F496036

General Info

Members Datasets Scaffolds Average Seq Length
1910 971 1460 291

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0002610|Ga0466966_0002610_1894_2916
Length 340
Sequence MHYRDERVQIAKIDFHCSLSRTARADYGPFSFEDAARSLASSSSKESPTMSSVQQSGTLSLGDRTVYRLGYGAMQLSGPGVFGPPKDRHAALTVLREVVASGVNHIDTSDFYGPHVTNQLIREALHPYRDDLVIVTKVGARRGEDASWMPAFSPEALTQAVHDNLRNLGLDVLDVVNLRVMFDVHAPAEGSIEAPLTVLAELQQQGLVRHVGLSNVTPMQLAEACRICNIVCVQNHYNLAHRGDEDFIDALARDGIAYVPYFPLGGFNPLQSSILSDVAARLDATPMQVALAWLLRRAPNIVLIPGTSSLAHLHENLAAAAVNLPDDAARELDGVAAKIN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
16 2512875024 Mesorhizobium loti R88b Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
21 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2519103095 Burkholderia sp. KJ006 Isolate Nodule
32 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
33 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
34 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
35 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
36 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
37 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
38 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
39 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
40 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
41 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
42 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
43 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
44 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
47 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
48 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
49 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
50 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
51 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
52 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
53 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
54 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
55 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
56 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
57 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
58 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
59 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
60 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
61 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
62 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
63 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
64 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
65 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
66 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
67 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
68 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
69 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
70 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
71 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
72 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
73 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
74 2643221568 Rhizobium sp. Root564 Isolate Unclassified
75 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
76 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
77 2643221596 Acidovorax sp. Root70 Isolate Unclassified
78 2643221607 Rhizobium sp. Root73 Isolate Unclassified
79 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
80 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
81 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
82 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
83 2643221664 Massilia sp. Root418 Isolate Unclassified
84 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
85 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
86 2643221693 Rhizobium sp. Root491 Isolate Unclassified
87 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
88 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
89 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
90 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
91 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
92 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
93 2718217882 Rhizobium sp. N741 Isolate Nodule
94 2718217927 Rhizobium sp. N324 Isolate Nodule
95 2718218009 Rhizobium sp. N561 Isolate Nodule
96 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
97 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
98 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
99 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
100 2718218363 Rhizobium sp. N113 Isolate Nodule
101 2718218365 Rhizobium sp. N731 Isolate Nodule
102 2718218366 Rhizobium sp. N621 Isolate Nodule
103 2718218423 Rhizobium sp. N941 Isolate Nodule
104 2721755514 Rhizobium sp. N6212 Isolate Nodule
105 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
106 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
107 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
108 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
109 2721755809 Rhizobium sp. N541 Isolate Nodule
110 2721755810 Rhizobium sp. N871 Isolate Nodule
111 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
112 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
113 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
114 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
115 2728369365 Rhizobium sp. N1341 Isolate Nodule
116 2728369397 Rhizobium sp. N1314 Isolate Nodule
117 2734482264 Dyella sp. AD052 Isolate Unclassified
118 2738541277 Variovorax sp. GV051 Isolate Unclassified
119 2738541307 Variovorax sp. GV008 Isolate Unclassified
120 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
121 2738543019 Variovorax sp. GV040 Isolate Unclassified
122 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
123 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
124 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
125 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
126 2751185917 Enterobacter sp. HK169 Isolate Unclassified
127 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
128 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
129 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
130 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
131 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
132 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
133 2791355260 Rhizobium sp. L9 Isolate Nodule
134 2791355261 Rhizobium sp. J15 Isolate Nodule
135 2791355264 Rhizobium sp. S9 Isolate Nodule
136 2791355265 Rhizobium sp. H4 Isolate Nodule
137 2791355266 Rhizobium sp. L43 Isolate Nodule
138 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
139 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
140 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
141 2802429633 Rhizobium anhuiense J3 Isolate Nodule
142 2802429634 Rhizobium anhuiense S10 Isolate Nodule
143 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
144 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
145 2802429637 Rhizobium anhuiense C15 Isolate Nodule
146 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
147 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
148 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
149 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
150 2818991436 Collimonas arenae 515 Isolate Unclassified
151 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
152 2818991457 Xanthomonas translucens 569 Isolate Unclassified
153 2821118458 Enterobacter asburiae 609 Isolate Unclassified
154 2821131069 Duganella sp. 1224 Isolate Unclassified
155 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
156 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
157 2831864461 Roseateles noduli HZ7 Isolate Nodule
158 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
159 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
160 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
161 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
162 2838061910 Rhizobium phaseoli L15 Isolate Nodule
163 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
164 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
165 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
166 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
167 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
168 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
169 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
170 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
171 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
172 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
173 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
174 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
175 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
176 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
177 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
178 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
179 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
180 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
181 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
182 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
183 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
184 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
185 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
186 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
187 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
188 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
189 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
190 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
191 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
192 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
193 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
194 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
195 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
196 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
197 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
198 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
199 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
200 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
201 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
202 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
203 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
204 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
205 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
206 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
207 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
208 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
209 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
210 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
211 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
212 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
213 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
214 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
215 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
216 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
217 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
218 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
219 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
220 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
221 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
222 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
223 2855730933 Achromobacter sp. HZ28 Isolate Nodule
224 2855767633 Achromobacter sp. HZ34 Isolate Nodule
225 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
226 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
227 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
228 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
229 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
230 2857564685 Duganella sp. R-74599 Isolate Unclassified
231 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
232 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
233 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
234 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
235 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
236 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
237 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
238 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
239 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
240 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
241 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
242 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
243 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
244 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
245 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
246 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
247 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
248 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
249 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
250 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
251 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
252 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
253 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
254 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
255 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
256 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
257 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
258 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
259 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
260 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
261 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
262 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
263 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
264 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
265 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
266 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
267 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
268 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
269 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
270 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
271 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
272 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
273 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
274 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
275 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
276 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
277 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
278 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
279 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
280 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
281 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
282 2904564687 Burkholderia sp. 571 Isolate Unclassified
283 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
284 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
285 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
286 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
287 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
288 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
289 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
290 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
291 2909042592 Labrys sp. LIt4 Isolate Nodule
292 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
293 2919085039 Luteibacter sp. 1214 Isolate Unclassified
294 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
295 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
296 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
297 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
298 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
299 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
300 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
301 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
302 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
303 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
304 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
305 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
306 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
307 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
308 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
309 2928058823 Ralstonia sp. 1138 Isolate Unclassified
310 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
311 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
312 2928163908 Burkholderia sp. 567 Isolate Unclassified
313 2928536128 Burkholderia sola 565 Isolate Unclassified
314 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
315 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
316 2932406140 Serratia sp. 2723 Isolate Rhizosphere
317 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
318 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
319 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
320 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
321 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
322 2936381700 Rhizobium chutanense C16 Isolate Unclassified
323 2937539931 Pantoea sp. LS15 Isolate Unclassified
324 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
325 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
326 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
327 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
328 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
329 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
330 2939577877 Serratia sp. 509 Isolate Rhizosphere
331 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
332 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
333 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
334 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
335 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
336 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
337 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
338 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
339 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
340 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
341 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
342 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
343 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
344 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
345 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
346 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
347 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
348 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
349 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
350 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
351 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
352 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
353 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
354 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
355 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
356 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
357 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
358 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
359 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
360 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
361 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
362 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
363 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
364 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
365 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
366 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
367 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
368 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
369 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
370 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
371 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
372 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
373 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
374 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
375 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
376 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
377 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
378 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
379 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
380 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
381 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
382 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
383 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
384 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
385 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
386 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
387 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
388 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
389 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
390 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
391 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
392 2996893221 Rhizobium sp. R635 Isolate Nodule
393 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
394 3004167301 Mesorhizobium loti 582 Isolate Unclassified
395 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
396 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
397 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
398 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
399 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
400 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
401 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
402 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
403 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
404 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
405 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
406 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
407 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
408 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
409 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
410 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
411 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
412 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
413 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
414 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
415 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
416 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
417 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
418 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
419 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
420 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
421 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
422 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
423 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
424 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
425 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
426 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
427 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
428 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
429 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
430 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
431 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
432 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
433 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
434 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
435 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
436 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
437 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
438 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
439 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
440 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
441 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
442 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
443 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
444 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
445 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
446 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
447 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
448 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
449 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
450 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
451 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
452 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
453 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
454 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
455 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
456 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
457 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
458 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
459 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
460 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
461 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
462 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
463 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
464 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
465 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
466 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
467 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
468 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
469 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
470 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
471 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
472 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
473 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
474 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
475 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
476 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
477 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
478 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
479 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
480 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
481 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
482 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
483 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
484 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
485 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
486 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
487 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
488 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
489 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
490 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
491 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
492 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
493 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
494 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
495 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
496 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
497 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
498 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
499 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
500 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
501 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
502 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
503 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
504 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
505 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
506 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
507 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
508 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
509 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
510 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
511 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
512 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
513 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
514 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
515 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
516 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
517 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
518 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
519 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
520 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
521 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
522 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
523 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
524 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
525 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
526 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
527 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
528 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
529 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
530 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
531 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
532 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
533 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
534 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
535 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
536 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
537 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
538 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
539 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
540 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
541 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
542 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
543 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
544 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
545 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
546 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
547 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
548 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
549 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
550 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
551 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
552 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
553 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
554 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
555 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
556 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
557 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
558 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
559 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
560 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
561 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
562 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
563 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
564 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
565 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
566 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
567 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
568 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
569 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
571 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
572 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
573 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
574 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
575 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
576 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
577 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
578 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
579 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
582 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
583 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
584 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
585 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
587 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
588 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
589 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
591 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
592 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
593 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
594 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
595 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
596 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
598 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
599 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
600 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
601 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
602 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
603 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
604 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
605 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
606 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
607 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
656 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
659 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
661 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
662 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
666 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
667 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
668 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
669 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
671 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
672 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
673 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
674 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
675 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
676 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
677 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
679 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
680 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
681 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
682 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
683 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
684 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
685 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
686 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
687 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
688 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
689 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
690 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
691 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
692 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
693 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
694 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
695 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
696 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
697 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
698 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
699 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
700 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
701 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
702 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
703 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
704 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
705 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
706 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
707 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
708 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
709 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
710 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
711 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
712 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
713 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
714 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
715 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
716 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
717 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
718 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
719 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
720 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
721 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
722 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
723 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
724 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
725 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
726 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
727 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
728 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
729 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
730 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
731 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
732 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
733 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
734 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
735 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
736 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
737 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
738 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
739 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
740 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
741 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
742 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
743 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
744 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
745 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
746 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
747 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
748 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
749 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
750 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
751 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
752 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
753 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
754 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
755 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
756 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
757 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
758 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
759 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
760 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
761 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
762 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
763 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
764 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
765 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
766 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
767 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
768 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
769 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
770 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
771 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
772 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
773 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
774 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
775 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
776 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
777 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
778 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
779 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
780 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
781 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
782 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
783 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
784 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
785 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
786 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
787 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
788 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
789 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
790 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
791 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
792 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
793 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
794 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
795 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
796 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
797 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
798 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
799 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
800 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
801 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
802 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
803 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
804 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
805 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
806 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
807 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
808 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
809 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
810 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
811 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
812 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
813 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
814 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
815 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
816 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
817 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
818 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
819 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
820 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
821 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
822 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
823 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
824 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
825 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
826 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
827 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
828 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
829 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
830 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
831 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
832 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
833 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
834 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
835 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
836 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
837 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
838 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
839 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
840 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
841 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
842 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
843 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
844 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
845 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
846 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
847 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
848 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
849 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
850 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
851 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
852 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
853 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
854 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
855 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
856 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
857 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
858 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
859 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
860 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
861 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
862 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
863 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
864 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
865 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
866 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
867 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
868 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
869 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
870 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
871 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
872 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
873 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
874 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
875 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
876 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
877 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
878 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
879 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
880 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
881 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
882 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
883 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
884 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
885 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
886 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
887 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
888 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
889 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
890 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
891 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
892 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
893 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
894 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
895 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
896 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
897 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
898 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
899 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
900 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
901 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
902 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
903 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
904 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
905 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
906 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
907 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
908 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
909 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
910 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
911 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
912 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
913 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
914 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
915 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
916 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
917 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
918 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
919 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
920 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
921 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
922 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
923 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
924 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
925 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
926 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
927 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
928 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
929 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
930 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
931 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
932 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
933 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
934 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
935 8005275841 Rhizobium sp. N4311 Isolate Nodule
936 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
937 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
938 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
939 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
940 8005382845 Rhizobium sp. R634 Isolate Nodule
941 8005395548 Rhizobium sp. R339 Isolate Nodule
942 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
943 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
944 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
945 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
946 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
947 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
948 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
949 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
950 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
951 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
952 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
953 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
954 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
955 8018176218 Rhizobium sp. N122 Isolate Nodule
956 8018221730 Enterobacter sp. CM29 Isolate Unclassified
957 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
958 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
959 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
960 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
961 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
962 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
963 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
964 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
965 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
966 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
967 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
968 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
969 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
970 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
971 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.86
Metatranscriptomes 0.58
Isolates 23.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 15.08
Nodule 15.34
Rhizoplane 3.14
Rhizosphere 51.05
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1809446 2162886007 Bacteria 1415
2 SwRhRL2b_contig_239577 2162886007 Bacteria 1747
3 SwRhRL2b_contig_97959 2162886007 Bacteria 8750
4 MRS1b_contig_984201 2162886011 Bacteria 1212
5 JGI24741J21665_1000141 3300001915 Bacteria 20031
6 JGI24741J21665_1003056 3300001915 Bacteria 4122
7 JGI24740J21852_10000026 3300001979 Bacteria 49563
8 JGI24740J21852_10001737 3300001979 Bacteria 10007
9 JGI24739J22299_10034747 3300001989 Bacteria 1715
10 JGI24738J21930_10000927 3300002075 Bacteria 8430
11 JGI25156J39149_1003279 3300002705 Bacteria 5362
12 JGI25156J39149_1007730 3300002705 Bacteria 2784
13 JGI25162J39368_1000177 3300002737 Bacteria 68786
14 JGI25162J39368_1000323 3300002737 Bacteria 41942
15 JGI25162J39368_1000775 3300002737 Bacteria 21515
16 JGI25162J39368_1000803 3300002737 Bacteria 20853
17 JGI25162J39368_1006232 3300002737 Bacteria 2108
18 JGI25154J39366_1000451 3300002738 Bacteria 21633
19 JGI25157J39369_1001008 3300002741 Bacteria 13088
20 JGI25164J39214_1000032 3300002772 Bacteria 144465
21 JGI25152J39213_1000657 3300002773 Bacteria 18088
22 JGI25152J39213_1002074 3300002773 Bacteria 7887
23 JGI25152J39213_1007876 3300002773 Bacteria 2703
24 JGI25159J45721_1000276 3300002987 Bacteria 24129
25 JGI25151J46595_10000341 3300003187 Bacteria 50002
26 JGI25151J46595_10000485 3300003187 Bacteria 37594
27 JGI25151J46595_10002329 3300003187 Bacteria 11566
28 JGI25165J46597_1000136 3300003214 Bacteria 122521
29 JGI25165J46597_1000406 3300003214 Bacteria 45616
30 JGI25165J46597_1000415 3300003214 Bacteria 44714
31 JGI25165J46597_1007210 3300003214 Bacteria 1872
32 JGI25153J46596_10000344 3300003215 Bacteria 32730
33 JGI25153J46596_10003378 3300003215 Bacteria 8955
34 JGI25153J46596_10004937 3300003215 Bacteria 7087
35 rootH1_10012089 3300003316 Bacteria 11247
36 rootH1_10028145 3300003316 Bacteria 16351
37 rootH1_10052697 3300003316 Bacteria 3957
38 rootH2_10037401 3300003320 Bacteria 5875
39 rootH2_10054426 3300003320 Bacteria 2427
40 rootH2_10057798 3300003320 Bacteria 4724
41 rootL2_10070782 3300003322 Bacteria 8969
42 rootH1_10003256 3300003323 Bacteria 53834
43 rootH1_10072615 3300003323 Bacteria 2144
44 rootH1_10189607 3300003323 Bacteria 2363
45 rootH1_10192974 3300003323 Bacteria 1548
46 JGI25160J50197_1000023 3300003354 Bacteria 200692
47 JGI25160J50197_1000384 3300003354 Bacteria 28677
48 JGI25161J50226_1000012 3300003374 Bacteria 200668
49 JGI25161J50226_1001233 3300003374 Bacteria 8299
50 Ga0055538_1003626 3300003751 Bacteria 1919
51 Ga0055538_1005754 3300003751 Bacteria 1258
52 Ga0055539_1000053 3300003752 Bacteria 165149
53 Ga0055539_1003561 3300003752 Bacteria 2164
54 Ga0055533_1003976 3300003756 Bacteria 2800
55 Ga0055533_1003999 3300003756 Bacteria 2787
56 Ga0055532_1000033 3300003758 Bacteria 214652
57 Ga0055532_1000301 3300003758 Bacteria 30248
58 Ga0055532_1000363 3300003758 Bacteria 23828
59 Ga0055532_1000680 3300003758 Bacteria 12818
60 Ga0055525_1000310 3300003759 Bacteria 39767
61 Ga0055527_1000279 3300003760 Bacteria 30091
62 Ga0055527_1004474 3300003760 Bacteria 1918
63 Ga0055527_1005898 3300003760 Bacteria 1561
64 Ga0055535_1000024 3300003761 Bacteria 214652
65 Ga0055535_1000589 3300003761 Bacteria 30248
66 Ga0055535_1000781 3300003761 Bacteria 23313
67 Ga0055535_1001563 3300003761 Bacteria 11137
68 Ga0055535_1003702 3300003761 Bacteria 4128
69 Ga0055542_1000390 3300003762 Bacteria 44140
70 Ga0055542_1000565 3300003762 Bacteria 32556
71 Ga0055542_1003574 3300003762 Bacteria 4128
72 Ga0055542_1003740 3300003762 Bacteria 3972
73 Ga0055542_1016377 3300003762 Bacteria 1169
74 Ga0055529_1000044 3300003763 Bacteria 214652
75 Ga0055529_1000183 3300003763 Bacteria 86414
76 Ga0055529_1000247 3300003763 Bacteria 66795
77 Ga0055529_1001634 3300003763 Bacteria 5953
78 Ga0055526_1000295 3300003771 Bacteria 41778
79 Ga0055526_1000353 3300003771 Bacteria 37277
80 Ga0055526_1000400 3300003771 Bacteria 35032
81 Ga0055526_1001272 3300003771 Bacteria 18075
82 Ga0055526_1006591 3300003771 Bacteria 6257
83 Ga0055526_1010319 3300003771 Bacteria 4364
84 Ga0055526_1026948 3300003771 Bacteria 1793
85 Ga0055524_1001036 3300003775 Bacteria 17159
86 Ga0055524_1005033 3300003775 Bacteria 5983
87 Ga0055524_1010008 3300003775 Bacteria 3810
88 Ga0055524_1017046 3300003775 Bacteria 2576
89 Ga0055524_1026965 3300003775 Bacteria 1758
90 Ga0055524_1027816 3300003775 Bacteria 1706
91 Ga0055534_1000981 3300003784 Bacteria 12605
92 Ga0055528_1000034 3300003790 Bacteria 118577
93 Ga0055528_1005932 3300003790 Bacteria 5600
94 Ga0055528_1007720 3300003790 Bacteria 4715
95 Ga0055528_1017273 3300003790 Bacteria 2510
96 Ga0055528_1024757 3300003790 Bacteria 1788
97 Ga0055540_1008434 3300003792 Bacteria 3712
98 Ga0055541_1006780 3300003841 Bacteria 1919
99 Ga0058692_1000057 3300003856 Bacteria 103718
100 Ga0058692_1000187 3300003856 Bacteria 37578
101 Ga0058692_1000790 3300003856 Bacteria 12695
102 Ga0058692_1001172 3300003856 Bacteria 10079
103 Ga0058692_1002515 3300003856 Bacteria 6096
104 JGI25405J52794_10021798 3300003911 Bacteria 1296
105 Ga0055543_1000009 3300004625 Bacteria 200706
106 Ga0055543_1000505 3300004625 Bacteria 22435
107 Ga0055543_1001297 3300004625 Bacteria 10273
108 Ga0065165_1000064 3300005262 Bacteria 175153
109 Ga0065165_1003434 3300005262 Bacteria 11144
110 Ga0065704_10000492 3300005289 Bacteria 24931
111 Ga0065704_10002773 3300005289 Bacteria 6059
112 Ga0065704_10003241 3300005289 Bacteria 5622
113 Ga0065704_10005983 3300005289 Bacteria 3600
114 Ga0065712_10080638 3300005290 Bacteria 3083
115 Ga0065715_10110171 3300005293 Bacteria 2629
116 Ga0070658_10027491 3300005327 Bacteria 4565
117 Ga0070658_10057535 3300005327 Bacteria 3163
118 Ga0070658_10086719 3300005327 Bacteria 2575
119 Ga0070658_10166371 3300005327 Bacteria 1851
120 Ga0070658_10179465 3300005327 Bacteria 1781
121 Ga0070683_100109746 3300005329 Bacteria 2602
122 Ga0070690_100020249 3300005330 Bacteria 4051
123 Ga0070690_100271451 3300005330 Bacteria 1206
124 Ga0070670_100000416 3300005331 Bacteria 35091
125 Ga0070670_100000697 3300005331 Bacteria 26100
126 Ga0070670_100029918 3300005331 Bacteria 4689
127 Ga0068869_100121152 3300005334 Bacteria 2001
128 Ga0068869_100399246 3300005334 Bacteria 1130
129 Ga0070666_10041064 3300005335 Bacteria 3090
130 Ga0070680_100001870 3300005336 Bacteria 15428
131 Ga0070680_100004874 3300005336 Bacteria 10105
132 Ga0070680_100005276 3300005336 Bacteria 9772
133 Ga0070680_100005898 3300005336 Bacteria 9302
134 Ga0070680_100042214 3300005336 Bacteria 3700
135 Ga0070680_100042511 3300005336 Bacteria 3688
136 Ga0070682_100041799 3300005337 Bacteria 2827
137 Ga0068868_100010007 3300005338 Bacteria 6852
138 Ga0068868_100028727 3300005338 Bacteria 4255
139 Ga0068868_100036766 3300005338 Bacteria 3793
140 Ga0070660_100000261 3300005339 Bacteria 34930
141 Ga0070660_100017615 3300005339 Bacteria 5209
142 Ga0070660_100315809 3300005339 Bacteria 1283
143 Ga0070691_10060783 3300005341 Bacteria 1816
144 Ga0070691_10124799 3300005341 Bacteria 1299
145 Ga0070661_100000021 3300005344 Bacteria 128510
146 Ga0070661_100000901 3300005344 Bacteria 21311
147 Ga0070661_100042774 3300005344 Bacteria 3307
148 Ga0070661_100062414 3300005344 Bacteria 2735
149 Ga0070661_100127868 3300005344 Bacteria 1907
150 Ga0070692_10100401 3300005345 Bacteria 1585
151 Ga0070675_100062107 3300005354 Bacteria 3086
152 Ga0070675_100139825 3300005354 Bacteria 2069
153 Ga0070671_100064953 3300005355 Bacteria 3040
154 Ga0070671_100067148 3300005355 Bacteria 2990
155 Ga0070671_100158401 3300005355 Bacteria 1913
156 Ga0070673_100002004 3300005364 Bacteria 12291
157 Ga0070688_100000670 3300005365 Bacteria 17041
158 Ga0070688_100061932 3300005365 Bacteria 2367
159 Ga0070688_100131186 3300005365 Bacteria 1691
160 Ga0070659_100000108 3300005366 Bacteria 61185
161 Ga0070659_100098295 3300005366 Bacteria 2353
162 Ga0070659_100105743 3300005366 Bacteria 2268
163 Ga0070659_100138341 3300005366 Bacteria 1981
164 Ga0070659_100213551 3300005366 Bacteria 1590
165 Ga0070667_100024748 3300005367 Bacteria 4988
166 Ga0070667_100040088 3300005367 Bacteria 3927
167 Ga0070667_100041372 3300005367 Bacteria 3866
168 Ga0070667_100058983 3300005367 Bacteria 3246
169 Ga0070667_100100477 3300005367 Bacteria 2498
170 Ga0070703_10002464 3300005406 Bacteria 5317
171 Ga0070703_10056291 3300005406 Bacteria 1273
172 Ga0070709_10061571 3300005434 Bacteria 2389
173 Ga0070701_10124100 3300005438 Bacteria 1459
174 Ga0070711_100000154 3300005439 Bacteria 36893
175 Ga0070711_100118168 3300005439 Bacteria 1956
176 Ga0070705_100000105 3300005440 Bacteria 47664
177 Ga0070700_100001122 3300005441 Bacteria 13254
178 Ga0070694_100004390 3300005444 Bacteria 8484
179 Ga0070663_100000004 3300005455 Bacteria 254839
180 Ga0070663_100002324 3300005455 Bacteria 10678
181 Ga0070663_100005266 3300005455 Bacteria 7668
182 Ga0070663_100083158 3300005455 Bacteria 2357
183 Ga0070678_100178486 3300005456 Bacteria 1736
184 Ga0070662_100089051 3300005457 Bacteria 2314
185 Ga0070662_100383957 3300005457 Bacteria 1156
186 Ga0070681_10000874 3300005458 Bacteria 25402
187 Ga0070681_10004469 3300005458 Bacteria 13326
188 Ga0070681_10007901 3300005458 Bacteria 10409
189 Ga0070681_10322169 3300005458 Bacteria 1455
190 Ga0070681_10328815 3300005458 Bacteria 1438
191 Ga0068867_100554336 3300005459 Bacteria 996
192 Ga0070685_10004218 3300005466 Bacteria 7256
193 Ga0070699_100000330 3300005518 Bacteria 45857
194 Ga0070679_100000934 3300005530 Bacteria 25378
195 Ga0070679_100007558 3300005530 Bacteria 10167
196 Ga0070679_100081078 3300005530 Bacteria 3234
197 Ga0070684_100044131 3300005535 Bacteria 3854
198 Ga0070684_100444376 3300005535 Bacteria 1198
199 Ga0068853_100189380 3300005539 Bacteria 1869
200 Ga0068853_100214779 3300005539 Bacteria 1754
201 Ga0068853_100238535 3300005539 Bacteria 1666
202 Ga0070686_100042207 3300005544 Bacteria 2856
203 Ga0070686_100227886 3300005544 Bacteria 1350
204 Ga0070695_100001309 3300005545 Bacteria 13753
205 Ga0070695_100059422 3300005545 Bacteria 2475
206 Ga0070696_100000069 3300005546 Bacteria 49879
207 Ga0070696_100291242 3300005546 Bacteria 1247
208 Ga0070693_100084080 3300005547 Bacteria 1904
209 Ga0070665_100002139 3300005548 Bacteria 22050
210 Ga0070665_100010264 3300005548 Bacteria 9478
211 Ga0070665_100011006 3300005548 Bacteria 9146
212 Ga0070665_100017050 3300005548 Bacteria 7285
213 Ga0070665_100072254 3300005548 Bacteria 3458
214 Ga0070665_100095775 3300005548 Bacteria 2973
215 Ga0070665_100096345 3300005548 Bacteria 2964
216 Ga0070665_100116162 3300005548 Bacteria 2678
217 Ga0070665_100154255 3300005548 Bacteria 2298
218 Ga0070665_100246946 3300005548 Bacteria 1785
219 Ga0070704_100001159 3300005549 Bacteria 13760
220 Ga0070704_100069702 3300005549 Bacteria 2549
221 Ga0068855_100000010 3300005563 Bacteria 246022
222 Ga0068855_100000195 3300005563 Bacteria 78223
223 Ga0068855_100000988 3300005563 Bacteria 35353
224 Ga0068855_100175538 3300005563 Bacteria 2425
225 Ga0068855_100468470 3300005563 Bacteria 1373
226 Ga0068855_100631052 3300005563 Bacteria 1153
227 Ga0070664_100000007 3300005564 Bacteria 176744
228 Ga0070664_100000030 3300005564 Bacteria 89030
229 Ga0070664_100000969 3300005564 Bacteria 22461
230 Ga0070664_100179353 3300005564 Bacteria 1882
231 Ga0070664_100179661 3300005564 Bacteria 1880
232 Ga0070664_100259160 3300005564 Bacteria 1564
233 Ga0068857_100003083 3300005577 Bacteria 13783
234 Ga0068857_100032292 3300005577 Bacteria 4629
235 Ga0068857_100055108 3300005577 Bacteria 3529
236 Ga0068857_100150582 3300005577 Bacteria 2107
237 Ga0068854_100000045 3300005578 Bacteria 91844
238 Ga0068854_100026179 3300005578 Bacteria 4006
239 Ga0068854_100171255 3300005578 Bacteria 1690
240 Ga0068854_100242391 3300005578 Bacteria 1436
241 Ga0068856_100000004 3300005614 Bacteria 233761
242 Ga0068856_100013928 3300005614 Bacteria 7778
243 Ga0068856_100025963 3300005614 Bacteria 5713
244 Ga0068856_100029524 3300005614 Bacteria 5356
245 Ga0068856_100262477 3300005614 Bacteria 1743
246 Ga0068856_100295311 3300005614 Bacteria 1637
247 Ga0068852_100000027 3300005616 Bacteria 113819
248 Ga0068852_100019019 3300005616 Bacteria 5426
249 Ga0068852_100030075 3300005616 Bacteria 4467
250 Ga0068852_100165037 3300005616 Bacteria 2071
251 Ga0068852_100178284 3300005616 Bacteria 1996
252 Ga0068852_100376523 3300005616 Bacteria 1392
253 Ga0068852_100732168 3300005616 Bacteria 1000
254 Ga0068859_100005533 3300005617 Bacteria 12866
255 Ga0068859_100016446 3300005617 Bacteria 7430
256 Ga0068859_100025880 3300005617 Bacteria 5887
257 Ga0068859_100109335 3300005617 Bacteria 2826
258 Ga0068859_100123093 3300005617 Bacteria 2661
259 Ga0068859_100159809 3300005617 Bacteria 2332
260 Ga0068864_100044086 3300005618 Bacteria 3821
261 Ga0068864_100382007 3300005618 Bacteria 1335
262 Ga0068851_10193651 3300005834 Bacteria 1131
263 Ga0068863_100000683 3300005841 Bacteria 34221
264 Ga0068863_100004808 3300005841 Bacteria 13303
265 Ga0068863_100027028 3300005841 Bacteria 5472
266 Ga0068863_100086368 3300005841 Bacteria 2972
267 Ga0068863_100126667 3300005841 Bacteria 2437
268 Ga0068863_100134507 3300005841 Bacteria 2362
269 Ga0068863_100556352 3300005841 Bacteria 1133
270 Ga0068858_100000111 3300005842 Bacteria 86228
271 Ga0068858_100099300 3300005842 Bacteria 2714
272 Ga0068858_100278124 3300005842 Bacteria 1594
273 Ga0068858_100486729 3300005842 Bacteria 1191
274 Ga0068860_100000439 3300005843 Bacteria 52876
275 Ga0068860_100011376 3300005843 Bacteria 8769
276 Ga0068860_100020906 3300005843 Bacteria 6341
277 Ga0068860_100148663 3300005843 Bacteria 2255
278 Ga0068860_100150557 3300005843 Bacteria 2240
279 Ga0068860_100151007 3300005843 Bacteria 2237
280 Ga0068860_100208932 3300005843 Bacteria 1893
281 Ga0068862_100001572 3300005844 Bacteria 20809
282 Ga0081455_10004123 3300005937 Bacteria 16434
283 Ga0081455_10009027 3300005937 Bacteria 10291
284 Ga0081455_10016579 3300005937 Bacteria 7105
285 Ga0081455_10056445 3300005937 Bacteria 3334
286 Ga0081540_1000092 3300005983 Bacteria 94188
287 Ga0081540_1089809 3300005983 Bacteria 1354
288 Ga0075365_10019425 3300006038 Bacteria 4194
289 Ga0075365_10121510 3300006038 Bacteria 1802
290 Ga0075365_10132810 3300006038 Bacteria 1723
291 Ga0075363_100024052 3300006048 Bacteria 3094
292 Ga0075363_100045564 3300006048 Bacteria 2326
293 Ga0075364_10003881 3300006051 Bacteria 8574
294 Ga0075364_10015008 3300006051 Bacteria 4797
295 Ga0075364_10073375 3300006051 Bacteria 2255
296 Ga0075364_10185860 3300006051 Bacteria 1407
297 Ga0075364_10228449 3300006051 Bacteria 1264
298 Ga0070716_100119615 3300006173 Bacteria 1647
299 Ga0070712_100000126 3300006175 Bacteria 40420
300 Ga0075362_10039953 3300006177 Bacteria 2064
301 Ga0075362_10111342 3300006177 Bacteria 1289
302 Ga0075367_10134593 3300006178 Bacteria 1529
303 Ga0075367_10265123 3300006178 Bacteria 1078
304 Ga0075369_10127115 3300006186 Bacteria 1156
305 Ga0075366_10220974 3300006195 Bacteria 1154
306 Ga0097621_100013057 3300006237 Bacteria 6176
307 Ga0097621_100134389 3300006237 Bacteria 2108
308 Ga0075370_10002020 3300006353 Bacteria 9197
309 Ga0075370_10010184 3300006353 Bacteria 4903
310 Ga0075370_10010830 3300006353 Bacteria 4779
311 Ga0075370_10014013 3300006353 Bacteria 4269
312 Ga0075370_10018625 3300006353 Bacteria 3768
313 Ga0075370_10125169 3300006353 Bacteria 1498
314 Ga0075370_10126994 3300006353 Bacteria 1487
315 Ga0068871_100000739 3300006358 Bacteria 22191
316 Ga0068871_100354221 3300006358 Bacteria 1299
317 Ga0075431_100311316 3300006847 Bacteria 1589
318 Ga0075434_100034079 3300006871 Bacteria 5027
319 Ga0075429_100137495 3300006880 Bacteria 2138
320 Ga0068865_100011752 3300006881 Bacteria 5484
321 Ga0068865_100017394 3300006881 Bacteria 4624
322 Ga0068865_100048661 3300006881 Bacteria 2918
323 Ga0075436_100001843 3300006914 Bacteria 14538
324 Ga0097620_100005533 3300006931 Bacteria 12866
325 Ga0097620_100016446 3300006931 Bacteria 7430
326 Ga0097620_100025879 3300006931 Bacteria 5887
327 Ga0097620_100109334 3300006931 Bacteria 2826
328 Ga0097620_100123094 3300006931 Bacteria 2661
329 Ga0097620_100159817 3300006931 Bacteria 2332
330 Ga0079104_1000205 3300006946 Bacteria 82673
331 Ga0079104_1000609 3300006946 Bacteria 35243
332 Ga0079104_1001874 3300006946 Bacteria 12740
333 Ga0079104_1024481 3300006946 Bacteria 1589
334 Ga0075435_100026548 3300007076 Bacteria 4520
335 Ga0105251_10000008 3300009011 Bacteria 213669
336 Ga0105251_10001647 3300009011 Bacteria 18903
337 Ga0105251_10003617 3300009011 Bacteria 11114
338 Ga0105251_10059009 3300009011 Bacteria 1811
339 Ga0105244_10000037 3300009036 Bacteria 161621
340 Ga0105244_10001078 3300009036 Bacteria 22727
341 Ga0105244_10004885 3300009036 Bacteria 9083
342 Ga0105244_10005575 3300009036 Bacteria 8328
343 Ga0105244_10006665 3300009036 Bacteria 7434
344 Ga0105244_10051119 3300009036 Bacteria 2106
345 Ga0105250_10000088 3300009092 Bacteria 80904
346 Ga0105250_10008534 3300009092 Bacteria 4345
347 Ga0105250_10011325 3300009092 Bacteria 3700
348 Ga0105240_10000222 3300009093 Bacteria 113825
349 Ga0105240_10000278 3300009093 Bacteria 101540
350 Ga0105240_10001873 3300009093 Bacteria 34963
351 Ga0105240_10009924 3300009093 Bacteria 13426
352 Ga0105240_10013307 3300009093 Bacteria 11309
353 Ga0105240_10024462 3300009093 Bacteria 7957
354 Ga0105240_10107270 3300009093 Bacteria 3387
355 Ga0105240_10282393 3300009093 Bacteria 1907
356 Ga0105240_10396954 3300009093 Bacteria 1554
357 Ga0111539_10002000 3300009094 Bacteria 27198
358 Ga0111539_10234427 3300009094 Bacteria 2137
359 Ga0105245_10017670 3300009098 Bacteria 6225
360 Ga0105245_10091060 3300009098 Bacteria 2806
361 Ga0105245_10096504 3300009098 Bacteria 2728
362 Ga0105247_10008991 3300009101 Bacteria 6086
363 Ga0105247_10010617 3300009101 Bacteria 5562
364 Ga0105247_10037292 3300009101 Bacteria 2966
365 Ga0105243_10000184 3300009148 Bacteria 72611
366 Ga0105243_10049156 3300009148 Bacteria 3326
367 Ga0105243_10099274 3300009148 Bacteria 2413
368 Ga0105243_10130061 3300009148 Bacteria 2135
369 Ga0105241_10086549 3300009174 Bacteria 2465
370 Ga0105241_10291453 3300009174 Bacteria 1397
371 Ga0105242_10005891 3300009176 Bacteria 9450
372 Ga0105242_10024858 3300009176 Bacteria 4734
373 Ga0105242_10370020 3300009176 Bacteria 1329
374 Ga0105248_10009030 3300009177 Bacteria 10965
375 Ga0105248_10032391 3300009177 Bacteria 5841
376 Ga0105248_10039423 3300009177 Bacteria 5290
377 Ga0105248_10072968 3300009177 Bacteria 3857
378 Ga0105248_10080310 3300009177 Bacteria 3665
379 Ga0105248_10139302 3300009177 Bacteria 2737
380 Ga0105248_10416741 3300009177 Bacteria 1512
381 Ga0105248_10528633 3300009177 Bacteria 1330
382 Ga0105237_10000277 3300009545 Bacteria 71828
383 Ga0105237_10000328 3300009545 Bacteria 66981
384 Ga0105237_10001925 3300009545 Bacteria 26498
385 Ga0105237_10003357 3300009545 Bacteria 19066
386 Ga0105237_10045750 3300009545 Bacteria 4403
387 Ga0105237_10046135 3300009545 Bacteria 4384
388 Ga0105237_10078992 3300009545 Bacteria 3280
389 Ga0105237_10125353 3300009545 Bacteria 2563
390 Ga0105237_10329753 3300009545 Bacteria 1530
391 Ga0105237_10409426 3300009545 Bacteria 1361
392 Ga0105238_10078371 3300009551 Bacteria 3294
393 Ga0105238_10249629 3300009551 Bacteria 1752
394 Ga0105238_10288025 3300009551 Bacteria 1624
395 Ga0105238_10288474 3300009551 Bacteria 1623
396 Ga0105238_10302791 3300009551 Bacteria 1582
397 Ga0105238_10350279 3300009551 Bacteria 1466
398 Ga0105238_10729561 3300009551 Bacteria 1004
399 Ga0105249_10004739 3300009553 Bacteria 11740
400 Ga0123341_1000005 3300009765 Bacteria 150422
401 Ga0123342_1019923 3300009766 Bacteria 5008
402 Ga0105239_10000433 3300010375 Bacteria 61072
403 Ga0105239_10001783 3300010375 Bacteria 28310
404 Ga0105239_10003475 3300010375 Bacteria 19275
405 Ga0105239_10039674 3300010375 Bacteria 5158
406 Ga0105239_10082341 3300010375 Bacteria 3543
407 Ga0105239_10152204 3300010375 Bacteria 2582
408 Ga0105239_10278197 3300010375 Bacteria 1884
409 Ga0105239_10500927 3300010375 Bacteria 1381
410 Ga0105239_10662342 3300010375 Bacteria 1192
411 Ga0105246_10011352 3300011119 Bacteria 5530
412 Ga0105246_10011744 3300011119 Bacteria 5443
413 Ga0105246_10111152 3300011119 Bacteria 2013
414 Ga0157326_1003400 3300012513 Bacteria 1677
415 Ga0157373_10001122 3300013100 Bacteria 20561
416 Ga0157373_10001155 3300013100 Bacteria 20224
417 Ga0157373_10001724 3300013100 Bacteria 16611
418 Ga0157373_10002821 3300013100 Bacteria 13144
419 Ga0157373_10054688 3300013100 Bacteria 2836
420 Ga0157373_10087440 3300013100 Bacteria 2196
421 Ga0157373_10208343 3300013100 Bacteria 1378
422 Ga0157371_10000028 3300013102 Bacteria 254964
423 Ga0157371_10000136 3300013102 Bacteria 107554
424 Ga0157371_10012605 3300013102 Bacteria 6453
425 Ga0157371_10022871 3300013102 Bacteria 4573
426 Ga0157371_10031350 3300013102 Bacteria 3830
427 Ga0157371_10065925 3300013102 Bacteria 2565
428 Ga0157370_10000002 3300013104 Bacteria 431400
429 Ga0157370_10000012 3300013104 Bacteria 201181
430 Ga0157370_10000065 3300013104 Bacteria 113986
431 Ga0157370_10001488 3300013104 Bacteria 29012
432 Ga0157370_10002472 3300013104 Bacteria 22293
433 Ga0157370_10013674 3300013104 Bacteria 8345
434 Ga0157370_10039973 3300013104 Bacteria 4531
435 Ga0157370_10043957 3300013104 Bacteria 4297
436 Ga0157369_10000112 3300013105 Bacteria 114309
437 Ga0157369_10001129 3300013105 Bacteria 33383
438 Ga0157369_10002704 3300013105 Bacteria 21151
439 Ga0157369_10008371 3300013105 Bacteria 11862
440 Ga0157369_10053573 3300013105 Bacteria 4359
441 Ga0157369_10198865 3300013105 Bacteria 2104
442 Ga0157369_10485037 3300013105 Bacteria 1279
443 Ga0157374_10003851 3300013296 Bacteria 12605
444 Ga0157374_10092371 3300013296 Bacteria 2888
445 Ga0157374_10251726 3300013296 Bacteria 1738
446 Ga0157374_10332842 3300013296 Bacteria 1506
447 Ga0157378_10535330 3300013297 Bacteria 1175
448 Ga0163162_10160782 3300013306 Bacteria 2368
449 Ga0163162_10171655 3300013306 Bacteria 2293
450 Ga0163162_10181482 3300013306 Bacteria 2231
451 Ga0157372_10000065 3300013307 Bacteria 114576
452 Ga0157372_10000111 3300013307 Bacteria 86033
453 Ga0157372_10163541 3300013307 Bacteria 2573
454 Ga0157372_10389054 3300013307 Bacteria 1625
455 Ga0157372_10512127 3300013307 Bacteria 1399
456 Ga0157375_10005611 3300013308 Bacteria 10923
457 Ga0157375_10008229 3300013308 Bacteria 9128
458 Ga0157375_10028115 3300013308 Bacteria 5265
459 Ga0157375_10416522 3300013308 Bacteria 1510
460 Ga0163163_10003284 3300014325 Bacteria 13715
461 Ga0163163_10012102 3300014325 Bacteria 7851
462 Ga0163163_10338360 3300014325 Bacteria 1560
463 Ga0182008_10001051 3300014497 Bacteria 19128
464 Ga0182008_10021760 3300014497 Bacteria 3292
465 Ga0182008_10054838 3300014497 Bacteria 1972
466 Ga0157377_10023260 3300014745 Bacteria 3283
467 Ga0157379_10024669 3300014968 Bacteria 5337
468 Ga0157379_10071375 3300014968 Bacteria 3106
469 Ga0157379_10078214 3300014968 Bacteria 2962
470 Ga0157379_10079534 3300014968 Bacteria 2935
471 Ga0157379_10139074 3300014968 Bacteria 2189
472 Ga0157379_10226704 3300014968 Bacteria 1694
473 Ga0157376_10008577 3300014969 Bacteria 7384
474 Ga0157376_10083407 3300014969 Bacteria 2749
475 Ga0182006_1000051 3300015261 Bacteria 183089
476 Ga0182006_1000119 3300015261 Bacteria 85008
477 Ga0182006_1000611 3300015261 Bacteria 25791
478 Ga0182006_1016700 3300015261 Bacteria 3129
479 Ga0182006_1030442 3300015261 Bacteria 2181
480 Ga0182007_10001225 3300015262 Bacteria 13942
481 Ga0182007_10001987 3300015262 Bacteria 10551
482 Ga0182005_1000044 3300015265 Bacteria 139973
483 Ga0182005_1000540 3300015265 Bacteria 19079
484 Ga0182005_1001006 3300015265 Bacteria 12081
485 Ga0182005_1002324 3300015265 Bacteria 6895
486 Ga0182005_1004016 3300015265 Bacteria 4834
487 Ga0182005_1048282 3300015265 Bacteria 1157
488 Ga0183366_1001 3300015679 Bacteria 2743932
489 Ga0183370_1001 3300015680 Bacteria 2743932
490 Ga0183369_1001 3300015685 Bacteria 2743932
491 Ga0183368_1001 3300015687 Bacteria 2743932
492 Ga0163161_10011734 3300017792 Bacteria 6077
493 Ga0206356_10524477 3300020070 Bacteria 1609
494 Ga0206356_11211633 3300020070 Bacteria 1588
495 Ga0206351_10620367 3300020077 Bacteria 2763
496 Ga0206352_10987329 3300020078 Bacteria 948
497 Ga0206354_10057609 3300020081 Bacteria 3122
498 Ga0206353_10393390 3300020082 Bacteria 1538
499 Ga0206353_11351368 3300020082 Bacteria 3420
500 Ga0154015_1386076 3300020610 Bacteria 1745
501 Ga0154015_1629196 3300020610 Bacteria 6102
502 Ga0213872_10009653 3300021361 Bacteria 4620
503 Ga0213872_10032113 3300021361 Bacteria 2406
504 Ga0213872_10048402 3300021361 Bacteria 1932
505 Ga0213874_10053187 3300021377 Bacteria 1249
506 Ga0213876_10001656 3300021384 Bacteria 13590
507 Ga0213876_10019582 3300021384 Bacteria 3575
508 Ga0213875_10002535 3300021388 Bacteria 10896
509 Ga0213875_10075069 3300021388 Bacteria 1577
510 Ga0213871_10030872 3300021441 Bacteria 1396
511 Ga0228598_1000515 3300024227 Bacteria 8034
512 Ga0209436_102863 3300025208 Bacteria 4882
513 Ga0209784_100024 3300025224 Bacteria 394613
514 Ga0209566_100018 3300025225 Bacteria 448638
515 Ga0209674_100046 3300025226 Bacteria 357920
516 Ga0209674_101757 3300025226 Bacteria 5261
517 Ga0209672_100030 3300025228 Bacteria 337051
518 Ga0209672_100040 3300025228 Bacteria 278858
519 Ga0209672_100058 3300025228 Bacteria 211992
520 Ga0209672_100068 3300025228 Bacteria 175572
521 Ga0209672_100457 3300025228 Bacteria 23137
522 Ga0209672_102427 3300025228 Bacteria 4590
523 Ga0209147_100008 3300025229 Bacteria 777096
524 Ga0209147_100036 3300025229 Bacteria 337052
525 Ga0209147_100048 3300025229 Bacteria 278858
526 Ga0209147_100074 3300025229 Bacteria 208743
527 Ga0209563_100039 3300025230 Bacteria 409717
528 Ga0209563_105425 3300025230 Bacteria 2314
529 Ga0207427_100081 3300025231 Bacteria 144588
530 Ga0209437_100036 3300025233 Bacteria 469153
531 Ga0209437_100086 3300025233 Bacteria 254578
532 Ga0209437_100168 3300025233 Bacteria 144520
533 Ga0209437_100261 3300025233 Bacteria 82127
534 Ga0209437_102301 3300025233 Bacteria 3752
535 Ga0209258_100013 3300025242 Bacteria 777096
536 Ga0209258_100056 3300025242 Bacteria 337051
537 Ga0209258_100070 3300025242 Bacteria 278858
538 Ga0209258_100149 3300025242 Bacteria 162184
539 Ga0209258_100164 3300025242 Bacteria 148838
540 Ga0207425_1000741 3300025245 Bacteria 17115
541 Ga0207425_1000744 3300025245 Bacteria 17015
542 Ga0207425_1009765 3300025245 Bacteria 2370
543 Ga0209646_1000077 3300025246 Bacteria 208262
544 Ga0209646_1001239 3300025246 Bacteria 7264
545 Ga0209026_1000231 3300025250 Bacteria 75789
546 Ga0209026_1012581 3300025250 Bacteria 1469
547 Ga0209677_100024 3300025253 Bacteria 406035
548 Ga0209677_100267 3300025253 Bacteria 35499
549 Ga0209677_105646 3300025253 Bacteria 3204
550 Ga0209148_1000037 3300025254 Bacteria 494767
551 Ga0209148_1000039 3300025254 Bacteria 482479
552 Ga0209148_1000143 3300025254 Bacteria 162184
553 Ga0209148_1000178 3300025254 Bacteria 126383
554 Ga0209148_1000461 3300025254 Bacteria 43728
555 Ga0209148_1003235 3300025254 Bacteria 4633
556 Ga0209148_1009411 3300025254 Bacteria 1903
557 Ga0209759_1000249 3300025256 Bacteria 80341
558 Ga0209759_1001303 3300025256 Bacteria 14731
559 Ga0209759_1009524 3300025256 Bacteria 2931
560 Ga0209759_1013780 3300025256 Bacteria 2170
561 Ga0209759_1023371 3300025256 Bacteria 1362
562 Ga0209129_1000025 3300025258 Bacteria 413639
563 Ga0209129_1000594 3300025258 Bacteria 24717
564 Ga0209129_1004157 3300025258 Bacteria 5846
565 Ga0209233_1000110 3300025261 Bacteria 260825
566 Ga0209233_1000151 3300025261 Bacteria 176515
567 Ga0209233_1000166 3300025261 Bacteria 152270
568 Ga0209233_1000342 3300025261 Bacteria 45690
569 Ga0209233_1000350 3300025261 Bacteria 43454
570 Ga0209565_1000216 3300025263 Bacteria 65734
571 Ga0209455_1000034 3300025272 Bacteria 483129
572 Ga0209455_1000036 3300025272 Bacteria 473309
573 Ga0209455_1000042 3300025272 Bacteria 419638
574 Ga0209455_1000061 3300025272 Bacteria 337052
575 Ga0209455_1000525 3300025272 Bacteria 27101
576 Ga0209673_1000020 3300025273 Bacteria 430653
577 Ga0209673_1000046 3300025273 Bacteria 289907
578 Ga0209673_1000601 3300025273 Bacteria 55798
579 Ga0209673_1000607 3300025273 Bacteria 55095
580 Ga0209673_1001959 3300025273 Bacteria 16130
581 Ga0209673_1002904 3300025273 Bacteria 10837
582 Ga0209673_1004592 3300025273 Bacteria 7322
583 Ga0209673_1005542 3300025273 Bacteria 6317
584 Ga0209673_1020631 3300025273 Bacteria 2328
585 Ga0209130_1000048 3300025284 Bacteria 233357
586 Ga0209130_1000272 3300025284 Bacteria 64696
587 Ga0209675_1000299 3300025291 Bacteria 45723
588 Ga0209675_1002721 3300025291 Bacteria 8852
589 Ga0209675_1026365 3300025291 Bacteria 1447
590 Ga0209676_1004206 3300025292 Bacteria 8151
591 Ga0209676_1039233 3300025292 Bacteria 1348
592 Ga0209025_1000029 3300025294 Bacteria 488571
593 Ga0209025_1000081 3300025294 Bacteria 265899
594 Ga0209025_1000589 3300025294 Bacteria 65607
595 Ga0209025_1001900 3300025294 Bacteria 24371
596 Ga0209025_1011450 3300025294 Bacteria 5840
597 Ga0209025_1013547 3300025294 Bacteria 5112
598 Ga0209025_1016446 3300025294 Bacteria 4362
599 Ga0209564_1000038 3300025295 Bacteria 414357
600 Ga0209564_1000039 3300025295 Bacteria 413604
601 Ga0209564_1000205 3300025295 Bacteria 135901
602 Ga0209564_1000491 3300025295 Bacteria 65596
603 Ga0209564_1000621 3300025295 Bacteria 54266
604 Ga0209564_1001753 3300025295 Bacteria 20252
605 Ga0209564_1001883 3300025295 Bacteria 18887
606 Ga0209564_1006715 3300025295 Bacteria 6114
607 Ga0209564_1013709 3300025295 Bacteria 3420
608 Ga0209564_1023211 3300025295 Bacteria 2164
609 Ga0209758_1000076 3300025297 Bacteria 270615
610 Ga0209758_1000196 3300025297 Bacteria 133816
611 Ga0209758_1003911 3300025297 Bacteria 12998
612 Ga0209758_1004142 3300025297 Bacteria 12369
613 Ga0209050_1003396 3300025298 Bacteria 11810
614 Ga0209050_1021437 3300025298 Bacteria 2355
615 Ga0209256_1000500 3300025299 Bacteria 57552
616 Ga0209256_1000519 3300025299 Bacteria 56383
617 Ga0209256_1002281 3300025299 Bacteria 16192
618 Ga0209256_1005384 3300025299 Bacteria 7410
619 Ga0209256_1006453 3300025299 Bacteria 6193
620 Ga0209256_1014665 3300025299 Bacteria 2798
621 Ga0209256_1018442 3300025299 Bacteria 2266
622 Ga0209256_1028334 3300025299 Bacteria 1581
623 Ga0207426_1000136 3300025302 Bacteria 201401
624 Ga0207426_1000169 3300025302 Bacteria 164859
625 Ga0207426_1000411 3300025302 Bacteria 71437
626 Ga0207426_1001232 3300025302 Bacteria 22539
627 Ga0209051_1001518 3300025303 Bacteria 19346
628 Ga0209051_1032555 3300025303 Bacteria 1986
629 Ga0207697_10073428 3300025315 Bacteria 1436
630 Ga0207696_1000091 3300025711 Bacteria 187999
631 Ga0207696_1007458 3300025711 Bacteria 4277
632 Ga0207655_1000001 3300025728 Bacteria 1866413
633 Ga0207655_1000009 3300025728 Bacteria 664676
634 Ga0207655_1000117 3300025728 Bacteria 161655
635 Ga0207655_1000288 3300025728 Bacteria 76899
636 Ga0207655_1000491 3300025728 Bacteria 50932
637 Ga0207655_1000593 3300025728 Bacteria 44462
638 Ga0207655_1000875 3300025728 Bacteria 31869
639 Ga0207655_1038253 3300025728 Bacteria 2100
640 Ga0207713_1000029 3300025735 Bacteria 285054
641 Ga0207713_1006528 3300025735 Bacteria 7086
642 Ga0207713_1025050 3300025735 Bacteria 2764
643 Ga0207642_10026900 3300025899 Bacteria 2348
644 Ga0207710_10000159 3300025900 Bacteria 71625
645 Ga0207710_10004228 3300025900 Bacteria 6293
646 Ga0207710_10069152 3300025900 Bacteria 1616
647 Ga0207688_10015030 3300025901 Bacteria 4199
648 Ga0207680_10031100 3300025903 Bacteria 3020
649 Ga0207680_10114982 3300025903 Bacteria 1752
650 Ga0207647_10005785 3300025904 Bacteria 9020
651 Ga0207647_10099775 3300025904 Bacteria 1724
652 Ga0207647_10105563 3300025904 Bacteria 1669
653 Ga0207647_10116561 3300025904 Bacteria 1577
654 Ga0207699_10000070 3300025906 Bacteria 82065
655 Ga0207699_10014816 3300025906 Bacteria 4034
656 Ga0207645_10099111 3300025907 Bacteria 1879
657 Ga0207705_10000204 3300025909 Bacteria 59946
658 Ga0207705_10249539 3300025909 Bacteria 1353
659 Ga0207654_10040827 3300025911 Bacteria 2616
660 Ga0207707_10000182 3300025912 Bacteria 65800
661 Ga0207707_10001174 3300025912 Bacteria 24646
662 Ga0207707_10001390 3300025912 Bacteria 22487
663 Ga0207707_10031843 3300025912 Bacteria 4616
664 Ga0207707_10071776 3300025912 Bacteria 3018
665 Ga0207707_10131076 3300025912 Bacteria 2193
666 Ga0207707_10276102 3300025912 Bacteria 1456
667 Ga0207707_10286976 3300025912 Bacteria 1424
668 Ga0207695_10000028 3300025913 Bacteria 551835
669 Ga0207695_10000171 3300025913 Bacteria 191448
670 Ga0207695_10000376 3300025913 Bacteria 101548
671 Ga0207695_10001369 3300025913 Bacteria 41341
672 Ga0207695_10001956 3300025913 Bacteria 31955
673 Ga0207695_10013742 3300025913 Bacteria 9633
674 Ga0207695_10030552 3300025913 Bacteria 5929
675 Ga0207695_10041583 3300025913 Bacteria 4919
676 Ga0207695_10069666 3300025913 Bacteria 3598
677 Ga0207695_10115904 3300025913 Bacteria 2653
678 Ga0207695_10322789 3300025913 Bacteria 1433
679 Ga0207671_10000732 3300025914 Bacteria 41620
680 Ga0207671_10001785 3300025914 Bacteria 24118
681 Ga0207671_10004719 3300025914 Bacteria 12877
682 Ga0207671_10006622 3300025914 Bacteria 10276
683 Ga0207671_10140872 3300025914 Bacteria 1858
684 Ga0207671_10261685 3300025914 Bacteria 1361
685 Ga0207693_10000102 3300025915 Bacteria 76687
686 Ga0207693_10001497 3300025915 Bacteria 20622
687 Ga0207693_10052430 3300025915 Bacteria 3200
688 Ga0207693_10172131 3300025915 Bacteria 1705
689 Ga0207663_10006827 3300025916 Bacteria 5875
690 Ga0207663_10040563 3300025916 Bacteria 2831
691 Ga0207660_10000587 3300025917 Bacteria 24526
692 Ga0207660_10006169 3300025917 Bacteria 7783
693 Ga0207660_10013602 3300025917 Bacteria 5335
694 Ga0207660_10043962 3300025917 Bacteria 3141
695 Ga0207660_10198352 3300025917 Bacteria 1566
696 Ga0207657_10000110 3300025919 Bacteria 80294
697 Ga0207657_10009002 3300025919 Bacteria 10083
698 Ga0207657_10009421 3300025919 Bacteria 9815
699 Ga0207657_10023144 3300025919 Bacteria 5791
700 Ga0207649_10000044 3300025920 Bacteria 115741
701 Ga0207649_10000070 3300025920 Bacteria 89018
702 Ga0207649_10000074 3300025920 Bacteria 85018
703 Ga0207649_10064494 3300025920 Bacteria 2316
704 Ga0207652_10000161 3300025921 Bacteria 72715
705 Ga0207652_10002347 3300025921 Bacteria 16024
706 Ga0207652_10066294 3300025921 Bacteria 3129
707 Ga0207652_10127717 3300025921 Bacteria 2266
708 Ga0207652_10182322 3300025921 Bacteria 1887
709 Ga0207652_10445574 3300025921 Bacteria 1167
710 Ga0207694_10059529 3300025924 Bacteria 2971
711 Ga0207694_10088854 3300025924 Bacteria 2436
712 Ga0207694_10189488 3300025924 Bacteria 1670
713 Ga0207650_10001503 3300025925 Bacteria 16688
714 Ga0207650_10002042 3300025925 Bacteria 14130
715 Ga0207659_10002302 3300025926 Bacteria 11378
716 Ga0207659_10051136 3300025926 Bacteria 2938
717 Ga0207659_10123986 3300025926 Bacteria 1984
718 Ga0207687_10010250 3300025927 Bacteria 6122
719 Ga0207700_10178472 3300025928 Bacteria 1776
720 Ga0207664_10099261 3300025929 Bacteria 2402
721 Ga0207644_10009521 3300025931 Bacteria 6383
722 Ga0207644_10042431 3300025931 Bacteria 3224
723 Ga0207644_10075266 3300025931 Bacteria 2480
724 Ga0207644_10204362 3300025931 Bacteria 1559
725 Ga0207690_10000016 3300025932 Bacteria 256657
726 Ga0207690_10067965 3300025932 Bacteria 2446
727 Ga0207690_10279055 3300025932 Bacteria 1301
728 Ga0207690_10446273 3300025932 Bacteria 1039
729 Ga0207706_10013496 3300025933 Bacteria 7424
730 Ga0207686_10002966 3300025934 Bacteria 9147
731 Ga0207709_10000466 3300025935 Bacteria 37282
732 Ga0207709_10052065 3300025935 Bacteria 2512
733 Ga0207669_10012678 3300025937 Bacteria 4154
734 Ga0207704_10149773 3300025938 Bacteria 1645
735 Ga0207665_10006300 3300025939 Bacteria 7868
736 Ga0207665_10018609 3300025939 Bacteria 4564
737 Ga0207665_10125320 3300025939 Bacteria 1818
738 Ga0207711_10008496 3300025941 Bacteria 8591
739 Ga0207711_10100310 3300025941 Bacteria 2561
740 Ga0207711_10136445 3300025941 Bacteria 2204
741 Ga0207689_10017003 3300025942 Bacteria 6154
742 Ga0207689_10092095 3300025942 Bacteria 2490
743 Ga0207689_10106981 3300025942 Bacteria 2298
744 Ga0207661_10006389 3300025944 Bacteria 8336
745 Ga0207661_10211282 3300025944 Bacteria 1710
746 Ga0207679_10000004 3300025945 Bacteria 589021
747 Ga0207679_10000021 3300025945 Bacteria 221630
748 Ga0207679_10076851 3300025945 Bacteria 2538
749 Ga0207679_10105872 3300025945 Bacteria 2209
750 Ga0207679_10163918 3300025945 Bacteria 1823
751 Ga0207679_10283651 3300025945 Bacteria 1421
752 Ga0207667_10000046 3300025949 Bacteria 245420
753 Ga0207667_10000093 3300025949 Bacteria 145814
754 Ga0207667_10004117 3300025949 Bacteria 17867
755 Ga0207667_10004376 3300025949 Bacteria 17293
756 Ga0207667_10007485 3300025949 Bacteria 13112
757 Ga0207667_10018955 3300025949 Bacteria 7693
758 Ga0207667_10032279 3300025949 Bacteria 5644
759 Ga0207667_10220878 3300025949 Bacteria 1941
760 Ga0207667_10369718 3300025949 Bacteria 1461
761 Ga0207651_10010829 3300025960 Bacteria 5073
762 Ga0207712_10009649 3300025961 Bacteria 6116
763 Ga0207668_10058586 3300025972 Bacteria 2693
764 Ga0207640_10000108 3300025981 Bacteria 62951
765 Ga0207640_10003445 3300025981 Bacteria 8521
766 Ga0207640_10018962 3300025981 Bacteria 4053
767 Ga0207658_10038341 3300025986 Bacteria 3451
768 Ga0207658_10200604 3300025986 Bacteria 1665
769 Ga0207677_10082150 3300026023 Bacteria 2315
770 Ga0207703_10034163 3300026035 Bacteria 4034
771 Ga0207703_10129697 3300026035 Bacteria 2176
772 Ga0207639_10001055 3300026041 Bacteria 18715
773 Ga0207639_10034133 3300026041 Bacteria 3758
774 Ga0207639_10191491 3300026041 Bacteria 1747
775 Ga0207678_10000005 3300026067 Bacteria 193984
776 Ga0207678_10002869 3300026067 Bacteria 15646
777 Ga0207678_10005689 3300026067 Bacteria 11133
778 Ga0207678_10007134 3300026067 Bacteria 9914
779 Ga0207678_10048244 3300026067 Bacteria 3681
780 Ga0207678_10070147 3300026067 Bacteria 3005
781 Ga0207678_10089995 3300026067 Bacteria 2623
782 Ga0207708_10001415 3300026075 Bacteria 17997
783 Ga0207708_10207808 3300026075 Bacteria 1564
784 Ga0207702_10000280 3300026078 Bacteria 58816
785 Ga0207702_10008346 3300026078 Bacteria 8745
786 Ga0207702_10112094 3300026078 Bacteria 2427
787 Ga0207702_10127312 3300026078 Bacteria 2288
788 Ga0207702_10245928 3300026078 Bacteria 1678
789 Ga0207702_10494259 3300026078 Bacteria 1192
790 Ga0207641_10000900 3300026088 Bacteria 30838
791 Ga0207641_10010599 3300026088 Bacteria 7563
792 Ga0207641_10019607 3300026088 Bacteria 5553
793 Ga0207641_10032111 3300026088 Bacteria 4359
794 Ga0207641_10119187 3300026088 Bacteria 2352
795 Ga0207641_10617242 3300026088 Bacteria 1063
796 Ga0207648_10026890 3300026089 Bacteria 5110
797 Ga0207648_10228857 3300026089 Bacteria 1653
798 Ga0207648_10274749 3300026089 Bacteria 1506
799 Ga0207676_10022067 3300026095 Bacteria 4679
800 Ga0207676_10064340 3300026095 Bacteria 2916
801 Ga0207676_10333313 3300026095 Bacteria 1397
802 Ga0207674_10004181 3300026116 Bacteria 17438
803 Ga0207674_10013703 3300026116 Bacteria 8979
804 Ga0207674_10024897 3300026116 Bacteria 6388
805 Ga0207674_10176584 3300026116 Bacteria 2088
806 Ga0207675_100576377 3300026118 Bacteria 1126
807 Ga0207683_10059589 3300026121 Bacteria 3353
808 Ga0207683_10218220 3300026121 Bacteria 1737
809 Ga0207698_10000021 3300026142 Bacteria 133280
810 Ga0207698_10076498 3300026142 Bacteria 2679
811 Ga0207698_10086585 3300026142 Bacteria 2548
812 Ga0207698_10093242 3300026142 Bacteria 2472
813 Ga0207698_10164919 3300026142 Bacteria 1943
814 Ga0207698_10204609 3300026142 Bacteria 1771
815 Ga0209281_1000004 3300027111 Bacteria 1253949
816 Ga0209281_1000024 3300027111 Bacteria 499062
817 Ga0209281_1000494 3300027111 Bacteria 53600
818 Ga0209281_1000619 3300027111 Bacteria 39884
819 Ga0209371_1000001 3300027312 Bacteria 2771503
820 Ga0209371_1000156 3300027312 Bacteria 106826
821 Ga0209371_1000187 3300027312 Bacteria 90195
822 Ga0209371_1000191 3300027312 Bacteria 89915
823 Ga0209371_1000213 3300027312 Bacteria 79996
824 Ga0209371_1000661 3300027312 Bacteria 30062
825 Ga0209371_1005487 3300027312 Bacteria 5021
826 Ga0209371_1023636 3300027312 Bacteria 1444
827 Ga0207428_10000946 3300027907 Bacteria 32282
828 Ga0268266_10000429 3300028379 Bacteria 63174
829 Ga0268266_10001965 3300028379 Bacteria 23059
830 Ga0268266_10014608 3300028379 Bacteria 6748
831 Ga0268266_10023448 3300028379 Bacteria 5256
832 Ga0268266_10116295 3300028379 Bacteria 2375
833 Ga0268266_10131313 3300028379 Bacteria 2240
834 Ga0268266_10170823 3300028379 Bacteria 1973
835 Ga0268266_10538016 3300028379 Bacteria 1118
836 Ga0268265_10002757 3300028380 Bacteria 12969
837 Ga0268264_10000100 3300028381 Bacteria 227852
838 Ga0268264_10008196 3300028381 Bacteria 8677
839 Ga0268264_10014328 3300028381 Bacteria 6519
840 Ga0268264_10124281 3300028381 Bacteria 2278
841 Ga0268264_10283773 3300028381 Bacteria 1552
842 Ga0265334_10037795 3300028573 Bacteria 1902
843 Ga0307515_10000034 3300028794 Bacteria 344640
844 Ga0307515_10005985 3300028794 Bacteria 24500
845 Ga0307515_10069225 3300028794 Bacteria 4829
846 Ga0265338_10024738 3300028800 Bacteria 6123
847 Ga0268256_1000001 3300030500 Bacteria 2771065
848 Ga0268256_1000028 3300030500 Bacteria 433179
849 Ga0268256_1000130 3300030500 Bacteria 106825
850 Ga0268256_1000156 3300030500 Bacteria 90195
851 Ga0268256_1000170 3300030500 Bacteria 79996
852 Ga0268256_1005395 3300030500 Bacteria 5021
853 Ga0307511_10028029 3300030521 Bacteria 5127
854 Ga0265770_1002894 3300030878 Bacteria 2330
855 Ga0265760_10020954 3300031090 Bacteria 1888
856 Ga0265330_10007239 3300031235 Bacteria 5426
857 Ga0265330_10007983 3300031235 Bacteria 5129
858 Ga0265329_10039004 3300031242 Bacteria 1528
859 Ga0265340_10003459 3300031247 Bacteria 8908
860 Ga0265340_10008781 3300031247 Bacteria 5449
861 Ga0265339_10003445 3300031249 Bacteria 11069
862 Ga0265331_10005664 3300031250 Bacteria 7502
863 Ga0265327_10021884 3300031251 Bacteria 3843
864 Ga0265327_10082731 3300031251 Bacteria 1581
865 Ga0265316_10031780 3300031344 Bacteria 4313
866 Ga0307513_10325622 3300031456 Bacteria 1293
867 Ga0307509_10427000 3300031507 Bacteria 1025
868 Ga0307408_100028246 3300031548 Bacteria 3875
869 Ga0265313_10126350 3300031595 Bacteria 1111
870 Ga0307514_10006575 3300031649 Bacteria 10093
871 Ga0265342_10021254 3300031712 Bacteria 4148
872 Ga0265342_10030579 3300031712 Bacteria 3336
873 Ga0265342_10033881 3300031712 Bacteria 3136
874 Ga0307516_10001608 3300031730 Bacteria 31115
875 Ga0307406_10005128 3300031901 Bacteria 7146
876 Ga0307406_10120971 3300031901 Bacteria 1820
877 Ga0307412_10000300 3300031911 Bacteria 31421
878 Ga0307411_10390109 3300032005 Bacteria 1148
879 Ga0307510_10057481 3300033180 Bacteria 4036
880 Ga0307510_10166774 3300033180 Bacteria 1789
881 Ga0373939_0023257 3300035114 Bacteria 1715
882 Ga0373953_0007239 3300035117 Bacteria 3708
883 Ga0373943_0081383 3300035170 Bacteria 1661
884 Ga0373931_0020020 3300035691 Bacteria 3345
885 Ga0373927_0177449 3300035695 Bacteria 1397
886 Ga0373947_0244272 3300035725 Bacteria 1185
887 Ga0373925_0130554 3300037068 Bacteria 1958
888 Ga0395899_0020825 3300037312 Bacteria 4973
889 Ga0395899_0049914 3300037312 Bacteria 3108
890 Ga0395899_0063904 3300037312 Bacteria 2707
891 Ga0395900_0021317 3300037418 Bacteria 6624
892 Ga0395900_0023643 3300037418 Bacteria 6286
893 Ga0395900_0095425 3300037418 Unclassified 3056
894 Ga0395900_0102528 3300037418 Bacteria 2939
895 Ga0395898_0000144 3300037466 Bacteria 187889
896 Ga0395898_0017704 3300037466 Bacteria 7272
897 Ga0395898_0021846 3300037466 Bacteria 6482
898 Ga0395898_0028143 3300037466 Bacteria 5636
899 Ga0395898_0088984 3300037466 Bacteria 2972
900 Ga0395898_0242654 3300037466 Bacteria 1718
901 Ga0395905_0002710 3300037471 Bacteria 19408
902 Ga0395905_0049799 3300037471 Unclassified 3926
903 Ga0395905_0236992 3300037471 Bacteria 1705
904 Ga0395905_0286439 3300037471 Bacteria 1534
905 Ga0436364_0044071 3300037853 Bacteria 12348
906 Ga0436364_0081014 3300037853 Bacteria 7260
907 Ga0436364_0139837 3300037853 Bacteria 1982
908 Ga0436364_0333628 3300037853 Bacteria 1046
909 Ga0436364_0542878 3300037853 Bacteria 12255
910 Ga0395901_0004676 3300038443 Bacteria 13801
911 Ga0395901_0033408 3300038443 Bacteria 5311
912 Ga0237819_09536 3300038705 Bacteria 1297
913 Ga0436365_0475170 3300039437 Bacteria 21720
914 Ga0436365_0595564 3300039437 Bacteria 5724
915 Ga0436365_1570145 3300039437 Bacteria 1503
916 Ga0436360_0888954 3300039438 Bacteria 2253
917 Ga0436360_1353135 3300039438 Bacteria 1729
918 Ga0436361_0040126 3300039447 Bacteria 2515
919 Ga0436361_0060388 3300039447 Bacteria 1629
920 Ga0436361_0474832 3300039447 Bacteria 1047
921 Ga0436361_1170673 3300039447 Bacteria 1497
922 Ga0436361_1187256 3300039447 Bacteria 1331
923 Ga0436363_0029129 3300039450 Bacteria 1461
924 Ga0436363_0171997 3300039450 Bacteria 3001
925 Ga0436363_0934761 3300039450 Bacteria 4848
926 Ga0436362_0283733 3300039453 Bacteria 7161
927 Ga0439436_0000001 3300041404 Bacteria 299341
928 Ga0439438_064349 3300041405 Bacteria 914
929 Ga0439466_0045670 3300041411 Bacteria 1448
930 Ga0439465_0007323 3300041413 Bacteria 3504
931 Ga0439465_0058099 3300041413 Bacteria 1278
932 Ga0451793_1206436 3300041452 Bacteria 1805
933 Ga0451839_0853427 3300041496 Bacteria 2772
934 Ga0451841_1419731 3300041498 Bacteria 915
935 Ga0451845_0892693 3300041501 Bacteria 1810
936 Ga0451847_0291915 3300041503 Bacteria 4019
937 Ga0451849_0744664 3300041505 Bacteria 3344
938 Ga0451851_0254806 3300041507 Bacteria 4020
939 Ga0451843_1092677 3300041509 Bacteria 1384
940 Ga0451853_0958912 3300041512 Bacteria 6230
941 Ga0451853_3235739 3300041512 Bacteria 3934
942 Ga0439449_0000965 3300042007 Bacteria 11289
943 Ga0439449_0007872 3300042007 Bacteria 4047
944 Ga0439452_000002 3300042010 Bacteria 1377577
945 Ga0439452_000248 3300042010 Bacteria 37260
946 Ga0439452_000300 3300042010 Bacteria 31857
947 Ga0439455_0001376 3300042012 Bacteria 4035
948 Ga0439455_0018557 3300042012 Bacteria 1632
949 Ga0439463_005881 3300042016 Bacteria 3046
950 Ga0450899_000439 3300042135 Bacteria 4636
951 Ga0466969_0004763 3300044656 Bacteria 7222
952 Ga0466969_0022928 3300044656 Bacteria 3218
953 Ga0466969_0030124 3300044656 Bacteria 2766
954 Ga0466972_0103632 3300044658 Bacteria 1346
955 Ga0466973_0057243 3300044659 Bacteria 3556
956 Ga0466981_0000002 3300044669 Bacteria 313036
957 Ga0466966_0002610 3300044684 Bacteria 11817
958 Ga0466966_0006513 3300044684 Bacteria 7725
959 Ga0466966_0013288 3300044684 Bacteria 5451
960 Ga0466966_0036335 3300044684 Bacteria 3180
961 Ga0466966_0061811 3300044684 Bacteria 2362
962 Ga0466966_0100568 3300044684 Bacteria 1788
963 Ga0466966_0107924 3300044684 Bacteria 1717
964 Ga0466961_0004115 3300044693 Bacteria 9079
965 Ga0466961_0012941 3300044693 Bacteria 5336
966 Ga0466961_0021366 3300044693 Bacteria 4166
967 Ga0466961_0038093 3300044693 Bacteria 3084
968 Ga0466961_0052262 3300044693 Bacteria 2607
969 Ga0466961_0108367 3300044693 Bacteria 1748
970 Ga0466963_0027613 3300044694 Bacteria 3636
971 Ga0466963_0064461 3300044694 Bacteria 2455
972 Ga0466971_0005973 3300044719 Bacteria 5298
973 Ga0466968_0165840 3300044735 Bacteria 1021
974 Ga0466970_0004814 3300044765 Bacteria 6668
975 Ga0466970_0015119 3300044765 Bacteria 3969
976 Ga0466957_0003433 3300044842 Bacteria 8695
977 Ga0466957_0014643 3300044842 Bacteria 4570
978 Ga0466957_0017015 3300044842 Bacteria 4254
979 Ga0466957_0132513 3300044842 Bacteria 1598
980 Ga0466959_0002415 3300045049 Bacteria 11927
981 Ga0466959_0005606 3300045049 Bacteria 8630
982 Ga0466959_0020051 3300045049 Bacteria 4921
983 Ga0466959_0145881 3300045049 Bacteria 1670
984 Ga0451576_0561399 3300045051 Bacteria 1199
985 Ga0466958_0016651 3300045836 Bacteria 4236
986 Ga0466958_0020405 3300045836 Bacteria 3863
987 Ga0466958_0129906 3300045836 Bacteria 1581
988 Ga0466967_0012429 3300045976 Bacteria 6511
989 Ga0466967_0450077 3300045976 Bacteria 1258
990 Ga0495617_002319 3300046452 Bacteria 7654
991 Ga0495592_0046945 3300046454 Bacteria 3218
992 Ga0495592_0146346 3300046454 Bacteria 1638
993 Ga0495591_000003 3300046458 Bacteria 449825
994 Ga0495638_0000007 3300046460 Bacteria 602783
995 Ga0495638_0000536 3300046460 Bacteria 43871
996 Ga0495638_0004272 3300046460 Bacteria 10854
997 Ga0495638_0183792 3300046460 Bacteria 1191
998 Ga0495651_0061328 3300046462 Bacteria 2878
999 Ga0495651_0090874 3300046462 Bacteria 2289
1000 Ga0495653_0002018 3300046463 Bacteria 15971
1001 Ga0495650_0000005 3300046471 Bacteria 766553
1002 Ga0495650_0002581 3300046471 Bacteria 14275
1003 Ga0495580_0046384 3300046472 Bacteria 3083
1004 Ga0495582_0015149 3300046473 Bacteria 4241
1005 Ga0495582_0039683 3300046473 Bacteria 2592
1006 Ga0495605_0018540 3300046474 Bacteria 3730
1007 Ga0495605_0059150 3300046474 Bacteria 1841
1008 Ga0495662_0003706 3300046476 Bacteria 7700
1009 Ga0495662_0028185 3300046476 Bacteria 2712
1010 Ga0495664_0033919 3300046477 Bacteria 3001
1011 Ga0495664_0070603 3300046477 Bacteria 2086
1012 Ga0495584_0132637 3300046491 Bacteria 1264
1013 Ga0495585_0114432 3300046492 Bacteria 1432
1014 Ga0495596_0003174 3300046500 Bacteria 8466
1015 Ga0495607_0000196 3300046501 Bacteria 63991
1016 Ga0495607_0000601 3300046501 Bacteria 35014
1017 Ga0495607_0002888 3300046501 Bacteria 13568
1018 Ga0495607_0035589 3300046501 Bacteria 3010
1019 Ga0495606_0000725 3300046507 Bacteria 50954
1020 Ga0495606_0001436 3300046507 Bacteria 31966
1021 Ga0495606_0006197 3300046507 Bacteria 11127
1022 Ga0495606_0007332 3300046507 Bacteria 9915
1023 Ga0495606_0009875 3300046507 Bacteria 8001
1024 Ga0495606_0106078 3300046507 Bacteria 1702
1025 Ga0495608_0011914 3300046511 Bacteria 6048
1026 Ga0495610_0006875 3300046512 Bacteria 7710
1027 Ga0495610_0012396 3300046512 Bacteria 5134
1028 Ga0495610_0013550 3300046512 Bacteria 4839
1029 Ga0495610_0034453 3300046512 Bacteria 2607
1030 Ga0495610_0090341 3300046512 Bacteria 1389
1031 Ga0495616_0023492 3300046513 Bacteria 3316
1032 Ga0495618_0064279 3300046514 Bacteria 2331
1033 Ga0495620_0000224 3300046515 Bacteria 42576
1034 Ga0495620_0008274 3300046515 Bacteria 5591
1035 Ga0495628_0003636 3300046516 Bacteria 13766
1036 Ga0495628_0014644 3300046516 Bacteria 6568
1037 Ga0495628_0021277 3300046516 Bacteria 5339
1038 Ga0495628_0112163 3300046516 Bacteria 2096
1039 Ga0495630_0126874 3300046517 Bacteria 1937
1040 Ga0495631_0001169 3300046518 Bacteria 16226
1041 Ga0495632_0004284 3300046519 Bacteria 9742
1042 Ga0495632_0046986 3300046519 Bacteria 2143
1043 Ga0495637_0002197 3300046520 Bacteria 10910
1044 Ga0495637_0003672 3300046520 Bacteria 8126
1045 Ga0495637_0095983 3300046520 Bacteria 1163
1046 Ga0495643_0000041 3300046522 Bacteria 231342
1047 Ga0495643_0001110 3300046522 Bacteria 26795
1048 Ga0495643_0039054 3300046522 Bacteria 2597
1049 Ga0495643_0098671 3300046522 Bacteria 1499
1050 Ga0495644_0008900 3300046523 Bacteria 3861
1051 Ga0495644_0079124 3300046523 Bacteria 1238
1052 Ga0495648_0040987 3300046524 Bacteria 2929
1053 Ga0495648_0072599 3300046524 Bacteria 1991
1054 Ga0495652_0021270 3300046529 Bacteria 5768
1055 Ga0495652_0041537 3300046529 Bacteria 3969
1056 Ga0495652_0093283 3300046529 Bacteria 2458
1057 Ga0495652_0193210 3300046529 Bacteria 1551
1058 Ga0495654_0004082 3300046530 Bacteria 8761
1059 Ga0495654_0048912 3300046530 Bacteria 2073
1060 Ga0495665_0073252 3300046531 Bacteria 1804
1061 Ga0495587_0053024 3300046536 Bacteria 2392
1062 Ga0495609_0021536 3300046538 Bacteria 2974
1063 Ga0495609_0040470 3300046538 Bacteria 2097
1064 Ga0495597_0016444 3300046542 Bacteria 3491
1065 Ga0495597_0048353 3300046542 Bacteria 1882
1066 Ga0495622_0028567 3300046557 Bacteria 2605
1067 Ga0495633_0028953 3300046558 Bacteria 2695
1068 Ga0495668_0012255 3300046616 Bacteria 5090
1069 Ga0495611_0000034 3300046648 Bacteria 103287
1070 Ga0495625_0000002 3300046660 Bacteria 813323
1071 Ga0495625_0102901 3300046660 Bacteria 1959
1072 Ga0495625_0292695 3300046660 Bacteria 1044
1073 Ga0495635_0072330 3300046663 Bacteria 2363
1074 Ga0495661_0001990 3300046665 Bacteria 16147
1075 Ga0495661_0177674 3300046665 Bacteria 1130
1076 Ga0495657_0127482 3300046675 Bacteria 1597
1077 Ga0495599_0003643 3300046678 Bacteria 9032
1078 Ga0495599_0044563 3300046678 Bacteria 2782
1079 Ga0495623_0096483 3300046679 Bacteria 1806
1080 Ga0495646_0005124 3300046680 Bacteria 8266
1081 Ga0495646_0136491 3300046680 Bacteria 1376
1082 Ga0495624_0006209 3300046690 Bacteria 8493
1083 Ga0495670_0000639 3300046691 Bacteria 16722
1084 Ga0495670_0015900 3300046691 Bacteria 3697
1085 Ga0495670_0062638 3300046691 Bacteria 1872
1086 Ga0495671_0031775 3300046692 Bacteria 2697
1087 Ga0495671_0119024 3300046692 Bacteria 1289
1088 Ga0495649_0082527 3300046694 Bacteria 1718
1089 Ga0495589_0000192 3300046794 Bacteria 53416
1090 Ga0495589_0000490 3300046794 Bacteria 28284
1091 Ga0495589_0066227 3300046794 Bacteria 1769
1092 Ga0495600_0002922 3300046809 Bacteria 9955
1093 Ga0495600_0035414 3300046809 Bacteria 3242
1094 Ga0495660_0000011 3300046810 Bacteria 361397
1095 Ga0495660_0000156 3300046810 Bacteria 74271
1096 Ga0495581_0113817 3300047315 Bacteria 1573
1097 Ga0495604_0001772 3300047317 Bacteria 17617
1098 Ga0495604_0005708 3300047317 Bacteria 9870
1099 Ga0495604_0024541 3300047317 Bacteria 4810
1100 Ga0495604_0116601 3300047317 Bacteria 1938
1101 Ga0495636_0072139 3300047318 Bacteria 1475
1102 Ga0495674_0247268 3300047319 Bacteria 1468
1103 Ga0495672_0016603 3300047320 Bacteria 4954
1104 Ga0495672_0077325 3300047320 Bacteria 1866
1105 Ga0495672_0083174 3300047320 Bacteria 1778
1106 Ga0495672_0103863 3300047320 Bacteria 1536
1107 Ga0495676_0100364 3300047321 Bacteria 2143
1108 Ga0495680_0166343 3300047322 Bacteria 1599
1109 Ga0495687_003645 3300047443 Bacteria 10981
1110 Ga0495687_012580 3300047443 Bacteria 4465
1111 Ga0495675_0005488 3300047444 Bacteria 7737
1112 Ga0495675_0015361 3300047444 Bacteria 4843
1113 Ga0495679_000003 3300047446 Bacteria 787868
1114 Ga0495679_000830 3300047446 Bacteria 19679
1115 Ga0495679_007769 3300047446 Bacteria 4430
1116 Ga0495673_0000070 3300047469 Bacteria 217453
1117 Ga0495673_0020096 3300047469 Bacteria 3331
1118 Ga0495681_0004774 3300047470 Bacteria 9180
1119 Ga0495686_0001536 3300047472 Bacteria 24751
1120 Ga0495686_0005493 3300047472 Bacteria 9977
1121 Ga0495686_0007185 3300047472 Bacteria 8384
1122 Ga0495686_0009091 3300047472 Bacteria 7200
1123 Ga0495686_0149627 3300047472 Bacteria 1371
1124 Ga0495593_0004348 3300047673 Bacteria 8431
1125 Ga0495602_0039549 3300048088 Bacteria 4340
1126 Ga0495602_0239692 3300048088 Bacteria 1357
1127 Ga0495626_0001268 3300048091 Bacteria 20659
1128 Ga0495626_0020911 3300048091 Bacteria 3255
1129 Ga0496100_0014245 3300048903 Bacteria 4612
1130 Ga0496100_0320638 3300048903 Bacteria 1164
1131 Ga0496100_0411805 3300048903 Bacteria 1031
1132 Ga0496101_0009116 3300048904 Bacteria 6511
1133 Ga0496101_0056526 3300048904 Bacteria 2837
1134 Ga0496101_0194628 3300048904 Bacteria 1566
1135 Ga0496101_0330133 3300048904 Bacteria 1197
1136 Ga0496102_0006737 3300048905 Bacteria 9814
1137 Ga0496102_0016623 3300048905 Bacteria 6432
1138 Ga0496102_0274219 3300048905 Bacteria 1590
1139 Ga0496102_0333118 3300048905 Bacteria 1429
1140 Ga0496102_0386712 3300048905 Bacteria 1316
1141 Ga0496103_0030844 3300048906 Bacteria 3263
1142 Ga0496103_0152998 3300048906 Bacteria 1478
1143 Ga0496103_0206039 3300048906 Bacteria 1265
1144 Ga0496104_0000144 3300048907 Bacteria 65594
1145 Ga0496104_0118725 3300048907 Bacteria 2539
1146 Ga0496104_0282359 3300048907 Bacteria 1573
1147 Ga0496105_0001656 3300048908 Bacteria 15879
1148 Ga0496105_0093583 3300048908 Bacteria 2482
1149 Ga0496105_0220517 3300048908 Bacteria 1544
1150 Ga0496106_0002011 3300048909 Bacteria 15292
1151 Ga0496106_0035516 3300048909 Bacteria 3727
1152 Ga0496107_0117139 3300048910 Bacteria 1961
1153 Ga0496108_0003772 3300048911 Bacteria 12130
1154 Ga0496108_0049839 3300048911 Bacteria 3503
1155 Ga0496108_0076179 3300048911 Bacteria 2835
1156 Ga0496108_0469968 3300048911 Bacteria 1099
1157 Ga0496109_0004165 3300048912 Bacteria 12074
1158 Ga0496109_0364182 3300048912 Bacteria 1366
1159 Ga0496110_0089966 3300048913 Bacteria 2744
1160 Ga0496110_0099908 3300048913 Bacteria 2600
1161 Ga0496110_0256355 3300048913 Bacteria 1592
1162 Ga0496111_0189189 3300048914 Bacteria 1530
1163 Ga0496112_0002096 3300048915 Bacteria 15835
1164 Ga0496112_0099298 3300048915 Bacteria 2881
1165 Ga0496112_0221230 3300048915 Bacteria 1849
1166 Ga0496112_0587969 3300048915 Bacteria 1045
1167 Ga0496113_0096216 3300048916 Bacteria 2289
1168 Ga0496113_0177443 3300048916 Bacteria 1688
1169 Ga0496114_0174910 3300048917 Bacteria 1873
1170 Ga0496115_0009933 3300048918 Bacteria 7090
1171 Ga0496115_0299904 3300048918 Bacteria 1317
1172 Ga0496116_0004768 3300048919 Bacteria 12795
1173 Ga0496116_0029359 3300048919 Bacteria 3966
1174 Ga0496116_0036507 3300048919 Bacteria 3437
1175 Ga0496116_0065446 3300048919 Bacteria 2332
1176 Ga0496116_0068600 3300048919 Bacteria 2258
1177 Ga0496116_0068784 3300048919 Bacteria 2254
1178 Ga0496116_0076471 3300048919 Bacteria 2096
1179 Ga0496116_0078994 3300048919 Bacteria 2049
1180 Ga0496116_0134302 3300048919 Bacteria 1404
1181 Ga0496116_0137098 3300048919 Bacteria 1383
1182 Ga0496117_0000020 3300048920 Bacteria 458405
1183 Ga0496117_0000033 3300048920 Bacteria 345605
1184 Ga0496117_0003961 3300048920 Bacteria 16741
1185 Ga0496117_0008695 3300048920 Bacteria 9598
1186 Ga0496117_0019573 3300048920 Bacteria 5554
1187 Ga0496117_0025946 3300048920 Bacteria 4594
1188 Ga0496117_0058680 3300048920 Bacteria 2664
1189 Ga0496117_0105021 3300048920 Bacteria 1776
1190 Ga0496117_0167852 3300048920 Bacteria 1277
1191 Ga0496118_0000015 3300048921 Bacteria 551359
1192 Ga0496118_0000477 3300048921 Bacteria 66433
1193 Ga0496118_0000594 3300048921 Bacteria 59894
1194 Ga0496118_0002815 3300048921 Bacteria 22770
1195 Ga0496118_0004254 3300048921 Bacteria 17134
1196 Ga0496118_0008241 3300048921 Bacteria 10810
1197 Ga0496118_0008545 3300048921 Bacteria 10558
1198 Ga0496118_0008797 3300048921 Bacteria 10345
1199 Ga0496118_0010211 3300048921 Bacteria 9322
1200 Ga0496118_0070858 3300048921 Bacteria 2513
1201 Ga0496118_0079034 3300048921 Bacteria 2323
1202 Ga0496118_0081909 3300048921 Bacteria 2263
1203 Ga0496118_0145444 3300048921 Bacteria 1494
1204 Ga0496119_0001524 3300048922 Bacteria 27691
1205 Ga0496119_0003299 3300048922 Bacteria 16859
1206 Ga0496119_0013005 3300048922 Bacteria 6686
1207 Ga0496119_0022474 3300048922 Bacteria 4513
1208 Ga0496119_0022836 3300048922 Bacteria 4460
1209 Ga0496119_0063569 3300048922 Bacteria 2194
1210 Ga0496119_0066478 3300048922 Bacteria 2130
1211 Ga0496119_0068500 3300048922 Bacteria 2089
1212 Ga0496119_0085679 3300048922 Bacteria 1803
1213 Ga0496119_0089162 3300048922 Bacteria 1757
1214 Ga0496119_0102933 3300048922 Bacteria 1600
1215 Ga0496119_0105054 3300048922 Bacteria 1578
1216 Ga0496120_0000430 3300048923 Bacteria 66414
1217 Ga0496120_0001435 3300048923 Bacteria 28631
1218 Ga0496120_0003272 3300048923 Bacteria 14942
1219 Ga0496120_0005266 3300048923 Bacteria 10390
1220 Ga0496120_0005908 3300048923 Bacteria 9547
1221 Ga0496120_0005910 3300048923 Bacteria 9546
1222 Ga0496120_0014600 3300048923 Bacteria 5225
1223 Ga0496120_0044448 3300048923 Bacteria 2580
1224 Ga0496120_0051102 3300048923 Bacteria 2363
1225 Ga0496120_0182351 3300048923 Bacteria 1029
1226 Ga0496120_0193235 3300048923 Bacteria 990
1227 Ga0496121_0001223 3300048924 Bacteria 44700
1228 Ga0496121_0002468 3300048924 Bacteria 28227
1229 Ga0496121_0003240 3300048924 Bacteria 23396
1230 Ga0496121_0003417 3300048924 Bacteria 22706
1231 Ga0496121_0005209 3300048924 Bacteria 16843
1232 Ga0496121_0014421 3300048924 Bacteria 8389
1233 Ga0496121_0017345 3300048924 Bacteria 7363
1234 Ga0496121_0018132 3300048924 Bacteria 7120
1235 Ga0496121_0034918 3300048924 Bacteria 4514
1236 Ga0496121_0041049 3300048924 Bacteria 4050
1237 Ga0496121_0098424 3300048924 Bacteria 2263
1238 Ga0496121_0135769 3300048924 Bacteria 1833
1239 Ga0496121_0160543 3300048924 Bacteria 1644
1240 Ga0496121_0253631 3300048924 Bacteria 1218
1241 Ga0496121_0299650 3300048924 Bacteria 1091
1242 Ga0496121_0325250 3300048924 Bacteria 1034
1243 Ga0496122_0000005 3300048925 Bacteria 630659
1244 Ga0496122_0000068 3300048925 Bacteria 226155
1245 Ga0496122_0000944 3300048925 Bacteria 52790
1246 Ga0496122_0002234 3300048925 Bacteria 28156
1247 Ga0496122_0009630 3300048925 Bacteria 10119
1248 Ga0496122_0016703 3300048925 Bacteria 6919
1249 Ga0496122_0020375 3300048925 Bacteria 5995
1250 Ga0496122_0021200 3300048925 Bacteria 5828
1251 Ga0496122_0022004 3300048925 Bacteria 5681
1252 Ga0496122_0089321 3300048925 Bacteria 2107
1253 Ga0496122_0131664 3300048925 Bacteria 1587
1254 Ga0496122_0241207 3300048925 Bacteria 1019
1255 Ga0496123_0000008 3300048926 Bacteria 630628
1256 Ga0496123_0000059 3300048926 Bacteria 226155
1257 Ga0496123_0000735 3300048926 Bacteria 53174
1258 Ga0496123_0002032 3300048926 Bacteria 26137
1259 Ga0496123_0002301 3300048926 Bacteria 23983
1260 Ga0496123_0003605 3300048926 Bacteria 17157
1261 Ga0496123_0004045 3300048926 Bacteria 15807
1262 Ga0496123_0004391 3300048926 Bacteria 14872
1263 Ga0496123_0005469 3300048926 Bacteria 12781
1264 Ga0496123_0015385 3300048926 Bacteria 6276
1265 Ga0496123_0047344 3300048926 Bacteria 2907
1266 Ga0496123_0079939 3300048926 Bacteria 1995
1267 Ga0496123_0124884 3300048926 Bacteria 1438
1268 Ga0496123_0154979 3300048926 Bacteria 1230
1269 Ga0496124_0000006 3300048927 Bacteria 904259
1270 Ga0496124_0000381 3300048927 Bacteria 81000
1271 Ga0496124_0001882 3300048927 Bacteria 28891
1272 Ga0496124_0002113 3300048927 Bacteria 26747
1273 Ga0496124_0002996 3300048927 Bacteria 21123
1274 Ga0496124_0005469 3300048927 Bacteria 14276
1275 Ga0496124_0025077 3300048927 Bacteria 5406
1276 Ga0496124_0031468 3300048927 Bacteria 4696
1277 Ga0496124_0070719 3300048927 Bacteria 2894
1278 Ga0496124_0084278 3300048927 Bacteria 2607
1279 Ga0496124_0128191 3300048927 Bacteria 2019
1280 Ga0496124_0173315 3300048927 Bacteria 1668
1281 Ga0496124_0189209 3300048927 Bacteria 1577
1282 Ga0496124_0273547 3300048927 Bacteria 1235
1283 Ga0496124_0286367 3300048927 Bacteria 1198
1284 Ga0496125_0001098 3300048928 Bacteria 41637
1285 Ga0496125_0001290 3300048928 Bacteria 37143
1286 Ga0496125_0001825 3300048928 Bacteria 29428
1287 Ga0496125_0002418 3300048928 Bacteria 24276
1288 Ga0496125_0004678 3300048928 Bacteria 15593
1289 Ga0496125_0011643 3300048928 Bacteria 8781
1290 Ga0496125_0013477 3300048928 Bacteria 8033
1291 Ga0496125_0021147 3300048928 Bacteria 6079
1292 Ga0496125_0044375 3300048928 Bacteria 3760
1293 Ga0496125_0048051 3300048928 Bacteria 3562
1294 Ga0496125_0069583 3300048928 Bacteria 2761
1295 Ga0496125_0082957 3300048928 Bacteria 2441
1296 Ga0496125_0092339 3300048928 Bacteria 2263
1297 Ga0496125_0145481 3300048928 Bacteria 1639
1298 Ga0496125_0148636 3300048928 Bacteria 1614
1299 Ga0496125_0192351 3300048928 Bacteria 1346
1300 Ga0496126_0000669 3300048929 Bacteria 63371
1301 Ga0496126_0015558 3300048929 Bacteria 7645
1302 Ga0496126_0016186 3300048929 Bacteria 7469
1303 Ga0496126_0020308 3300048929 Bacteria 6518
1304 Ga0496126_0023623 3300048929 Bacteria 5956
1305 Ga0496126_0106373 3300048929 Bacteria 2448
1306 Ga0496126_0217165 3300048929 Bacteria 1608
1307 Ga0495678_000026 3300049459 Bacteria 226978
1308 Ga0495682_0000004 3300049460 Bacteria 378337
1309 Ga0501032_0184529 3300049569 Bacteria 1365
1310 Ga0501033_0001198 3300049570 Bacteria 23371
1311 Ga0501033_0017974 3300049570 Bacteria 5339
1312 Ga0501033_0040914 3300049570 Bacteria 3459
1313 Ga0501034_0093395 3300049571 Bacteria 3005
1314 Ga0501037_0000077 3300049573 Bacteria 91081
1315 Ga0501037_0119811 3300049573 Bacteria 1893
1316 Ga0501037_0247171 3300049573 Bacteria 1249
1317 Ga0501037_0265846 3300049573 Bacteria 1198
1318 Ga0501037_0285442 3300049573 Bacteria 1149
1319 Ga0501038_0084447 3300049574 Bacteria 2671
1320 Ga0501043_0000114 3300049579 Bacteria 75782
1321 Ga0501043_0009282 3300049579 Bacteria 7730
1322 Ga0501047_0004190 3300049581 Bacteria 13573
1323 Ga0501047_0176606 3300049581 Bacteria 2003
1324 Ga0501047_0321306 3300049581 Bacteria 1388
1325 Ga0501067_0017287 3300049583 Bacteria 3985
1326 Ga0501068_0165285 3300049584 Bacteria 1396
1327 Ga0501069_0000016 3300049585 Bacteria 142565
1328 Ga0501069_0049767 3300049585 Bacteria 2329
1329 Ga0501069_0223125 3300049585 Bacteria 1096
1330 Ga0501070_0000450 3300049586 Bacteria 37447
1331 Ga0501070_0014387 3300049586 Bacteria 6657
1332 Ga0501070_0022723 3300049586 Bacteria 5251
1333 Ga0501070_0078089 3300049586 Bacteria 2740
1334 Ga0501071_0006392 3300049587 Bacteria 7649
1335 Ga0501071_0147504 3300049587 Bacteria 1754
1336 Ga0501072_0231524 3300049588 Bacteria 1472
1337 Ga0501073_0001442 3300049589 Bacteria 17577
1338 Ga0501073_0004199 3300049589 Bacteria 10800
1339 Ga0501073_0039577 3300049589 Bacteria 3339
1340 Ga0501073_0055590 3300049589 Bacteria 2769
1341 Ga0501074_0000067 3300049590 Bacteria 49686
1342 Ga0501074_0000095 3300049590 Bacteria 42376
1343 Ga0501079_0054343 3300049741 Bacteria 3089
1344 Ga0501080_0000250 3300049742 Bacteria 40604
1345 Ga0501080_0000591 3300049742 Bacteria 28648
1346 Ga0501080_0035544 3300049742 Bacteria 4649
1347 Ga0501080_0082904 3300049742 Bacteria 2979
1348 Ga0501083_0000111 3300049744 Bacteria 55529
1349 Ga0501083_0103355 3300049744 Bacteria 1877
1350 Ga0501241_010227 3300049758 Bacteria 1707
1351 Ga0501266_001145 3300049763 Bacteria 3400
1352 Ga0501035_0000048 3300049822 Bacteria 146466
1353 Ga0501035_0001937 3300049822 Bacteria 20727
1354 Ga0501035_0002791 3300049822 Bacteria 16891
1355 Ga0501035_0003776 3300049822 Bacteria 14433
1356 Ga0501035_0188292 3300049822 Bacteria 1775
1357 Ga0501035_0454422 3300049822 Bacteria 1059
1358 Ga0501044_0000003 3300049823 Bacteria 345647
1359 Ga0501044_0001869 3300049823 Bacteria 24413
1360 Ga0501044_0008702 3300049823 Bacteria 11108
1361 Ga0501044_0027890 3300049823 Bacteria 5960
1362 Ga0501044_0178024 3300049823 Bacteria 2095
1363 Ga0501044_0525652 3300049823 Bacteria 1082
1364 nmdc:mga03n38_109244_c1 3300050490 Bacteria 1344
1365 nmdc:mga03n38_33255_c1 3300050490 Bacteria 2192
1366 nmdc:mga03n38_55514_c1 3300050490 Bacteria 1785
1367 nmdc:mga03n38_65779_c1 3300050490 Bacteria 1663
1368 nmdc:mga00v17_155812_c1 3300050491 Bacteria 1469
1369 nmdc:mga00v17_1594_c1 3300050491 Bacteria 11845
1370 nmdc:mga00v17_213265_c1 3300050491 Bacteria 1249
1371 nmdc:mga00v17_30433_c1 3300050491 Bacteria 3177
1372 nmdc:mga00v17_8_c1 3300050491 Bacteria 141008
1373 nmdc:mga0yw44_153095_c1 3300050492 Bacteria 1505
1374 nmdc:mga0yw44_222463_c1 3300050492 Bacteria 1251
1375 nmdc:mga0yw44_41686_c2 3300050492 Bacteria 2533
1376 nmdc:mga0yw44_54127_c1 3300050492 Bacteria 2438
1377 nmdc:mga0yw44_57872_c1 3300050492 Bacteria 2366
1378 nmdc:mga0yw44_72213_c1 3300050492 Bacteria 2145
1379 nmdc:mga0k408_204020_c1 3300050493 Bacteria 1180
1380 nmdc:mga0k408_35672_c1 3300050493 Bacteria 2852
1381 nmdc:mga06z11_103442_c1 3300050494 Bacteria 1566
1382 nmdc:mga06z11_162189_c1 3300050494 Bacteria 1278
1383 nmdc:mga06z11_86835_c1 3300050494 Bacteria 1690
1384 nmdc:mga07m45_115185_c1 3300050496 Bacteria 1550
1385 nmdc:mga07m45_116580_c1 3300050496 Bacteria 1541
1386 nmdc:mga07m45_19984_c1 3300050496 Bacteria 3634
1387 nmdc:mga07m45_24549_c1 3300050496 Bacteria 3304
1388 nmdc:mga07m45_34685_c1 3300050496 Bacteria 2805
1389 nmdc:mga07m45_81169_c1 3300050496 Bacteria 1852
1390 nmdc:mga05p37_2055_c1 3300050507 Bacteria 23464
1391 nmdc:mga09592_18432_c1 3300050508 Bacteria 5726
1392 nmdc:mga0qj67_5481_c1 3300050509 Bacteria 9275
1393 nmdc:mga08y16_490352_c1 3300050511 Bacteria 1249
1394 nmdc:mga08y16_778154_c1 3300050511 Bacteria 951
1395 nmdc:mga08y16_9243_c1 3300050511 Bacteria 10340
1396 nmdc:mga0n895_254103_c1 3300050512 Bacteria 1784
1397 nmdc:mga0n895_274736_c1 3300050512 Bacteria 1709
1398 nmdc:mga0n895_27571_c1 3300050512 Bacteria 5398
1399 nmdc:mga0n895_77027_c1 3300050512 Bacteria 3317
1400 nmdc:mga0rr50_13239_c1 3300050513 Bacteria 5364
1401 nmdc:mga0rr50_235646_c1 3300050513 Bacteria 1516
1402 nmdc:mga08x19_33532_c1 3300050514 Bacteria 3241
1403 nmdc:mga0sz30_599_c1 3300050516 Bacteria 13429
1404 nmdc:mga0sz30_6341_c1 3300050516 Bacteria 4389
1405 Ga0495601_0024660 3300053077 Bacteria 3704
1406 Ga0495601_0056379 3300053077 Bacteria 2488
1407 Ga0495601_0293508 3300053077 Bacteria 1059
1408 Ga0500578_0020392 3300053086 Bacteria 4259
1409 Ga0500643_000001 3300053087 Bacteria 1440111
1410 Ga0500643_000138 3300053087 Bacteria 73474
1411 Ga0500643_025724 3300053087 Bacteria 1852
1412 Ga0500644_0002712 3300053088 Bacteria 4424
1413 Ga0500583_0012961 3300053092 Bacteria 3204
1414 Ga0500583_0056423 3300053092 Bacteria 1840
1415 Ga0500651_0022954 3300053093 Bacteria 3903
1416 Ga0500566_0190547 3300053094 Bacteria 1044
1417 Ga0500641_0127578 3300053096 Bacteria 1097
1418 Ga0500641_0128268 3300053096 Bacteria 1094
1419 Ga0500554_003013 3300053102 Bacteria 3390
1420 Ga0500555_001236 3300053103 Bacteria 8222
1421 Ga0500572_001289 3300053111 Bacteria 7015
1422 Ga0500591_017361 3300053115 Bacteria 3477
1423 Ga0500594_0007310 3300053118 Bacteria 2498
1424 Ga0500595_000458 3300053119 Bacteria 25358
1425 Ga0500595_005177 3300053119 Bacteria 5719
1426 Ga0500607_137328 3300053121 Bacteria 1156
1427 Ga0500618_003301 3300053125 Bacteria 5596
1428 Ga0500628_006877 3300053129 Bacteria 1934
1429 Ga0500652_014351 3300053131 Bacteria 2830
1430 Ga0500655_001613 3300053133 Bacteria 4249
1431 Ga0500658_0000075 3300053134 Bacteria 45932
1432 Ga0500659_0120482 3300053135 Bacteria 1340
1433 Ga0500559_0000002 3300053136 Bacteria 262002
1434 Ga0500559_0000027 3300053136 Bacteria 118758
1435 Ga0500559_0000217 3300053136 Bacteria 46155
1436 Ga0500559_0002459 3300053136 Bacteria 9585
1437 Ga0500561_0000020 3300053137 Bacteria 39471
1438 Ga0500574_000164 3300053141 Bacteria 7746
1439 Ga0500588_0046396 3300053146 Bacteria 1335
1440 Ga0500590_001048 3300053148 Bacteria 10801
1441 Ga0500604_0003449 3300053151 Bacteria 4258
1442 Ga0500616_0005615 3300053153 Bacteria 8471
1443 Ga0500616_0006871 3300053153 Bacteria 7345
1444 Ga0500616_0012233 3300053153 Bacteria 5024
1445 Ga0500616_0033959 3300053153 Bacteria 2782
1446 Ga0500616_0052145 3300053153 Bacteria 2152
1447 Ga0500619_032717 3300053154 Bacteria 1595
1448 Ga0500622_0010898 3300053156 Bacteria 4965
1449 Ga0500627_0073105 3300053158 Bacteria 1521
1450 Ga0500634_0000022 3300053161 Bacteria 95424
1451 Ga0500634_0000709 3300053161 Bacteria 11446
1452 Ga0500639_030895 3300053163 Bacteria 2831
1453 Ga0500636_0048143 3300053177 Bacteria 2510
1454 Ga0500636_0122489 3300053177 Bacteria 1457
1455 Ga0500645_000360 3300053730 Bacteria 32459
1456 Ga0500645_010045 3300053730 Bacteria 3152
1457 Ga0500596_001019 3300053735 Bacteria 5611
1458 Ga0500587_005739 3300053739 Bacteria 1661
1459 Ga0501082_0010634 3300060353 Bacteria 7922
1460 Ga0466962_0004668 3300061719 Bacteria 6579

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10288474 Ga0105238_102884742 223
2 3300048912 Ga0496109_0364182 Ga0496109_0364182_537_1274 242
3 3300013105 Ga0157369_10485037 Ga0157369_104850374 248
4 3300013307 Ga0157372_10389054 Ga0157372_103890542 248
5 3300041405 Ga0439438_064349 Ga0439438_064349_126_902 257
6 3300026089 Ga0207648_10274749 Ga0207648_102747492 262
7 3300049581 Ga0501047_0321306 Ga0501047_0321306_534_1355 267
8 3300009177 Ga0105248_10032391 Ga0105248_100323914 268
9 3300035170 Ga0373943_0081383 Ga0373943_0081383_29_850 269
10 3300039438 Ga0436360_1353135 Ga0436360_1353135_588_1430 269
11 3300039450 Ga0436363_0934761 Ga0436363_0934761_1526_2368 269
12 3300049587 Ga0501071_0147504 Ga0501071_0147504_896_1717 269
13 3300037418 Ga0395900_0095425 Ga0395900_0095425_1528_2400 271
14 3300037471 Ga0395905_0049799 Ga0395905_0049799_2879_3751 271
15 3300048924 Ga0496121_0299650 Ga0496121_0299650_30_860 271
16 3300005338 Ga0068868_100028727 Ga0068868_1000287272 273
17 3300005843 Ga0068860_100011376 Ga0068860_1000113765 273
18 3300009093 Ga0105240_10009924 Ga0105240_100099248 273
19 3300009545 Ga0105237_10000277 Ga0105237_1000027714 273
20 3300010375 Ga0105239_10000433 Ga0105239_1000043320 273
21 3300013100 Ga0157373_10054688 Ga0157373_100546881 273
22 3300025914 Ga0207671_10004719 Ga0207671_100047192 273
23 3300026023 Ga0207677_10082150 Ga0207677_100821502 273
24 3300028381 Ga0268264_10008196 Ga0268264_100081963 273
25 3300046460 Ga0495638_0183792 Ga0495638_0183792_312_1145 273
26 3300048918 Ga0496115_0299904 Ga0496115_0299904_219_1100 273
27 3300042012 Ga0439455_0001376 Ga0439455_0001376_670_1572 274
28 3300046473 Ga0495582_0039683 Ga0495582_0039683_666_1550 274
29 3300046474 Ga0495605_0059150 Ga0495605_0059150_449_1315 274
30 3300046477 Ga0495664_0070603 Ga0495664_0070603_693_1577 274
31 3300046501 Ga0495607_0002888 Ga0495607_0002888_7291_8157 274
32 3300047315 Ga0495581_0113817 Ga0495581_0113817_231_1115 274
33 3300047320 Ga0495672_0077325 Ga0495672_0077325_968_1834 274
34 3300050511 nmdc:mga08y16_490352_c1 nmdc:mga08y16_490352_c1_35_883 274
35 iso_pu_bacteria 8004361976 8004368385 274
36 3300048924 Ga0496121_0325250 Ga0496121_0325250_30_914 275
37 iso_pu_bacteria 2958137437 2958137983 275
38 iso_pu_bacteria 2965047637 2965052070 275
39 3300002737 JGI25162J39368_1000775 JGI25162J39368_10007753 276
40 3300003320 rootH2_10037401 rootH2_100374013 276
41 3300003323 rootH1_10003256 rootH1_1000325618 276
42 3300003323 rootH1_10189607 rootH1_101896071 276
43 3300005459 Ga0068867_100554336 Ga0068867_1005543361 276
44 3300005563 Ga0068855_100000195 Ga0068855_10000019582 276
45 3300005563 Ga0068855_100000988 Ga0068855_10000098820 276
46 3300005614 Ga0068856_100029524 Ga0068856_1000295244 276
47 3300009545 Ga0105237_10125353 Ga0105237_101253532 276
48 3300009545 Ga0105237_10329753 Ga0105237_103297532 276
49 3300020078 Ga0206352_10987329 Ga0206352_109873291 276
50 3300025949 Ga0207667_10000046 Ga0207667_100000465 276
51 3300025949 Ga0207667_10007485 Ga0207667_100074859 276
52 3300026078 Ga0207702_10245928 Ga0207702_102459282 276
53 3300028800 Ga0265338_10024738 Ga0265338_100247383 276
54 iso_pu_bacteria 2891088606 2891093132 276
55 3300005539 Ga0068853_100238535 Ga0068853_1002385352 277
56 3300009177 Ga0105248_10072968 Ga0105248_100729682 277
57 3300046531 Ga0495665_0073252 Ga0495665_0073252_233_1066 277
58 iso_pu_bacteria 2821131069 2821133927 277
59 iso_pu_bacteria 2857564685 2857565719 277
60 3300041413 Ga0439465_0058099 Ga0439465_0058099_207_1052 278
61 3300042007 Ga0439449_0000965 Ga0439449_0000965_5812_6657 278
62 3300044765 Ga0466970_0015119 Ga0466970_0015119_2189_3211 278
63 3300045836 Ga0466958_0020405 Ga0466958_0020405_1461_2483 278
64 3300048920 Ga0496117_0003961 Ga0496117_0003961_1345_2181 278
65 3300050513 nmdc:mga0rr50_235646_c1 nmdc:mga0rr50_235646_c1_488_1348 278
66 3300009093 Ga0105240_10282393 Ga0105240_102823932 280
67 3300009551 Ga0105238_10078371 Ga0105238_100783712 280
68 3300025924 Ga0207694_10059529 Ga0207694_100595292 280
69 3300048922 Ga0496119_0066478 Ga0496119_0066478_420_1262 280
70 iso_pu_bacteria 2945961074 2945962402 280
71 iso_pu_bacteria 8001845381 8001849216 280
72 3300003771 Ga0055526_1000353 Ga0055526_10003535 281
73 3300005367 Ga0070667_100100477 Ga0070667_1001004772 281
74 3300005563 Ga0068855_100631052 Ga0068855_1006310521 281
75 3300005614 Ga0068856_100262477 Ga0068856_1002624773 281
76 3300005841 Ga0068863_100000683 Ga0068863_10000068321 281
77 3300005843 Ga0068860_100000439 Ga0068860_1000004397 281
78 3300009036 Ga0105244_10004885 Ga0105244_100048858 281
79 3300010375 Ga0105239_10082341 Ga0105239_100823411 281
80 3300011119 Ga0105246_10111152 Ga0105246_101111522 281
81 3300025295 Ga0209564_1000038 Ga0209564_1000038232 281
82 3300025728 Ga0207655_1038253 Ga0207655_10382532 281
83 3300025903 Ga0207680_10114982 Ga0207680_101149822 281
84 3300025904 Ga0207647_10105563 Ga0207647_101055632 281
85 3300025911 Ga0207654_10040827 Ga0207654_100408272 281
86 3300026078 Ga0207702_10127312 Ga0207702_101273122 281
87 3300026088 Ga0207641_10000900 Ga0207641_100009008 281
88 3300028381 Ga0268264_10000100 Ga0268264_10000100113 281
89 3300035114 Ga0373939_0023257 Ga0373939_0023257_674_1528 281
90 3300037312 Ga0395899_0063904 Ga0395899_0063904_1751_2596 281
91 3300037418 Ga0395900_0102528 Ga0395900_0102528_1967_2812 281
92 3300044684 Ga0466966_0100568 Ga0466966_0100568_626_1471 281
93 3300047443 Ga0495687_003645 Ga0495687_003645_128_1054 281
94 3300048909 Ga0496106_0035516 Ga0496106_0035516_2767_3612 281
95 3300048910 Ga0496107_0117139 Ga0496107_0117139_1097_1942 281
96 iso_pu_bacteria 2524023209 2524457562 281
97 iso_pu_bacteria 2643221664 2644358185 281
98 iso_pu_bacteria 2842298080 2842300823 281
99 iso_pu_bacteria 2842357229 2842358057 281
100 iso_pu_bacteria 2884086401 2884088636 281
101 iso_pu_bacteria 8004312739 8004315299 281
102 3300021388 Ga0213875_10002535 Ga0213875_100025359 282
103 3300031242 Ga0265329_10039004 Ga0265329_100390042 282
104 3300031250 Ga0265331_10005664 Ga0265331_100056648 282
105 3300031251 Ga0265327_10021884 Ga0265327_100218842 282
106 3300031344 Ga0265316_10031780 Ga0265316_100317802 282
107 3300037853 Ga0436364_0542878 Ga0436364_0542878_844_1707 282
108 iso_pu_bacteria 2511231026 2511385540 282
109 iso_pu_bacteria 2855730933 2855732388 282
110 iso_pu_bacteria 2855767633 2855769096 282
111 iso_pu_bacteria 2932406140 2932408889 282
112 iso_pu_bacteria 2939577877 2939582021 282
113 3300003316 rootH1_10012089 rootH1_100120899 283
114 3300005545 Ga0070695_100059422 Ga0070695_1000594222 283
115 3300005549 Ga0070704_100069702 Ga0070704_1000697023 283
116 3300005577 Ga0068857_100032292 Ga0068857_1000322923 283
117 3300005617 Ga0068859_100159809 Ga0068859_1001598094 283
118 3300005937 Ga0081455_10009027 Ga0081455_100090279 283
119 3300006177 Ga0075362_10039953 Ga0075362_100399532 283
120 3300006931 Ga0097620_100159817 Ga0097620_1001598174 283
121 3300009551 Ga0105238_10288025 Ga0105238_102880252 283
122 3300026116 Ga0207674_10024897 Ga0207674_100248977 283
123 3300037471 Ga0395905_0236992 Ga0395905_0236992_482_1336 283
124 3300046513 Ga0495616_0023492 Ga0495616_0023492_2049_2909 283
125 3300046523 Ga0495644_0079124 Ga0495644_0079124_366_1226 283
126 3300046810 Ga0495660_0000011 Ga0495660_0000011_307449_308309 283
127 3300048928 Ga0496125_0192351 Ga0496125_0192351_465_1316 283
128 3300049460 Ga0495682_0000004 Ga0495682_0000004_304567_305427 283
129 3300050490 nmdc:mga03n38_109244_c1 nmdc:mga03n38_109244_c1_419_1291 283
130 3300050491 nmdc:mga00v17_213265_c1 nmdc:mga00v17_213265_c1_156_1028 283
131 3300053096 Ga0500641_0128268 Ga0500641_0128268_207_1058 283
132 iso_pu_bacteria 2516143018 2516204846 283
133 iso_pu_bacteria 2744054900 2746086289 283
134 iso_pu_bacteria 2744054901 2746096958 283
135 iso_pu_bacteria 2765235942 2766068311 283
136 iso_pu_bacteria 2844425489 2844427359 283
137 iso_pu_bacteria 2848694841 2848700259 283
138 iso_pu_bacteria 2881161766 2881161893 283
139 iso_pu_bacteria 3004268573 3004272379 283
140 iso_pu_bacteria 8054002106 8054008264 283
141 3300005293 Ga0065715_10110171 Ga0065715_101101713 284
142 3300005330 Ga0070690_100020249 Ga0070690_1000202496 284
143 3300005334 Ga0068869_100121152 Ga0068869_1001211522 284
144 3300005335 Ga0070666_10041064 Ga0070666_100410644 284
145 3300005338 Ga0068868_100010007 Ga0068868_1000100075 284
146 3300005344 Ga0070661_100127868 Ga0070661_1001278683 284
147 3300005354 Ga0070675_100062107 Ga0070675_1000621072 284
148 3300005355 Ga0070671_100067148 Ga0070671_1000671482 284
149 3300005364 Ga0070673_100002004 Ga0070673_10000200412 284
150 3300005365 Ga0070688_100000670 Ga0070688_10000067016 284
151 3300005366 Ga0070659_100138341 Ga0070659_1001383412 284
152 3300005367 Ga0070667_100058983 Ga0070667_1000589835 284
153 3300005406 Ga0070703_10056291 Ga0070703_100562912 284
154 3300005438 Ga0070701_10124100 Ga0070701_101241002 284
155 3300005456 Ga0070678_100178486 Ga0070678_1001784863 284
156 3300005457 Ga0070662_100089051 Ga0070662_1000890511 284
157 3300005466 Ga0070685_10004218 Ga0070685_100042185 284
158 3300005544 Ga0070686_100042207 Ga0070686_1000422072 284
159 3300005546 Ga0070696_100291242 Ga0070696_1002912422 284
160 3300005548 Ga0070665_100116162 Ga0070665_1001161622 284
161 3300005548 Ga0070665_100154255 Ga0070665_1001542552 284
162 3300005564 Ga0070664_100000969 Ga0070664_10000096918 284
163 3300005617 Ga0068859_100109335 Ga0068859_1001093353 284
164 3300005618 Ga0068864_100382007 Ga0068864_1003820072 284
165 3300005841 Ga0068863_100004808 Ga0068863_1000048088 284
166 3300005842 Ga0068858_100278124 Ga0068858_1002781242 284
167 3300005843 Ga0068860_100151007 Ga0068860_1001510073 284
168 3300006237 Ga0097621_100013057 Ga0097621_1000130572 284
169 3300006358 Ga0068871_100000739 Ga0068871_10000073913 284
170 3300006358 Ga0068871_100354221 Ga0068871_1003542212 284
171 3300006847 Ga0075431_100311316 Ga0075431_1003113163 284
172 3300006871 Ga0075434_100034079 Ga0075434_1000340794 284
173 3300006880 Ga0075429_100137495 Ga0075429_1001374953 284
174 3300006881 Ga0068865_100011752 Ga0068865_1000117526 284
175 3300006881 Ga0068865_100017394 Ga0068865_1000173944 284
176 3300006914 Ga0075436_100001843 Ga0075436_10000184316 284
177 3300006931 Ga0097620_100109334 Ga0097620_1001093343 284
178 3300007076 Ga0075435_100026548 Ga0075435_1000265483 284
179 3300009094 Ga0111539_10002000 Ga0111539_100020005 284
180 3300009094 Ga0111539_10234427 Ga0111539_102344271 284
181 3300009098 Ga0105245_10017670 Ga0105245_100176705 284
182 3300009176 Ga0105242_10005891 Ga0105242_100058919 284
183 3300009176 Ga0105242_10370020 Ga0105242_103700202 284
184 3300009177 Ga0105248_10139302 Ga0105248_101393022 284
185 3300009177 Ga0105248_10528633 Ga0105248_105286331 284
186 3300013306 Ga0163162_10181482 Ga0163162_101814822 284
187 3300013308 Ga0157375_10005611 Ga0157375_1000561114 284
188 3300013308 Ga0157375_10416522 Ga0157375_104165222 284
189 3300014745 Ga0157377_10023260 Ga0157377_100232601 284
190 3300014968 Ga0157379_10079534 Ga0157379_100795342 284
191 3300014968 Ga0157379_10139074 Ga0157379_101390741 284
192 3300014969 Ga0157376_10008577 Ga0157376_100085777 284
193 3300025315 Ga0207697_10073428 Ga0207697_100734282 284
194 3300025901 Ga0207688_10015030 Ga0207688_100150304 284
195 3300025903 Ga0207680_10031100 Ga0207680_100311004 284
196 3300025906 Ga0207699_10000070 Ga0207699_1000007037 284
197 3300025907 Ga0207645_10099111 Ga0207645_100991113 284
198 3300025926 Ga0207659_10002302 Ga0207659_100023029 284
199 3300025926 Ga0207659_10051136 Ga0207659_100511363 284
200 3300025927 Ga0207687_10010250 Ga0207687_100102505 284
201 3300025931 Ga0207644_10042431 Ga0207644_100424314 284
202 3300025933 Ga0207706_10013496 Ga0207706_1001349614 284
203 3300025934 Ga0207686_10002966 Ga0207686_100029667 284
204 3300025937 Ga0207669_10012678 Ga0207669_100126784 284
205 3300025939 Ga0207665_10018609 Ga0207665_100186092 284
206 3300025941 Ga0207711_10008496 Ga0207711_100084965 284
207 3300025941 Ga0207711_10100310 Ga0207711_101003102 284
208 3300025941 Ga0207711_10136445 Ga0207711_101364451 284
209 3300025942 Ga0207689_10092095 Ga0207689_100920953 284
210 3300025945 Ga0207679_10105872 Ga0207679_101058721 284
211 3300025960 Ga0207651_10010829 Ga0207651_1001082910 284
212 3300025986 Ga0207658_10200604 Ga0207658_102006042 284
213 3300026035 Ga0207703_10129697 Ga0207703_101296972 284
214 3300026088 Ga0207641_10010599 Ga0207641_100105996 284
215 3300026089 Ga0207648_10026890 Ga0207648_100268903 284
216 3300026095 Ga0207676_10333313 Ga0207676_103333132 284
217 3300026118 Ga0207675_100576377 Ga0207675_1005763772 284
218 3300026121 Ga0207683_10218220 Ga0207683_102182202 284
219 3300027907 Ga0207428_10000946 Ga0207428_1000094634 284
220 3300028381 Ga0268264_10124281 Ga0268264_101242813 284
221 3300038705 Ga0237819_09536 Ga0237819_09536_15_905 284
222 3300045051 Ga0451576_0561399 Ga0451576_0561399_206_1069 284
223 3300046501 Ga0495607_0035589 Ga0495607_0035589_757_1611 284
224 3300046507 Ga0495606_0000725 Ga0495606_0000725_32706_33560 284
225 3300046522 Ga0495643_0039054 Ga0495643_0039054_1064_1918 284
226 3300046794 Ga0495589_0000490 Ga0495589_0000490_26107_26961 284
227 3300047318 Ga0495636_0072139 Ga0495636_0072139_574_1437 284
228 3300047446 Ga0495679_007769 Ga0495679_007769_2305_3159 284
229 3300048911 Ga0496108_0469968 Ga0496108_0469968_117_1001 284
230 3300050507 nmdc:mga05p37_2055_c1 nmdc:mga05p37_2055_c1_5923_6786 284
231 3300050508 nmdc:mga09592_18432_c1 nmdc:mga09592_18432_c1_4239_5102 284
232 3300050509 nmdc:mga0qj67_5481_c1 nmdc:mga0qj67_5481_c1_7062_7925 284
233 3300050511 nmdc:mga08y16_9243_c1 nmdc:mga08y16_9243_c1_5618_6481 284
234 3300050512 nmdc:mga0n895_254103_c1 nmdc:mga0n895_254103_c1_227_1090 284
235 3300050512 nmdc:mga0n895_27571_c1 nmdc:mga0n895_27571_c1_2470_3330 284
236 3300050512 nmdc:mga0n895_77027_c1 nmdc:mga0n895_77027_c1_17_880 284
237 3300050513 nmdc:mga0rr50_13239_c1 nmdc:mga0rr50_13239_c1_2520_3380 284
238 3300050514 nmdc:mga08x19_33532_c1 nmdc:mga08x19_33532_c1_2271_3131 284
239 3300053096 Ga0500641_0127578 Ga0500641_0127578_167_1048 284
240 iso_pu_bacteria 2503198000 2503201166 284
241 iso_pu_bacteria 2508501123 2509118560 284
242 iso_pu_bacteria 2508501127 2509145239 284
243 iso_pu_bacteria 2508501128 2509153238 284
244 iso_pu_bacteria 2509276018 2509372430 284
245 iso_pu_bacteria 2509276021 2509391016 284
246 iso_pu_bacteria 2509276022 2509395917 284
247 iso_pu_bacteria 2509276033 2509441825 284
248 iso_pu_bacteria 2510065019 2510137433 284
249 iso_pu_bacteria 2510917022 2511137117 284
250 iso_pu_bacteria 2512047086 2512533315 284
251 iso_pu_bacteria 2512875016 2512931929 284
252 iso_pu_bacteria 2512875024 2512959879 284
253 iso_pu_bacteria 2513237085 2513576015 284
254 iso_pu_bacteria 2513237144 2513908891 284
255 iso_pu_bacteria 2513237164 2514036100 284
256 iso_pu_bacteria 2513237305 2514418758 284
257 iso_pu_bacteria 2513237351 2514589737 284
258 iso_pu_bacteria 2515075009 2515109498 284
259 iso_pu_bacteria 2515154113 2515634272 284
260 iso_pu_bacteria 2515154123 2515690632 284
261 iso_pu_bacteria 2515154134 2515742562 284
262 iso_pu_bacteria 2516653085 2517081478 284
263 iso_pu_bacteria 2517093000 2517100132 284
264 iso_pu_bacteria 2517287029 2517411330 284
265 iso_pu_bacteria 2519103095 2519463134 284
266 iso_pu_bacteria 2529292951 2530648553 284
267 iso_pu_bacteria 2547132416 2548652292 284
268 iso_pu_bacteria 2554235003 2554249522 284
269 iso_pu_bacteria 2558860242 2559298147 284
270 iso_pu_bacteria 2582581283 2585165258 284
271 iso_pu_bacteria 2582581298 2585226528 284
272 iso_pu_bacteria 2582581304 2585256876 284
273 iso_pu_bacteria 2582581306 2585265110 284
274 iso_pu_bacteria 2582581307 2585273630 284
275 iso_pu_bacteria 2582581311 2585293482 284
276 iso_pu_bacteria 2582581315 2585325935 284
277 iso_pu_bacteria 2582581316 2585330104 284
278 iso_pu_bacteria 2582581865 2585385759 284
279 iso_pu_bacteria 2585427528 2585538868 284
280 iso_pu_bacteria 2585427529 2585549602 284
281 iso_pu_bacteria 2585427530 2585557026 284
282 iso_pu_bacteria 2585427531 2585559804 284
283 iso_pu_bacteria 2585427593 2585836819 284
284 iso_pu_bacteria 2585427608 2585900485 284
285 iso_pu_bacteria 2585427609 2585906018 284
286 iso_pu_bacteria 2585428125 2587978867 284
287 iso_pu_bacteria 2588253730 2588517785 284
288 iso_pu_bacteria 2595698237 2596375044 284
289 iso_pu_bacteria 2596583598 2597028123 284
290 iso_pu_bacteria 2597489875 2597814445 284
291 iso_pu_bacteria 2599185178 2599444844 284
292 iso_pu_bacteria 2599185236 2599720082 284
293 iso_pu_bacteria 2599185240 2599743691 284
294 iso_pu_bacteria 2599185292 2599907420 284
295 iso_pu_bacteria 2599185303 2599946963 284
296 iso_pu_bacteria 2599185354 2600200266 284
297 iso_pu_bacteria 2599185355 2600209239 284
298 iso_pu_bacteria 2602042047 2603642594 284
299 iso_pu_bacteria 2602042066 2603698368 284
300 iso_pu_bacteria 2602042067 2603703186 284
301 iso_pu_bacteria 2615840624 2616294273 284
302 iso_pu_bacteria 2615840626 2616306278 284
303 iso_pu_bacteria 2615840698 2616553456 284
304 iso_pu_bacteria 2617270735 2617346501 284
305 iso_pu_bacteria 2617270742 2617383693 284
306 iso_pu_bacteria 2643221568 2643858116 284
307 iso_pu_bacteria 2643221592 2643969452 284
308 iso_pu_bacteria 2643221595 2643986840 284
309 iso_pu_bacteria 2643221607 2644046888 284
310 iso_pu_bacteria 2643221625 2644143752 284
311 iso_pu_bacteria 2643221627 2644157683 284
312 iso_pu_bacteria 2643221636 2644202580 284
313 iso_pu_bacteria 2643221648 2644276542 284
314 iso_pu_bacteria 2643221686 2644479677 284
315 iso_pu_bacteria 2643221689 2644497217 284
316 iso_pu_bacteria 2643221693 2644523581 284
317 iso_pu_bacteria 2667528172 2671103122 284
318 iso_pu_bacteria 2667528174 2671112413 284
319 iso_pu_bacteria 2675903129 2676742522 284
320 iso_pu_bacteria 2681812866 2681997732 284
321 iso_pu_bacteria 2681812869 2682006744 284
322 iso_pu_bacteria 2687453392 2688599792 284
323 iso_pu_bacteria 2718217882 2719184244 284
324 iso_pu_bacteria 2718217927 2719389988 284
325 iso_pu_bacteria 2718218009 2719729817 284
326 iso_pu_bacteria 2718218232 2720610936 284
327 iso_pu_bacteria 2718218233 2720616817 284
328 iso_pu_bacteria 2718218235 2720628173 284
329 iso_pu_bacteria 2718218269 2720771753 284
330 iso_pu_bacteria 2718218363 2721144067 284
331 iso_pu_bacteria 2718218365 2721156756 284
332 iso_pu_bacteria 2718218366 2721161442 284
333 iso_pu_bacteria 2718218423 2721403627 284
334 iso_pu_bacteria 2721755514 2722837395 284
335 iso_pu_bacteria 2721755556 2723031007 284
336 iso_pu_bacteria 2721755684 2723563513 284
337 iso_pu_bacteria 2721755685 2723571507 284
338 iso_pu_bacteria 2721755686 2723576569 284
339 iso_pu_bacteria 2721755809 2724035203 284
340 iso_pu_bacteria 2721755810 2724040971 284
341 iso_pu_bacteria 2721755819 2724087302 284
342 iso_pu_bacteria 2721755822 2724101013 284
343 iso_pu_bacteria 2721755823 2724108255 284
344 iso_pu_bacteria 2728369352 2730105473 284
345 iso_pu_bacteria 2728369365 2730162384 284
346 iso_pu_bacteria 2728369397 2730295517 284
347 iso_pu_bacteria 2738541277 2738721026 284
348 iso_pu_bacteria 2738541307 2738881037 284
349 iso_pu_bacteria 2738541333 2739034290 284
350 iso_pu_bacteria 2738543019 2739280225 284
351 iso_pu_bacteria 2751185846 2753568516 284
352 iso_pu_bacteria 2751185897 2753763957 284
353 iso_pu_bacteria 2751185917 2753855809 284
354 iso_pu_bacteria 2765235842 2765588803 284
355 iso_pu_bacteria 2775506706 2775538810 284
356 iso_pu_bacteria 2775507266 2778174216 284
357 iso_pu_bacteria 2791355123 2792745906 284
358 iso_pu_bacteria 2791355259 2793312845 284
359 iso_pu_bacteria 2791355260 2793321864 284
360 iso_pu_bacteria 2791355261 2793326893 284
361 iso_pu_bacteria 2791355264 2793348563 284
362 iso_pu_bacteria 2791355265 2793354186 284
363 iso_pu_bacteria 2791355266 2793361728 284
364 iso_pu_bacteria 2791355275 2793405447 284
365 iso_pu_bacteria 2802429605 2805929807 284
366 iso_pu_bacteria 2802429606 2805933157 284
367 iso_pu_bacteria 2802429633 2806043091 284
368 iso_pu_bacteria 2802429634 2806051043 284
369 iso_pu_bacteria 2802429635 2806057788 284
370 iso_pu_bacteria 2802429636 2806065495 284
371 iso_pu_bacteria 2802429637 2806075264 284
372 iso_pu_bacteria 2808606387 2808989343 284
373 iso_pu_bacteria 2816332253 2817263483 284
374 iso_pu_bacteria 2816332256 2817276860 284
375 iso_pu_bacteria 2816332286 2817452972 284
376 iso_pu_bacteria 2818991436 2819543100 284
377 iso_pu_bacteria 2818991453 2819643560 284
378 iso_pu_bacteria 2818991457 2819661897 284
379 iso_pu_bacteria 2821118458 2821119612 284
380 iso_pu_bacteria 2823373977 2823374593 284
381 iso_pu_bacteria 2824696289 2824702954 284
382 iso_pu_bacteria 2838016132 2838019649 284
383 iso_pu_bacteria 2838022645 2838027148 284
384 iso_pu_bacteria 2838029111 2838029249 284
385 iso_pu_bacteria 2838061910 2838066428 284
386 iso_pu_bacteria 2838068647 2838072520 284
387 iso_pu_bacteria 2838680041 2838686038 284
388 iso_pu_bacteria 2838686498 2838688497 284
389 iso_pu_bacteria 2838694306 2838700591 284
390 iso_pu_bacteria 2838707686 2838713870 284
391 iso_pu_bacteria 2838729681 2838734369 284
392 iso_pu_bacteria 2838742623 2838746828 284
393 iso_pu_bacteria 2841734538 2841740749 284
394 iso_pu_bacteria 2841851746 2841852237 284
395 iso_pu_bacteria 2841864319 2841865647 284
396 iso_pu_bacteria 2841941048 2841944756 284
397 iso_pu_bacteria 2841949485 2841955953 284
398 iso_pu_bacteria 2841966195 2841969910 284
399 iso_pu_bacteria 2841974524 2841978659 284
400 iso_pu_bacteria 2842077413 2842082976 284
401 iso_pu_bacteria 2842118031 2842124215 284
402 iso_pu_bacteria 2842156927 2842158688 284
403 iso_pu_bacteria 2842163707 2842166112 284
404 iso_pu_bacteria 2842180545 2842182302 284
405 iso_pu_bacteria 2842192696 2842193922 284
406 iso_pu_bacteria 2842198810 2842200622 284
407 iso_pu_bacteria 2842229732 2842234685 284
408 iso_pu_bacteria 2842237096 2842243283 284
409 iso_pu_bacteria 2842243621 2842248418 284
410 iso_pu_bacteria 2842257432 2842262409 284
411 iso_pu_bacteria 2842271015 2842272553 284
412 iso_pu_bacteria 2842285085 2842289188 284
413 iso_pu_bacteria 2842291075 2842297235 284
414 iso_pu_bacteria 2842304105 2842308006 284
415 iso_pu_bacteria 2842311132 2842313242 284
416 iso_pu_bacteria 2842317721 2842319336 284
417 iso_pu_bacteria 2842341865 2842345577 284
418 iso_pu_bacteria 2842363717 2842363874 284
419 iso_pu_bacteria 2842370503 2842376343 284
420 iso_pu_bacteria 2842377471 2842383629 284
421 iso_pu_bacteria 2842384541 2842390768 284
422 iso_pu_bacteria 2842402390 2842407394 284
423 iso_pu_bacteria 2842409023 2842413357 284
424 iso_pu_bacteria 2842415677 2842420000 284
425 iso_pu_bacteria 2842422224 2842426032 284
426 iso_pu_bacteria 2842447887 2842452453 284
427 iso_pu_bacteria 2842475841 2842476321 284
428 iso_pu_bacteria 2842482326 2842482397 284
429 iso_pu_bacteria 2842489311 2842490675 284
430 iso_pu_bacteria 2842495871 2842498912 284
431 iso_pu_bacteria 2842502639 2842502777 284
432 iso_pu_bacteria 2842780639 2842782529 284
433 iso_pu_bacteria 2842914999 2842917209 284
434 iso_pu_bacteria 2842918807 2842919102 284
435 iso_pu_bacteria 2844454524 2844461451 284
436 iso_pu_bacteria 2847939898 2847947443 284
437 iso_pu_bacteria 2852387548 2852395064 284
438 iso_pu_bacteria 2852684882 2852688563 284
439 iso_pu_bacteria 2854916844 2854919307 284
440 iso_pu_bacteria 2856320880 2856326952 284
441 iso_pu_bacteria 2856328259 2856333071 284
442 iso_pu_bacteria 2856334872 2856337629 284
443 iso_pu_bacteria 2856342000 2856349276 284
444 iso_pu_bacteria 2857367948 2857368988 284
445 iso_pu_bacteria 2863421361 2863423436 284
446 iso_pu_bacteria 2869162929 2869166882 284
447 iso_pu_bacteria 2869169390 2869169763 284
448 iso_pu_bacteria 2869234852 2869236193 284
449 iso_pu_bacteria 2869242130 2869244352 284
450 iso_pu_bacteria 2869249662 2869252902 284
451 iso_pu_bacteria 2869256925 2869257051 284
452 iso_pu_bacteria 2869264136 2869267428 284
453 iso_pu_bacteria 2869271264 2869273433 284
454 iso_pu_bacteria 2869278585 2869283501 284
455 iso_pu_bacteria 2870068957 2870074594 284
456 iso_pu_bacteria 2871435913 2871441178 284
457 iso_pu_bacteria 2871451962 2871455051 284
458 iso_pu_bacteria 2871459585 2871465325 284
459 iso_pu_bacteria 2871474448 2871478708 284
460 iso_pu_bacteria 2871481445 2871481928 284
461 iso_pu_bacteria 2874109183 2874116471 284
462 iso_pu_bacteria 2874116593 2874123398 284
463 iso_pu_bacteria 2874123672 2874126165 284
464 iso_pu_bacteria 2874131515 2874134472 284
465 iso_pu_bacteria 2874139085 2874143811 284
466 iso_pu_bacteria 2874162495 2874166196 284
467 iso_pu_bacteria 2874168670 2874170248 284
468 iso_pu_bacteria 2876363079 2876368917 284
469 iso_pu_bacteria 2876386047 2876386788 284
470 iso_pu_bacteria 2876399893 2876403472 284
471 iso_pu_bacteria 2876406927 2876413183 284
472 iso_pu_bacteria 2876420981 2876426574 284
473 iso_pu_bacteria 2878730984 2878735906 284
474 iso_pu_bacteria 2878738818 2878739071 284
475 iso_pu_bacteria 2878774303 2878778177 284
476 iso_pu_bacteria 2878781027 2878783386 284
477 iso_pu_bacteria 2878788777 2878794232 284
478 iso_pu_bacteria 2882456835 2882457773 284
479 iso_pu_bacteria 2882632389 2882633373 284
480 iso_pu_bacteria 2885305155 2885310781 284
481 iso_pu_bacteria 2885312484 2885316739 284
482 iso_pu_bacteria 2885326080 2885330695 284
483 iso_pu_bacteria 2886627955 2886633395 284
484 iso_pu_bacteria 2888343758 2888348178 284
485 iso_pu_bacteria 2899792073 2899793820 284
486 iso_pu_bacteria 2899845264 2899846751 284
487 iso_pu_bacteria 2900577576 2900582781 284
488 iso_pu_bacteria 2903448605 2903450858 284
489 iso_pu_bacteria 2903513507 2903513651 284
490 iso_pu_bacteria 2903521522 2903527915 284
491 iso_pu_bacteria 2903528002 2903529773 284
492 iso_pu_bacteria 2904541872 2904545423 284
493 iso_pu_bacteria 2904564687 2904569692 284
494 iso_pu_bacteria 2904571731 2904577003 284
495 iso_pu_bacteria 2906363423 2906364756 284
496 iso_pu_bacteria 2906370794 2906371295 284
497 iso_pu_bacteria 2906386501 2906392451 284
498 iso_pu_bacteria 2906393657 2906400746 284
499 iso_pu_bacteria 2906401398 2906405847 284
500 iso_pu_bacteria 2906408224 2906409497 284
501 iso_pu_bacteria 2908446538 2908449442 284
502 iso_pu_bacteria 2909042592 2909044943 284
503 iso_pu_bacteria 2916035215 2916040689 284
504 iso_pu_bacteria 2919085039 2919086260 284
505 iso_pu_bacteria 2919130084 2919133805 284
506 iso_pu_bacteria 2919166419 2919169909 284
507 iso_pu_bacteria 2919408235 2919408847 284
508 iso_pu_bacteria 2920760137 2920767133 284
509 iso_pu_bacteria 2922151315 2922155020 284
510 iso_pu_bacteria 2922172374 2922175902 284
511 iso_pu_bacteria 2923634449 2923634681 284
512 iso_pu_bacteria 2924710171 2924714255 284
513 iso_pu_bacteria 2924718760 2924723619 284
514 iso_pu_bacteria 2924733363 2924735033 284
515 iso_pu_bacteria 2924748358 2924752049 284
516 iso_pu_bacteria 2924754689 2924756886 284
517 iso_pu_bacteria 2924776078 2924776433 284
518 iso_pu_bacteria 2926760298 2926765563 284
519 iso_pu_bacteria 2927833300 2927834268 284
520 iso_pu_bacteria 2928058823 2928059976 284
521 iso_pu_bacteria 2928125067 2928126392 284
522 iso_pu_bacteria 2928157003 2928162309 284
523 iso_pu_bacteria 2928163908 2928166272 284
524 iso_pu_bacteria 2928536128 2928536908 284
525 iso_pu_bacteria 2929160207 2929168072 284
526 iso_pu_bacteria 2929195423 2929199902 284
527 iso_pu_bacteria 2933570622 2933574455 284
528 iso_pu_bacteria 2935630451 2935635988 284
529 iso_pu_bacteria 2935894831 2935900907 284
530 iso_pu_bacteria 2935901341 2935906551 284
531 iso_pu_bacteria 2936381700 2936382571 284
532 iso_pu_bacteria 2937539931 2937541835 284
533 iso_pu_bacteria 2937836603 2937836920 284
534 iso_pu_bacteria 2937848649 2937852620 284
535 iso_pu_bacteria 2937861824 2937862438 284
536 iso_pu_bacteria 2937877337 2937884113 284
537 iso_pu_bacteria 2937972304 2937979781 284
538 iso_pu_bacteria 2939568625 2939569029 284
539 iso_pu_bacteria 2939642701 2939643922 284
540 iso_pu_bacteria 2939669807 2939670164 284
541 iso_pu_bacteria 2941507105 2941512708 284
542 iso_pu_bacteria 2941515067 2941520454 284
543 iso_pu_bacteria 2941523033 2941528468 284
544 iso_pu_bacteria 2958034702 2958040013 284
545 iso_pu_bacteria 2958041894 2958054357 284
546 iso_pu_bacteria 2958064165 2958071134 284
547 iso_pu_bacteria 2958071322 2958076807 284
548 iso_pu_bacteria 2958084443 2958091424 284
549 iso_pu_bacteria 2958092219 2958098785 284
550 iso_pu_bacteria 2958108152 2958111171 284
551 iso_pu_bacteria 2958122699 2958122701 284
552 iso_pu_bacteria 2958144490 2958146655 284
553 iso_pu_bacteria 2958158011 2958160696 284
554 iso_pu_bacteria 2961136820 2961139380 284
555 iso_pu_bacteria 2961183825 2961188626 284
556 iso_pu_bacteria 2963644680 2963647279 284
557 iso_pu_bacteria 2964698721 2964700452 284
558 iso_pu_bacteria 2965025482 2965028038 284
559 iso_pu_bacteria 2965032056 2965039197 284
560 iso_pu_bacteria 2965040258 2965044930 284
561 iso_pu_bacteria 2965089291 2965092937 284
562 iso_pu_bacteria 2965102966 2965106856 284
563 iso_pu_bacteria 2965110997 2965118794 284
564 iso_pu_bacteria 2968016561 2968018856 284
565 iso_pu_bacteria 2968083720 2968087886 284
566 iso_pu_bacteria 2970469710 2970470971 284
567 iso_pu_bacteria 2970489779 2970495392 284
568 iso_pu_bacteria 2970524798 2970531497 284
569 iso_pu_bacteria 2970532167 2970535179 284
570 iso_pu_bacteria 2970540015 2970546227 284
571 iso_pu_bacteria 2970547951 2970549130 284
572 iso_pu_bacteria 2970593180 2970598074 284
573 iso_pu_bacteria 2970619444 2970622825 284
574 iso_pu_bacteria 2970627176 2970628006 284
575 iso_pu_bacteria 2974310843 2974312275 284
576 iso_pu_bacteria 2977851361 2977858043 284
577 iso_pu_bacteria 2977872689 2977873123 284
578 iso_pu_bacteria 2977898635 2977904200 284
579 iso_pu_bacteria 2977907340 2977910721 284
580 iso_pu_bacteria 2977935797 2977939243 284
581 iso_pu_bacteria 2977950692 2977951561 284
582 iso_pu_bacteria 2977957713 2977958611 284
583 iso_pu_bacteria 2977986579 2977989568 284
584 iso_pu_bacteria 2978969890 2978972367 284
585 iso_pu_bacteria 2979100975 2979103325 284
586 iso_pu_bacteria 2979764755 2979767215 284
587 iso_pu_bacteria 2979772303 2979775880 284
588 iso_pu_bacteria 2979793036 2979797511 284
589 iso_pu_bacteria 2980125574 2980127584 284
590 iso_pu_bacteria 2981990288 2981995642 284
591 iso_pu_bacteria 2984587000 2984590616 284
592 iso_pu_bacteria 2987645492 2987645995 284
593 iso_pu_bacteria 2987673487 2987675956 284
594 iso_pu_bacteria 2996310559 2996312951 284
595 iso_pu_bacteria 2996348954 2996349717 284
596 iso_pu_bacteria 2996386984 2996389435 284
597 iso_pu_bacteria 2996893221 2996894809 284
598 iso_pu_bacteria 3000135777 3000136362 284
599 iso_pu_bacteria 3004167301 3004170504 284
600 iso_pu_bacteria 3004195979 3004203164 284
601 iso_pu_bacteria 3004232784 3004237826 284
602 iso_pu_bacteria 3004239961 3004242948 284
603 iso_pu_bacteria 3004248173 3004248886 284
604 iso_pu_bacteria 3004275668 3004276423 284
605 iso_pu_bacteria 3004289098 3004289098 284
606 iso_pu_bacteria 3004334049 3004334973 284
607 iso_pu_bacteria 3005416602 3005422765 284
608 iso_pu_bacteria 637000159 637075026 284
609 iso_pu_bacteria 641736154 642414341 284
610 iso_pu_bacteria 643692032 643822484 284
611 iso_pu_bacteria 649633066 649874298 284
612 iso_pu_bacteria 650716007 650741767 284
613 iso_pu_bacteria 8004300914 8004307336 284
614 iso_pu_bacteria 8004395343 8004402280 284
615 iso_pu_bacteria 8004633249 8004640056 284
616 iso_pu_bacteria 8004727605 8004727943 284
617 iso_pu_bacteria 8005275841 8005276112 284
618 iso_pu_bacteria 8005282627 8005287344 284
619 iso_pu_bacteria 8005289223 8005289918 284
620 iso_pu_bacteria 8005307578 8005311547 284
621 iso_pu_bacteria 8005314921 8005321699 284
622 iso_pu_bacteria 8005382845 8005389285 284
623 iso_pu_bacteria 8005395548 8005396852 284
624 iso_pu_bacteria 8005430974 8005435740 284
625 iso_pu_bacteria 8005460587 8005466239 284
626 iso_pu_bacteria 8005484373 8005486095 284
627 iso_pu_bacteria 8005497431 8005503484 284
628 iso_pu_bacteria 8005556819 8005563241 284
629 iso_pu_bacteria 8005570704 8005575942 284
630 iso_pu_bacteria 8005619151 8005625786 284
631 iso_pu_bacteria 8005626139 8005632043 284
632 iso_pu_bacteria 8005668836 8005675362 284
633 iso_pu_bacteria 8005682033 8005685071 284
634 iso_pu_bacteria 8005688590 8005688683 284
635 iso_pu_bacteria 8005695170 8005695293 284
636 iso_pu_bacteria 8018127388 8018134586 284
637 iso_pu_bacteria 8018176218 8018180697 284
638 iso_pu_bacteria 8018221730 8018222357 284
639 iso_pu_bacteria 8018405270 8018408304 284
640 iso_pu_bacteria 8020807995 8020813463 284
641 iso_pu_bacteria 8020938398 8020940623 284
642 iso_pu_bacteria 8020945358 8020953049 284
643 iso_pu_bacteria 8020953355 8020954203 284
644 iso_pu_bacteria 8023680758 8023686066 284
645 iso_pu_bacteria 8040167225 8040170077 284
646 iso_pu_bacteria 8040173305 8040175300 284
647 iso_pu_bacteria 8046767195 8046768940 284
648 iso_pu_bacteria 8054844752 8054848149 284
649 iso_pu_bacteria 8054849141 8054852599 284
650 iso_pu_bacteria 8055431914 8055434737 284
651 iso_pu_bacteria 8055617313 8055622297 284
652 iso_pu_bacteria 8056375014 8056381925 284
653 3300002738 JGI25154J39366_1000451 JGI25154J39366_100045125 285
654 3300005548 Ga0070665_100095775 Ga0070665_1000957752 285
655 3300005548 Ga0070665_100246946 Ga0070665_1002469462 285
656 3300009036 Ga0105244_10000037 Ga0105244_10000037136 285
657 3300009545 Ga0105237_10000328 Ga0105237_1000032865 285
658 3300010375 Ga0105239_10001783 Ga0105239_1000178320 285
659 3300013105 Ga0157369_10008371 Ga0157369_100083717 285
660 3300025233 Ga0209437_102301 Ga0209437_1023012 285
661 3300025246 Ga0209646_1000077 Ga0209646_1000077138 285
662 3300025728 Ga0207655_1000117 Ga0207655_1000117136 285
663 3300025914 Ga0207671_10001785 Ga0207671_1000178519 285
664 3300025916 Ga0207663_10040563 Ga0207663_100405632 285
665 3300028379 Ga0268266_10000429 Ga0268266_1000042955 285
666 3300028379 Ga0268266_10014608 Ga0268266_100146087 285
667 3300028379 Ga0268266_10538016 Ga0268266_105380161 285
668 3300031090 Ga0265760_10020954 Ga0265760_100209542 285
669 3300035117 Ga0373953_0007239 Ga0373953_0007239_1211_2089 285
670 3300046462 Ga0495651_0061328 Ga0495651_0061328_1785_2663 285
671 3300046507 Ga0495606_0007332 Ga0495606_0007332_7358_8239 285
672 3300046516 Ga0495628_0112163 Ga0495628_0112163_842_1720 285
673 3300046678 Ga0495599_0044563 Ga0495599_0044563_1491_2369 285
674 3300046679 Ga0495623_0096483 Ga0495623_0096483_89_967 285
675 3300053077 Ga0495601_0056379 Ga0495601_0056379_1329_2207 285
676 3300053177 Ga0500636_0122489 Ga0500636_0122489_240_1112 285
677 iso_pu_bacteria 2513237146 2513929226 285
678 iso_pu_bacteria 2599185170 2599415547 285
679 iso_pu_bacteria 2643221596 2643990715 285
680 iso_pu_bacteria 2838035591 2838035663 285
681 iso_pu_bacteria 2838661181 2838665281 285
682 3300003323 rootH1_10192974 rootH1_101929742 286
683 3300005564 Ga0070664_100179353 Ga0070664_1001793532 286
684 3300005841 Ga0068863_100556352 Ga0068863_1005563521 286
685 3300005843 Ga0068860_100148663 Ga0068860_1001486632 286
686 3300006051 Ga0075364_10003881 Ga0075364_1000388110 286
687 3300006353 Ga0075370_10018625 Ga0075370_100186253 286
688 3300009093 Ga0105240_10024462 Ga0105240_100244628 286
689 3300009177 Ga0105248_10009030 Ga0105248_100090302 286
690 3300010375 Ga0105239_10500927 Ga0105239_105009272 286
691 3300013296 Ga0157374_10003851 Ga0157374_1000385110 286
692 3300014325 Ga0163163_10003284 Ga0163163_100032844 286
693 3300014968 Ga0157379_10024669 Ga0157379_100246693 286
694 3300021361 Ga0213872_10009653 Ga0213872_100096534 286
695 3300021377 Ga0213874_10053187 Ga0213874_100531872 286
696 3300021384 Ga0213876_10001656 Ga0213876_1000165614 286
697 3300021384 Ga0213876_10019582 Ga0213876_100195822 286
698 3300025913 Ga0207695_10069666 Ga0207695_100696662 286
699 3300025913 Ga0207695_10115904 Ga0207695_101159043 286
700 3300025945 Ga0207679_10163918 Ga0207679_101639182 286
701 3300026075 Ga0207708_10207808 Ga0207708_102078082 286
702 3300026088 Ga0207641_10617242 Ga0207641_106172421 286
703 3300027312 Ga0209371_1005487 Ga0209371_10054872 286
704 3300030500 Ga0268256_1005395 Ga0268256_10053954 286
705 3300031507 Ga0307509_10427000 Ga0307509_104270002 286
706 3300033180 Ga0307510_10166774 Ga0307510_101667741 286
707 3300039437 Ga0436365_0475170 Ga0436365_0475170_3388_4260 286
708 3300039438 Ga0436360_0888954 Ga0436360_0888954_918_1823 286
709 3300039447 Ga0436361_0040126 Ga0436361_0040126_588_1487 286
710 3300039447 Ga0436361_0060388 Ga0436361_0060388_114_1019 286
711 3300039447 Ga0436361_0474832 Ga0436361_0474832_16_921 286
712 3300039447 Ga0436361_1170673 Ga0436361_1170673_134_1039 286
713 3300039450 Ga0436363_0029129 Ga0436363_0029129_406_1296 286
714 3300044658 Ga0466972_0103632 Ga0466972_0103632_51_911 286
715 3300044684 Ga0466966_0036335 Ga0466966_0036335_140_1000 286
716 3300044684 Ga0466966_0107924 Ga0466966_0107924_718_1578 286
717 3300044693 Ga0466961_0108367 Ga0466961_0108367_170_1030 286
718 3300045049 Ga0466959_0020051 Ga0466959_0020051_361_1221 286
719 3300046471 Ga0495650_0002581 Ga0495650_0002581_13208_14095 286
720 3300046491 Ga0495584_0132637 Ga0495584_0132637_316_1212 286
721 3300046500 Ga0495596_0003174 Ga0495596_0003174_187_1074 286
722 3300046520 Ga0495637_0095983 Ga0495637_0095983_34_921 286
723 3300046524 Ga0495648_0040987 Ga0495648_0040987_1944_2804 286
724 3300046538 Ga0495609_0021536 Ga0495609_0021536_203_1090 286
725 3300046794 Ga0495589_0066227 Ga0495589_0066227_821_1708 286
726 3300047320 Ga0495672_0083174 Ga0495672_0083174_248_1135 286
727 3300047321 Ga0495676_0100364 Ga0495676_0100364_1196_2083 286
728 3300048905 Ga0496102_0333118 Ga0496102_0333118_146_1006 286
729 3300048906 Ga0496103_0206039 Ga0496103_0206039_96_956 286
730 3300048907 Ga0496104_0118725 Ga0496104_0118725_533_1435 286
731 3300048911 Ga0496108_0003772 Ga0496108_0003772_9698_10600 286
732 3300048912 Ga0496109_0004165 Ga0496109_0004165_5070_5972 286
733 3300048913 Ga0496110_0099908 Ga0496110_0099908_1221_2123 286
734 3300048915 Ga0496112_0002096 Ga0496112_0002096_11481_12383 286
735 3300048928 Ga0496125_0069583 Ga0496125_0069583_1885_2748 286
736 3300049589 Ga0501073_0001442 Ga0501073_0001442_10242_11135 286
737 3300049590 Ga0501074_0000095 Ga0501074_0000095_36449_37342 286
738 3300049742 Ga0501080_0000250 Ga0501080_0000250_3263_4156 286
739 3300049758 Ga0501241_010227 Ga0501241_010227_768_1640 286
740 3300049763 Ga0501266_001145 Ga0501266_001145_1101_1988 286
741 3300050494 nmdc:mga06z11_86835_c1 nmdc:mga06z11_86835_c1_619_1521 286
742 3300050496 nmdc:mga07m45_24549_c1 nmdc:mga07m45_24549_c1_299_1201 286
743 3300050512 nmdc:mga0n895_274736_c1 nmdc:mga0n895_274736_c1_462_1376 286
744 3300053125 Ga0500618_003301 Ga0500618_003301_3220_4083 286
745 iso_pu_bacteria 2734482264 2735834320 286
746 iso_pu_bacteria 2842718218 2842720365 286
747 iso_pu_bacteria 2933016740 2933022091 286
748 3300002737 JGI25162J39368_1006232 JGI25162J39368_10062322 287
749 3300003187 JGI25151J46595_10002329 JGI25151J46595_1000232916 287
750 3300003320 rootH2_10057798 rootH2_100577982 287
751 3300003771 Ga0055526_1001272 Ga0055526_10012729 287
752 3300003775 Ga0055524_1001036 Ga0055524_100103617 287
753 3300003784 Ga0055534_1000981 Ga0055534_10009814 287
754 3300005337 Ga0070682_100041799 Ga0070682_1000417992 287
755 3300005544 Ga0070686_100227886 Ga0070686_1002278862 287
756 3300005548 Ga0070665_100011006 Ga0070665_1000110068 287
757 3300005841 Ga0068863_100134507 Ga0068863_1001345072 287
758 3300005937 Ga0081455_10004123 Ga0081455_1000412312 287
759 3300006038 Ga0075365_10132810 Ga0075365_101328102 287
760 3300006051 Ga0075364_10228449 Ga0075364_102284492 287
761 3300006177 Ga0075362_10111342 Ga0075362_101113422 287
762 3300006178 Ga0075367_10134593 Ga0075367_101345932 287
763 3300006195 Ga0075366_10220974 Ga0075366_102209742 287
764 3300013100 Ga0157373_10001122 Ga0157373_1000112215 287
765 3300015261 Ga0182006_1000051 Ga0182006_100005198 287
766 3300015261 Ga0182006_1016700 Ga0182006_10167002 287
767 3300021388 Ga0213875_10075069 Ga0213875_100750692 287
768 3300025233 Ga0209437_100261 Ga0209437_1002615 287
769 3300025263 Ga0209565_1000216 Ga0209565_100021635 287
770 3300025273 Ga0209673_1005542 Ga0209673_10055427 287
771 3300025291 Ga0209675_1000299 Ga0209675_100029943 287
772 3300025294 Ga0209025_1000589 Ga0209025_100058935 287
773 3300025295 Ga0209564_1000491 Ga0209564_100049142 287
774 3300025299 Ga0209256_1000519 Ga0209256_100051942 287
775 3300026088 Ga0207641_10119187 Ga0207641_101191872 287
776 3300028379 Ga0268266_10023448 Ga0268266_100234485 287
777 3300037853 Ga0436364_0081014 Ga0436364_0081014_4920_5801 287
778 3300041512 Ga0451853_0958912 Ga0451853_0958912_3846_4709 287
779 3300042010 Ga0439452_000002 Ga0439452_000002_965651_966517 287
780 3300042016 Ga0439463_005881 Ga0439463_005881_2049_2912 287
781 3300044842 Ga0466957_0132513 Ga0466957_0132513_556_1431 287
782 3300046463 Ga0495653_0002018 Ga0495653_0002018_891_1775 287
783 3300046472 Ga0495580_0046384 Ga0495580_0046384_400_1284 287
784 3300046516 Ga0495628_0021277 Ga0495628_0021277_3882_4766 287
785 3300046680 Ga0495646_0005124 Ga0495646_0005124_3984_4868 287
786 3300046690 Ga0495624_0006209 Ga0495624_0006209_4463_5347 287
787 3300047317 Ga0495604_0005708 Ga0495604_0005708_5013_5876 287
788 3300047320 Ga0495672_0103863 Ga0495672_0103863_598_1461 287
789 3300047444 Ga0495675_0015361 Ga0495675_0015361_1152_2015 287
790 3300047673 Ga0495593_0004348 Ga0495593_0004348_10_894 287
791 3300048919 Ga0496116_0029359 Ga0496116_0029359_2100_2975 287
792 3300048920 Ga0496117_0058680 Ga0496117_0058680_66_929 287
793 3300049570 Ga0501033_0040914 Ga0501033_0040914_2459_3355 287
794 3300049571 Ga0501034_0093395 Ga0501034_0093395_1053_1949 287
795 3300049573 Ga0501037_0247171 Ga0501037_0247171_326_1222 287
796 3300049573 Ga0501037_0265846 Ga0501037_0265846_272_1159 287
797 3300049581 Ga0501047_0004190 Ga0501047_0004190_11257_12153 287
798 3300049586 Ga0501070_0022723 Ga0501070_0022723_2553_3440 287
799 3300049742 Ga0501080_0082904 Ga0501080_0082904_455_1342 287
800 3300049822 Ga0501035_0001937 Ga0501035_0001937_7089_7985 287
801 3300049823 Ga0501044_0001869 Ga0501044_0001869_12489_13385 287
802 3300049823 Ga0501044_0525652 Ga0501044_0525652_27_914 287
803 3300050492 nmdc:mga0yw44_153095_c1 nmdc:mga0yw44_153095_c1_203_1081 287
804 3300050494 nmdc:mga06z11_162189_c1 nmdc:mga06z11_162189_c1_15_893 287
805 3300050511 nmdc:mga08y16_778154_c1 nmdc:mga08y16_778154_c1_23_901 287
806 iso_pu_bacteria 2831864461 2831865222 287
807 2162886007 SwRhRL2b_contig_1809446 SwRhRL2b_0289.00006090 288
808 2162886007 SwRhRL2b_contig_239577 SwRhRL2b_0191.00002310 288
809 2162886007 SwRhRL2b_contig_97959 SwRhRL2b_0733.00004650 288
810 2162886011 MRS1b_contig_984201 MRS1b_0819.00002140 288
811 3300001915 JGI24741J21665_1000141 JGI24741J21665_10001416 288
812 3300001915 JGI24741J21665_1003056 JGI24741J21665_10030562 288
813 3300001979 JGI24740J21852_10000026 JGI24740J21852_1000002643 288
814 3300001979 JGI24740J21852_10001737 JGI24740J21852_100017372 288
815 3300001989 JGI24739J22299_10034747 JGI24739J22299_100347472 288
816 3300002075 JGI24738J21930_10000927 JGI24738J21930_100009277 288
817 3300002705 JGI25156J39149_1003279 JGI25156J39149_10032792 288
818 3300002705 JGI25156J39149_1007730 JGI25156J39149_10077303 288
819 3300002737 JGI25162J39368_1000177 JGI25162J39368_100017710 288
820 3300002737 JGI25162J39368_1000323 JGI25162J39368_100032316 288
821 3300002737 JGI25162J39368_1000803 JGI25162J39368_100080312 288
822 3300002741 JGI25157J39369_1001008 JGI25157J39369_10010088 288
823 3300002772 JGI25164J39214_1000032 JGI25164J39214_100003229 288
824 3300002773 JGI25152J39213_1000657 JGI25152J39213_100065717 288
825 3300002773 JGI25152J39213_1002074 JGI25152J39213_10020744 288
826 3300002773 JGI25152J39213_1007876 JGI25152J39213_10078762 288
827 3300002987 JGI25159J45721_1000276 JGI25159J45721_100027610 288
828 3300003187 JGI25151J46595_10000341 JGI25151J46595_100003418 288
829 3300003187 JGI25151J46595_10000485 JGI25151J46595_1000048534 288
830 3300003214 JGI25165J46597_1000136 JGI25165J46597_100013688 288
831 3300003214 JGI25165J46597_1000406 JGI25165J46597_100040629 288
832 3300003214 JGI25165J46597_1000415 JGI25165J46597_100041510 288
833 3300003214 JGI25165J46597_1007210 JGI25165J46597_10072102 288
834 3300003215 JGI25153J46596_10000344 JGI25153J46596_1000034430 288
835 3300003215 JGI25153J46596_10003378 JGI25153J46596_100033789 288
836 3300003215 JGI25153J46596_10004937 JGI25153J46596_100049379 288
837 3300003316 rootH1_10028145 rootH1_100281456 288
838 3300003316 rootH1_10052697 rootH1_100526975 288
839 3300003320 rootH2_10054426 rootH2_100544263 288
840 3300003322 rootL2_10070782 rootL2_100707823 288
841 3300003323 rootH1_10072615 rootH1_100726152 288
842 3300003354 JGI25160J50197_1000023 JGI25160J50197_100002399 288
843 3300003354 JGI25160J50197_1000384 JGI25160J50197_100038417 288
844 3300003374 JGI25161J50226_1000012 JGI25161J50226_100001299 288
845 3300003374 JGI25161J50226_1001233 JGI25161J50226_10012335 288
846 3300003751 Ga0055538_1003626 Ga0055538_10036262 288
847 3300003751 Ga0055538_1005754 Ga0055538_10057541 288
848 3300003752 Ga0055539_1000053 Ga0055539_100005346 288
849 3300003752 Ga0055539_1003561 Ga0055539_10035612 288
850 3300003756 Ga0055533_1003976 Ga0055533_10039762 288
851 3300003756 Ga0055533_1003999 Ga0055533_10039992 288
852 3300003758 Ga0055532_1000033 Ga0055532_100003388 288
853 3300003758 Ga0055532_1000301 Ga0055532_100030120 288
854 3300003758 Ga0055532_1000363 Ga0055532_100036310 288
855 3300003758 Ga0055532_1000680 Ga0055532_10006802 288
856 3300003759 Ga0055525_1000310 Ga0055525_100031018 288
857 3300003760 Ga0055527_1000279 Ga0055527_100027920 288
858 3300003760 Ga0055527_1004474 Ga0055527_10044742 288
859 3300003760 Ga0055527_1005898 Ga0055527_10058982 288
860 3300003761 Ga0055535_1000024 Ga0055535_100002488 288
861 3300003761 Ga0055535_1000589 Ga0055535_100058920 288
862 3300003761 Ga0055535_1000781 Ga0055535_10007812 288
863 3300003761 Ga0055535_1001563 Ga0055535_10015636 288
864 3300003761 Ga0055535_1003702 Ga0055535_10037022 288
865 3300003762 Ga0055542_1000390 Ga0055542_100039054 288
866 3300003762 Ga0055542_1000565 Ga0055542_100056523 288
867 3300003762 Ga0055542_1003574 Ga0055542_10035744 288
868 3300003762 Ga0055542_1003740 Ga0055542_10037404 288
869 3300003762 Ga0055542_1016377 Ga0055542_10163771 288
870 3300003763 Ga0055529_1000044 Ga0055529_100004488 288
871 3300003763 Ga0055529_1000183 Ga0055529_10001832 288
872 3300003763 Ga0055529_1000247 Ga0055529_100024729 288
873 3300003763 Ga0055529_1001634 Ga0055529_10016346 288
874 3300003771 Ga0055526_1000295 Ga0055526_100029531 288
875 3300003771 Ga0055526_1000400 Ga0055526_10004005 288
876 3300003771 Ga0055526_1006591 Ga0055526_10065914 288
877 3300003771 Ga0055526_1010319 Ga0055526_10103192 288
878 3300003771 Ga0055526_1026948 Ga0055526_10269482 288
879 3300003775 Ga0055524_1005033 Ga0055524_10050332 288
880 3300003775 Ga0055524_1010008 Ga0055524_10100082 288
881 3300003775 Ga0055524_1017046 Ga0055524_10170462 288
882 3300003775 Ga0055524_1026965 Ga0055524_10269652 288
883 3300003775 Ga0055524_1027816 Ga0055524_10278162 288
884 3300003790 Ga0055528_1000034 Ga0055528_10000344 288
885 3300003790 Ga0055528_1005932 Ga0055528_10059322 288
886 3300003790 Ga0055528_1007720 Ga0055528_10077204 288
887 3300003790 Ga0055528_1017273 Ga0055528_10172732 288
888 3300003790 Ga0055528_1024757 Ga0055528_10247572 288
889 3300003792 Ga0055540_1008434 Ga0055540_10084343 288
890 3300003841 Ga0055541_1006780 Ga0055541_10067802 288
891 3300003856 Ga0058692_1000057 Ga0058692_100005755 288
892 3300003856 Ga0058692_1000187 Ga0058692_100018723 288
893 3300003856 Ga0058692_1000790 Ga0058692_10007907 288
894 3300003856 Ga0058692_1001172 Ga0058692_10011729 288
895 3300003856 Ga0058692_1002515 Ga0058692_10025158 288
896 3300003911 JGI25405J52794_10021798 JGI25405J52794_100217982 288
897 3300004625 Ga0055543_1000009 Ga0055543_100000999 288
898 3300004625 Ga0055543_1000505 Ga0055543_100050510 288
899 3300004625 Ga0055543_1001297 Ga0055543_10012973 288
900 3300005262 Ga0065165_1000064 Ga0065165_100006499 288
901 3300005262 Ga0065165_1003434 Ga0065165_10034347 288
902 3300005289 Ga0065704_10000492 Ga0065704_1000049219 288
903 3300005289 Ga0065704_10002773 Ga0065704_100027736 288
904 3300005289 Ga0065704_10003241 Ga0065704_100032411 288
905 3300005289 Ga0065704_10005983 Ga0065704_100059833 288
906 3300005290 Ga0065712_10080638 Ga0065712_100806383 288
907 3300005327 Ga0070658_10027491 Ga0070658_100274915 288
908 3300005327 Ga0070658_10057535 Ga0070658_100575353 288
909 3300005327 Ga0070658_10086719 Ga0070658_100867193 288
910 3300005327 Ga0070658_10166371 Ga0070658_101663712 288
911 3300005327 Ga0070658_10179465 Ga0070658_101794652 288
912 3300005329 Ga0070683_100109746 Ga0070683_1001097461 288
913 3300005330 Ga0070690_100271451 Ga0070690_1002714511 288
914 3300005331 Ga0070670_100000416 Ga0070670_10000041616 288
915 3300005331 Ga0070670_100000697 Ga0070670_10000069717 288
916 3300005331 Ga0070670_100029918 Ga0070670_1000299182 288
917 3300005334 Ga0068869_100399246 Ga0068869_1003992461 288
918 3300005336 Ga0070680_100001870 Ga0070680_10000187014 288
919 3300005336 Ga0070680_100004874 Ga0070680_1000048741 288
920 3300005336 Ga0070680_100005276 Ga0070680_1000052767 288
921 3300005336 Ga0070680_100005898 Ga0070680_1000058986 288
922 3300005336 Ga0070680_100042214 Ga0070680_1000422142 288
923 3300005336 Ga0070680_100042511 Ga0070680_1000425112 288
924 3300005338 Ga0068868_100036766 Ga0068868_1000367663 288
925 3300005339 Ga0070660_100000261 Ga0070660_10000026122 288
926 3300005339 Ga0070660_100017615 Ga0070660_1000176155 288
927 3300005339 Ga0070660_100315809 Ga0070660_1003158091 288
928 3300005341 Ga0070691_10060783 Ga0070691_100607831 288
929 3300005341 Ga0070691_10124799 Ga0070691_101247991 288
930 3300005344 Ga0070661_100000021 Ga0070661_10000002197 288
931 3300005344 Ga0070661_100000901 Ga0070661_10000090120 288
932 3300005344 Ga0070661_100042774 Ga0070661_1000427742 288
933 3300005344 Ga0070661_100062414 Ga0070661_1000624143 288
934 3300005345 Ga0070692_10100401 Ga0070692_101004012 288
935 3300005354 Ga0070675_100139825 Ga0070675_1001398252 288
936 3300005355 Ga0070671_100064953 Ga0070671_1000649531 288
937 3300005355 Ga0070671_100158401 Ga0070671_1001584012 288
938 3300005365 Ga0070688_100061932 Ga0070688_1000619322 288
939 3300005365 Ga0070688_100131186 Ga0070688_1001311862 288
940 3300005366 Ga0070659_100000108 Ga0070659_10000010838 288
941 3300005366 Ga0070659_100098295 Ga0070659_1000982952 288
942 3300005366 Ga0070659_100105743 Ga0070659_1001057433 288
943 3300005366 Ga0070659_100213551 Ga0070659_1002135512 288
944 3300005367 Ga0070667_100024748 Ga0070667_1000247483 288
945 3300005367 Ga0070667_100040088 Ga0070667_1000400884 288
946 3300005367 Ga0070667_100041372 Ga0070667_1000413721 288
947 3300005406 Ga0070703_10002464 Ga0070703_100024644 288
948 3300005434 Ga0070709_10061571 Ga0070709_100615711 288
949 3300005439 Ga0070711_100000154 Ga0070711_10000015429 288
950 3300005439 Ga0070711_100118168 Ga0070711_1001181681 288
951 3300005440 Ga0070705_100000105 Ga0070705_10000010530 288
952 3300005441 Ga0070700_100001122 Ga0070700_1000011222 288
953 3300005444 Ga0070694_100004390 Ga0070694_1000043904 288
954 3300005455 Ga0070663_100000004 Ga0070663_100000004106 288
955 3300005455 Ga0070663_100002324 Ga0070663_1000023244 288
956 3300005455 Ga0070663_100005266 Ga0070663_1000052664 288
957 3300005455 Ga0070663_100083158 Ga0070663_1000831581 288
958 3300005457 Ga0070662_100383957 Ga0070662_1003839571 288
959 3300005458 Ga0070681_10000874 Ga0070681_1000087410 288
960 3300005458 Ga0070681_10004469 Ga0070681_1000446919 288
961 3300005458 Ga0070681_10007901 Ga0070681_100079011 288
962 3300005458 Ga0070681_10322169 Ga0070681_103221691 288
963 3300005458 Ga0070681_10328815 Ga0070681_103288152 288
964 3300005518 Ga0070699_100000330 Ga0070699_1000003308 288
965 3300005530 Ga0070679_100000934 Ga0070679_10000093410 288
966 3300005530 Ga0070679_100007558 Ga0070679_1000075581 288
967 3300005530 Ga0070679_100081078 Ga0070679_1000810784 288
968 3300005535 Ga0070684_100044131 Ga0070684_1000441313 288
969 3300005535 Ga0070684_100444376 Ga0070684_1004443761 288
970 3300005539 Ga0068853_100189380 Ga0068853_1001893802 288
971 3300005539 Ga0068853_100214779 Ga0068853_1002147791 288
972 3300005545 Ga0070695_100001309 Ga0070695_10000130910 288
973 3300005546 Ga0070696_100000069 Ga0070696_10000006943 288
974 3300005547 Ga0070693_100084080 Ga0070693_1000840802 288
975 3300005548 Ga0070665_100002139 Ga0070665_10000213915 288
976 3300005548 Ga0070665_100010264 Ga0070665_1000102646 288
977 3300005548 Ga0070665_100017050 Ga0070665_1000170503 288
978 3300005548 Ga0070665_100072254 Ga0070665_1000722541 288
979 3300005548 Ga0070665_100096345 Ga0070665_1000963453 288
980 3300005549 Ga0070704_100001159 Ga0070704_1000011597 288
981 3300005563 Ga0068855_100000010 Ga0068855_10000001030 288
982 3300005563 Ga0068855_100175538 Ga0068855_1001755381 288
983 3300005563 Ga0068855_100468470 Ga0068855_1004684702 288
984 3300005564 Ga0070664_100000007 Ga0070664_100000007106 288
985 3300005564 Ga0070664_100000030 Ga0070664_10000003077 288
986 3300005564 Ga0070664_100179661 Ga0070664_1001796612 288
987 3300005564 Ga0070664_100259160 Ga0070664_1002591601 288
988 3300005577 Ga0068857_100003083 Ga0068857_1000030836 288
989 3300005577 Ga0068857_100055108 Ga0068857_1000551082 288
990 3300005577 Ga0068857_100150582 Ga0068857_1001505822 288
991 3300005578 Ga0068854_100000045 Ga0068854_10000004569 288
992 3300005578 Ga0068854_100026179 Ga0068854_1000261791 288
993 3300005578 Ga0068854_100171255 Ga0068854_1001712553 288
994 3300005578 Ga0068854_100242391 Ga0068854_1002423912 288
995 3300005614 Ga0068856_100000004 Ga0068856_10000000491 288
996 3300005614 Ga0068856_100013928 Ga0068856_1000139284 288
997 3300005614 Ga0068856_100025963 Ga0068856_1000259633 288
998 3300005614 Ga0068856_100295311 Ga0068856_1002953113 288
999 3300005616 Ga0068852_100000027 Ga0068852_10000002787 288
1000 3300005616 Ga0068852_100019019 Ga0068852_1000190196 288
1001 3300005616 Ga0068852_100030075 Ga0068852_1000300753 288
1002 3300005616 Ga0068852_100165037 Ga0068852_1001650373 288
1003 3300005616 Ga0068852_100178284 Ga0068852_1001782842 288
1004 3300005616 Ga0068852_100376523 Ga0068852_1003765232 288
1005 3300005616 Ga0068852_100732168 Ga0068852_1007321681 288
1006 3300005617 Ga0068859_100005533 Ga0068859_1000055338 288
1007 3300005617 Ga0068859_100016446 Ga0068859_1000164465 288
1008 3300005617 Ga0068859_100025880 Ga0068859_1000258803 288
1009 3300005617 Ga0068859_100123093 Ga0068859_1001230933 288
1010 3300005618 Ga0068864_100044086 Ga0068864_1000440864 288
1011 3300005834 Ga0068851_10193651 Ga0068851_101936512 288
1012 3300005841 Ga0068863_100027028 Ga0068863_1000270284 288
1013 3300005841 Ga0068863_100086368 Ga0068863_1000863682 288
1014 3300005841 Ga0068863_100126667 Ga0068863_1001266672 288
1015 3300005842 Ga0068858_100000111 Ga0068858_1000001113 288
1016 3300005842 Ga0068858_100099300 Ga0068858_1000993002 288
1017 3300005842 Ga0068858_100486729 Ga0068858_1004867291 288
1018 3300005843 Ga0068860_100020906 Ga0068860_1000209065 288
1019 3300005843 Ga0068860_100150557 Ga0068860_1001505571 288
1020 3300005843 Ga0068860_100208932 Ga0068860_1002089322 288
1021 3300005844 Ga0068862_100001572 Ga0068862_10000157215 288
1022 3300005937 Ga0081455_10016579 Ga0081455_100165798 288
1023 3300005937 Ga0081455_10056445 Ga0081455_100564453 288
1024 3300005983 Ga0081540_1000092 Ga0081540_100009292 288
1025 3300005983 Ga0081540_1089809 Ga0081540_10898092 288
1026 3300006038 Ga0075365_10019425 Ga0075365_100194252 288
1027 3300006038 Ga0075365_10121510 Ga0075365_101215102 288
1028 3300006048 Ga0075363_100024052 Ga0075363_1000240523 288
1029 3300006048 Ga0075363_100045564 Ga0075363_1000455643 288
1030 3300006051 Ga0075364_10015008 Ga0075364_100150084 288
1031 3300006051 Ga0075364_10073375 Ga0075364_100733752 288
1032 3300006051 Ga0075364_10185860 Ga0075364_101858601 288
1033 3300006173 Ga0070716_100119615 Ga0070716_1001196152 288
1034 3300006175 Ga0070712_100000126 Ga0070712_10000012617 288
1035 3300006178 Ga0075367_10265123 Ga0075367_102651231 288
1036 3300006186 Ga0075369_10127115 Ga0075369_101271151 288
1037 3300006237 Ga0097621_100134389 Ga0097621_1001343892 288
1038 3300006353 Ga0075370_10002020 Ga0075370_100020205 288
1039 3300006353 Ga0075370_10010184 Ga0075370_100101844 288
1040 3300006353 Ga0075370_10010830 Ga0075370_100108302 288
1041 3300006353 Ga0075370_10014013 Ga0075370_100140135 288
1042 3300006353 Ga0075370_10125169 Ga0075370_101251692 288
1043 3300006353 Ga0075370_10126994 Ga0075370_101269941 288
1044 3300006881 Ga0068865_100048661 Ga0068865_1000486613 288
1045 3300006931 Ga0097620_100005533 Ga0097620_1000055338 288
1046 3300006931 Ga0097620_100016446 Ga0097620_1000164465 288
1047 3300006931 Ga0097620_100025879 Ga0097620_1000258795 288
1048 3300006931 Ga0097620_100123094 Ga0097620_1001230943 288
1049 3300006946 Ga0079104_1000205 Ga0079104_100020573 288
1050 3300006946 Ga0079104_1000609 Ga0079104_100060932 288
1051 3300006946 Ga0079104_1001874 Ga0079104_10018749 288
1052 3300006946 Ga0079104_1024481 Ga0079104_10244811 288
1053 3300009011 Ga0105251_10000008 Ga0105251_1000000826 288
1054 3300009011 Ga0105251_10001647 Ga0105251_1000164713 288
1055 3300009011 Ga0105251_10003617 Ga0105251_100036177 288
1056 3300009011 Ga0105251_10059009 Ga0105251_100590092 288
1057 3300009036 Ga0105244_10001078 Ga0105244_100010787 288
1058 3300009036 Ga0105244_10005575 Ga0105244_100055756 288
1059 3300009036 Ga0105244_10006665 Ga0105244_100066657 288
1060 3300009036 Ga0105244_10051119 Ga0105244_100511192 288
1061 3300009092 Ga0105250_10000088 Ga0105250_100000889 288
1062 3300009092 Ga0105250_10008534 Ga0105250_100085342 288
1063 3300009092 Ga0105250_10011325 Ga0105250_100113253 288
1064 3300009093 Ga0105240_10000222 Ga0105240_1000022283 288
1065 3300009093 Ga0105240_10000278 Ga0105240_1000027872 288
1066 3300009093 Ga0105240_10001873 Ga0105240_1000187333 288
1067 3300009093 Ga0105240_10013307 Ga0105240_100133076 288
1068 3300009093 Ga0105240_10107270 Ga0105240_101072702 288
1069 3300009093 Ga0105240_10396954 Ga0105240_103969542 288
1070 3300009098 Ga0105245_10091060 Ga0105245_100910602 288
1071 3300009098 Ga0105245_10096504 Ga0105245_100965043 288
1072 3300009101 Ga0105247_10008991 Ga0105247_100089915 288
1073 3300009101 Ga0105247_10010617 Ga0105247_100106173 288
1074 3300009101 Ga0105247_10037292 Ga0105247_100372922 288
1075 3300009148 Ga0105243_10000184 Ga0105243_1000018428 288
1076 3300009148 Ga0105243_10049156 Ga0105243_100491562 288
1077 3300009148 Ga0105243_10099274 Ga0105243_100992743 288
1078 3300009148 Ga0105243_10130061 Ga0105243_101300613 288
1079 3300009174 Ga0105241_10086549 Ga0105241_100865493 288
1080 3300009174 Ga0105241_10291453 Ga0105241_102914532 288
1081 3300009176 Ga0105242_10024858 Ga0105242_100248584 288
1082 3300009177 Ga0105248_10039423 Ga0105248_100394234 288
1083 3300009177 Ga0105248_10080310 Ga0105248_100803103 288
1084 3300009177 Ga0105248_10416741 Ga0105248_104167411 288
1085 3300009545 Ga0105237_10001925 Ga0105237_1000192523 288
1086 3300009545 Ga0105237_10003357 Ga0105237_100033579 288
1087 3300009545 Ga0105237_10045750 Ga0105237_100457504 288
1088 3300009545 Ga0105237_10046135 Ga0105237_100461352 288
1089 3300009545 Ga0105237_10078992 Ga0105237_100789924 288
1090 3300009545 Ga0105237_10409426 Ga0105237_104094262 288
1091 3300009551 Ga0105238_10249629 Ga0105238_102496292 288
1092 3300009551 Ga0105238_10302791 Ga0105238_103027912 288
1093 3300009551 Ga0105238_10350279 Ga0105238_103502791 288
1094 3300009551 Ga0105238_10729561 Ga0105238_107295612 288
1095 3300009553 Ga0105249_10004739 Ga0105249_100047395 288
1096 3300009765 Ga0123341_1000005 Ga0123341_1000005104 288
1097 3300009766 Ga0123342_1019923 Ga0123342_10199237 288
1098 3300010375 Ga0105239_10003475 Ga0105239_100034754 288
1099 3300010375 Ga0105239_10039674 Ga0105239_100396747 288
1100 3300010375 Ga0105239_10152204 Ga0105239_101522042 288
1101 3300010375 Ga0105239_10278197 Ga0105239_102781972 288
1102 3300010375 Ga0105239_10662342 Ga0105239_106623421 288
1103 3300011119 Ga0105246_10011352 Ga0105246_100113524 288
1104 3300011119 Ga0105246_10011744 Ga0105246_100117443 288
1105 3300012513 Ga0157326_1003400 Ga0157326_10034002 288
1106 3300013100 Ga0157373_10001155 Ga0157373_1000115510 288
1107 3300013100 Ga0157373_10001724 Ga0157373_100017247 288
1108 3300013100 Ga0157373_10002821 Ga0157373_100028219 288
1109 3300013100 Ga0157373_10087440 Ga0157373_100874401 288
1110 3300013100 Ga0157373_10208343 Ga0157373_102083432 288
1111 3300013102 Ga0157371_10000028 Ga0157371_10000028120 288
1112 3300013102 Ga0157371_10000136 Ga0157371_10000136102 288
1113 3300013102 Ga0157371_10012605 Ga0157371_100126056 288
1114 3300013102 Ga0157371_10022871 Ga0157371_100228712 288
1115 3300013102 Ga0157371_10031350 Ga0157371_100313502 288
1116 3300013102 Ga0157371_10065925 Ga0157371_100659252 288
1117 3300013104 Ga0157370_10000002 Ga0157370_10000002103 288
1118 3300013104 Ga0157370_10000012 Ga0157370_10000012120 288
1119 3300013104 Ga0157370_10000065 Ga0157370_1000006525 288
1120 3300013104 Ga0157370_10001488 Ga0157370_1000148815 288
1121 3300013104 Ga0157370_10002472 Ga0157370_1000247213 288
1122 3300013104 Ga0157370_10013674 Ga0157370_100136742 288
1123 3300013104 Ga0157370_10039973 Ga0157370_100399735 288
1124 3300013104 Ga0157370_10043957 Ga0157370_100439573 288
1125 3300013105 Ga0157369_10000112 Ga0157369_1000011284 288
1126 3300013105 Ga0157369_10001129 Ga0157369_1000112921 288
1127 3300013105 Ga0157369_10002704 Ga0157369_1000270416 288
1128 3300013105 Ga0157369_10053573 Ga0157369_100535734 288
1129 3300013105 Ga0157369_10198865 Ga0157369_101988652 288
1130 3300013296 Ga0157374_10092371 Ga0157374_100923712 288
1131 3300013296 Ga0157374_10251726 Ga0157374_102517262 288
1132 3300013296 Ga0157374_10332842 Ga0157374_103328421 288
1133 3300013297 Ga0157378_10535330 Ga0157378_105353302 288
1134 3300013306 Ga0163162_10160782 Ga0163162_101607822 288
1135 3300013306 Ga0163162_10171655 Ga0163162_101716553 288
1136 3300013307 Ga0157372_10000065 Ga0157372_1000006510 288
1137 3300013307 Ga0157372_10000111 Ga0157372_1000011123 288
1138 3300013307 Ga0157372_10163541 Ga0157372_101635412 288
1139 3300013307 Ga0157372_10512127 Ga0157372_105121272 288
1140 3300013308 Ga0157375_10008229 Ga0157375_100082293 288
1141 3300013308 Ga0157375_10028115 Ga0157375_100281153 288
1142 3300014325 Ga0163163_10012102 Ga0163163_100121024 288
1143 3300014325 Ga0163163_10338360 Ga0163163_103383602 288
1144 3300014497 Ga0182008_10001051 Ga0182008_1000105119 288
1145 3300014497 Ga0182008_10021760 Ga0182008_100217602 288
1146 3300014497 Ga0182008_10054838 Ga0182008_100548382 288
1147 3300014968 Ga0157379_10071375 Ga0157379_100713753 288
1148 3300014968 Ga0157379_10078214 Ga0157379_100782142 288
1149 3300014968 Ga0157379_10226704 Ga0157379_102267042 288
1150 3300014969 Ga0157376_10083407 Ga0157376_100834072 288
1151 3300015261 Ga0182006_1000119 Ga0182006_100011981 288
1152 3300015261 Ga0182006_1000611 Ga0182006_100061127 288
1153 3300015261 Ga0182006_1030442 Ga0182006_10304422 288
1154 3300015262 Ga0182007_10001225 Ga0182007_100012255 288
1155 3300015262 Ga0182007_10001987 Ga0182007_1000198711 288
1156 3300015265 Ga0182005_1000044 Ga0182005_100004452 288
1157 3300015265 Ga0182005_1000540 Ga0182005_100054017 288
1158 3300015265 Ga0182005_1001006 Ga0182005_10010064 288
1159 3300015265 Ga0182005_1002324 Ga0182005_10023244 288
1160 3300015265 Ga0182005_1004016 Ga0182005_10040163 288
1161 3300015265 Ga0182005_1048282 Ga0182005_10482821 288
1162 3300015679 Ga0183366_1001 Ga0183366_10011188 288
1163 3300015680 Ga0183370_1001 Ga0183370_10011188 288
1164 3300015685 Ga0183369_1001 Ga0183369_10011188 288
1165 3300015687 Ga0183368_1001 Ga0183368_10011188 288
1166 3300017792 Ga0163161_10011734 Ga0163161_100117346 288
1167 3300020070 Ga0206356_10524477 Ga0206356_105244771 288
1168 3300020070 Ga0206356_11211633 Ga0206356_112116332 288
1169 3300020077 Ga0206351_10620367 Ga0206351_106203672 288
1170 3300020081 Ga0206354_10057609 Ga0206354_100576092 288
1171 3300020082 Ga0206353_10393390 Ga0206353_103933902 288
1172 3300020082 Ga0206353_11351368 Ga0206353_113513685 288
1173 3300020610 Ga0154015_1386076 Ga0154015_13860762 288
1174 3300020610 Ga0154015_1629196 Ga0154015_16291963 288
1175 3300021361 Ga0213872_10032113 Ga0213872_100321132 288
1176 3300021361 Ga0213872_10048402 Ga0213872_100484022 288
1177 3300021441 Ga0213871_10030872 Ga0213871_100308722 288
1178 3300024227 Ga0228598_1000515 Ga0228598_10005153 288
1179 3300025208 Ga0209436_102863 Ga0209436_1028634 288
1180 3300025224 Ga0209784_100024 Ga0209784_10002498 288
1181 3300025225 Ga0209566_100018 Ga0209566_10001898 288
1182 3300025226 Ga0209674_100046 Ga0209674_100046265 288
1183 3300025226 Ga0209674_101757 Ga0209674_1017571 288
1184 3300025228 Ga0209672_100030 Ga0209672_100030253 288
1185 3300025228 Ga0209672_100040 Ga0209672_100040148 288
1186 3300025228 Ga0209672_100058 Ga0209672_10005867 288
1187 3300025228 Ga0209672_100068 Ga0209672_10006821 288
1188 3300025228 Ga0209672_100457 Ga0209672_10045713 288
1189 3300025228 Ga0209672_102427 Ga0209672_1024272 288
1190 3300025229 Ga0209147_100008 Ga0209147_100008274 288
1191 3300025229 Ga0209147_100036 Ga0209147_10003686 288
1192 3300025229 Ga0209147_100048 Ga0209147_100048148 288
1193 3300025229 Ga0209147_100074 Ga0209147_100074194 288
1194 3300025230 Ga0209563_100039 Ga0209563_100039265 288
1195 3300025230 Ga0209563_105425 Ga0209563_1054252 288
1196 3300025231 Ga0207427_100081 Ga0207427_10008128 288
1197 3300025233 Ga0209437_100036 Ga0209437_10003675 288
1198 3300025233 Ga0209437_100086 Ga0209437_100086175 288
1199 3300025233 Ga0209437_100168 Ga0209437_10016828 288
1200 3300025242 Ga0209258_100013 Ga0209258_100013274 288
1201 3300025242 Ga0209258_100056 Ga0209258_100056253 288
1202 3300025242 Ga0209258_100070 Ga0209258_100070148 288
1203 3300025242 Ga0209258_100149 Ga0209258_1001492 288
1204 3300025242 Ga0209258_100164 Ga0209258_10016473 288
1205 3300025245 Ga0207425_1000741 Ga0207425_100074120 288
1206 3300025245 Ga0207425_1000744 Ga0207425_10007441 288
1207 3300025245 Ga0207425_1009765 Ga0207425_10097652 288
1208 3300025246 Ga0209646_1001239 Ga0209646_10012397 288
1209 3300025250 Ga0209026_1000231 Ga0209026_100023131 288
1210 3300025250 Ga0209026_1012581 Ga0209026_10125813 288
1211 3300025253 Ga0209677_100024 Ga0209677_100024263 288
1212 3300025253 Ga0209677_100267 Ga0209677_10026734 288
1213 3300025253 Ga0209677_105646 Ga0209677_1056464 288
1214 3300025254 Ga0209148_1000037 Ga0209148_1000037178 288
1215 3300025254 Ga0209148_1000039 Ga0209148_1000039144 288
1216 3300025254 Ga0209148_1000143 Ga0209148_10001432 288
1217 3300025254 Ga0209148_1000178 Ga0209148_100017835 288
1218 3300025254 Ga0209148_1000461 Ga0209148_100046117 288
1219 3300025254 Ga0209148_1003235 Ga0209148_10032351 288
1220 3300025254 Ga0209148_1009411 Ga0209148_10094112 288
1221 3300025256 Ga0209759_1000249 Ga0209759_100024961 288
1222 3300025256 Ga0209759_1001303 Ga0209759_10013036 288
1223 3300025256 Ga0209759_1009524 Ga0209759_10095243 288
1224 3300025256 Ga0209759_1013780 Ga0209759_10137802 288
1225 3300025256 Ga0209759_1023371 Ga0209759_10233711 288
1226 3300025258 Ga0209129_1000025 Ga0209129_1000025137 288
1227 3300025258 Ga0209129_1000594 Ga0209129_100059422 288
1228 3300025258 Ga0209129_1004157 Ga0209129_10041573 288
1229 3300025261 Ga0209233_1000110 Ga0209233_100011072 288
1230 3300025261 Ga0209233_1000151 Ga0209233_100015128 288
1231 3300025261 Ga0209233_1000166 Ga0209233_100016675 288
1232 3300025261 Ga0209233_1000342 Ga0209233_100034229 288
1233 3300025261 Ga0209233_1000350 Ga0209233_100035036 288
1234 3300025272 Ga0209455_1000034 Ga0209455_1000034145 288
1235 3300025272 Ga0209455_1000036 Ga0209455_1000036155 288
1236 3300025272 Ga0209455_1000042 Ga0209455_1000042274 288
1237 3300025272 Ga0209455_1000061 Ga0209455_100006186 288
1238 3300025272 Ga0209455_1000525 Ga0209455_100052510 288
1239 3300025273 Ga0209673_1000020 Ga0209673_1000020192 288
1240 3300025273 Ga0209673_1000046 Ga0209673_100004618 288
1241 3300025273 Ga0209673_1000601 Ga0209673_100060132 288
1242 3300025273 Ga0209673_1000607 Ga0209673_100060733 288
1243 3300025273 Ga0209673_1001959 Ga0209673_10019594 288
1244 3300025273 Ga0209673_1002904 Ga0209673_10029042 288
1245 3300025273 Ga0209673_1004592 Ga0209673_10045922 288
1246 3300025273 Ga0209673_1020631 Ga0209673_10206312 288
1247 3300025284 Ga0209130_1000048 Ga0209130_100004899 288
1248 3300025284 Ga0209130_1000272 Ga0209130_100027218 288
1249 3300025291 Ga0209675_1002721 Ga0209675_100272110 288
1250 3300025291 Ga0209675_1026365 Ga0209675_10263652 288
1251 3300025292 Ga0209676_1004206 Ga0209676_10042062 288
1252 3300025292 Ga0209676_1039233 Ga0209676_10392332 288
1253 3300025294 Ga0209025_1000029 Ga0209025_1000029329 288
1254 3300025294 Ga0209025_1000081 Ga0209025_1000081108 288
1255 3300025294 Ga0209025_1001900 Ga0209025_100190018 288
1256 3300025294 Ga0209025_1011450 Ga0209025_10114502 288
1257 3300025294 Ga0209025_1013547 Ga0209025_10135472 288
1258 3300025294 Ga0209025_1016446 Ga0209025_10164462 288
1259 3300025295 Ga0209564_1000039 Ga0209564_1000039137 288
1260 3300025295 Ga0209564_1000205 Ga0209564_10002054 288
1261 3300025295 Ga0209564_1000621 Ga0209564_10006214 288
1262 3300025295 Ga0209564_1001753 Ga0209564_100175315 288
1263 3300025295 Ga0209564_1001883 Ga0209564_100188318 288
1264 3300025295 Ga0209564_1006715 Ga0209564_10067152 288
1265 3300025295 Ga0209564_1013709 Ga0209564_10137093 288
1266 3300025295 Ga0209564_1023211 Ga0209564_10232113 288
1267 3300025297 Ga0209758_1000076 Ga0209758_100007690 288
1268 3300025297 Ga0209758_1000196 Ga0209758_100019618 288
1269 3300025297 Ga0209758_1003911 Ga0209758_100391117 288
1270 3300025297 Ga0209758_1004142 Ga0209758_10041423 288
1271 3300025298 Ga0209050_1003396 Ga0209050_10033962 288
1272 3300025298 Ga0209050_1021437 Ga0209050_10214372 288
1273 3300025299 Ga0209256_1000500 Ga0209256_100050025 288
1274 3300025299 Ga0209256_1002281 Ga0209256_100228116 288
1275 3300025299 Ga0209256_1005384 Ga0209256_10053845 288
1276 3300025299 Ga0209256_1006453 Ga0209256_10064536 288
1277 3300025299 Ga0209256_1014665 Ga0209256_10146653 288
1278 3300025299 Ga0209256_1018442 Ga0209256_10184422 288
1279 3300025299 Ga0209256_1028334 Ga0209256_10283341 288
1280 3300025302 Ga0207426_1000136 Ga0207426_100013699 288
1281 3300025302 Ga0207426_1000169 Ga0207426_100016947 288
1282 3300025302 Ga0207426_1000411 Ga0207426_100041147 288
1283 3300025302 Ga0207426_1001232 Ga0207426_100123221 288
1284 3300025303 Ga0209051_1001518 Ga0209051_100151819 288
1285 3300025303 Ga0209051_1032555 Ga0209051_10325551 288
1286 3300025711 Ga0207696_1000091 Ga0207696_1000091149 288
1287 3300025711 Ga0207696_1007458 Ga0207696_10074583 288
1288 3300025728 Ga0207655_1000001 Ga0207655_10000011261 288
1289 3300025728 Ga0207655_1000009 Ga0207655_1000009435 288
1290 3300025728 Ga0207655_1000288 Ga0207655_100028814 288
1291 3300025728 Ga0207655_1000491 Ga0207655_100049140 288
1292 3300025728 Ga0207655_1000593 Ga0207655_10005934 288
1293 3300025728 Ga0207655_1000875 Ga0207655_10008753 288
1294 3300025735 Ga0207713_1000029 Ga0207713_100002972 288
1295 3300025735 Ga0207713_1006528 Ga0207713_10065285 288
1296 3300025735 Ga0207713_1025050 Ga0207713_10250502 288
1297 3300025899 Ga0207642_10026900 Ga0207642_100269002 288
1298 3300025900 Ga0207710_10000159 Ga0207710_1000015944 288
1299 3300025900 Ga0207710_10004228 Ga0207710_100042283 288
1300 3300025900 Ga0207710_10069152 Ga0207710_100691522 288
1301 3300025904 Ga0207647_10005785 Ga0207647_100057855 288
1302 3300025904 Ga0207647_10099775 Ga0207647_100997751 288
1303 3300025904 Ga0207647_10116561 Ga0207647_101165612 288
1304 3300025906 Ga0207699_10014816 Ga0207699_100148165 288
1305 3300025909 Ga0207705_10000204 Ga0207705_100002045 288
1306 3300025909 Ga0207705_10249539 Ga0207705_102495391 288
1307 3300025912 Ga0207707_10000182 Ga0207707_1000018252 288
1308 3300025912 Ga0207707_10001174 Ga0207707_1000117411 288
1309 3300025912 Ga0207707_10001390 Ga0207707_100013903 288
1310 3300025912 Ga0207707_10031843 Ga0207707_100318432 288
1311 3300025912 Ga0207707_10071776 Ga0207707_100717761 288
1312 3300025912 Ga0207707_10131076 Ga0207707_101310762 288
1313 3300025912 Ga0207707_10276102 Ga0207707_102761021 288
1314 3300025912 Ga0207707_10286976 Ga0207707_102869762 288
1315 3300025913 Ga0207695_10000028 Ga0207695_10000028135 288
1316 3300025913 Ga0207695_10000171 Ga0207695_1000017172 288
1317 3300025913 Ga0207695_10000376 Ga0207695_1000037672 288
1318 3300025913 Ga0207695_10001369 Ga0207695_1000136925 288
1319 3300025913 Ga0207695_10001956 Ga0207695_100019562 288
1320 3300025913 Ga0207695_10013742 Ga0207695_100137424 288
1321 3300025913 Ga0207695_10030552 Ga0207695_100305526 288
1322 3300025913 Ga0207695_10041583 Ga0207695_100415836 288
1323 3300025913 Ga0207695_10322789 Ga0207695_103227892 288
1324 3300025914 Ga0207671_10000732 Ga0207671_1000073215 288
1325 3300025914 Ga0207671_10006622 Ga0207671_100066223 288
1326 3300025914 Ga0207671_10140872 Ga0207671_101408722 288
1327 3300025914 Ga0207671_10261685 Ga0207671_102616852 288
1328 3300025915 Ga0207693_10000102 Ga0207693_1000010240 288
1329 3300025915 Ga0207693_10001497 Ga0207693_100014978 288
1330 3300025915 Ga0207693_10052430 Ga0207693_100524302 288
1331 3300025915 Ga0207693_10172131 Ga0207693_101721312 288
1332 3300025916 Ga0207663_10006827 Ga0207663_100068273 288
1333 3300025917 Ga0207660_10000587 Ga0207660_100005871 288
1334 3300025917 Ga0207660_10006169 Ga0207660_100061693 288
1335 3300025917 Ga0207660_10013602 Ga0207660_100136022 288
1336 3300025917 Ga0207660_10043962 Ga0207660_100439622 288
1337 3300025917 Ga0207660_10198352 Ga0207660_101983522 288
1338 3300025919 Ga0207657_10000110 Ga0207657_1000011023 288
1339 3300025919 Ga0207657_10009002 Ga0207657_100090021 288
1340 3300025919 Ga0207657_10009421 Ga0207657_100094211 288
1341 3300025919 Ga0207657_10023144 Ga0207657_100231446 288
1342 3300025920 Ga0207649_10000044 Ga0207649_1000004458 288
1343 3300025920 Ga0207649_10000070 Ga0207649_100000702 288
1344 3300025920 Ga0207649_10000074 Ga0207649_1000007431 288
1345 3300025920 Ga0207649_10064494 Ga0207649_100644943 288
1346 3300025921 Ga0207652_10000161 Ga0207652_100001611 288
1347 3300025921 Ga0207652_10002347 Ga0207652_100023475 288
1348 3300025921 Ga0207652_10066294 Ga0207652_100662942 288
1349 3300025921 Ga0207652_10127717 Ga0207652_101277172 288
1350 3300025921 Ga0207652_10182322 Ga0207652_101823221 288
1351 3300025921 Ga0207652_10445574 Ga0207652_104455742 288
1352 3300025924 Ga0207694_10088854 Ga0207694_100888542 288
1353 3300025924 Ga0207694_10189488 Ga0207694_101894881 288
1354 3300025925 Ga0207650_10001503 Ga0207650_100015036 288
1355 3300025925 Ga0207650_10002042 Ga0207650_100020429 288
1356 3300025926 Ga0207659_10123986 Ga0207659_101239862 288
1357 3300025928 Ga0207700_10178472 Ga0207700_101784722 288
1358 3300025929 Ga0207664_10099261 Ga0207664_100992612 288
1359 3300025931 Ga0207644_10009521 Ga0207644_100095214 288
1360 3300025931 Ga0207644_10075266 Ga0207644_100752663 288
1361 3300025931 Ga0207644_10204362 Ga0207644_102043622 288
1362 3300025932 Ga0207690_10000016 Ga0207690_10000016172 288
1363 3300025932 Ga0207690_10067965 Ga0207690_100679652 288
1364 3300025932 Ga0207690_10279055 Ga0207690_102790551 288
1365 3300025932 Ga0207690_10446273 Ga0207690_104462732 288
1366 3300025935 Ga0207709_10000466 Ga0207709_1000046618 288
1367 3300025935 Ga0207709_10052065 Ga0207709_100520653 288
1368 3300025938 Ga0207704_10149773 Ga0207704_101497732 288
1369 3300025939 Ga0207665_10006300 Ga0207665_100063003 288
1370 3300025939 Ga0207665_10125320 Ga0207665_101253202 288
1371 3300025942 Ga0207689_10017003 Ga0207689_100170031 288
1372 3300025942 Ga0207689_10106981 Ga0207689_101069813 288
1373 3300025944 Ga0207661_10006389 Ga0207661_100063895 288
1374 3300025944 Ga0207661_10211282 Ga0207661_102112822 288
1375 3300025945 Ga0207679_10000004 Ga0207679_10000004290 288
1376 3300025945 Ga0207679_10000021 Ga0207679_1000002176 288
1377 3300025945 Ga0207679_10076851 Ga0207679_100768513 288
1378 3300025945 Ga0207679_10283651 Ga0207679_102836511 288
1379 3300025949 Ga0207667_10000093 Ga0207667_1000009318 288
1380 3300025949 Ga0207667_10004117 Ga0207667_1000411711 288
1381 3300025949 Ga0207667_10004376 Ga0207667_1000437614 288
1382 3300025949 Ga0207667_10018955 Ga0207667_100189557 288
1383 3300025949 Ga0207667_10032279 Ga0207667_100322792 288
1384 3300025949 Ga0207667_10220878 Ga0207667_102208781 288
1385 3300025949 Ga0207667_10369718 Ga0207667_103697182 288
1386 3300025961 Ga0207712_10009649 Ga0207712_100096492 288
1387 3300025972 Ga0207668_10058586 Ga0207668_100585863 288
1388 3300025981 Ga0207640_10000108 Ga0207640_1000010848 288
1389 3300025981 Ga0207640_10003445 Ga0207640_100034452 288
1390 3300025981 Ga0207640_10018962 Ga0207640_100189622 288
1391 3300025986 Ga0207658_10038341 Ga0207658_100383413 288
1392 3300026035 Ga0207703_10034163 Ga0207703_100341633 288
1393 3300026041 Ga0207639_10001055 Ga0207639_100010559 288
1394 3300026041 Ga0207639_10034133 Ga0207639_100341332 288
1395 3300026041 Ga0207639_10191491 Ga0207639_101914912 288
1396 3300026067 Ga0207678_10000005 Ga0207678_10000005106 288
1397 3300026067 Ga0207678_10002869 Ga0207678_1000286915 288
1398 3300026067 Ga0207678_10005689 Ga0207678_100056894 288
1399 3300026067 Ga0207678_10007134 Ga0207678_100071345 288
1400 3300026067 Ga0207678_10048244 Ga0207678_100482442 288
1401 3300026067 Ga0207678_10070147 Ga0207678_100701474 288
1402 3300026067 Ga0207678_10089995 Ga0207678_100899953 288
1403 3300026075 Ga0207708_10001415 Ga0207708_100014152 288
1404 3300026078 Ga0207702_10000280 Ga0207702_1000028038 288
1405 3300026078 Ga0207702_10008346 Ga0207702_100083463 288
1406 3300026078 Ga0207702_10112094 Ga0207702_101120942 288
1407 3300026078 Ga0207702_10494259 Ga0207702_104942592 288
1408 3300026088 Ga0207641_10019607 Ga0207641_100196074 288
1409 3300026088 Ga0207641_10032111 Ga0207641_100321112 288
1410 3300026089 Ga0207648_10228857 Ga0207648_102288572 288
1411 3300026095 Ga0207676_10022067 Ga0207676_100220671 288
1412 3300026095 Ga0207676_10064340 Ga0207676_100643402 288
1413 3300026116 Ga0207674_10004181 Ga0207674_100041814 288
1414 3300026116 Ga0207674_10013703 Ga0207674_100137039 288
1415 3300026116 Ga0207674_10176584 Ga0207674_101765842 288
1416 3300026121 Ga0207683_10059589 Ga0207683_100595893 288
1417 3300026142 Ga0207698_10000021 Ga0207698_1000002140 288
1418 3300026142 Ga0207698_10076498 Ga0207698_100764983 288
1419 3300026142 Ga0207698_10086585 Ga0207698_100865853 288
1420 3300026142 Ga0207698_10093242 Ga0207698_100932422 288
1421 3300026142 Ga0207698_10164919 Ga0207698_101649192 288
1422 3300026142 Ga0207698_10204609 Ga0207698_102046092 288
1423 3300027111 Ga0209281_1000004 Ga0209281_10000041178 288
1424 3300027111 Ga0209281_1000024 Ga0209281_1000024459 288
1425 3300027111 Ga0209281_1000494 Ga0209281_10004945 288
1426 3300027111 Ga0209281_1000619 Ga0209281_10006196 288
1427 3300027312 Ga0209371_1000001 Ga0209371_10000011113 288
1428 3300027312 Ga0209371_1000156 Ga0209371_100015620 288
1429 3300027312 Ga0209371_1000187 Ga0209371_10001879 288
1430 3300027312 Ga0209371_1000191 Ga0209371_100019156 288
1431 3300027312 Ga0209371_1000213 Ga0209371_100021320 288
1432 3300027312 Ga0209371_1000661 Ga0209371_100066132 288
1433 3300027312 Ga0209371_1023636 Ga0209371_10236362 288
1434 3300028379 Ga0268266_10001965 Ga0268266_1000196511 288
1435 3300028379 Ga0268266_10116295 Ga0268266_101162953 288
1436 3300028379 Ga0268266_10131313 Ga0268266_101313133 288
1437 3300028379 Ga0268266_10170823 Ga0268266_101708232 288
1438 3300028380 Ga0268265_10002757 Ga0268265_1000275713 288
1439 3300028381 Ga0268264_10014328 Ga0268264_100143283 288
1440 3300028381 Ga0268264_10283773 Ga0268264_102837732 288
1441 3300028573 Ga0265334_10037795 Ga0265334_100377952 288
1442 3300028794 Ga0307515_10000034 Ga0307515_1000003478 288
1443 3300028794 Ga0307515_10005985 Ga0307515_1000598522 288
1444 3300028794 Ga0307515_10069225 Ga0307515_100692254 288
1445 3300030500 Ga0268256_1000001 Ga0268256_10000011528 288
1446 3300030500 Ga0268256_1000028 Ga0268256_100002840 288
1447 3300030500 Ga0268256_1000130 Ga0268256_100013057 288
1448 3300030500 Ga0268256_1000156 Ga0268256_100015679 288
1449 3300030500 Ga0268256_1000170 Ga0268256_100017020 288
1450 3300030521 Ga0307511_10028029 Ga0307511_100280296 288
1451 3300030878 Ga0265770_1002894 Ga0265770_10028941 288
1452 3300031235 Ga0265330_10007239 Ga0265330_100072396 288
1453 3300031235 Ga0265330_10007983 Ga0265330_100079837 288
1454 3300031247 Ga0265340_10003459 Ga0265340_100034598 288
1455 3300031247 Ga0265340_10008781 Ga0265340_100087814 288
1456 3300031249 Ga0265339_10003445 Ga0265339_1000344512 288
1457 3300031251 Ga0265327_10082731 Ga0265327_100827311 288
1458 3300031456 Ga0307513_10325622 Ga0307513_103256222 288
1459 3300031548 Ga0307408_100028246 Ga0307408_1000282464 288
1460 3300031595 Ga0265313_10126350 Ga0265313_101263502 288
1461 3300031649 Ga0307514_10006575 Ga0307514_100065753 288
1462 3300031712 Ga0265342_10021254 Ga0265342_100212543 288
1463 3300031712 Ga0265342_10030579 Ga0265342_100305793 288
1464 3300031712 Ga0265342_10033881 Ga0265342_100338815 288
1465 3300031730 Ga0307516_10001608 Ga0307516_1000160811 288
1466 3300031901 Ga0307406_10005128 Ga0307406_100051285 288
1467 3300031901 Ga0307406_10120971 Ga0307406_101209712 288
1468 3300031911 Ga0307412_10000300 Ga0307412_1000030023 288
1469 3300032005 Ga0307411_10390109 Ga0307411_103901092 288
1470 3300033180 Ga0307510_10057481 Ga0307510_100574814 288
1471 3300035691 Ga0373931_0020020 Ga0373931_0020020_629_1501 288
1472 3300035695 Ga0373927_0177449 Ga0373927_0177449_257_1198 288
1473 3300035725 Ga0373947_0244272 Ga0373947_0244272_144_1019 288
1474 3300037068 Ga0373925_0130554 Ga0373925_0130554_315_1190 288
1475 3300037312 Ga0395899_0020825 Ga0395899_0020825_3357_4235 288
1476 3300037312 Ga0395899_0049914 Ga0395899_0049914_1941_2810 288
1477 3300037418 Ga0395900_0021317 Ga0395900_0021317_4069_4947 288
1478 3300037418 Ga0395900_0023643 Ga0395900_0023643_5293_6162 288
1479 3300037466 Ga0395898_0000144 Ga0395898_0000144_108521_109408 288
1480 3300037466 Ga0395898_0017704 Ga0395898_0017704_6276_7145 288
1481 3300037466 Ga0395898_0021846 Ga0395898_0021846_3604_4482 288
1482 3300037466 Ga0395898_0028143 Ga0395898_0028143_2026_2907 288
1483 3300037466 Ga0395898_0088984 Ga0395898_0088984_198_1067 288
1484 3300037466 Ga0395898_0242654 Ga0395898_0242654_29_904 288
1485 3300037471 Ga0395905_0002710 Ga0395905_0002710_7389_8267 288
1486 3300037471 Ga0395905_0286439 Ga0395905_0286439_562_1431 288
1487 3300037853 Ga0436364_0044071 Ga0436364_0044071_9945_10823 288
1488 3300037853 Ga0436364_0139837 Ga0436364_0139837_1021_1899 288
1489 3300037853 Ga0436364_0333628 Ga0436364_0333628_37_924 288
1490 3300038443 Ga0395901_0004676 Ga0395901_0004676_12561_13430 288
1491 3300038443 Ga0395901_0033408 Ga0395901_0033408_2405_3283 288
1492 3300039437 Ga0436365_0595564 Ga0436365_0595564_4394_5281 288
1493 3300039437 Ga0436365_1570145 Ga0436365_1570145_599_1483 288
1494 3300039447 Ga0436361_1187256 Ga0436361_1187256_110_1006 288
1495 3300039450 Ga0436363_0171997 Ga0436363_0171997_390_1277 288
1496 3300039453 Ga0436362_0283733 Ga0436362_0283733_2649_3578 288
1497 3300041404 Ga0439436_0000001 Ga0439436_0000001_29682_30557 288
1498 3300041411 Ga0439466_0045670 Ga0439466_0045670_400_1293 288
1499 3300041413 Ga0439465_0007323 Ga0439465_0007323_1553_2422 288
1500 3300041452 Ga0451793_1206436 Ga0451793_1206436_622_1524 288
1501 3300041496 Ga0451839_0853427 Ga0451839_0853427_1442_2317 288
1502 3300041498 Ga0451841_1419731 Ga0451841_1419731_10_885 288
1503 3300041501 Ga0451845_0892693 Ga0451845_0892693_372_1247 288
1504 3300041503 Ga0451847_0291915 Ga0451847_0291915_1307_2182 288
1505 3300041505 Ga0451849_0744664 Ga0451849_0744664_544_1419 288
1506 3300041507 Ga0451851_0254806 Ga0451851_0254806_1804_2679 288
1507 3300041509 Ga0451843_1092677 Ga0451843_1092677_186_1061 288
1508 3300041512 Ga0451853_3235739 Ga0451853_3235739_2003_2884 288
1509 3300042007 Ga0439449_0007872 Ga0439449_0007872_1399_2292 288
1510 3300042010 Ga0439452_000248 Ga0439452_000248_22147_23013 288
1511 3300042010 Ga0439452_000300 Ga0439452_000300_6710_7591 288
1512 3300042012 Ga0439455_0018557 Ga0439455_0018557_133_1020 288
1513 3300042135 Ga0450899_000439 Ga0450899_000439_1309_2175 288
1514 3300044656 Ga0466969_0004763 Ga0466969_0004763_205_1101 288
1515 3300044656 Ga0466969_0022928 Ga0466969_0022928_585_1475 288
1516 3300044656 Ga0466969_0030124 Ga0466969_0030124_1864_2739 288
1517 3300044659 Ga0466973_0057243 Ga0466973_0057243_16_894 288
1518 3300044669 Ga0466981_0000002 Ga0466981_0000002_263117_263998 288
1519 3300044684 Ga0466966_0002610 Ga0466966_0002610_1894_2916 288
1520 3300044684 Ga0466966_0006513 Ga0466966_0006513_5265_6155 288
1521 3300044684 Ga0466966_0013288 Ga0466966_0013288_3327_4223 288
1522 3300044684 Ga0466966_0061811 Ga0466966_0061811_1473_2342 288
1523 3300044693 Ga0466961_0004115 Ga0466961_0004115_4538_5428 288
1524 3300044693 Ga0466961_0012941 Ga0466961_0012941_3278_4156 288
1525 3300044693 Ga0466961_0021366 Ga0466961_0021366_2598_3479 288
1526 3300044693 Ga0466961_0038093 Ga0466961_0038093_1797_2675 288
1527 3300044693 Ga0466961_0052262 Ga0466961_0052262_1149_2024 288
1528 3300044694 Ga0466963_0027613 Ga0466963_0027613_2700_3587 288
1529 3300044694 Ga0466963_0064461 Ga0466963_0064461_256_1137 288
1530 3300044719 Ga0466971_0005973 Ga0466971_0005973_2854_3732 288
1531 3300044735 Ga0466968_0165840 Ga0466968_0165840_52_927 288
1532 3300044765 Ga0466970_0004814 Ga0466970_0004814_4209_5099 288
1533 3300044842 Ga0466957_0003433 Ga0466957_0003433_1626_2504 288
1534 3300044842 Ga0466957_0014643 Ga0466957_0014643_1124_2146 288
1535 3300044842 Ga0466957_0017015 Ga0466957_0017015_2235_3110 288
1536 3300045049 Ga0466959_0002415 Ga0466959_0002415_1862_2740 288
1537 3300045049 Ga0466959_0005606 Ga0466959_0005606_4003_4893 288
1538 3300045049 Ga0466959_0145881 Ga0466959_0145881_116_985 288
1539 3300045836 Ga0466958_0016651 Ga0466958_0016651_193_1071 288
1540 3300045836 Ga0466958_0129906 Ga0466958_0129906_427_1308 288
1541 3300045976 Ga0466967_0012429 Ga0466967_0012429_3697_4584 288
1542 3300045976 Ga0466967_0450077 Ga0466967_0450077_11_889 288
1543 3300046452 Ga0495617_002319 Ga0495617_002319_4738_5616 288
1544 3300046454 Ga0495592_0046945 Ga0495592_0046945_386_1264 288
1545 3300046454 Ga0495592_0146346 Ga0495592_0146346_741_1610 288
1546 3300046458 Ga0495591_000003 Ga0495591_000003_428192_429058 288
1547 3300046460 Ga0495638_0000007 Ga0495638_0000007_221776_222678 288
1548 3300046460 Ga0495638_0000536 Ga0495638_0000536_18176_19054 288
1549 3300046460 Ga0495638_0004272 Ga0495638_0004272_45_911 288
1550 3300046462 Ga0495651_0090874 Ga0495651_0090874_151_1029 288
1551 3300046471 Ga0495650_0000005 Ga0495650_0000005_616803_617684 288
1552 3300046473 Ga0495582_0015149 Ga0495582_0015149_709_1578 288
1553 3300046474 Ga0495605_0018540 Ga0495605_0018540_2521_3396 288
1554 3300046476 Ga0495662_0003706 Ga0495662_0003706_2248_3117 288
1555 3300046476 Ga0495662_0028185 Ga0495662_0028185_450_1391 288
1556 3300046477 Ga0495664_0033919 Ga0495664_0033919_1490_2359 288
1557 3300046492 Ga0495585_0114432 Ga0495585_0114432_338_1303 288
1558 3300046501 Ga0495607_0000196 Ga0495607_0000196_38270_39148 288
1559 3300046501 Ga0495607_0000601 Ga0495607_0000601_12620_13489 288
1560 3300046507 Ga0495606_0001436 Ga0495606_0001436_29701_30579 288
1561 3300046507 Ga0495606_0006197 Ga0495606_0006197_1981_2856 288
1562 3300046507 Ga0495606_0009875 Ga0495606_0009875_1322_2197 288
1563 3300046507 Ga0495606_0106078 Ga0495606_0106078_275_1150 288
1564 3300046511 Ga0495608_0011914 Ga0495608_0011914_1291_2169 288
1565 3300046512 Ga0495610_0006875 Ga0495610_0006875_2895_3770 288
1566 3300046512 Ga0495610_0012396 Ga0495610_0012396_1717_2583 288
1567 3300046512 Ga0495610_0013550 Ga0495610_0013550_1247_2113 288
1568 3300046512 Ga0495610_0034453 Ga0495610_0034453_877_1746 288
1569 3300046512 Ga0495610_0090341 Ga0495610_0090341_408_1289 288
1570 3300046514 Ga0495618_0064279 Ga0495618_0064279_989_1879 288
1571 3300046515 Ga0495620_0000224 Ga0495620_0000224_38354_39220 288
1572 3300046515 Ga0495620_0008274 Ga0495620_0008274_603_1478 288
1573 3300046516 Ga0495628_0003636 Ga0495628_0003636_918_1796 288
1574 3300046516 Ga0495628_0014644 Ga0495628_0014644_1796_2674 288
1575 3300046517 Ga0495630_0126874 Ga0495630_0126874_345_1235 288
1576 3300046518 Ga0495631_0001169 Ga0495631_0001169_6509_7375 288
1577 3300046519 Ga0495632_0004284 Ga0495632_0004284_1452_2327 288
1578 3300046519 Ga0495632_0046986 Ga0495632_0046986_1121_1987 288
1579 3300046520 Ga0495637_0002197 Ga0495637_0002197_6812_7690 288
1580 3300046520 Ga0495637_0003672 Ga0495637_0003672_1223_2089 288
1581 3300046522 Ga0495643_0000041 Ga0495643_0000041_95544_96413 288
1582 3300046522 Ga0495643_0001110 Ga0495643_0001110_22511_23386 288
1583 3300046522 Ga0495643_0098671 Ga0495643_0098671_211_1080 288
1584 3300046523 Ga0495644_0008900 Ga0495644_0008900_130_999 288
1585 3300046524 Ga0495648_0072599 Ga0495648_0072599_849_1730 288
1586 3300046529 Ga0495652_0021270 Ga0495652_0021270_4242_5111 288
1587 3300046529 Ga0495652_0041537 Ga0495652_0041537_1934_2806 288
1588 3300046529 Ga0495652_0093283 Ga0495652_0093283_293_1171 288
1589 3300046529 Ga0495652_0193210 Ga0495652_0193210_45_923 288
1590 3300046530 Ga0495654_0004082 Ga0495654_0004082_715_1581 288
1591 3300046530 Ga0495654_0048912 Ga0495654_0048912_85_960 288
1592 3300046536 Ga0495587_0053024 Ga0495587_0053024_1182_2051 288
1593 3300046538 Ga0495609_0040470 Ga0495609_0040470_512_1387 288
1594 3300046542 Ga0495597_0016444 Ga0495597_0016444_1764_2639 288
1595 3300046542 Ga0495597_0048353 Ga0495597_0048353_857_1723 288
1596 3300046557 Ga0495622_0028567 Ga0495622_0028567_873_1751 288
1597 3300046558 Ga0495633_0028953 Ga0495633_0028953_181_1059 288
1598 3300046616 Ga0495668_0012255 Ga0495668_0012255_1912_2796 288
1599 3300046648 Ga0495611_0000034 Ga0495611_0000034_64737_65615 288
1600 3300046660 Ga0495625_0000002 Ga0495625_0000002_774772_775650 288
1601 3300046660 Ga0495625_0102901 Ga0495625_0102901_135_1001 288
1602 3300046660 Ga0495625_0292695 Ga0495625_0292695_68_946 288
1603 3300046663 Ga0495635_0072330 Ga0495635_0072330_78_956 288
1604 3300046665 Ga0495661_0001990 Ga0495661_0001990_5490_6356 288
1605 3300046665 Ga0495661_0177674 Ga0495661_0177674_36_914 288
1606 3300046675 Ga0495657_0127482 Ga0495657_0127482_331_1245 288
1607 3300046678 Ga0495599_0003643 Ga0495599_0003643_7384_8262 288
1608 3300046680 Ga0495646_0136491 Ga0495646_0136491_44_922 288
1609 3300046691 Ga0495670_0000639 Ga0495670_0000639_15696_16571 288
1610 3300046691 Ga0495670_0015900 Ga0495670_0015900_1885_2763 288
1611 3300046691 Ga0495670_0062638 Ga0495670_0062638_800_1735 288
1612 3300046692 Ga0495671_0031775 Ga0495671_0031775_766_1644 288
1613 3300046692 Ga0495671_0119024 Ga0495671_0119024_343_1224 288
1614 3300046694 Ga0495649_0082527 Ga0495649_0082527_20_895 288
1615 3300046794 Ga0495589_0000192 Ga0495589_0000192_23830_24708 288
1616 3300046809 Ga0495600_0002922 Ga0495600_0002922_6227_7105 288
1617 3300046809 Ga0495600_0035414 Ga0495600_0035414_1658_2545 288
1618 3300046810 Ga0495660_0000156 Ga0495660_0000156_36733_37611 288
1619 3300047317 Ga0495604_0001772 Ga0495604_0001772_13987_14856 288
1620 3300047317 Ga0495604_0024541 Ga0495604_0024541_1147_2016 288
1621 3300047317 Ga0495604_0116601 Ga0495604_0116601_525_1403 288
1622 3300047319 Ga0495674_0247268 Ga0495674_0247268_206_1096 288
1623 3300047320 Ga0495672_0016603 Ga0495672_0016603_3658_4533 288
1624 3300047322 Ga0495680_0166343 Ga0495680_0166343_662_1540 288
1625 3300047443 Ga0495687_012580 Ga0495687_012580_2621_3496 288
1626 3300047444 Ga0495675_0005488 Ga0495675_0005488_95_964 288
1627 3300047446 Ga0495679_000003 Ga0495679_000003_24796_25674 288
1628 3300047446 Ga0495679_000830 Ga0495679_000830_9379_10245 288
1629 3300047469 Ga0495673_0000070 Ga0495673_0000070_82222_83088 288
1630 3300047469 Ga0495673_0020096 Ga0495673_0020096_1754_2632 288
1631 3300047470 Ga0495681_0004774 Ga0495681_0004774_6014_6880 288
1632 3300047472 Ga0495686_0001536 Ga0495686_0001536_22318_23196 288
1633 3300047472 Ga0495686_0005493 Ga0495686_0005493_4249_5121 288
1634 3300047472 Ga0495686_0007185 Ga0495686_0007185_3569_4444 288
1635 3300047472 Ga0495686_0009091 Ga0495686_0009091_2946_3827 288
1636 3300047472 Ga0495686_0149627 Ga0495686_0149627_254_1132 288
1637 3300048088 Ga0495602_0039549 Ga0495602_0039549_3095_3973 288
1638 3300048088 Ga0495602_0239692 Ga0495602_0239692_98_976 288
1639 3300048091 Ga0495626_0001268 Ga0495626_0001268_5913_6785 288
1640 3300048091 Ga0495626_0020911 Ga0495626_0020911_1527_2399 288
1641 3300048903 Ga0496100_0014245 Ga0496100_0014245_1353_2243 288
1642 3300048903 Ga0496100_0320638 Ga0496100_0320638_170_1063 288
1643 3300048903 Ga0496100_0411805 Ga0496100_0411805_92_997 288
1644 3300048904 Ga0496101_0009116 Ga0496101_0009116_3302_4189 288
1645 3300048904 Ga0496101_0056526 Ga0496101_0056526_1448_2323 288
1646 3300048904 Ga0496101_0194628 Ga0496101_0194628_422_1291 288
1647 3300048904 Ga0496101_0330133 Ga0496101_0330133_208_1113 288
1648 3300048905 Ga0496102_0006737 Ga0496102_0006737_4181_5086 288
1649 3300048905 Ga0496102_0016623 Ga0496102_0016623_3353_4243 288
1650 3300048905 Ga0496102_0274219 Ga0496102_0274219_347_1216 288
1651 3300048905 Ga0496102_0386712 Ga0496102_0386712_71_985 288
1652 3300048906 Ga0496103_0030844 Ga0496103_0030844_1334_2224 288
1653 3300048906 Ga0496103_0152998 Ga0496103_0152998_144_1037 288
1654 3300048907 Ga0496104_0000144 Ga0496104_0000144_58002_58868 288
1655 3300048907 Ga0496104_0282359 Ga0496104_0282359_420_1289 288
1656 3300048908 Ga0496105_0001656 Ga0496105_0001656_14549_15415 288
1657 3300048908 Ga0496105_0093583 Ga0496105_0093583_1472_2386 288
1658 3300048908 Ga0496105_0220517 Ga0496105_0220517_363_1232 288
1659 3300048909 Ga0496106_0002011 Ga0496106_0002011_9780_10685 288
1660 3300048911 Ga0496108_0049839 Ga0496108_0049839_254_1168 288
1661 3300048911 Ga0496108_0076179 Ga0496108_0076179_415_1302 288
1662 3300048913 Ga0496110_0089966 Ga0496110_0089966_1744_2631 288
1663 3300048913 Ga0496110_0256355 Ga0496110_0256355_345_1214 288
1664 3300048914 Ga0496111_0189189 Ga0496111_0189189_295_1164 288
1665 3300048915 Ga0496112_0099298 Ga0496112_0099298_50_964 288
1666 3300048915 Ga0496112_0221230 Ga0496112_0221230_298_1182 288
1667 3300048915 Ga0496112_0587969 Ga0496112_0587969_120_995 288
1668 3300048916 Ga0496113_0096216 Ga0496113_0096216_1379_2272 288
1669 3300048916 Ga0496113_0177443 Ga0496113_0177443_426_1292 288
1670 3300048917 Ga0496114_0174910 Ga0496114_0174910_628_1497 288
1671 3300048918 Ga0496115_0009933 Ga0496115_0009933_2028_2906 288
1672 3300048919 Ga0496116_0004768 Ga0496116_0004768_2985_3866 288
1673 3300048919 Ga0496116_0036507 Ga0496116_0036507_751_1617 288
1674 3300048919 Ga0496116_0065446 Ga0496116_0065446_1372_2244 288
1675 3300048919 Ga0496116_0068600 Ga0496116_0068600_1084_1968 288
1676 3300048919 Ga0496116_0068784 Ga0496116_0068784_137_1003 288
1677 3300048919 Ga0496116_0076471 Ga0496116_0076471_247_1122 288
1678 3300048919 Ga0496116_0078994 Ga0496116_0078994_12_890 288
1679 3300048919 Ga0496116_0134302 Ga0496116_0134302_203_1072 288
1680 3300048919 Ga0496116_0137098 Ga0496116_0137098_139_1014 288
1681 3300048920 Ga0496117_0000020 Ga0496117_0000020_390129_391010 288
1682 3300048920 Ga0496117_0000033 Ga0496117_0000033_219840_220706 288
1683 3300048920 Ga0496117_0008695 Ga0496117_0008695_1963_2853 288
1684 3300048920 Ga0496117_0019573 Ga0496117_0019573_3923_4789 288
1685 3300048920 Ga0496117_0025946 Ga0496117_0025946_1307_2173 288
1686 3300048920 Ga0496117_0105021 Ga0496117_0105021_452_1327 288
1687 3300048920 Ga0496117_0167852 Ga0496117_0167852_300_1166 288
1688 3300048921 Ga0496118_0000015 Ga0496118_0000015_405340_406221 288
1689 3300048921 Ga0496118_0000477 Ga0496118_0000477_35598_36473 288
1690 3300048921 Ga0496118_0000594 Ga0496118_0000594_17796_18662 288
1691 3300048921 Ga0496118_0002815 Ga0496118_0002815_6746_7636 288
1692 3300048921 Ga0496118_0004254 Ga0496118_0004254_7337_8203 288
1693 3300048921 Ga0496118_0008241 Ga0496118_0008241_6195_7061 288
1694 3300048921 Ga0496118_0008545 Ga0496118_0008545_5943_6809 288
1695 3300048921 Ga0496118_0008797 Ga0496118_0008797_1298_2167 288
1696 3300048921 Ga0496118_0010211 Ga0496118_0010211_2497_3363 288
1697 3300048921 Ga0496118_0070858 Ga0496118_0070858_151_1026 288
1698 3300048921 Ga0496118_0079034 Ga0496118_0079034_1027_1902 288
1699 3300048921 Ga0496118_0081909 Ga0496118_0081909_1140_2015 288
1700 3300048921 Ga0496118_0145444 Ga0496118_0145444_296_1174 288
1701 3300048922 Ga0496119_0001524 Ga0496119_0001524_7785_8651 288
1702 3300048922 Ga0496119_0003299 Ga0496119_0003299_1172_2053 288
1703 3300048922 Ga0496119_0013005 Ga0496119_0013005_2828_3709 288
1704 3300048922 Ga0496119_0022474 Ga0496119_0022474_985_1851 288
1705 3300048922 Ga0496119_0022836 Ga0496119_0022836_3012_3890 288
1706 3300048922 Ga0496119_0063569 Ga0496119_0063569_78_944 288
1707 3300048922 Ga0496119_0068500 Ga0496119_0068500_160_1041 288
1708 3300048922 Ga0496119_0085679 Ga0496119_0085679_780_1661 288
1709 3300048922 Ga0496119_0089162 Ga0496119_0089162_84_959 288
1710 3300048922 Ga0496119_0102933 Ga0496119_0102933_73_966 288
1711 3300048922 Ga0496119_0105054 Ga0496119_0105054_371_1240 288
1712 3300048923 Ga0496120_0000430 Ga0496120_0000430_35911_36777 288
1713 3300048923 Ga0496120_0001435 Ga0496120_0001435_22450_23316 288
1714 3300048923 Ga0496120_0003272 Ga0496120_0003272_11767_12633 288
1715 3300048923 Ga0496120_0005266 Ga0496120_0005266_1175_2056 288
1716 3300048923 Ga0496120_0005908 Ga0496120_0005908_6088_6978 288
1717 3300048923 Ga0496120_0005910 Ga0496120_0005910_8115_8996 288
1718 3300048923 Ga0496120_0014600 Ga0496120_0014600_1083_1949 288
1719 3300048923 Ga0496120_0044448 Ga0496120_0044448_1132_1998 288
1720 3300048923 Ga0496120_0051102 Ga0496120_0051102_792_1658 288
1721 3300048923 Ga0496120_0182351 Ga0496120_0182351_14_880 288
1722 3300048923 Ga0496120_0193235 Ga0496120_0193235_89_955 288
1723 3300048924 Ga0496121_0001223 Ga0496121_0001223_30158_31039 288
1724 3300048924 Ga0496121_0002468 Ga0496121_0002468_19438_20307 288
1725 3300048924 Ga0496121_0003240 Ga0496121_0003240_15134_16024 288
1726 3300048924 Ga0496121_0003417 Ga0496121_0003417_4702_5583 288
1727 3300048924 Ga0496121_0005209 Ga0496121_0005209_3674_4555 288
1728 3300048924 Ga0496121_0014421 Ga0496121_0014421_4949_5827 288
1729 3300048924 Ga0496121_0017345 Ga0496121_0017345_3259_4152 288
1730 3300048924 Ga0496121_0018132 Ga0496121_0018132_2274_3140 288
1731 3300048924 Ga0496121_0034918 Ga0496121_0034918_2068_2934 288
1732 3300048924 Ga0496121_0041049 Ga0496121_0041049_2917_3792 288
1733 3300048924 Ga0496121_0098424 Ga0496121_0098424_179_1045 288
1734 3300048924 Ga0496121_0135769 Ga0496121_0135769_826_1704 288
1735 3300048924 Ga0496121_0160543 Ga0496121_0160543_645_1520 288
1736 3300048924 Ga0496121_0253631 Ga0496121_0253631_174_1040 288
1737 3300048925 Ga0496122_0000005 Ga0496122_0000005_155197_156063 288
1738 3300048925 Ga0496122_0000068 Ga0496122_0000068_168323_169189 288
1739 3300048925 Ga0496122_0000944 Ga0496122_0000944_6110_6976 288
1740 3300048925 Ga0496122_0002234 Ga0496122_0002234_5462_6343 288
1741 3300048925 Ga0496122_0009630 Ga0496122_0009630_7551_8444 288
1742 3300048925 Ga0496122_0016703 Ga0496122_0016703_239_1120 288
1743 3300048925 Ga0496122_0020375 Ga0496122_0020375_1122_1994 288
1744 3300048925 Ga0496122_0021200 Ga0496122_0021200_1756_2646 288
1745 3300048925 Ga0496122_0022004 Ga0496122_0022004_3575_4456 288
1746 3300048925 Ga0496122_0089321 Ga0496122_0089321_473_1351 288
1747 3300048925 Ga0496122_0131664 Ga0496122_0131664_345_1214 288
1748 3300048925 Ga0496122_0241207 Ga0496122_0241207_76_945 288
1749 3300048926 Ga0496123_0000008 Ga0496123_0000008_474566_475432 288
1750 3300048926 Ga0496123_0000059 Ga0496123_0000059_56967_57833 288
1751 3300048926 Ga0496123_0000735 Ga0496123_0000735_6295_7161 288
1752 3300048926 Ga0496123_0002032 Ga0496123_0002032_4344_5225 288
1753 3300048926 Ga0496123_0002301 Ga0496123_0002301_21150_22022 288
1754 3300048926 Ga0496123_0003605 Ga0496123_0003605_6551_7417 288
1755 3300048926 Ga0496123_0004045 Ga0496123_0004045_5168_6034 288
1756 3300048926 Ga0496123_0004391 Ga0496123_0004391_8923_9825 288
1757 3300048926 Ga0496123_0005469 Ga0496123_0005469_6791_7672 288
1758 3300048926 Ga0496123_0015385 Ga0496123_0015385_3427_4317 288
1759 3300048926 Ga0496123_0047344 Ga0496123_0047344_1904_2797 288
1760 3300048926 Ga0496123_0079939 Ga0496123_0079939_154_1035 288
1761 3300048926 Ga0496123_0124884 Ga0496123_0124884_300_1166 288
1762 3300048926 Ga0496123_0154979 Ga0496123_0154979_143_1012 288
1763 3300048927 Ga0496124_0000006 Ga0496124_0000006_415856_416722 288
1764 3300048927 Ga0496124_0000381 Ga0496124_0000381_74435_75307 288
1765 3300048927 Ga0496124_0001882 Ga0496124_0001882_11500_12366 288
1766 3300048927 Ga0496124_0002113 Ga0496124_0002113_18330_19196 288
1767 3300048927 Ga0496124_0002996 Ga0496124_0002996_12491_13366 288
1768 3300048927 Ga0496124_0005469 Ga0496124_0005469_9685_10566 288
1769 3300048927 Ga0496124_0025077 Ga0496124_0025077_3030_3911 288
1770 3300048927 Ga0496124_0031468 Ga0496124_0031468_716_1594 288
1771 3300048927 Ga0496124_0070719 Ga0496124_0070719_97_999 288
1772 3300048927 Ga0496124_0084278 Ga0496124_0084278_569_1438 288
1773 3300048927 Ga0496124_0128191 Ga0496124_0128191_427_1296 288
1774 3300048927 Ga0496124_0173315 Ga0496124_0173315_563_1429 288
1775 3300048927 Ga0496124_0189209 Ga0496124_0189209_332_1207 288
1776 3300048927 Ga0496124_0273547 Ga0496124_0273547_60_950 288
1777 3300048927 Ga0496124_0286367 Ga0496124_0286367_148_1017 288
1778 3300048928 Ga0496125_0001098 Ga0496125_0001098_37874_38740 288
1779 3300048928 Ga0496125_0001290 Ga0496125_0001290_35269_36135 288
1780 3300048928 Ga0496125_0001825 Ga0496125_0001825_14808_15689 288
1781 3300048928 Ga0496125_0002418 Ga0496125_0002418_1504_2388 288
1782 3300048928 Ga0496125_0004678 Ga0496125_0004678_11040_11921 288
1783 3300048928 Ga0496125_0011643 Ga0496125_0011643_2352_3218 288
1784 3300048928 Ga0496125_0013477 Ga0496125_0013477_6775_7668 288
1785 3300048928 Ga0496125_0021147 Ga0496125_0021147_2072_2962 288
1786 3300048928 Ga0496125_0044375 Ga0496125_0044375_1824_2690 288
1787 3300048928 Ga0496125_0048051 Ga0496125_0048051_1922_2788 288
1788 3300048928 Ga0496125_0082957 Ga0496125_0082957_1411_2286 288
1789 3300048928 Ga0496125_0092339 Ga0496125_0092339_179_1045 288
1790 3300048928 Ga0496125_0145481 Ga0496125_0145481_475_1350 288
1791 3300048928 Ga0496125_0148636 Ga0496125_0148636_371_1240 288
1792 3300048929 Ga0496126_0000669 Ga0496126_0000669_30313_31194 288
1793 3300048929 Ga0496126_0015558 Ga0496126_0015558_4385_5251 288
1794 3300048929 Ga0496126_0016186 Ga0496126_0016186_436_1311 288
1795 3300048929 Ga0496126_0020308 Ga0496126_0020308_1531_2397 288
1796 3300048929 Ga0496126_0023623 Ga0496126_0023623_4470_5345 288
1797 3300048929 Ga0496126_0106373 Ga0496126_0106373_1286_2167 288
1798 3300048929 Ga0496126_0217165 Ga0496126_0217165_335_1204 288
1799 3300049459 Ga0495678_000026 Ga0495678_000026_201283_202161 288
1800 3300049569 Ga0501032_0184529 Ga0501032_0184529_330_1208 288
1801 3300049570 Ga0501033_0001198 Ga0501033_0001198_1335_2297 288
1802 3300049570 Ga0501033_0017974 Ga0501033_0017974_4362_5237 288
1803 3300049573 Ga0501037_0000077 Ga0501037_0000077_65718_66680 288
1804 3300049573 Ga0501037_0119811 Ga0501037_0119811_774_1652 288
1805 3300049573 Ga0501037_0285442 Ga0501037_0285442_129_1016 288
1806 3300049574 Ga0501038_0084447 Ga0501038_0084447_1304_2182 288
1807 3300049579 Ga0501043_0000114 Ga0501043_0000114_24070_25032 288
1808 3300049579 Ga0501043_0009282 Ga0501043_0009282_2620_3498 288
1809 3300049581 Ga0501047_0176606 Ga0501047_0176606_1038_1916 288
1810 3300049583 Ga0501067_0017287 Ga0501067_0017287_2515_3477 288
1811 3300049584 Ga0501068_0165285 Ga0501068_0165285_88_966 288
1812 3300049585 Ga0501069_0000016 Ga0501069_0000016_51190_52152 288
1813 3300049585 Ga0501069_0049767 Ga0501069_0049767_922_1800 288
1814 3300049585 Ga0501069_0223125 Ga0501069_0223125_140_1021 288
1815 3300049586 Ga0501070_0000450 Ga0501070_0000450_9643_10605 288
1816 3300049586 Ga0501070_0014387 Ga0501070_0014387_1023_1901 288
1817 3300049586 Ga0501070_0078089 Ga0501070_0078089_112_990 288
1818 3300049587 Ga0501071_0006392 Ga0501071_0006392_1056_2018 288
1819 3300049588 Ga0501072_0231524 Ga0501072_0231524_395_1273 288
1820 3300049589 Ga0501073_0004199 Ga0501073_0004199_7808_8770 288
1821 3300049589 Ga0501073_0039577 Ga0501073_0039577_1338_2216 288
1822 3300049589 Ga0501073_0055590 Ga0501073_0055590_451_1329 288
1823 3300049590 Ga0501074_0000067 Ga0501074_0000067_35738_36700 288
1824 3300049741 Ga0501079_0054343 Ga0501079_0054343_1827_2705 288
1825 3300049742 Ga0501080_0000591 Ga0501080_0000591_14806_15768 288
1826 3300049742 Ga0501080_0035544 Ga0501080_0035544_2172_3050 288
1827 3300049744 Ga0501083_0000111 Ga0501083_0000111_51990_52952 288
1828 3300049744 Ga0501083_0103355 Ga0501083_0103355_545_1423 288
1829 3300049822 Ga0501035_0000048 Ga0501035_0000048_127224_128186 288
1830 3300049822 Ga0501035_0002791 Ga0501035_0002791_241_1119 288
1831 3300049822 Ga0501035_0003776 Ga0501035_0003776_1425_2312 288
1832 3300049822 Ga0501035_0188292 Ga0501035_0188292_316_1191 288
1833 3300049822 Ga0501035_0454422 Ga0501035_0454422_121_999 288
1834 3300049823 Ga0501044_0000003 Ga0501044_0000003_125792_126754 288
1835 3300049823 Ga0501044_0008702 Ga0501044_0008702_8955_9842 288
1836 3300049823 Ga0501044_0027890 Ga0501044_0027890_843_1721 288
1837 3300049823 Ga0501044_0178024 Ga0501044_0178024_569_1444 288
1838 3300050490 nmdc:mga03n38_33255_c1 nmdc:mga03n38_33255_c1_711_1595 288
1839 3300050490 nmdc:mga03n38_55514_c1 nmdc:mga03n38_55514_c1_909_1775 288
1840 3300050490 nmdc:mga03n38_65779_c1 nmdc:mga03n38_65779_c1_457_1332 288
1841 3300050491 nmdc:mga00v17_155812_c1 nmdc:mga00v17_155812_c1_70_936 288
1842 3300050491 nmdc:mga00v17_1594_c1 nmdc:mga00v17_1594_c1_4191_5057 288
1843 3300050491 nmdc:mga00v17_30433_c1 nmdc:mga00v17_30433_c1_883_1764 288
1844 3300050491 nmdc:mga00v17_8_c1 nmdc:mga00v17_8_c1_58533_59399 288
1845 3300050492 nmdc:mga0yw44_222463_c1 nmdc:mga0yw44_222463_c1_185_1054 288
1846 3300050492 nmdc:mga0yw44_41686_c2 nmdc:mga0yw44_41686_c2_811_1695 288
1847 3300050492 nmdc:mga0yw44_54127_c1 nmdc:mga0yw44_54127_c1_278_1156 288
1848 3300050492 nmdc:mga0yw44_57872_c1 nmdc:mga0yw44_57872_c1_1313_2185 288
1849 3300050492 nmdc:mga0yw44_72213_c1 nmdc:mga0yw44_72213_c1_1114_1980 288
1850 3300050493 nmdc:mga0k408_204020_c1 nmdc:mga0k408_204020_c1_55_969 288
1851 3300050493 nmdc:mga0k408_35672_c1 nmdc:mga0k408_35672_c1_469_1344 288
1852 3300050494 nmdc:mga06z11_103442_c1 nmdc:mga06z11_103442_c1_433_1308 288
1853 3300050496 nmdc:mga07m45_115185_c1 nmdc:mga07m45_115185_c1_523_1398 288
1854 3300050496 nmdc:mga07m45_116580_c1 nmdc:mga07m45_116580_c1_103_978 288
1855 3300050496 nmdc:mga07m45_19984_c1 nmdc:mga07m45_19984_c1_1535_2419 288
1856 3300050496 nmdc:mga07m45_34685_c1 nmdc:mga07m45_34685_c1_146_1036 288
1857 3300050496 nmdc:mga07m45_81169_c1 nmdc:mga07m45_81169_c1_449_1426 288
1858 3300050516 nmdc:mga0sz30_599_c1 nmdc:mga0sz30_599_c1_7620_8486 288
1859 3300050516 nmdc:mga0sz30_6341_c1 nmdc:mga0sz30_6341_c1_147_1019 288
1860 3300053077 Ga0495601_0024660 Ga0495601_0024660_2558_3436 288
1861 3300053077 Ga0495601_0293508 Ga0495601_0293508_105_995 288
1862 3300053086 Ga0500578_0020392 Ga0500578_0020392_3280_4155 288
1863 3300053087 Ga0500643_000001 Ga0500643_000001_495040_495924 288
1864 3300053087 Ga0500643_000138 Ga0500643_000138_34751_35629 288
1865 3300053087 Ga0500643_025724 Ga0500643_025724_681_1580 288
1866 3300053088 Ga0500644_0002712 Ga0500644_0002712_2287_3168 288
1867 3300053092 Ga0500583_0012961 Ga0500583_0012961_952_1881 288
1868 3300053092 Ga0500583_0056423 Ga0500583_0056423_746_1612 288
1869 3300053093 Ga0500651_0022954 Ga0500651_0022954_2746_3627 288
1870 3300053094 Ga0500566_0190547 Ga0500566_0190547_91_975 288
1871 3300053102 Ga0500554_003013 Ga0500554_003013_869_1747 288
1872 3300053103 Ga0500555_001236 Ga0500555_001236_4787_5665 288
1873 3300053111 Ga0500572_001289 Ga0500572_001289_2754_3629 288
1874 3300053115 Ga0500591_017361 Ga0500591_017361_1355_2221 288
1875 3300053118 Ga0500594_0007310 Ga0500594_0007310_550_1431 288
1876 3300053119 Ga0500595_000458 Ga0500595_000458_20576_21475 288
1877 3300053119 Ga0500595_005177 Ga0500595_005177_885_1763 288
1878 3300053121 Ga0500607_137328 Ga0500607_137328_125_1009 288
1879 3300053129 Ga0500628_006877 Ga0500628_006877_632_1504 288
1880 3300053131 Ga0500652_014351 Ga0500652_014351_155_1039 288
1881 3300053133 Ga0500655_001613 Ga0500655_001613_592_1521 288
1882 3300053134 Ga0500658_0000075 Ga0500658_0000075_38155_39030 288
1883 3300053135 Ga0500659_0120482 Ga0500659_0120482_416_1291 288
1884 3300053136 Ga0500559_0000002 Ga0500559_0000002_128396_129274 288
1885 3300053136 Ga0500559_0000027 Ga0500559_0000027_11929_12810 288
1886 3300053136 Ga0500559_0000217 Ga0500559_0000217_20837_21712 288
1887 3300053136 Ga0500559_0002459 Ga0500559_0002459_3790_4668 288
1888 3300053137 Ga0500561_0000020 Ga0500561_0000020_12874_13740 288
1889 3300053141 Ga0500574_000164 Ga0500574_000164_197_1075 288
1890 3300053146 Ga0500588_0046396 Ga0500588_0046396_126_992 288
1891 3300053148 Ga0500590_001048 Ga0500590_001048_8320_9234 288
1892 3300053151 Ga0500604_0003449 Ga0500604_0003449_3296_4225 288
1893 3300053153 Ga0500616_0005615 Ga0500616_0005615_6355_7230 288
1894 3300053153 Ga0500616_0006871 Ga0500616_0006871_1293_2177 288
1895 3300053153 Ga0500616_0012233 Ga0500616_0012233_3818_4699 288
1896 3300053153 Ga0500616_0033959 Ga0500616_0033959_1439_2320 288
1897 3300053153 Ga0500616_0052145 Ga0500616_0052145_490_1371 288
1898 3300053154 Ga0500619_032717 Ga0500619_032717_201_1079 288
1899 3300053156 Ga0500622_0010898 Ga0500622_0010898_474_1355 288
1900 3300053158 Ga0500627_0073105 Ga0500627_0073105_48_923 288
1901 3300053161 Ga0500634_0000022 Ga0500634_0000022_6003_6881 288
1902 3300053161 Ga0500634_0000709 Ga0500634_0000709_5203_6069 288
1903 3300053163 Ga0500639_030895 Ga0500639_030895_650_1525 288
1904 3300053177 Ga0500636_0048143 Ga0500636_0048143_329_1210 288
1905 3300053730 Ga0500645_000360 Ga0500645_000360_9262_10146 288
1906 3300053730 Ga0500645_010045 Ga0500645_010045_1043_1960 288
1907 3300053735 Ga0500596_001019 Ga0500596_001019_3396_4271 288
1908 3300053739 Ga0500587_005739 Ga0500587_005739_732_1613 288
1909 3300060353 Ga0501082_0010634 Ga0501082_0010634_1587_2549 288
1910 3300061719 Ga0466962_0004668 Ga0466962_0004668_5032_5910 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

68

337

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9424 2 283
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9106 2 283
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8722 9 283
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.8654 9 286
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8607 8 271
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9865 11 287 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9725 11 287 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9299 12 285 3.20.20.100
af_A0A0R0I9K3_1_172_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8881 151 286 3.20.20.100
af_A0A1D6QTZ0_289_448_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8851 179 286 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A840K117-F1-model_v4 deleted 0.9915 2 288
AF-A0A3N2QZW5-F1-model_v4 Aldo/keto reductase family oxidoreductase 0.9879 1 286 GO:0004033
GO:0005737
AF-A0A3D1C8P2-F1-model_v4 deleted 0.9877 188 287
AF-A0A659YI34-F1-model_v4 deleted 0.9875 186 286
AF-A0A0Q8NZJ9-F1-model_v4 Oxidoreductase 0.9867 1 287 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
94.4 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map