960 3300049521 Ga0501298_000903 Ga0501298_000903_2272_2808 178
961 3300049521 Ga0501298_117794 Ga0501298_117794_33_587 178
962 3300049522 Ga0501299_001032 Ga0501299_001032_1141_1677 178
963 3300049526 Ga0501303_001306 Ga0501303_001306_836_1372 178
964 3300049533 Ga0501317_064519 Ga0501317_064519_31_585 178
965 3300049551 Ga0501335_032941 Ga0501335_032941_40_576 178
966 3300049572 Ga0501036_0474141 Ga0501036_0474141_94_666 178
967 3300049576 Ga0501040_0681836 Ga0501040_0681836_75_611 178
968 3300049588 Ga0501072_0888955 Ga0501072_0888955_117_656 178
969 3300049649 Ga0501198_005139 Ga0501198_005139_547_1083 178
970 3300049650 Ga0501199_012462 Ga0501199_012462_242_778 178
971 3300049651 Ga0501201_002710 Ga0501201_002710_605_1141 178
972 3300049652 Ga0501202_000495 Ga0501202_000495_5094_5630 178
973 3300049652 Ga0501202_004022 Ga0501202_004022_1134_1670 178
974 3300049652 Ga0501202_009648 Ga0501202_009648_374_910 178
975 3300049652 Ga0501202_154852 Ga0501202_154852_50_586 178
976 3300049653 Ga0501206_002594 Ga0501206_002594_845_1381 178
977 3300049653 Ga0501206_007186 Ga0501206_007186_709_1245 178
978 3300049654 Ga0501207_000159 Ga0501207_000159_880_1416 178
979 3300049655 Ga0501208_004728 Ga0501208_004728_645_1181 178
980 3300049656 Ga0501209_018149 Ga0501209_018149_607_1143 178
981 3300049659 Ga0501214_013098 Ga0501214_013098_212_748 178
982 3300049660 Ga0501216_006308 Ga0501216_006308_567_1103 178
983 3300049660 Ga0501216_007014 Ga0501216_007014_497_1033 178
984 3300049660 Ga0501216_015025 Ga0501216_015025_91_627 178
985 3300049661 Ga0501217_000993 Ga0501217_000993_3405_3941 178
986 3300049661 Ga0501217_004888 Ga0501217_004888_1443_1979 178
987 3300049661 Ga0501217_012178 Ga0501217_012178_159_695 178
988 3300049663 Ga0501223_001016 Ga0501223_001016_198_734 178
989 3300049663 Ga0501223_026919 Ga0501223_026919_249_785 178
990 3300049664 Ga0501224_000580 Ga0501224_000580_429_965 178
991 3300049664 Ga0501224_003979 Ga0501224_003979_232_768 178
992 3300049665 Ga0501227_002026 Ga0501227_002026_3525_4061 178
993 3300049667 Ga0501230_003396 Ga0501230_003396_558_1094 178
994 3300049667 Ga0501230_014788 Ga0501230_014788_128_664 178
995 3300049667 Ga0501230_054091 Ga0501230_054091_162_716 178
996 3300049668 Ga0501233_003063 Ga0501233_003063_1714_2250 178
997 3300049668 Ga0501233_019041 Ga0501233_019041_170_706 178
998 3300049668 Ga0501233_035393 Ga0501233_035393_122_676 178
999 3300049669 Ga0501235_011130 Ga0501235_011130_252_788 178
1000 3300049669 Ga0501235_040064 Ga0501235_040064_400_936 178
1001 3300049669 Ga0501235_044273 Ga0501235_044273_137_673 178
1002 3300049670 Ga0501236_013070 Ga0501236_013070_85_621 178
1003 3300049670 Ga0501236_023450 Ga0501236_023450_31_567 178
1004 3300049670 Ga0501236_024666 Ga0501236_024666_230_766 178
1005 3300049671 Ga0501238_029156 Ga0501238_029156_241_777 178
1006 3300049672 Ga0501239_048721 Ga0501239_048721_15_569 178
1007 3300049675 Ga0501243_002081 Ga0501243_002081_1850_2386 178
1008 3300049675 Ga0501243_006636 Ga0501243_006636_654_1190 178
1009 3300049675 Ga0501243_090328 Ga0501243_090328_28_564 178
1010 3300049679 Ga0501249_005865 Ga0501249_005865_736_1272 178
1011 3300049679 Ga0501249_012720 Ga0501249_012720_578_1114 178
1012 3300049685 Ga0501256_003405 Ga0501256_003405_312_848 178
1013 3300049685 Ga0501256_028920 Ga0501256_028920_17_553 178
1014 3300049686 Ga0501257_006949 Ga0501257_006949_918_1454 178
1015 3300049688 Ga0501259_124398 Ga0501259_124398_41_577 178
1016 3300049703 Ga0501219_009680 Ga0501219_009680_91_627 178
1017 3300049704 Ga0501221_006347 Ga0501221_006347_564_1100 178
1018 3300049704 Ga0501221_034026 Ga0501221_034026_497_1033 178
1019 3300049704 Ga0501221_157040 Ga0501221_157040_30_584 178
1020 3300049705 Ga0501225_0003735 Ga0501225_0003735_970_1506 178
1021 3300049705 Ga0501225_0015602 Ga0501225_0015602_1213_1749 178
1022 3300049705 Ga0501225_0064310 Ga0501225_0064310_104_658 178
1023 3300049706 Ga0501229_021164 Ga0501229_021164_199_735 178
1024 3300049707 Ga0501234_004733 Ga0501234_004733_742_1278 178
1025 3300049707 Ga0501234_015274 Ga0501234_015274_54_590 178
1026 3300049758 Ga0501241_031018 Ga0501241_031018_116_652 178
1027 3300049760 Ga0501263_038682 Ga0501263_038682_109_663 178
1028 3300049761 Ga0501264_011341 Ga0501264_011341_267_821 178
1029 3300049762 Ga0501265_045254 Ga0501265_045254_56_592 178
1030 3300049766 Ga0501269_046627 Ga0501269_046627_10_564 178
1031 3300049770 Ga0501273_002267 Ga0501273_002267_69_605 178
1032 3300049771 Ga0501274_037803 Ga0501274_037803_11_547 178
1033 3300049775 Ga0501279_006371 Ga0501279_006371_380_916 178
1034 3300049779 Ga0501283_000823 Ga0501283_000823_2543_3079 178
1035 3300049779 Ga0501283_007508 Ga0501283_007508_573_1109 178
1036 3300049779 Ga0501283_009547 Ga0501283_009547_17_553 178
1037 3300049851 Ga0501212_014682 Ga0501212_014682_156_692 178
1038 3300049853 Ga0501226_002034 Ga0501226_002034_1442_1978 178
1039 3300050491 nmdc:mga00v17_97591_c1 nmdc:mga00v17_97591_c1_1032_1583 178
1040 3300050507 nmdc:mga05p37_215389_c1 nmdc:mga05p37_215389_c1_1666_2202 178
1041 3300050507 nmdc:mga05p37_291211_c1 nmdc:mga05p37_291211_c1_295_831 178
1042 3300050507 nmdc:mga05p37_478470_c1 nmdc:mga05p37_478470_c1_752_1288 178
1043 3300050507 nmdc:mga05p37_522147_c1 nmdc:mga05p37_522147_c1_420_956 178
1044 3300050507 nmdc:mga05p37_90114_c1 nmdc:mga05p37_90114_c1_1854_2390 178
1045 3300050507 nmdc:mga05p37_9215_c2 nmdc:mga05p37_9215_c2_4453_4989 178
1046 3300050508 nmdc:mga09592_114041_c1 nmdc:mga09592_114041_c1_442_996 178
1047 3300050508 nmdc:mga09592_176407_c1 nmdc:mga09592_176407_c1_196_774 178
1048 3300050508 nmdc:mga09592_687476_c1 nmdc:mga09592_687476_c1_315_851 178
1049 3300050508 nmdc:mga09592_843651_c1 nmdc:mga09592_843651_c1_110_652 178
1050 3300050509 nmdc:mga0qj67_10316_c1 nmdc:mga0qj67_10316_c1_186_722 178
1051 3300050510 nmdc:mga06r32_237871_c1 nmdc:mga06r32_237871_c1_16_552 178
1052 3300050510 nmdc:mga06r32_704538_c1 nmdc:mga06r32_704538_c1_405_941 178
1053 3300050510 nmdc:mga06r32_776833_c1 nmdc:mga06r32_776833_c1_364_900 178
1054 3300050510 nmdc:mga06r32_929031_c1 nmdc:mga06r32_929031_c1_76_630 178
1055 3300050511 nmdc:mga08y16_1100_c1 nmdc:mga08y16_1100_c1_4226_4804 178
1056 3300050511 nmdc:mga08y16_6735_c1 nmdc:mga08y16_6735_c1_976_1512 178
1057 3300050512 nmdc:mga0n895_1014101_c1 nmdc:mga0n895_1014101_c1_260_796 178
1058 3300050512 nmdc:mga0n895_125202_c1 nmdc:mga0n895_125202_c1_234_770 178
1059 3300050512 nmdc:mga0n895_534865_c1 nmdc:mga0n895_534865_c1_298_834 178
1060 3300050512 nmdc:mga0n895_69738_c1 nmdc:mga0n895_69738_c1_654_1190 178
1061 3300050512 nmdc:mga0n895_73201_c1 nmdc:mga0n895_73201_c1_1458_1994 178
1062 3300050513 nmdc:mga0rr50_40020_c1 nmdc:mga0rr50_40020_c1_2310_2846 178
1063 3300050514 nmdc:mga08x19_23014_c2 nmdc:mga08x19_23014_c2_231_767 178
1064 3300050515 nmdc:mga0a205_1124588_c1 nmdc:mga0a205_1124588_c1_80_616 178
1065 3300050515 nmdc:mga0a205_156563_c1 nmdc:mga0a205_156563_c1_1160_1696 178
1066 3300050515 nmdc:mga0a205_22271_c1 nmdc:mga0a205_22271_c1_2810_3346 178
1067 3300050515 nmdc:mga0a205_426536_c1 nmdc:mga0a205_426536_c1_189_725 178
1068 3300050515 nmdc:mga0a205_587112_c1 nmdc:mga0a205_587112_c1_55_591 178
1069 3300050515 nmdc:mga0a205_64748_c1 nmdc:mga0a205_64748_c1_17_553 178
1070 3300054114 Ga0501084_1012670 Ga0501084_1012670_51_587 178
1071 3300059492 Ga0587073_0056194 Ga0587073_0056194_136_672 178
1072 3300059493 Ga0587077_094669 Ga0587077_094669_156_692 178
1073 3300061734 Ga0530510_0112879 Ga0530510_0112879_228_764 178
1074 iso_pu_bacteria 2576861471 2578457412 178
1075 iso_pu_bacteria 2643221593 2643976631 178
1076 iso_pu_bacteria 2939589442 2939591317 178
1077 iso_pu_bacteria 2939622612 2939625824 178
1078 iso_pu_bacteria 2974307012 2974308036 178
1079 iso_pu_bacteria 2977247770 2977248769 178
1080 iso_pu_bacteria 2984514374 2984516758 178
1081 2162886012 MBSR1b_contig_1669793 MBSR1b_0881.00001940 179
1082 3300005293 Ga0065715_10090385 Ga0065715_100903852 179
1083 3300005293 Ga0065715_10250944 Ga0065715_102509442 179
1084 3300005295 Ga0065707_10430364 Ga0065707_104303642 179
1085 3300005328 Ga0070676_10009358 Ga0070676_100093584 179
1086 3300005330 Ga0070690_100000480 Ga0070690_10000048015 179
1087 3300005330 Ga0070690_100006857 Ga0070690_1000068576 179
1088 3300005331 Ga0070670_100013880 Ga0070670_10001388011 179
1089 3300005331 Ga0070670_100064955 Ga0070670_1000649554 179
1090 3300005334 Ga0068869_100002415 Ga0068869_10000241511 179
1091 3300005334 Ga0068869_100007284 Ga0068869_1000072846 179
1092 3300005335 Ga0070666_10002449 Ga0070666_1000244912 179
1093 3300005335 Ga0070666_10187027 Ga0070666_101870272 179
1094 3300005338 Ga0068868_100010297 Ga0068868_1000102972 179
1095 3300005338 Ga0068868_100079907 Ga0068868_1000799072 179
1096 3300005340 Ga0070689_100347476 Ga0070689_1003474762 179
1097 3300005344 Ga0070661_100257591 Ga0070661_1002575912 179
1098 3300005347 Ga0070668_100078425 Ga0070668_1000784255 179
1099 3300005353 Ga0070669_100007482 Ga0070669_1000074824 179
1100 3300005353 Ga0070669_100450112 Ga0070669_1004501121 179
1101 3300005354 Ga0070675_100004808 Ga0070675_1000048083 179
1102 3300005355 Ga0070671_100051022 Ga0070671_1000510222 179
1103 3300005356 Ga0070674_100312747 Ga0070674_1003127472 179
1104 3300005364 Ga0070673_100000406 Ga0070673_1000004068 179
1105 3300005364 Ga0070673_100090652 Ga0070673_1000906524 179
1106 3300005365 Ga0070688_100074012 Ga0070688_1000740123 179
1107 3300005367 Ga0070667_100006866 Ga0070667_1000068668 179
1108 3300005436 Ga0070713_101123560 Ga0070713_1011235601 179
1109 3300005438 Ga0070701_10215987 Ga0070701_102159872 179
1110 3300005440 Ga0070705_100171787 Ga0070705_1001717872 179
1111 3300005441 Ga0070700_100180380 Ga0070700_1001803802 179
1112 3300005441 Ga0070700_100205862 Ga0070700_1002058621 179
1113 3300005444 Ga0070694_100070041 Ga0070694_1000700412 179
1114 3300005444 Ga0070694_100463457 Ga0070694_1004634572 179
1115 3300005456 Ga0070678_100000191 Ga0070678_1000001913 179
1116 3300005456 Ga0070678_100024274 Ga0070678_1000242743 179
1117 3300005459 Ga0068867_100007154 Ga0068867_1000071543 179
1118 3300005459 Ga0068867_100042871 Ga0068867_1000428714 179
1119 3300005467 Ga0070706_100934018 Ga0070706_1009340182 179
1120 3300005468 Ga0070707_100578974 Ga0070707_1005789742 179
1121 3300005471 Ga0070698_100037444 Ga0070698_1000374442 179
1122 3300005543 Ga0070672_100008446 Ga0070672_1000084461 179
1123 3300005543 Ga0070672_100203658 Ga0070672_1002036584 179
1124 3300005545 Ga0070695_100407901 Ga0070695_1004079012 179
1125 3300005545 Ga0070695_100816478 Ga0070695_1008164781 179
1126 3300005545 Ga0070695_100831977 Ga0070695_1008319771 179
1127 3300005546 Ga0070696_100118397 Ga0070696_1001183972 179
1128 3300005548 Ga0070665_100004101 Ga0070665_10000410119 179
1129 3300005548 Ga0070665_100009320 Ga0070665_1000093206 179
1130 3300005549 Ga0070704_100044483 Ga0070704_1000444834 179
1131 3300005549 Ga0070704_100047394 Ga0070704_1000473941 179
1132 3300005549 Ga0070704_101263994 Ga0070704_1012639941 179
1133 3300005617 Ga0068859_100014358 Ga0068859_10001435810 179
1134 3300005617 Ga0068859_100141890 Ga0068859_1001418902 179
1135 3300005617 Ga0068859_100171464 Ga0068859_1001714644 179
1136 3300005618 Ga0068864_100005931 Ga0068864_10000593119 179
1137 3300005718 Ga0068866_10058763 Ga0068866_100587632 179
1138 3300005718 Ga0068866_10164459 Ga0068866_101644592 179
1139 3300005719 Ga0068861_100012199 Ga0068861_1000121994 179
1140 3300005840 Ga0068870_10086474 Ga0068870_100864743 179
1141 3300005841 Ga0068863_100000618 Ga0068863_10000061813 179
1142 3300005842 Ga0068858_100001007 Ga0068858_10000100725 179
1143 3300005842 Ga0068858_100048188 Ga0068858_1000481882 179
1144 3300005843 Ga0068860_100000744 Ga0068860_1000007445 179
1145 3300005843 Ga0068860_100291757 Ga0068860_1002917571 179
1146 3300005844 Ga0068862_100747706 Ga0068862_1007477062 179
1147 3300006237 Ga0097621_100006203 Ga0097621_1000062039 179
1148 3300006358 Ga0068871_100000995 Ga0068871_10000099510 179
1149 3300006844 Ga0075428_100044431 Ga0075428_1000444315 179
1150 3300006852 Ga0075433_10066961 Ga0075433_100669612 179
1151 3300006880 Ga0075429_100000233 Ga0075429_10000023319 179
1152 3300006881 Ga0068865_100214921 Ga0068865_1002149212 179
1153 3300006931 Ga0097620_100014358 Ga0097620_1000143587 179
1154 3300006931 Ga0097620_100141883 Ga0097620_1001418832 179
1155 3300006931 Ga0097620_100171463 Ga0097620_1001714634 179
1156 3300007076 Ga0075435_100133137 Ga0075435_1001331373 179
1157 3300009094 Ga0111539_11980174 Ga0111539_119801741 179
1158 3300009094 Ga0111539_12030869 Ga0111539_120308692 179
1159 3300009098 Ga0105245_10418195 Ga0105245_104181951 179
1160 3300009147 Ga0114129_10080988 Ga0114129_100809886 179
1161 3300009147 Ga0114129_10084023 Ga0114129_100840231 179
1162 3300009148 Ga0105243_11390051 Ga0105243_113900511 179
1163 3300009174 Ga0105241_10916610 Ga0105241_109166102 179
1164 3300009177 Ga0105248_10185451 Ga0105248_101854512 179
1165 3300009177 Ga0105248_10546673 Ga0105248_105466732 179
1166 3300009553 Ga0105249_10560986 Ga0105249_105609861 179
1167 3300009553 Ga0105249_10805328 Ga0105249_108053281 179
1168 3300013296 Ga0157374_10010521 Ga0157374_1001052112 179
1169 3300013297 Ga0157378_10029854 Ga0157378_100298542 179
1170 3300013306 Ga0163162_10000770 Ga0163162_1000077030 179
1171 3300013308 Ga0157375_10003568 Ga0157375_1000356820 179
1172 3300014326 Ga0157380_10026332 Ga0157380_100263322 179
1173 3300014968 Ga0157379_10011763 Ga0157379_1001176314 179
1174 3300017792 Ga0163161_10029878 Ga0163161_100298784 179
1175 3300025315 Ga0207697_10010377 Ga0207697_100103771 179
1176 3300025901 Ga0207688_10397091 Ga0207688_103970912 179
1177 3300025903 Ga0207680_10007010 Ga0207680_100070108 179
1178 3300025903 Ga0207680_10299415 Ga0207680_102994152 179
1179 3300025907 Ga0207645_10000539 Ga0207645_100005396 179
1180 3300025908 Ga0207643_10019005 Ga0207643_100190054 179
1181 3300025909 Ga0207705_10447491 Ga0207705_104474911 179
1182 3300025918 Ga0207662_10008249 Ga0207662_100082493 179
1183 3300025923 Ga0207681_10017485 Ga0207681_100174855 179
1184 3300025923 Ga0207681_10021616 Ga0207681_100216166 179
1185 3300025923 Ga0207681_10425731 Ga0207681_104257312 179
1186 3300025925 Ga0207650_10017769 Ga0207650_100177697 179
1187 3300025925 Ga0207650_10065538 Ga0207650_100655386 179
1188 3300025926 Ga0207659_10001158 Ga0207659_100011584 179
1189 3300025926 Ga0207659_10210393 Ga0207659_102103933 179
1190 3300025931 Ga0207644_10030475 Ga0207644_100304755 179
1191 3300025935 Ga0207709_10834704 Ga0207709_108347042 179
1192 3300025936 Ga0207670_10293093 Ga0207670_102930931 179
1193 3300025936 Ga0207670_10759917 Ga0207670_107599171 179
1194 3300025937 Ga0207669_10010056 Ga0207669_100100561 179
1195 3300025938 Ga0207704_10283907 Ga0207704_102839072 179
1196 3300025940 Ga0207691_10010724 Ga0207691_100107246 179
1197 3300025941 Ga0207711_10357476 Ga0207711_103574762 179
1198 3300025942 Ga0207689_10002240 Ga0207689_1000224011 179
1199 3300025942 Ga0207689_10007737 Ga0207689_100077375 179
1200 3300025960 Ga0207651_10142137 Ga0207651_101421374 179
1201 3300025960 Ga0207651_10272335 Ga0207651_102723352 179
1202 3300025961 Ga0207712_10592224 Ga0207712_105922242 179
1203 3300025961 Ga0207712_10686745 Ga0207712_106867452 179
1204 3300025972 Ga0207668_10017990 Ga0207668_100179904 179
1205 3300025972 Ga0207668_11337251 Ga0207668_113372511 179
1206 3300025986 Ga0207658_10014885 Ga0207658_100148857 179
1207 3300026023 Ga0207677_10007448 Ga0207677_100074489 179
1208 3300026023 Ga0207677_10051409 Ga0207677_100514094 179
1209 3300026023 Ga0207677_10518082 Ga0207677_105180822 179
1210 3300026035 Ga0207703_10029362 Ga0207703_100293627 179
1211 3300026035 Ga0207703_10043116 Ga0207703_100431162 179
1212 3300026075 Ga0207708_10214154 Ga0207708_102141542 179
1213 3300026075 Ga0207708_10250131 Ga0207708_102501312 179
1214 3300026088 Ga0207641_10013946 Ga0207641_100139462 179
1215 3300026089 Ga0207648_10011645 Ga0207648_1001164510 179
1216 3300026089 Ga0207648_10309172 Ga0207648_103091722 179
1217 3300026095 Ga0207676_10021108 Ga0207676_100211085 179
1218 3300026118 Ga0207675_100072553 Ga0207675_1000725532 179
1219 3300026121 Ga0207683_10000135 Ga0207683_1000013556 179
1220 3300026121 Ga0207683_10015495 Ga0207683_100154957 179
1221 3300027471 Ga0209995_1053886 Ga0209995_10538861 179
1222 3300027526 Ga0209968_1019111 Ga0209968_10191112 179
1223 3300028379 Ga0268266_10063738 Ga0268266_100637384 179
1224 3300028379 Ga0268266_11063030 Ga0268266_110630301 179
1225 3300028380 Ga0268265_10123230 Ga0268265_101232302 179
1226 3300028380 Ga0268265_10939140 Ga0268265_109391401 179
1227 3300028381 Ga0268264_10301308 Ga0268264_103013081 179
1228 3300035114 Ga0373939_0117765 Ga0373939_0117765_161_727 179
1229 3300037466 Ga0395898_1123380 Ga0395898_1123380_136_675 179
1230 3300037471 Ga0395905_0667009 Ga0395905_0667009_11_550 179
1231 3300045051 Ga0451576_0049155 Ga0451576_0049155_3398_3940 179
1232 3300046539 Ga0495621_0030605 Ga0495621_0030605_287_829 179
1233 3300048904 Ga0496101_0202849 Ga0496101_0202849_456_1022 179
1234 3300048909 Ga0496106_0244229 Ga0496106_0244229_493_1059 179
1235 3300048912 Ga0496109_0486984 Ga0496109_0486984_276_842 179
1236 3300048917 Ga0496114_0109587 Ga0496114_0109587_1067_1633 179
1237 3300049575 Ga0501039_0073576 Ga0501039_0073576_1338_1880 179
1238 3300049576 Ga0501040_0068626 Ga0501040_0068626_14_556 179
1239 3300049577 Ga0501041_0025160 Ga0501041_0025160_2378_2920 179
1240 3300049580 Ga0501046_0037906 Ga0501046_0037906_1003_1545 179
1241 3300049587 Ga0501071_0041941 Ga0501071_0041941_789_1331 179
1242 3300049588 Ga0501072_0008532 Ga0501072_0008532_5113_5655 179
1243 3300049591 Ga0501075_0069093 Ga0501075_0069093_1651_2193 179
1244 3300049591 Ga0501075_0118270 Ga0501075_0118270_930_1472 179
1245 3300049592 Ga0501076_0001139 Ga0501076_0001139_4938_5480 179
1246 3300049592 Ga0501076_0301662 Ga0501076_0301662_364_906 179
1247 3300049593 Ga0501077_0031627 Ga0501077_0031627_2725_3267 179
1248 3300049741 Ga0501079_0098561 Ga0501079_0098561_1475_2017 179
1249 3300049742 Ga0501080_0021611 Ga0501080_0021611_3279_3821 179
1250 3300049742 Ga0501080_0337359 Ga0501080_0337359_712_1254 179
1251 3300049743 Ga0501081_0014012 Ga0501081_0014012_1994_2536 179
1252 3300049743 Ga0501081_0229605 Ga0501081_0229605_715_1257 179
1253 3300049824 Ga0501045_0282056 Ga0501045_0282056_364_906 179
1254 3300050507 nmdc:mga05p37_68458_c2 nmdc:mga05p37_68458_c2_408_947 179
1255 3300050507 nmdc:mga05p37_9043_c1 nmdc:mga05p37_9043_c1_5718_6260 179
1256 3300050508 nmdc:mga09592_487_c1 nmdc:mga09592_487_c1_20561_21103 179
1257 3300050510 nmdc:mga06r32_319559_c1 nmdc:mga06r32_319559_c1_872_1414 179
1258 3300050513 nmdc:mga0rr50_239722_c1 nmdc:mga0rr50_239722_c1_225_767 179
1259 3300050515 nmdc:mga0a205_24199_c1 nmdc:mga0a205_24199_c1_2776_3315 179
1260 3300054114 Ga0501084_0008917 Ga0501084_0008917_6033_6575 179
1261 3300061734 Ga0530510_0006180 Ga0530510_0006180_2665_3207 179
1262 iso_pu_bacteria 2643221569 2643859343 179
1263 3300000532 CNAas_1001950 CNAas_10019502 180
1264 3300003187 JGI25151J46595_10000214 JGI25151J46595_100002147 180
1265 3300005347 Ga0070668_100219177 Ga0070668_1002191771 180
1266 3300005617 Ga0068859_100416025 Ga0068859_1004160252 180
1267 3300005618 Ga0068864_100708128 Ga0068864_1007081282 180
1268 3300005841 Ga0068863_100095061 Ga0068863_1000950615 180
1269 3300005841 Ga0068863_100276489 Ga0068863_1002764893 180
1270 3300005844 Ga0068862_100024312 Ga0068862_1000243125 180
1271 3300006871 Ga0075434_100250460 Ga0075434_1002504602 180
1272 3300006931 Ga0097620_100416017 Ga0097620_1004160172 180
1273 3300009094 Ga0111539_11474405 Ga0111539_114744051 180
1274 3300009174 Ga0105241_10110018 Ga0105241_101100182 180
1275 3300009553 Ga0105249_11330925 Ga0105249_113309251 180
1276 3300010375 Ga0105239_10618736 Ga0105239_106187362 180
1277 3300013308 Ga0157375_10409043 Ga0157375_104090433 180
1278 3300025294 Ga0209025_1000005 Ga0209025_1000005565 180
1279 3300025297 Ga0209758_1045517 Ga0209758_10455171 180
1280 3300025885 Ga0207653_10066038 Ga0207653_100660382 180
1281 3300025911 Ga0207654_10080890 Ga0207654_100808902 180
1282 3300025940 Ga0207691_10034037 Ga0207691_100340371 180
1283 3300025940 Ga0207691_10129329 Ga0207691_101293293 180
1284 3300025972 Ga0207668_10082119 Ga0207668_100821192 180
1285 3300026088 Ga0207641_10246039 Ga0207641_102460392 180
1286 3300026088 Ga0207641_10656690 Ga0207641_106566902 180
1287 3300026089 Ga0207648_10570433 Ga0207648_105704332 180
1288 3300028380 Ga0268265_10021907 Ga0268265_100219074 180
1289 3300035083 Ga0373926_0097364 Ga0373926_0097364_535_1080 180
1290 3300035172 Ga0373955_0216492 Ga0373955_0216492_25_570 180
1291 3300035241 Ga0373961_0113941 Ga0373961_0113941_35_583 180
1292 3300035692 Ga0373935_0035009 Ga0373935_0035009_2164_2709 180
1293 3300035724 Ga0373933_0223920 Ga0373933_0223920_374_919 180
1294 3300035724 Ga0373933_0480668 Ga0373933_0480668_184_729 180
1295 3300035725 Ga0373947_0239093 Ga0373947_0239093_341_886 180
1296 3300037068 Ga0373925_0610009 Ga0373925_0610009_240_785 180
1297 3300037312 Ga0395899_0348609 Ga0395899_0348609_73_702 180
1298 3300037418 Ga0395900_0172055 Ga0395900_0172055_320_949 180
1299 3300037466 Ga0395898_0159365 Ga0395898_0159365_1254_1883 180
1300 3300039447 Ga0436361_0836520 Ga0436361_0836520_192_746 180
1301 3300041407 Ga0439447_002680 Ga0439447_002680_5245_5832 180
1302 3300046459 Ga0495629_0256851 Ga0495629_0256851_369_914 180
1303 3300046499 Ga0495594_0083139 Ga0495594_0083139_133_678 180
1304 3300046499 Ga0495594_0263359 Ga0495594_0263359_56_601 180
1305 3300046512 Ga0495610_0003267 Ga0495610_0003267_3889_4491 180
1306 3300046518 Ga0495631_0004302 Ga0495631_0004302_1071_1673 180
1307 3300047317 Ga0495604_0513619 Ga0495604_0513619_71_616 180
1308 3300047322 Ga0495680_0120568 Ga0495680_0120568_933_1478 180
1309 3300048918 Ga0496115_0068613 Ga0496115_0068613_1665_2255 180
1310 3300049569 Ga0501032_0153683 Ga0501032_0153683_937_1485 180
1311 3300049571 Ga0501034_0203610 Ga0501034_0203610_164_712 180
1312 3300049581 Ga0501047_0039864 Ga0501047_0039864_233_781 180
1313 3300049822 Ga0501035_0023035 Ga0501035_0023035_1833_2381 180
1314 3300049823 Ga0501044_0005101 Ga0501044_0005101_11195_11743 180
1315 3300050512 nmdc:mga0n895_74962_c1 nmdc:mga0n895_74962_c1_623_1171 180
1316 3300050513 nmdc:mga0rr50_102433_c1 nmdc:mga0rr50_102433_c1_1243_1791 180
1317 3300053085 Ga0495619_0155140 Ga0495619_0155140_650_1195 180
1318 iso_pu_bacteria 2599185292 2599904194 180
1319 iso_pu_bacteria 2858950400 2858954388 180
1320 3300003771 Ga0055526_1000032 Ga0055526_100003257 181
1321 3300003773 Ga0055537_1000301 Ga0055537_100030122 181
1322 3300003773 Ga0055537_1000309 Ga0055537_100030917 181
1323 3300003775 Ga0055524_1000054 Ga0055524_100005457 181
1324 3300003775 Ga0055524_1035836 Ga0055524_10358362 181
1325 3300003784 Ga0055534_1000041 Ga0055534_100004158 181
1326 3300003784 Ga0055534_1000065 Ga0055534_100006536 181
1327 3300003790 Ga0055528_1000021 Ga0055528_100002158 181
1328 3300003790 Ga0055528_1002176 Ga0055528_10021764 181
1329 3300003791 Ga0055530_10000307 Ga0055530_1000030723 181
1330 3300003794 Ga0055531_10002203 Ga0055531_100022035 181
1331 3300003794 Ga0055531_10009391 Ga0055531_100093912 181
1332 3300005289 Ga0065704_10074617 Ga0065704_100746172 181
1333 3300005327 Ga0070658_10047287 Ga0070658_100472876 181
1334 3300005328 Ga0070676_10095348 Ga0070676_100953482 181
1335 3300005329 Ga0070683_100363202 Ga0070683_1003632021 181
1336 3300005330 Ga0070690_100099752 Ga0070690_1000997522 181
1337 3300005331 Ga0070670_100019355 Ga0070670_1000193552 181
1338 3300005333 Ga0070677_10059101 Ga0070677_100591012 181
1339 3300005335 Ga0070666_10004454 Ga0070666_100044542 181
1340 3300005336 Ga0070680_100242121 Ga0070680_1002421212 181
1341 3300005338 Ga0068868_100002004 Ga0068868_1000020043 181
1342 3300005339 Ga0070660_100004078 Ga0070660_10000407812 181
1343 3300005340 Ga0070689_100045280 Ga0070689_1000452805 181
1344 3300005340 Ga0070689_101155234 Ga0070689_1011552341 181
1345 3300005344 Ga0070661_100001835 Ga0070661_10000183515 181
1346 3300005345 Ga0070692_10033730 Ga0070692_100337302 181
1347 3300005347 Ga0070668_100205905 Ga0070668_1002059051 181
1348 3300005353 Ga0070669_100131975 Ga0070669_1001319752 181
1349 3300005355 Ga0070671_100017960 Ga0070671_1000179602 181
1350 3300005355 Ga0070671_100033349 Ga0070671_1000333492 181
1351 3300005356 Ga0070674_100106629 Ga0070674_1001066292 181
1352 3300005364 Ga0070673_100008677 Ga0070673_1000086776 181
1353 3300005366 Ga0070659_100043492 Ga0070659_1000434921 181
1354 3300005367 Ga0070667_100006931 Ga0070667_1000069316 181
1355 3300005435 Ga0070714_100002547 Ga0070714_1000025473 181
1356 3300005440 Ga0070705_100465295 Ga0070705_1004652951 181
1357 3300005441 Ga0070700_100041569 Ga0070700_1000415692 181
1358 3300005444 Ga0070694_100842012 Ga0070694_1008420121 181
1359 3300005457 Ga0070662_100005620 Ga0070662_1000056206 181
1360 3300005458 Ga0070681_10003631 Ga0070681_100036319 181
1361 3300005459 Ga0068867_100062424 Ga0068867_1000624242 181
1362 3300005466 Ga0070685_10009659 Ga0070685_100096593 181
1363 3300005471 Ga0070698_100004063 Ga0070698_1000040637 181
1364 3300005471 Ga0070698_100019004 Ga0070698_1000190044 181
1365 3300005535 Ga0070684_100021581 Ga0070684_1000215817 181
1366 3300005535 Ga0070684_100074293 Ga0070684_1000742932 181
1367 3300005543 Ga0070672_100010329 Ga0070672_1000103294 181
1368 3300005543 Ga0070672_100186079 Ga0070672_1001860792 181
1369 3300005545 Ga0070695_100032453 Ga0070695_1000324532 181
1370 3300005547 Ga0070693_100009978 Ga0070693_1000099782 181
1371 3300005563 Ga0068855_100030461 Ga0068855_1000304618 181
1372 3300005564 Ga0070664_100003363 Ga0070664_1000033633 181
1373 3300005564 Ga0070664_100007225 Ga0070664_1000072258 181
1374 3300005577 Ga0068857_100025679 Ga0068857_1000256793 181
1375 3300005577 Ga0068857_100107557 Ga0068857_1001075572 181
1376 3300005578 Ga0068854_100051060 Ga0068854_1000510602 181
1377 3300005614 Ga0068856_100070365 Ga0068856_1000703652 181
1378 3300005614 Ga0068856_101054940 Ga0068856_1010549401 181
1379 3300005615 Ga0070702_100039702 Ga0070702_1000397021 181
1380 3300005615 Ga0070702_100041529 Ga0070702_1000415292 181
1381 3300005616 Ga0068852_100221286 Ga0068852_1002212864 181
1382 3300005617 Ga0068859_100006511 Ga0068859_1000065114 181
1383 3300005617 Ga0068859_100007211 Ga0068859_1000072112 181
1384 3300005618 Ga0068864_100008896 Ga0068864_1000088962 181
1385 3300005718 Ga0068866_10040321 Ga0068866_100403212 181
1386 3300005719 Ga0068861_100157220 Ga0068861_1001572201 181
1387 3300005834 Ga0068851_10482217 Ga0068851_104822171 181
1388 3300005840 Ga0068870_10042336 Ga0068870_100423362 181
1389 3300005841 Ga0068863_100005806 Ga0068863_1000058068 181
1390 3300005842 Ga0068858_100002751 Ga0068858_10000275113 181
1391 3300005844 Ga0068862_100011674 Ga0068862_1000116741 181
1392 3300006051 Ga0075364_10083504 Ga0075364_100835042 181
1393 3300006051 Ga0075364_10265256 Ga0075364_102652562 181
1394 3300006358 Ga0068871_100396305 Ga0068871_1003963052 181
1395 3300006844 Ga0075428_100168990 Ga0075428_1001689902 181
1396 3300006846 Ga0075430_100077544 Ga0075430_1000775442 181
1397 3300006847 Ga0075431_100013466 Ga0075431_1000134667 181
1398 3300006881 Ga0068865_100061840 Ga0068865_1000618402 181
1399 3300006931 Ga0097620_100006512 Ga0097620_1000065124 181
1400 3300006931 Ga0097620_100007211 Ga0097620_10000721110 181
1401 3300009011 Ga0105251_10001834 Ga0105251_1000183414 181
1402 3300009036 Ga0105244_10064937 Ga0105244_100649372 181
1403 3300009093 Ga0105240_10007842 Ga0105240_1000784214 181
1404 3300009093 Ga0105240_10276896 Ga0105240_102768962 181
1405 3300009094 Ga0111539_10129689 Ga0111539_101296894 181
1406 3300009098 Ga0105245_10215450 Ga0105245_102154502 181
1407 3300009101 Ga0105247_10009144 Ga0105247_100091447 181
1408 3300009147 Ga0114129_10283852 Ga0114129_102838522 181
1409 3300009148 Ga0105243_10260413 Ga0105243_102604132 181
1410 3300009174 Ga0105241_10011563 Ga0105241_100115639 181
1411 3300009174 Ga0105241_10562516 Ga0105241_105625162 181
1412 3300009174 Ga0105241_10708772 Ga0105241_107087722 181
1413 3300009176 Ga0105242_10191918 Ga0105242_101919182 181
1414 3300009176 Ga0105242_10303479 Ga0105242_103034791 181
1415 3300009176 Ga0105242_10384318 Ga0105242_103843182 181
1416 3300009177 Ga0105248_10002525 Ga0105248_1000252521 181
1417 3300009545 Ga0105237_10018907 Ga0105237_100189076 181
1418 3300009545 Ga0105237_10256117 Ga0105237_102561171 181
1419 3300009551 Ga0105238_10000622 Ga0105238_1000062225 181
1420 3300009551 Ga0105238_10003831 Ga0105238_1000383113 181
1421 3300009551 Ga0105238_10086058 Ga0105238_100860582 181
1422 3300009553 Ga0105249_10373844 Ga0105249_103738442 181
1423 3300009553 Ga0105249_10823283 Ga0105249_108232832 181
1424 3300009553 Ga0105249_10867337 Ga0105249_108673372 181
1425 3300010375 Ga0105239_10134909 Ga0105239_101349095 181
1426 3300010375 Ga0105239_10263279 Ga0105239_102632791 181
1427 3300011119 Ga0105246_10010041 Ga0105246_100100414 181
1428 3300011119 Ga0105246_10125676 Ga0105246_101256762 181
1429 3300013100 Ga0157373_10011744 Ga0157373_100117444 181
1430 3300013102 Ga0157371_10001931 Ga0157371_100019319 181
1431 3300013102 Ga0157371_10082683 Ga0157371_100826835 181
1432 3300013102 Ga0157371_10297099 Ga0157371_102970991 181
1433 3300013104 Ga0157370_10017321 Ga0157370_1001732111 181
1434 3300013104 Ga0157370_10029507 Ga0157370_100295072 181
1435 3300013105 Ga0157369_10018020 Ga0157369_100180205 181
1436 3300013296 Ga0157374_10015160 Ga0157374_1001516010 181
1437 3300013296 Ga0157374_10033129 Ga0157374_100331296 181
1438 3300013296 Ga0157374_10036684 Ga0157374_100366844 181
1439 3300013297 Ga0157378_10001035 Ga0157378_1000103516 181
1440 3300013297 Ga0157378_10750497 Ga0157378_107504972 181
1441 3300013306 Ga0163162_10008872 Ga0163162_100088724 181
1442 3300013306 Ga0163162_10033327 Ga0163162_100333276 181
1443 3300013306 Ga0163162_10111575 Ga0163162_101115751 181
1444 3300013307 Ga0157372_12028863 Ga0157372_120288631 181
1445 3300013308 Ga0157375_10123431 Ga0157375_101234312 181
1446 3300013308 Ga0157375_10179649 Ga0157375_101796492 181
1447 3300013308 Ga0157375_10520657 Ga0157375_105206572 181
1448 3300014325 Ga0163163_10008460 Ga0163163_100084602 181
1449 3300014325 Ga0163163_10017425 Ga0163163_100174253 181
1450 3300014325 Ga0163163_10035487 Ga0163163_100354873 181
1451 3300014497 Ga0182008_10033626 Ga0182008_100336263 181
1452 3300014745 Ga0157377_10088515 Ga0157377_100885152 181
1453 3300014745 Ga0157377_10093640 Ga0157377_100936402 181
1454 3300014745 Ga0157377_10344943 Ga0157377_103449432 181
1455 3300014968 Ga0157379_10031955 Ga0157379_100319556 181
1456 3300014968 Ga0157379_10274782 Ga0157379_102747821 181
1457 3300014969 Ga0157376_10034429 Ga0157376_100344292 181
1458 3300015261 Ga0182006_1008997 Ga0182006_10089975 181
1459 3300015261 Ga0182006_1136572 Ga0182006_11365721 181
1460 3300015262 Ga0182007_10000593 Ga0182007_100005937 181
1461 3300015265 Ga0182005_1001301 Ga0182005_10013013 181
1462 3300020069 Ga0197907_10857353 Ga0197907_108573533 181
1463 3300020075 Ga0206349_1594483 Ga0206349_15944833 181
1464 3300020080 Ga0206350_10618878 Ga0206350_106188781 181
1465 3300020081 Ga0206354_10497689 Ga0206354_104976893 181
1466 3300022467 Ga0224712_10042402 Ga0224712_100424021 181
1467 3300025263 Ga0209565_1000001 Ga0209565_10000012112 181
1468 3300025263 Ga0209565_1000023 Ga0209565_1000023292 181
1469 3300025273 Ga0209673_1000001 Ga0209673_10000012112 181
1470 3300025273 Ga0209673_1000308 Ga0209673_100030844 181
1471 3300025273 Ga0209673_1000853 Ga0209673_100085329 181
1472 3300025284 Ga0209130_1006582 Ga0209130_10065822 181
1473 3300025291 Ga0209675_1000001 Ga0209675_1000001420 181
1474 3300025291 Ga0209675_1000154 Ga0209675_100015412 181
1475 3300025292 Ga0209676_1000352 Ga0209676_100035263 181
1476 3300025292 Ga0209676_1003485 Ga0209676_100348510 181
1477 3300025295 Ga0209564_1000001 Ga0209564_1000001582 181
1478 3300025295 Ga0209564_1000106 Ga0209564_100010691 181
1479 3300025298 Ga0209050_1000436 Ga0209050_100043650 181
1480 3300025298 Ga0209050_1004931 Ga0209050_10049315 181
1481 3300025298 Ga0209050_1022114 Ga0209050_10221142 181
1482 3300025299 Ga0209256_1000002 Ga0209256_1000002970 181
1483 3300025299 Ga0209256_1001379 Ga0209256_100137921 181
1484 3300025299 Ga0209256_1013420 Ga0209256_10134203 181
1485 3300025303 Ga0209051_1011336 Ga0209051_10113365 181
1486 3300025304 Ga0209257_1000241 Ga0209257_100024192 181
1487 3300025304 Ga0209257_1000251 Ga0209257_100025176 181
1488 3300025304 Ga0209257_1005006 Ga0209257_10050067 181
1489 3300025728 Ga0207655_1056976 Ga0207655_10569762 181
1490 3300025735 Ga0207713_1004179 Ga0207713_10041794 181
1491 3300025899 Ga0207642_10011549 Ga0207642_100115493 181
1492 3300025900 Ga0207710_10021935 Ga0207710_100219352 181
1493 3300025903 Ga0207680_10018000 Ga0207680_100180002 181
1494 3300025907 Ga0207645_10001493 Ga0207645_1000149316 181
1495 3300025908 Ga0207643_10030115 Ga0207643_100301153 181
1496 3300025909 Ga0207705_10046439 Ga0207705_100464392 181
1497 3300025913 Ga0207695_10047974 Ga0207695_100479746 181
1498 3300025913 Ga0207695_10213149 Ga0207695_102131492 181
1499 3300025914 Ga0207671_10148448 Ga0207671_101484481 181
1500 3300025917 Ga0207660_10252870 Ga0207660_102528702 181
1501 3300025919 Ga0207657_10007121 Ga0207657_100071216 181
1502 3300025920 Ga0207649_10111687 Ga0207649_101116871 181
1503 3300025923 Ga0207681_10051584 Ga0207681_100515843 181
1504 3300025924 Ga0207694_10012926 Ga0207694_100129262 181
1505 3300025924 Ga0207694_10135782 Ga0207694_101357822 181
1506 3300025927 Ga0207687_10073446 Ga0207687_100734462 181
1507 3300025929 Ga0207664_10092159 Ga0207664_100921591 181
1508 3300025931 Ga0207644_10019459 Ga0207644_100194595 181
1509 3300025932 Ga0207690_10019422 Ga0207690_100194225 181
1510 3300025933 Ga0207706_10005309 Ga0207706_100053099 181
1511 3300025935 Ga0207709_10165182 Ga0207709_101651822 181
1512 3300025936 Ga0207670_10041072 Ga0207670_100410722 181
1513 3300025937 Ga0207669_10280926 Ga0207669_102809262 181
1514 3300025938 Ga0207704_10308085 Ga0207704_103080852 181
1515 3300025940 Ga0207691_10002829 Ga0207691_100028299 181
1516 3300025940 Ga0207691_10528115 Ga0207691_105281151 181
1517 3300025941 Ga0207711_10002786 Ga0207711_1000278611 181
1518 3300025944 Ga0207661_10232684 Ga0207661_102326843 181
1519 3300025945 Ga0207679_10039470 Ga0207679_100394705 181
1520 3300025945 Ga0207679_10314926 Ga0207679_103149261 181
1521 3300025949 Ga0207667_10073513 Ga0207667_100735136 181
1522 3300025961 Ga0207712_10110082 Ga0207712_101100823 181
1523 3300025972 Ga0207668_10028978 Ga0207668_100289784 181
1524 3300025981 Ga0207640_10052014 Ga0207640_100520145 181
1525 3300025986 Ga0207658_10075584 Ga0207658_100755842 181
1526 3300026023 Ga0207677_10016511 Ga0207677_100165114 181
1527 3300026035 Ga0207703_10022044 Ga0207703_100220446 181
1528 3300026041 Ga0207639_11125377 Ga0207639_111253771 181
1529 3300026067 Ga0207678_10085536 Ga0207678_100855363 181
1530 3300026067 Ga0207678_10278868 Ga0207678_102788683 181
1531 3300026075 Ga0207708_10052044 Ga0207708_100520443 181
1532 3300026078 Ga0207702_10029353 Ga0207702_100293532 181
1533 3300026078 Ga0207702_10791688 Ga0207702_107916881 181
1534 3300026088 Ga0207641_10012900 Ga0207641_100129002 181
1535 3300026089 Ga0207648_10063892 Ga0207648_100638923 181
1536 3300026095 Ga0207676_10003600 Ga0207676_1000360012 181
1537 3300026116 Ga0207674_10004128 Ga0207674_1000412815 181
1538 3300026116 Ga0207674_10256181 Ga0207674_102561812 181
1539 3300026118 Ga0207675_100040134 Ga0207675_1000401344 181
1540 3300026142 Ga0207698_10116124 Ga0207698_101161243 181
1541 3300026142 Ga0207698_10222086 Ga0207698_102220861 181
1542 3300027252 Ga0209973_1057456 Ga0209973_10574561 181
1543 3300027462 Ga0210000_1004019 Ga0210000_10040192 181
1544 3300027471 Ga0209995_1029061 Ga0209995_10290612 181
1545 3300027617 Ga0210002_1005955 Ga0210002_10059552 181
1546 3300027665 Ga0209983_1002021 Ga0209983_10020211 181
1547 3300027665 Ga0209983_1039751 Ga0209983_10397511 181
1548 3300027682 Ga0209971_1000911 Ga0209971_10009114 181
1549 3300027695 Ga0209966_1025830 Ga0209966_10258301 181
1550 3300027717 Ga0209998_10003602 Ga0209998_100036023 181
1551 3300027876 Ga0209974_10001075 Ga0209974_100010754 181
1552 3300027876 Ga0209974_10001283 Ga0209974_100012834 181
1553 3300028379 Ga0268266_10779833 Ga0268266_107798331 181
1554 3300028380 Ga0268265_10023898 Ga0268265_100238982 181
1555 3300035119 Ga0373956_0160274 Ga0373956_0160274_276_836 181
1556 3300035691 Ga0373931_0025971 Ga0373931_0025971_934_1491 181
1557 3300036401 Ga0373937_0030552 Ga0373937_0030552_2630_3190 181
1558 3300036401 Ga0373937_0088188 Ga0373937_0088188_1402_1947 181
1559 3300041498 Ga0451841_0398296 Ga0451841_0398296_1685_2272 181
1560 3300045051 Ga0451576_0737216 Ga0451576_0737216_248_802 181
1561 3300046460 Ga0495638_0008515 Ga0495638_0008515_6428_7015 181
1562 3300046473 Ga0495582_0037392 Ga0495582_0037392_521_1066 181
1563 3300046525 Ga0495663_0003376 Ga0495663_0003376_244_831 181
1564 3300046535 Ga0495586_0611829 Ga0495586_0611829_20_580 181
1565 3300046538 Ga0495609_0193957 Ga0495609_0193957_186_773 181
1566 3300048905 Ga0496102_0039477 Ga0496102_0039477_466_1065 181
1567 3300048905 Ga0496102_0726601 Ga0496102_0726601_253_807 181
1568 3300048906 Ga0496103_0188312 Ga0496103_0188312_351_950 181
1569 3300048906 Ga0496103_0490099 Ga0496103_0490099_98_655 181
1570 3300048907 Ga0496104_0282703 Ga0496104_0282703_306_863 181
1571 3300048908 Ga0496105_0123271 Ga0496105_0123271_1523_2107 181
1572 3300048909 Ga0496106_0103660 Ga0496106_0103660_127_684 181
1573 3300048910 Ga0496107_0184656 Ga0496107_0184656_471_1028 181
1574 3300048911 Ga0496108_1048287 Ga0496108_1048287_81_635 181
1575 3300048912 Ga0496109_0016646 Ga0496109_0016646_1800_2357 181
1576 3300048913 Ga0496110_0976826 Ga0496110_0976826_35_592 181
1577 3300048915 Ga0496112_0173924 Ga0496112_0173924_1037_1594 181
1578 3300048916 Ga0496113_0038487 Ga0496113_0038487_1874_2431 181
1579 3300048916 Ga0496113_0124661 Ga0496113_0124661_695_1294 181
1580 3300048916 Ga0496113_0802832 Ga0496113_0802832_80_661 181
1581 3300048917 Ga0496114_0348858 Ga0496114_0348858_558_1103 181
1582 3300048919 Ga0496116_0112871 Ga0496116_0112871_92_694 181
1583 3300048920 Ga0496117_0013761 Ga0496117_0013761_5543_6145 181
1584 3300048921 Ga0496118_0006054 Ga0496118_0006054_5617_6219 181
1585 3300048921 Ga0496118_0198232 Ga0496118_0198232_392_979 181
1586 3300048921 Ga0496118_0207996 Ga0496118_0207996_471_1055 181
1587 3300048922 Ga0496119_0001070 Ga0496119_0001070_27985_28569 181
1588 3300048923 Ga0496120_0000716 Ga0496120_0000716_41851_42435 181
1589 3300048924 Ga0496121_0019793 Ga0496121_0019793_2944_3528 181
1590 3300048924 Ga0496121_0496248 Ga0496121_0496248_96_680 181
1591 3300048925 Ga0496122_0021341 Ga0496122_0021341_5150_5734 181
1592 3300048926 Ga0496123_0028737 Ga0496123_0028737_2193_2795 181
1593 3300048927 Ga0496124_0011269 Ga0496124_0011269_2571_3155 181
1594 3300048927 Ga0496124_0018455 Ga0496124_0018455_2725_3309 181
1595 3300048927 Ga0496124_0284803 Ga0496124_0284803_68_670 181
1596 3300048928 Ga0496125_0003520 Ga0496125_0003520_12253_12825 181
1597 3300048928 Ga0496125_0019301 Ga0496125_0019301_2949_3533 181
1598 3300048928 Ga0496125_0168538 Ga0496125_0168538_806_1390 181
1599 3300048929 Ga0496126_0039425 Ga0496126_0039425_3071_3655 181
1600 3300049576 Ga0501040_0534254 Ga0501040_0534254_124_669 181
1601 3300049577 Ga0501041_0157371 Ga0501041_0157371_585_1130 181
1602 3300049589 Ga0501073_0393996 Ga0501073_0393996_383_931 181
1603 3300049741 Ga0501079_0194617 Ga0501079_0194617_680_1225 181
1604 3300050491 nmdc:mga00v17_528875_c1 nmdc:mga00v17_528875_c1_107_691 181
1605 3300050491 nmdc:mga00v17_95767_c1 nmdc:mga00v17_95767_c1_419_1021 181
1606 3300050507 nmdc:mga05p37_210285_c1 nmdc:mga05p37_210285_c1_1710_2255 181
1607 3300050508 nmdc:mga09592_100656_c1 nmdc:mga09592_100656_c1_820_1365 181
1608 3300050509 nmdc:mga0qj67_260138_c1 nmdc:mga0qj67_260138_c1_680_1225 181
1609 3300050510 nmdc:mga06r32_67173_c1 nmdc:mga06r32_67173_c1_436_984 181
1610 3300050511 nmdc:mga08y16_328000_c1 nmdc:mga08y16_328000_c1_321_878 181
1611 3300053734 Ga0500565_001697 Ga0500565_001697_760_1347 181
1612 3300054114 Ga0501084_0204294 Ga0501084_0204294_669_1214 181
1613 3300059492 Ga0587073_0008701 Ga0587073_0008701_499_1080 181
1614 3300059505 Ga0587083_0130129 Ga0587083_0130129_11_586 181
1615 3300059508 Ga0587088_086960 Ga0587088_086960_38_619 181
1616 3300059630 Ga0587128_012103 Ga0587128_012103_501_1082 181
1617 3300059655 Ga0587114_002881 Ga0587114_002881_487_1068 181
1618 3300005331 Ga0070670_100142762 Ga0070670_1001427622 182
1619 3300005343 Ga0070687_100000386 Ga0070687_1000003864 182
1620 3300005539 Ga0068853_100565056 Ga0068853_1005650562 182
1621 3300005544 Ga0070686_100008969 Ga0070686_1000089695 182
1622 3300005615 Ga0070702_100055986 Ga0070702_1000559862 182
1623 3300006237 Ga0097621_100720775 Ga0097621_1007207752 182
1624 3300006358 Ga0068871_100925233 Ga0068871_1009252332 182
1625 3300013100 Ga0157373_10026055 Ga0157373_100260552 182
1626 3300013306 Ga0163162_10073228 Ga0163162_100732282 182
1627 3300013307 Ga0157372_11021025 Ga0157372_110210252 182
1628 3300025937 Ga0207669_10125459 Ga0207669_101254592 182
1629 3300025961 Ga0207712_10019879 Ga0207712_100198792 182
1630 3300027312 Ga0209371_1006007 Ga0209371_10060072 182
1631 3300030500 Ga0268256_1005994 Ga0268256_10059942 182
1632 3300031911 Ga0307412_10000200 Ga0307412_1000020029 182
1633 3300048919 Ga0496116_0020428 Ga0496116_0020428_327_890 182
1634 3300048921 Ga0496118_0036137 Ga0496118_0036137_3055_3618 182
1635 3300049514 Ga0501291_016208 Ga0501291_016208_48_602 182
1636 3300049518 Ga0501295_026587 Ga0501295_026587_350_904 182
1637 3300049519 Ga0501296_006247 Ga0501296_006247_195_749 182
1638 3300049521 Ga0501298_016772 Ga0501298_016772_97_651 182
1639 3300049522 Ga0501299_036713 Ga0501299_036713_315_869 182
1640 3300049649 Ga0501198_016538 Ga0501198_016538_33_587 182
1641 3300049652 Ga0501202_140957 Ga0501202_140957_35_589 182
1642 3300049656 Ga0501209_078939 Ga0501209_078939_165_719 182
1643 3300049660 Ga0501216_012881 Ga0501216_012881_366_920 182
1644 3300049661 Ga0501217_004261 Ga0501217_004261_1396_1950 182
1645 3300049663 Ga0501223_034208 Ga0501223_034208_88_642 182
1646 3300049664 Ga0501224_028763 Ga0501224_028763_146_700 182
1647 3300049665 Ga0501227_018874 Ga0501227_018874_489_1043 182
1648 3300049667 Ga0501230_022557 Ga0501230_022557_213_767 182
1649 3300049668 Ga0501233_003286 Ga0501233_003286_1094_1648 182
1650 3300049672 Ga0501239_024015 Ga0501239_024015_197_751 182
1651 3300049677 Ga0501247_011094 Ga0501247_011094_115_669 182
1652 3300049679 Ga0501249_029526 Ga0501249_029526_510_1064 182
1653 3300049688 Ga0501259_079329 Ga0501259_079329_99_653 182
1654 3300049689 Ga0501260_007769 Ga0501260_007769_227_781 182
1655 3300049704 Ga0501221_037179 Ga0501221_037179_165_719 182
1656 3300049705 Ga0501225_0038461 Ga0501225_0038461_275_829 182
1657 3300049706 Ga0501229_009149 Ga0501229_009149_556_1110 182
1658 3300049765 Ga0501268_092984 Ga0501268_092984_69_623 182
1659 3300049775 Ga0501279_014792 Ga0501279_014792_327_881 182
1660 3300049779 Ga0501283_005213 Ga0501283_005213_786_1340 182
1661 3300049851 Ga0501212_012466 Ga0501212_012466_524_1078 182
1662 3300050491 nmdc:mga00v17_70184_c1 nmdc:mga00v17_70184_c1_1383_1955 182
1663 2162886007 SwRhRL2b_contig_3096326 SwRhRL2b_0035.00000410 183
1664 3300005289 Ga0065704_10285155 Ga0065704_102851551 183
1665 3300005289 Ga0065704_10339599 Ga0065704_103395991 183
1666 3300005293 Ga0065715_10281888 Ga0065715_102818881 183
1667 3300005295 Ga0065707_10109535 Ga0065707_101095352 183
1668 3300005328 Ga0070676_10030613 Ga0070676_100306132 183
1669 3300005328 Ga0070676_10047666 Ga0070676_100476662 183
1670 3300005329 Ga0070683_100369267 Ga0070683_1003692671 183
1671 3300005330 Ga0070690_100014072 Ga0070690_1000140724 183
1672 3300005334 Ga0068869_100033429 Ga0068869_1000334296 183
1673 3300005335 Ga0070666_10009085 Ga0070666_100090854 183
1674 3300005336 Ga0070680_100000341 Ga0070680_1000003418 183
1675 3300005336 Ga0070680_100123196 Ga0070680_1001231962 183
1676 3300005337 Ga0070682_100265811 Ga0070682_1002658112 183
1677 3300005338 Ga0068868_100043128 Ga0068868_1000431282 183
1678 3300005340 Ga0070689_100034314 Ga0070689_1000343143 183
1679 3300005344 Ga0070661_100142704 Ga0070661_1001427041 183
1680 3300005345 Ga0070692_10017064 Ga0070692_100170642 183
1681 3300005345 Ga0070692_10105990 Ga0070692_101059902 183
1682 3300005347 Ga0070668_100031091 Ga0070668_1000310913 183
1683 3300005353 Ga0070669_100060659 Ga0070669_1000606592 183
1684 3300005354 Ga0070675_100309335 Ga0070675_1003093353 183
1685 3300005355 Ga0070671_100012201 Ga0070671_1000122015 183
1686 3300005355 Ga0070671_100472066 Ga0070671_1004720661 183
1687 3300005356 Ga0070674_100006790 Ga0070674_1000067905 183
1688 3300005364 Ga0070673_100356003 Ga0070673_1003560032 183
1689 3300005365 Ga0070688_100025103 Ga0070688_1000251031 183
1690 3300005367 Ga0070667_100023195 Ga0070667_1000231952 183
1691 3300005434 Ga0070709_10440148 Ga0070709_104401482 183
1692 3300005438 Ga0070701_10024099 Ga0070701_100240991 183
1693 3300005441 Ga0070700_100047000 Ga0070700_1000470005 183
1694 3300005441 Ga0070700_100058060 Ga0070700_1000580602 183
1695 3300005444 Ga0070694_100059225 Ga0070694_1000592253 183
1696 3300005444 Ga0070694_100083865 Ga0070694_1000838651 183
1697 3300005445 Ga0070708_100041676 Ga0070708_1000416763 183
1698 3300005457 Ga0070662_100070834 Ga0070662_1000708344 183
1699 3300005457 Ga0070662_100117726 Ga0070662_1001177261 183
1700 3300005458 Ga0070681_10000526 Ga0070681_100005268 183
1701 3300005459 Ga0068867_100042479 Ga0068867_1000424792 183
1702 3300005459 Ga0068867_100385531 Ga0068867_1003855311 183
1703 3300005466 Ga0070685_10060237 Ga0070685_100602371 183
1704 3300005467 Ga0070706_100028319 Ga0070706_1000283194 183
1705 3300005467 Ga0070706_100413562 Ga0070706_1004135622 183
1706 3300005468 Ga0070707_100203238 Ga0070707_1002032382 183
1707 3300005518 Ga0070699_100456654 Ga0070699_1004566542 183
1708 3300005530 Ga0070679_100002522 Ga0070679_1000025228 183
1709 3300005530 Ga0070679_100246984 Ga0070679_1002469842 183
1710 3300005536 Ga0070697_100000207 Ga0070697_10000020729 183
1711 3300005536 Ga0070697_100080708 Ga0070697_1000807082 183
1712 3300005536 Ga0070697_100141900 Ga0070697_1001419002 183
1713 3300005539 Ga0068853_100153962 Ga0068853_1001539622 183
1714 3300005539 Ga0068853_100634912 Ga0068853_1006349121 183
1715 3300005543 Ga0070672_100114443 Ga0070672_1001144432 183
1716 3300005543 Ga0070672_100851492 Ga0070672_1008514921 183
1717 3300005543 Ga0070672_101118128 Ga0070672_1011181281 183
1718 3300005544 Ga0070686_100295384 Ga0070686_1002953841 183
1719 3300005545 Ga0070695_100048535 Ga0070695_1000485351 183
1720 3300005545 Ga0070695_100312562 Ga0070695_1003125622 183
1721 3300005545 Ga0070695_100377912 Ga0070695_1003779122 183
1722 3300005546 Ga0070696_100249571 Ga0070696_1002495711 183
1723 3300005547 Ga0070693_100207381 Ga0070693_1002073812 183
1724 3300005547 Ga0070693_100242349 Ga0070693_1002423491 183
1725 3300005549 Ga0070704_100096176 Ga0070704_1000961761 183
1726 3300005549 Ga0070704_100298109 Ga0070704_1002981092 183
1727 3300005549 Ga0070704_100378599 Ga0070704_1003785992 183
1728 3300005549 Ga0070704_100402797 Ga0070704_1004027972 183
1729 3300005564 Ga0070664_100261390 Ga0070664_1002613904 183
1730 3300005577 Ga0068857_100361200 Ga0068857_1003612002 183
1731 3300005614 Ga0068856_100084702 Ga0068856_1000847023 183
1732 3300005615 Ga0070702_100026599 Ga0070702_1000265991 183
1733 3300005618 Ga0068864_100680074 Ga0068864_1006800741 183
1734 3300005718 Ga0068866_10030947 Ga0068866_100309472 183
1735 3300005719 Ga0068861_100029416 Ga0068861_1000294162 183
1736 3300005719 Ga0068861_100071859 Ga0068861_1000718592 183
1737 3300005840 Ga0068870_10069559 Ga0068870_100695593 183
1738 3300005841 Ga0068863_100196471 Ga0068863_1001964712 183
1739 3300005842 Ga0068858_100064499 Ga0068858_1000644994 183
1740 3300005842 Ga0068858_100605206 Ga0068858_1006052062 183
1741 3300005843 Ga0068860_100063248 Ga0068860_1000632482 183
1742 3300005844 Ga0068862_100002302 Ga0068862_1000023027 183
1743 3300005844 Ga0068862_100111621 Ga0068862_1001116212 183
1744 3300005937 Ga0081455_10309573 Ga0081455_103095731 183
1745 3300006237 Ga0097621_100150815 Ga0097621_1001508152 183
1746 3300006237 Ga0097621_100669554 Ga0097621_1006695542 183
1747 3300006358 Ga0068871_100219565 Ga0068871_1002195652 183
1748 3300006844 Ga0075428_100182798 Ga0075428_1001827982 183
1749 3300006844 Ga0075428_100247604 Ga0075428_1002476042 183
1750 3300006852 Ga0075433_10013418 Ga0075433_100134189 183
1751 3300006871 Ga0075434_100282443 Ga0075434_1002824433 183
1752 3300006881 Ga0068865_100198776 Ga0068865_1001987761 183
1753 3300009094 Ga0111539_10066866 Ga0111539_100668664 183
1754 3300009094 Ga0111539_10069922 Ga0111539_100699224 183
1755 3300009094 Ga0111539_10345548 Ga0111539_103455482 183
1756 3300009098 Ga0105245_10015758 Ga0105245_100157584 183
1757 3300009098 Ga0105245_11364201 Ga0105245_113642011 183
1758 3300009147 Ga0114129_10011276 Ga0114129_100112766 183
1759 3300009147 Ga0114129_10071705 Ga0114129_100717052 183
1760 3300009148 Ga0105243_10001184 Ga0105243_1000118417 183
1761 3300009148 Ga0105243_10133691 Ga0105243_101336912 183
1762 3300009176 Ga0105242_10002565 Ga0105242_100025652 183
1763 3300009176 Ga0105242_10006981 Ga0105242_100069815 183
1764 3300009177 Ga0105248_10017113 Ga0105248_100171136 183
1765 3300009177 Ga0105248_10030262 Ga0105248_100302624 183
1766 3300009545 Ga0105237_10224498 Ga0105237_102244981 183
1767 3300009553 Ga0105249_10006513 Ga0105249_100065132 183
1768 3300009553 Ga0105249_10016152 Ga0105249_100161522 183
1769 3300009553 Ga0105249_10037854 Ga0105249_100378546 183
1770 3300009553 Ga0105249_10073789 Ga0105249_100737892 183
1771 3300009553 Ga0105249_10905650 Ga0105249_109056502 183
1772 3300010375 Ga0105239_10487382 Ga0105239_104873822 183
1773 3300010375 Ga0105239_10510810 Ga0105239_105108102 183
1774 3300013297 Ga0157378_10004449 Ga0157378_100044496 183
1775 3300013297 Ga0157378_10133166 Ga0157378_101331664 183
1776 3300013297 Ga0157378_10271656 Ga0157378_102716562 183
1777 3300013306 Ga0163162_10045061 Ga0163162_100450616 183
1778 3300013306 Ga0163162_10073421 Ga0163162_100734212 183
1779 3300013306 Ga0163162_10810881 Ga0163162_108108811 183
1780 3300013307 Ga0157372_10200359 Ga0157372_102003592 183
1781 3300013308 Ga0157375_10060707 Ga0157375_100607074 183
1782 3300014326 Ga0157380_10002469 Ga0157380_100024692 183
1783 3300014326 Ga0157380_10015457 Ga0157380_100154572 183
1784 3300014326 Ga0157380_10039987 Ga0157380_100399873 183
1785 3300014968 Ga0157379_10047420 Ga0157379_100474204 183
1786 3300014968 Ga0157379_10127813 Ga0157379_101278134 183
1787 3300017792 Ga0163161_10100476 Ga0163161_101004762 183
1788 3300025315 Ga0207697_10011283 Ga0207697_100112833 183
1789 3300025893 Ga0207682_10004024 Ga0207682_100040246 183
1790 3300025899 Ga0207642_10015514 Ga0207642_100155141 183
1791 3300025901 Ga0207688_10005288 Ga0207688_100052885 183
1792 3300025903 Ga0207680_10013221 Ga0207680_100132216 183
1793 3300025904 Ga0207647_10256557 Ga0207647_102565571 183
1794 3300025907 Ga0207645_10009600 Ga0207645_100096005 183
1795 3300025907 Ga0207645_10059577 Ga0207645_100595772 183
1796 3300025908 Ga0207643_10005835 Ga0207643_100058354 183
1797 3300025911 Ga0207654_10319338 Ga0207654_103193382 183
1798 3300025912 Ga0207707_10000335 Ga0207707_1000033531 183
1799 3300025914 Ga0207671_10611068 Ga0207671_106110681 183
1800 3300025917 Ga0207660_10022527 Ga0207660_100225274 183
1801 3300025917 Ga0207660_10395635 Ga0207660_103956351 183
1802 3300025918 Ga0207662_10005591 Ga0207662_100055914 183
1803 3300025921 Ga0207652_10001909 Ga0207652_100019098 183
1804 3300025921 Ga0207652_10104029 Ga0207652_101040292 183
1805 3300025922 Ga0207646_10529836 Ga0207646_105298362 183
1806 3300025923 Ga0207681_10479708 Ga0207681_104797081 183
1807 3300025925 Ga0207650_10629943 Ga0207650_106299431 183
1808 3300025926 Ga0207659_10292455 Ga0207659_102924552 183
1809 3300025931 Ga0207644_10132251 Ga0207644_101322511 183
1810 3300025933 Ga0207706_10004974 Ga0207706_100049745 183
1811 3300025933 Ga0207706_10604219 Ga0207706_106042191 183
1812 3300025934 Ga0207686_10023796 Ga0207686_100237962 183
1813 3300025935 Ga0207709_10074046 Ga0207709_100740462 183
1814 3300025935 Ga0207709_10081560 Ga0207709_100815602 183
1815 3300025936 Ga0207670_10339940 Ga0207670_103399402 183
1816 3300025937 Ga0207669_10009982 Ga0207669_100099824 183
1817 3300025940 Ga0207691_10053702 Ga0207691_100537022 183
1818 3300025940 Ga0207691_10162449 Ga0207691_101624492 183
1819 3300025940 Ga0207691_10799052 Ga0207691_107990522 183
1820 3300025942 Ga0207689_10014962 Ga0207689_100149625 183
1821 3300025942 Ga0207689_10650546 Ga0207689_106505461 183
1822 3300025944 Ga0207661_10169723 Ga0207661_101697234 183
1823 3300025945 Ga0207679_10122002 Ga0207679_101220021 183
1824 3300025945 Ga0207679_10587555 Ga0207679_105875552 183
1825 3300025945 Ga0207679_10682112 Ga0207679_106821121 183
1826 3300025961 Ga0207712_10016553 Ga0207712_100165533 183
1827 3300025961 Ga0207712_10019000 Ga0207712_100190002 183
1828 3300025961 Ga0207712_11550712 Ga0207712_115507121 183
1829 3300025972 Ga0207668_10135035 Ga0207668_101350352 183
1830 3300025981 Ga0207640_10993294 Ga0207640_109932941 183
1831 3300025986 Ga0207658_10041621 Ga0207658_100416214 183
1832 3300025986 Ga0207658_10817054 Ga0207658_108170541 183
1833 3300026023 Ga0207677_10095043 Ga0207677_100950432 183
1834 3300026041 Ga0207639_10269115 Ga0207639_102691152 183
1835 3300026075 Ga0207708_10002796 Ga0207708_100027963 183
1836 3300026075 Ga0207708_10007857 Ga0207708_100078577 183
1837 3300026078 Ga0207702_10355129 Ga0207702_103551292 183
1838 3300026088 Ga0207641_10004827 Ga0207641_100048275 183
1839 3300026088 Ga0207641_10034599 Ga0207641_100345995 183
1840 3300026088 Ga0207641_10255113 Ga0207641_102551132 183
1841 3300026089 Ga0207648_10021375 Ga0207648_100213757 183
1842 3300026089 Ga0207648_10363368 Ga0207648_103633682 183
1843 3300026095 Ga0207676_10171962 Ga0207676_101719621 183
1844 3300026095 Ga0207676_10352853 Ga0207676_103528531 183
1845 3300026116 Ga0207674_10169193 Ga0207674_101691931 183
1846 3300026116 Ga0207674_10409432 Ga0207674_104094321 183
1847 3300026118 Ga0207675_100007670 Ga0207675_1000076706 183
1848 3300026118 Ga0207675_100041384 Ga0207675_1000413843 183
1849 3300026118 Ga0207675_100186483 Ga0207675_1001864832 183
1850 3300026118 Ga0207675_100248374 Ga0207675_1002483742 183
1851 3300026118 Ga0207675_100359216 Ga0207675_1003592161 183
1852 3300026121 Ga0207683_10021685 Ga0207683_100216855 183
1853 3300027907 Ga0207428_10109001 Ga0207428_101090012 183
1854 3300027907 Ga0207428_10373463 Ga0207428_103734632 183
1855 3300028379 Ga0268266_10157774 Ga0268266_101577743 183
1856 3300028380 Ga0268265_10130050 Ga0268265_101300503 183
1857 3300028380 Ga0268265_10620971 Ga0268265_106209711 183
1858 3300028380 Ga0268265_10673478 Ga0268265_106734781 183
1859 3300028380 Ga0268265_11440904 Ga0268265_114409041 183
1860 3300028381 Ga0268264_10151469 Ga0268264_101514692 183
1861 3300028381 Ga0268264_10372365 Ga0268264_103723653 183
1862 3300031548 Ga0307408_100056598 Ga0307408_1000565981 183
1863 3300031731 Ga0307405_10019355 Ga0307405_100193556 183
1864 3300031824 Ga0307413_10002016 Ga0307413_100020161 183
1865 3300031852 Ga0307410_10000799 Ga0307410_100007991 183
1866 3300031852 Ga0307410_10449896 Ga0307410_104498961 183
1867 3300031903 Ga0307407_10000206 Ga0307407_100002061 183
1868 3300031903 Ga0307407_10172521 Ga0307407_101725211 183
1869 3300031911 Ga0307412_10004249 Ga0307412_100042491 183
1870 3300031995 Ga0307409_100004602 Ga0307409_1000046024 183
1871 3300032005 Ga0307411_10050420 Ga0307411_100504201 183
1872 3300032005 Ga0307411_10145246 Ga0307411_101452461 183
1873 3300032126 Ga0307415_100043193 Ga0307415_1000431935 183
1874 3300036401 Ga0373937_0092052 Ga0373937_0092052_2123_2719 183
1875 3300037471 Ga0395905_0263957 Ga0395905_0263957_923_1588 183
1876 3300038996 Ga0242420_002252 Ga0242420_002252_1130_1690 183
1877 3300045051 Ga0451576_0055959 Ga0451576_0055959_1939_2496 183
1878 3300045051 Ga0451576_0662930 Ga0451576_0662930_151_711 183
1879 3300045051 Ga0451576_0904556 Ga0451576_0904556_210_767 183
1880 3300046454 Ga0495592_0190801 Ga0495592_0190801_644_1240 183
1881 3300046499 Ga0495594_0405832 Ga0495594_0405832_145_741 183
1882 3300046516 Ga0495628_0109190 Ga0495628_0109190_20_616 183
1883 3300046528 Ga0495642_0085544 Ga0495642_0085544_670_1278 183
1884 3300046533 Ga0495640_0583417 Ga0495640_0583417_37_633 183
1885 3300046537 Ga0495598_0175165 Ga0495598_0175165_115_723 183
1886 3300046678 Ga0495599_0247522 Ga0495599_0247522_124_720 183
1887 3300046683 Ga0495658_0050397 Ga0495658_0050397_1408_2016 183
1888 3300047317 Ga0495604_0138528 Ga0495604_0138528_267_863 183
1889 3300047471 Ga0495684_0025690 Ga0495684_0025690_1515_2111 183
1890 3300048905 Ga0496102_0050765 Ga0496102_0050765_543_1100 183
1891 3300048906 Ga0496103_0288703 Ga0496103_0288703_10_567 183
1892 3300048907 Ga0496104_0085809 Ga0496104_0085809_1238_1795 183
1893 3300048908 Ga0496105_0488511 Ga0496105_0488511_85_681 183
1894 3300048912 Ga0496109_0176089 Ga0496109_0176089_1256_1813 183
1895 3300048925 Ga0496122_0003158 Ga0496122_0003158_5376_5981 183
1896 3300048926 Ga0496123_0010900 Ga0496123_0010900_1500_2105 183
1897 3300048929 Ga0496126_0033945 Ga0496126_0033945_3969_4574 183
1898 3300050507 nmdc:mga05p37_129348_c1 nmdc:mga05p37_129348_c1_1684_2241 183
1899 3300050507 nmdc:mga05p37_44653_c1 nmdc:mga05p37_44653_c1_1120_1677 183
1900 3300050511 nmdc:mga08y16_197181_c1 nmdc:mga08y16_197181_c1_1487_2038 183
1901 3300050511 nmdc:mga08y16_29980_c1 nmdc:mga08y16_29980_c1_3480_4037 183
1902 3300050511 nmdc:mga08y16_476308_c1 nmdc:mga08y16_476308_c1_618_1175 183
1903 3300050511 nmdc:mga08y16_49145_c1 nmdc:mga08y16_49145_c1_3720_4328 183
1904 3300050511 nmdc:mga08y16_55014_c1 nmdc:mga08y16_55014_c1_2223_2774 183
1905 3300050512 nmdc:mga0n895_1224906_c1 nmdc:mga0n895_1224906_c1_70_636 183
1906 3300050515 nmdc:mga0a205_117553_c1 nmdc:mga0a205_117553_c1_1316_1873 183
1907 3300050515 nmdc:mga0a205_6702_c1 nmdc:mga0a205_6702_c1_7180_7740 183
1908 3300053077 Ga0495601_0086354 Ga0495601_0086354_468_1064 183
1909 3300053084 Ga0495595_0008948 Ga0495595_0008948_302_898 183
1910 3300053085 Ga0495619_0002138 Ga0495619_0002138_4517_5113 183
1911 3300054114 Ga0501084_0874960 Ga0501084_0874960_120_695 183
1912 3300061734 Ga0530510_0460838 Ga0530510_0460838_85_660 183
1913 iso_pu_bacteria 2995948881 2995951503 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

38

178

0.94

PF02915

Rubrerythrin

Rubrerythrin

39

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vzb-assembly1.cif.gz_A a dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis 0.9628 36 182
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.9598 40 179
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9532 38 179
5hjf-assembly1.cif.gz_D the apo form of dps4 from nostoc punctiforme 0.9471 37 179
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9456 39 179
ID Description Score Start End Superfamily
2vzbB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9628 36 182 1.20.1260.10
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9598 40 179 1.20.1260.10
5hjfD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9471 37 179 1.20.1260.10
2c6rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9467 38 179 1.20.1260.10
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9456 39 179 1.20.1260.10
ID Description Score Start End GO Terms
AF-F1VVE5-F1-model_v4 Putative bacterioferritin 1 46 182 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A534PC10-F1-model_v4 Bacterioferritin 0.9979 50 183 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A534AUP0-F1-model_v4 Ferritin-like domain-containing protein 0.9973 73 179 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-E6PIX5-F1-model_v4 Putative bacterioferritin (Cytochrome b1) 0.9965 27 183 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A656GYT0-F1-model_v4 deleted 0.9958 47 181

Feature Viewer

pLDDT pTM Quality
91.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map