F496036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1910 | 971 | 1460 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0002610|Ga0466966_0002610_1894_2916 |
| Length | 340 |
| Sequence | MHYRDERVQIAKIDFHCSLSRTARADYGPFSFEDAARSLASSSSKESPTMSSVQQSGTLSLGDRTVYRLGYGAMQLSGPGVFGPPKDRHAALTVLREVVASGVNHIDTSDFYGPHVTNQLIREALHPYRDDLVIVTKVGARRGEDASWMPAFSPEALTQAVHDNLRNLGLDVLDVVNLRVMFDVHAPAEGSIEAPLTVLAELQQQGLVRHVGLSNVTPMQLAEACRICNIVCVQNHYNLAHRGDEDFIDALARDGIAYVPYFPLGGFNPLQSSILSDVAARLDATPMQVALAWLLRRAPNIVLIPGTSSLAHLHENLAAAAVNLPDDAARELDGVAAKIN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 7 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 13 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 16 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 21 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 22 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 23 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 24 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 25 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 26 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 27 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 28 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 29 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 30 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 31 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 32 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 33 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 34 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 35 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 36 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 37 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 38 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 39 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 40 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 41 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 42 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 43 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 44 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 45 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 46 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 47 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 48 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 49 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 50 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 51 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 52 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 53 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 54 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 55 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 56 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 57 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 58 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 59 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 60 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 61 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 62 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 63 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 64 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 65 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 66 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 67 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 68 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 69 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 70 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 71 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 72 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 73 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 74 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 75 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 76 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 77 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 78 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 79 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 80 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 81 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 82 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 83 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 84 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 85 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 86 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 87 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 88 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 89 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 90 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 91 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 92 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 93 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 94 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 95 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 96 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 97 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 98 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 99 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 100 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 101 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 102 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 103 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 104 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 105 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 106 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 107 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 108 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 109 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 110 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 111 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 112 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 113 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 114 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 115 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 116 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 117 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 118 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 119 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 120 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 121 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 122 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 123 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 124 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 125 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 126 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 127 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 128 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 129 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 130 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 131 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 132 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 133 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 134 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 135 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 136 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 137 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 138 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 139 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 140 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 141 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 142 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 143 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 144 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 145 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 146 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 147 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 148 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 149 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 150 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 151 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 152 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 153 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 154 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 155 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 156 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 157 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 158 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 159 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 160 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 161 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 162 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 163 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 164 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 165 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 166 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 167 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 168 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 169 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 170 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 171 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 172 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 173 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 174 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 175 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 176 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 177 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 178 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 179 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 180 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 181 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 182 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 183 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 184 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 185 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 186 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 187 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 188 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 189 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 190 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 191 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 192 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 193 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 194 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 195 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 196 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 197 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 198 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 199 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 200 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 201 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 202 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 203 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 204 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 205 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 206 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 207 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 208 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 209 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 210 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 211 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 212 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 213 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 214 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 215 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 216 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 217 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 218 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 219 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 220 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 221 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 222 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 223 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 224 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 225 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 226 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 227 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 228 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 229 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 230 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 231 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 232 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 233 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 234 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 235 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 236 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 237 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 238 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 239 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 240 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 241 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 242 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 243 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 244 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 245 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 246 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 247 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 248 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 249 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 250 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 251 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 252 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 253 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 254 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 255 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 256 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 257 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 258 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 259 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 260 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 261 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 262 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 263 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 264 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 265 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 266 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 267 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 268 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 269 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 270 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 271 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 272 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 273 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 274 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 275 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 276 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 277 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 278 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 279 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 280 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 281 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 282 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 283 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 284 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 285 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 286 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 287 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 288 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 289 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 290 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 291 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 292 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 293 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 294 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 295 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 296 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 297 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 298 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 299 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 300 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 301 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 302 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 303 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 304 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 305 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 306 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 307 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 308 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 309 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 310 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 311 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 312 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 313 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 314 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 315 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 316 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 317 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 318 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 319 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 320 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 321 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 322 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 323 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 324 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 325 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 326 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 327 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 328 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 329 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 330 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 331 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 332 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 333 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 334 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 335 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 336 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 337 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 338 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 339 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 340 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 341 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 342 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 343 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 344 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 345 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 346 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 347 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 348 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 349 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 350 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 351 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 352 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 353 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 354 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 355 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 356 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 357 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 358 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 359 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 360 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 361 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 362 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 363 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 364 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 365 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 366 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 367 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 368 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 369 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 370 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 371 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 372 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 373 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 374 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 375 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 376 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 377 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 378 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 379 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 380 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 381 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 382 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 383 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 384 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 385 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 386 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 387 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 388 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 389 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 390 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 391 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 392 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 393 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 394 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 395 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 396 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 397 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 398 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 399 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 400 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 401 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 402 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 403 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 404 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 405 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 406 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 407 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 408 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 409 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 410 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 411 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 412 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 413 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 414 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 415 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 416 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 417 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 418 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 419 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 420 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 421 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 422 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 423 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 424 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 425 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 426 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 427 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 428 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 429 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 430 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 431 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 432 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 433 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 434 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 435 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 436 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 437 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 438 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 439 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 440 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 441 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 442 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 443 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 444 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 445 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 446 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 447 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 448 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 449 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 450 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 451 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 452 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 453 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 454 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 455 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 456 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 457 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 458 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 459 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 460 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 461 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 462 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 463 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 464 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 465 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 466 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 467 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 468 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 469 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 470 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 471 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 472 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 474 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 475 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 476 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 477 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 478 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 479 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 480 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 481 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 482 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 483 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 484 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 485 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 487 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 488 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 489 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 490 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 491 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 492 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 493 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 494 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 495 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 496 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 497 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 498 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 499 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 500 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 501 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 502 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 503 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 504 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 505 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 506 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 507 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 508 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 509 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 510 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 511 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 512 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 514 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 515 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 516 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 517 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 518 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 519 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 520 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 522 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 523 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 525 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 526 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 527 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 529 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 530 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 531 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 532 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 533 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 534 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 535 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 538 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 539 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 541 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 542 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 543 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 544 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 545 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 548 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 550 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 553 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 557 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 558 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 559 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 560 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 561 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 562 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 563 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 564 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 565 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 566 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 567 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 568 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 569 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 571 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 572 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 573 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 574 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 575 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 576 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 578 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 585 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 587 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 588 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 589 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 590 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 592 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 593 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 594 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 595 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 597 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 598 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 599 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 601 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 602 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 603 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 604 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 605 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 606 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 607 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 667 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 669 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 673 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 674 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 675 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 676 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 677 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 680 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 681 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 682 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 683 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 684 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 685 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 686 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 687 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 688 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 689 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 690 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 691 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 692 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 693 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 694 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 695 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 696 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 697 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 698 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 699 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 700 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 701 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 702 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 703 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 704 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 705 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 706 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 707 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 708 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 709 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 710 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 711 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 712 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 713 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 714 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 715 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 716 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 717 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 718 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 719 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 720 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 721 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 722 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 723 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 724 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 725 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 726 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 727 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 728 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 729 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 730 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 731 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 732 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 733 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 734 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 735 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 736 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 737 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 738 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 739 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 740 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 741 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 742 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 743 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 744 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 745 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 746 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 747 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 748 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 749 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 820 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 821 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 822 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 823 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 824 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 825 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 826 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 827 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 828 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 829 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 830 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 831 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 832 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 833 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 834 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 835 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 836 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 837 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 838 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 839 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 840 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 841 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 842 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 843 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 844 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 845 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 846 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 847 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 848 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 849 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 850 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 851 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 852 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 853 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 854 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 855 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 856 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 857 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 858 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 859 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 860 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 861 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 862 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 863 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 864 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 865 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 866 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 867 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 868 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 869 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 870 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 871 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 872 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 873 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 874 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 875 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 876 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 877 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 878 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 879 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 880 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 881 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 882 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 883 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 884 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 886 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 887 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 888 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 889 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 890 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 891 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 892 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 893 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 894 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 895 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 896 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 897 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 898 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 899 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 900 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 901 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 902 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 903 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 904 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 905 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 906 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 907 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 908 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 909 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 910 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 911 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 912 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 913 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 914 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 915 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 916 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 917 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 918 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 919 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 920 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 921 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 922 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 923 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 924 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 925 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 926 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 927 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 928 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 929 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 930 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 931 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 932 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 933 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 934 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 935 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 936 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 937 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 938 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 939 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 940 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 941 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 942 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 943 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 944 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 945 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 946 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 947 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 948 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 949 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 950 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 951 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 952 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 953 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 954 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 955 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 956 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 957 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 958 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 959 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 960 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 961 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 962 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 963 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 964 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 965 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 966 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 967 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 968 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 969 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 970 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 971 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.86 |
| Metatranscriptomes | 0.58 |
| Isolates | 23.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.05 |
| Bulb | 0 |
| Endosphere | 15.08 |
| Nodule | 15.34 |
| Rhizoplane | 3.14 |
| Rhizosphere | 51.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1809446 | 2162886007 | Bacteria | 1415 |
| 2 | SwRhRL2b_contig_239577 | 2162886007 | Bacteria | 1747 |
| 3 | SwRhRL2b_contig_97959 | 2162886007 | Bacteria | 8750 |
| 4 | MRS1b_contig_984201 | 2162886011 | Bacteria | 1212 |
| 5 | JGI24741J21665_1000141 | 3300001915 | Bacteria | 20031 |
| 6 | JGI24741J21665_1003056 | 3300001915 | Bacteria | 4122 |
| 7 | JGI24740J21852_10000026 | 3300001979 | Bacteria | 49563 |
| 8 | JGI24740J21852_10001737 | 3300001979 | Bacteria | 10007 |
| 9 | JGI24739J22299_10034747 | 3300001989 | Bacteria | 1715 |
| 10 | JGI24738J21930_10000927 | 3300002075 | Bacteria | 8430 |
| 11 | JGI25156J39149_1003279 | 3300002705 | Bacteria | 5362 |
| 12 | JGI25156J39149_1007730 | 3300002705 | Bacteria | 2784 |
| 13 | JGI25162J39368_1000177 | 3300002737 | Bacteria | 68786 |
| 14 | JGI25162J39368_1000323 | 3300002737 | Bacteria | 41942 |
| 15 | JGI25162J39368_1000775 | 3300002737 | Bacteria | 21515 |
| 16 | JGI25162J39368_1000803 | 3300002737 | Bacteria | 20853 |
| 17 | JGI25162J39368_1006232 | 3300002737 | Bacteria | 2108 |
| 18 | JGI25154J39366_1000451 | 3300002738 | Bacteria | 21633 |
| 19 | JGI25157J39369_1001008 | 3300002741 | Bacteria | 13088 |
| 20 | JGI25164J39214_1000032 | 3300002772 | Bacteria | 144465 |
| 21 | JGI25152J39213_1000657 | 3300002773 | Bacteria | 18088 |
| 22 | JGI25152J39213_1002074 | 3300002773 | Bacteria | 7887 |
| 23 | JGI25152J39213_1007876 | 3300002773 | Bacteria | 2703 |
| 24 | JGI25159J45721_1000276 | 3300002987 | Bacteria | 24129 |
| 25 | JGI25151J46595_10000341 | 3300003187 | Bacteria | 50002 |
| 26 | JGI25151J46595_10000485 | 3300003187 | Bacteria | 37594 |
| 27 | JGI25151J46595_10002329 | 3300003187 | Bacteria | 11566 |
| 28 | JGI25165J46597_1000136 | 3300003214 | Bacteria | 122521 |
| 29 | JGI25165J46597_1000406 | 3300003214 | Bacteria | 45616 |
| 30 | JGI25165J46597_1000415 | 3300003214 | Bacteria | 44714 |
| 31 | JGI25165J46597_1007210 | 3300003214 | Bacteria | 1872 |
| 32 | JGI25153J46596_10000344 | 3300003215 | Bacteria | 32730 |
| 33 | JGI25153J46596_10003378 | 3300003215 | Bacteria | 8955 |
| 34 | JGI25153J46596_10004937 | 3300003215 | Bacteria | 7087 |
| 35 | rootH1_10012089 | 3300003316 | Bacteria | 11247 |
| 36 | rootH1_10028145 | 3300003316 | Bacteria | 16351 |
| 37 | rootH1_10052697 | 3300003316 | Bacteria | 3957 |
| 38 | rootH2_10037401 | 3300003320 | Bacteria | 5875 |
| 39 | rootH2_10054426 | 3300003320 | Bacteria | 2427 |
| 40 | rootH2_10057798 | 3300003320 | Bacteria | 4724 |
| 41 | rootL2_10070782 | 3300003322 | Bacteria | 8969 |
| 42 | rootH1_10003256 | 3300003323 | Bacteria | 53834 |
| 43 | rootH1_10072615 | 3300003323 | Bacteria | 2144 |
| 44 | rootH1_10189607 | 3300003323 | Bacteria | 2363 |
| 45 | rootH1_10192974 | 3300003323 | Bacteria | 1548 |
| 46 | JGI25160J50197_1000023 | 3300003354 | Bacteria | 200692 |
| 47 | JGI25160J50197_1000384 | 3300003354 | Bacteria | 28677 |
| 48 | JGI25161J50226_1000012 | 3300003374 | Bacteria | 200668 |
| 49 | JGI25161J50226_1001233 | 3300003374 | Bacteria | 8299 |
| 50 | Ga0055538_1003626 | 3300003751 | Bacteria | 1919 |
| 51 | Ga0055538_1005754 | 3300003751 | Bacteria | 1258 |
| 52 | Ga0055539_1000053 | 3300003752 | Bacteria | 165149 |
| 53 | Ga0055539_1003561 | 3300003752 | Bacteria | 2164 |
| 54 | Ga0055533_1003976 | 3300003756 | Bacteria | 2800 |
| 55 | Ga0055533_1003999 | 3300003756 | Bacteria | 2787 |
| 56 | Ga0055532_1000033 | 3300003758 | Bacteria | 214652 |
| 57 | Ga0055532_1000301 | 3300003758 | Bacteria | 30248 |
| 58 | Ga0055532_1000363 | 3300003758 | Bacteria | 23828 |
| 59 | Ga0055532_1000680 | 3300003758 | Bacteria | 12818 |
| 60 | Ga0055525_1000310 | 3300003759 | Bacteria | 39767 |
| 61 | Ga0055527_1000279 | 3300003760 | Bacteria | 30091 |
| 62 | Ga0055527_1004474 | 3300003760 | Bacteria | 1918 |
| 63 | Ga0055527_1005898 | 3300003760 | Bacteria | 1561 |
| 64 | Ga0055535_1000024 | 3300003761 | Bacteria | 214652 |
| 65 | Ga0055535_1000589 | 3300003761 | Bacteria | 30248 |
| 66 | Ga0055535_1000781 | 3300003761 | Bacteria | 23313 |
| 67 | Ga0055535_1001563 | 3300003761 | Bacteria | 11137 |
| 68 | Ga0055535_1003702 | 3300003761 | Bacteria | 4128 |
| 69 | Ga0055542_1000390 | 3300003762 | Bacteria | 44140 |
| 70 | Ga0055542_1000565 | 3300003762 | Bacteria | 32556 |
| 71 | Ga0055542_1003574 | 3300003762 | Bacteria | 4128 |
| 72 | Ga0055542_1003740 | 3300003762 | Bacteria | 3972 |
| 73 | Ga0055542_1016377 | 3300003762 | Bacteria | 1169 |
| 74 | Ga0055529_1000044 | 3300003763 | Bacteria | 214652 |
| 75 | Ga0055529_1000183 | 3300003763 | Bacteria | 86414 |
| 76 | Ga0055529_1000247 | 3300003763 | Bacteria | 66795 |
| 77 | Ga0055529_1001634 | 3300003763 | Bacteria | 5953 |
| 78 | Ga0055526_1000295 | 3300003771 | Bacteria | 41778 |
| 79 | Ga0055526_1000353 | 3300003771 | Bacteria | 37277 |
| 80 | Ga0055526_1000400 | 3300003771 | Bacteria | 35032 |
| 81 | Ga0055526_1001272 | 3300003771 | Bacteria | 18075 |
| 82 | Ga0055526_1006591 | 3300003771 | Bacteria | 6257 |
| 83 | Ga0055526_1010319 | 3300003771 | Bacteria | 4364 |
| 84 | Ga0055526_1026948 | 3300003771 | Bacteria | 1793 |
| 85 | Ga0055524_1001036 | 3300003775 | Bacteria | 17159 |
| 86 | Ga0055524_1005033 | 3300003775 | Bacteria | 5983 |
| 87 | Ga0055524_1010008 | 3300003775 | Bacteria | 3810 |
| 88 | Ga0055524_1017046 | 3300003775 | Bacteria | 2576 |
| 89 | Ga0055524_1026965 | 3300003775 | Bacteria | 1758 |
| 90 | Ga0055524_1027816 | 3300003775 | Bacteria | 1706 |
| 91 | Ga0055534_1000981 | 3300003784 | Bacteria | 12605 |
| 92 | Ga0055528_1000034 | 3300003790 | Bacteria | 118577 |
| 93 | Ga0055528_1005932 | 3300003790 | Bacteria | 5600 |
| 94 | Ga0055528_1007720 | 3300003790 | Bacteria | 4715 |
| 95 | Ga0055528_1017273 | 3300003790 | Bacteria | 2510 |
| 96 | Ga0055528_1024757 | 3300003790 | Bacteria | 1788 |
| 97 | Ga0055540_1008434 | 3300003792 | Bacteria | 3712 |
| 98 | Ga0055541_1006780 | 3300003841 | Bacteria | 1919 |
| 99 | Ga0058692_1000057 | 3300003856 | Bacteria | 103718 |
| 100 | Ga0058692_1000187 | 3300003856 | Bacteria | 37578 |
| 101 | Ga0058692_1000790 | 3300003856 | Bacteria | 12695 |
| 102 | Ga0058692_1001172 | 3300003856 | Bacteria | 10079 |
| 103 | Ga0058692_1002515 | 3300003856 | Bacteria | 6096 |
| 104 | JGI25405J52794_10021798 | 3300003911 | Bacteria | 1296 |
| 105 | Ga0055543_1000009 | 3300004625 | Bacteria | 200706 |
| 106 | Ga0055543_1000505 | 3300004625 | Bacteria | 22435 |
| 107 | Ga0055543_1001297 | 3300004625 | Bacteria | 10273 |
| 108 | Ga0065165_1000064 | 3300005262 | Bacteria | 175153 |
| 109 | Ga0065165_1003434 | 3300005262 | Bacteria | 11144 |
| 110 | Ga0065704_10000492 | 3300005289 | Bacteria | 24931 |
| 111 | Ga0065704_10002773 | 3300005289 | Bacteria | 6059 |
| 112 | Ga0065704_10003241 | 3300005289 | Bacteria | 5622 |
| 113 | Ga0065704_10005983 | 3300005289 | Bacteria | 3600 |
| 114 | Ga0065712_10080638 | 3300005290 | Bacteria | 3083 |
| 115 | Ga0065715_10110171 | 3300005293 | Bacteria | 2629 |
| 116 | Ga0070658_10027491 | 3300005327 | Bacteria | 4565 |
| 117 | Ga0070658_10057535 | 3300005327 | Bacteria | 3163 |
| 118 | Ga0070658_10086719 | 3300005327 | Bacteria | 2575 |
| 119 | Ga0070658_10166371 | 3300005327 | Bacteria | 1851 |
| 120 | Ga0070658_10179465 | 3300005327 | Bacteria | 1781 |
| 121 | Ga0070683_100109746 | 3300005329 | Bacteria | 2602 |
| 122 | Ga0070690_100020249 | 3300005330 | Bacteria | 4051 |
| 123 | Ga0070690_100271451 | 3300005330 | Bacteria | 1206 |
| 124 | Ga0070670_100000416 | 3300005331 | Bacteria | 35091 |
| 125 | Ga0070670_100000697 | 3300005331 | Bacteria | 26100 |
| 126 | Ga0070670_100029918 | 3300005331 | Bacteria | 4689 |
| 127 | Ga0068869_100121152 | 3300005334 | Bacteria | 2001 |
| 128 | Ga0068869_100399246 | 3300005334 | Bacteria | 1130 |
| 129 | Ga0070666_10041064 | 3300005335 | Bacteria | 3090 |
| 130 | Ga0070680_100001870 | 3300005336 | Bacteria | 15428 |
| 131 | Ga0070680_100004874 | 3300005336 | Bacteria | 10105 |
| 132 | Ga0070680_100005276 | 3300005336 | Bacteria | 9772 |
| 133 | Ga0070680_100005898 | 3300005336 | Bacteria | 9302 |
| 134 | Ga0070680_100042214 | 3300005336 | Bacteria | 3700 |
| 135 | Ga0070680_100042511 | 3300005336 | Bacteria | 3688 |
| 136 | Ga0070682_100041799 | 3300005337 | Bacteria | 2827 |
| 137 | Ga0068868_100010007 | 3300005338 | Bacteria | 6852 |
| 138 | Ga0068868_100028727 | 3300005338 | Bacteria | 4255 |
| 139 | Ga0068868_100036766 | 3300005338 | Bacteria | 3793 |
| 140 | Ga0070660_100000261 | 3300005339 | Bacteria | 34930 |
| 141 | Ga0070660_100017615 | 3300005339 | Bacteria | 5209 |
| 142 | Ga0070660_100315809 | 3300005339 | Bacteria | 1283 |
| 143 | Ga0070691_10060783 | 3300005341 | Bacteria | 1816 |
| 144 | Ga0070691_10124799 | 3300005341 | Bacteria | 1299 |
| 145 | Ga0070661_100000021 | 3300005344 | Bacteria | 128510 |
| 146 | Ga0070661_100000901 | 3300005344 | Bacteria | 21311 |
| 147 | Ga0070661_100042774 | 3300005344 | Bacteria | 3307 |
| 148 | Ga0070661_100062414 | 3300005344 | Bacteria | 2735 |
| 149 | Ga0070661_100127868 | 3300005344 | Bacteria | 1907 |
| 150 | Ga0070692_10100401 | 3300005345 | Bacteria | 1585 |
| 151 | Ga0070675_100062107 | 3300005354 | Bacteria | 3086 |
| 152 | Ga0070675_100139825 | 3300005354 | Bacteria | 2069 |
| 153 | Ga0070671_100064953 | 3300005355 | Bacteria | 3040 |
| 154 | Ga0070671_100067148 | 3300005355 | Bacteria | 2990 |
| 155 | Ga0070671_100158401 | 3300005355 | Bacteria | 1913 |
| 156 | Ga0070673_100002004 | 3300005364 | Bacteria | 12291 |
| 157 | Ga0070688_100000670 | 3300005365 | Bacteria | 17041 |
| 158 | Ga0070688_100061932 | 3300005365 | Bacteria | 2367 |
| 159 | Ga0070688_100131186 | 3300005365 | Bacteria | 1691 |
| 160 | Ga0070659_100000108 | 3300005366 | Bacteria | 61185 |
| 161 | Ga0070659_100098295 | 3300005366 | Bacteria | 2353 |
| 162 | Ga0070659_100105743 | 3300005366 | Bacteria | 2268 |
| 163 | Ga0070659_100138341 | 3300005366 | Bacteria | 1981 |
| 164 | Ga0070659_100213551 | 3300005366 | Bacteria | 1590 |
| 165 | Ga0070667_100024748 | 3300005367 | Bacteria | 4988 |
| 166 | Ga0070667_100040088 | 3300005367 | Bacteria | 3927 |
| 167 | Ga0070667_100041372 | 3300005367 | Bacteria | 3866 |
| 168 | Ga0070667_100058983 | 3300005367 | Bacteria | 3246 |
| 169 | Ga0070667_100100477 | 3300005367 | Bacteria | 2498 |
| 170 | Ga0070703_10002464 | 3300005406 | Bacteria | 5317 |
| 171 | Ga0070703_10056291 | 3300005406 | Bacteria | 1273 |
| 172 | Ga0070709_10061571 | 3300005434 | Bacteria | 2389 |
| 173 | Ga0070701_10124100 | 3300005438 | Bacteria | 1459 |
| 174 | Ga0070711_100000154 | 3300005439 | Bacteria | 36893 |
| 175 | Ga0070711_100118168 | 3300005439 | Bacteria | 1956 |
| 176 | Ga0070705_100000105 | 3300005440 | Bacteria | 47664 |
| 177 | Ga0070700_100001122 | 3300005441 | Bacteria | 13254 |
| 178 | Ga0070694_100004390 | 3300005444 | Bacteria | 8484 |
| 179 | Ga0070663_100000004 | 3300005455 | Bacteria | 254839 |
| 180 | Ga0070663_100002324 | 3300005455 | Bacteria | 10678 |
| 181 | Ga0070663_100005266 | 3300005455 | Bacteria | 7668 |
| 182 | Ga0070663_100083158 | 3300005455 | Bacteria | 2357 |
| 183 | Ga0070678_100178486 | 3300005456 | Bacteria | 1736 |
| 184 | Ga0070662_100089051 | 3300005457 | Bacteria | 2314 |
| 185 | Ga0070662_100383957 | 3300005457 | Bacteria | 1156 |
| 186 | Ga0070681_10000874 | 3300005458 | Bacteria | 25402 |
| 187 | Ga0070681_10004469 | 3300005458 | Bacteria | 13326 |
| 188 | Ga0070681_10007901 | 3300005458 | Bacteria | 10409 |
| 189 | Ga0070681_10322169 | 3300005458 | Bacteria | 1455 |
| 190 | Ga0070681_10328815 | 3300005458 | Bacteria | 1438 |
| 191 | Ga0068867_100554336 | 3300005459 | Bacteria | 996 |
| 192 | Ga0070685_10004218 | 3300005466 | Bacteria | 7256 |
| 193 | Ga0070699_100000330 | 3300005518 | Bacteria | 45857 |
| 194 | Ga0070679_100000934 | 3300005530 | Bacteria | 25378 |
| 195 | Ga0070679_100007558 | 3300005530 | Bacteria | 10167 |
| 196 | Ga0070679_100081078 | 3300005530 | Bacteria | 3234 |
| 197 | Ga0070684_100044131 | 3300005535 | Bacteria | 3854 |
| 198 | Ga0070684_100444376 | 3300005535 | Bacteria | 1198 |
| 199 | Ga0068853_100189380 | 3300005539 | Bacteria | 1869 |
| 200 | Ga0068853_100214779 | 3300005539 | Bacteria | 1754 |
| 201 | Ga0068853_100238535 | 3300005539 | Bacteria | 1666 |
| 202 | Ga0070686_100042207 | 3300005544 | Bacteria | 2856 |
| 203 | Ga0070686_100227886 | 3300005544 | Bacteria | 1350 |
| 204 | Ga0070695_100001309 | 3300005545 | Bacteria | 13753 |
| 205 | Ga0070695_100059422 | 3300005545 | Bacteria | 2475 |
| 206 | Ga0070696_100000069 | 3300005546 | Bacteria | 49879 |
| 207 | Ga0070696_100291242 | 3300005546 | Bacteria | 1247 |
| 208 | Ga0070693_100084080 | 3300005547 | Bacteria | 1904 |
| 209 | Ga0070665_100002139 | 3300005548 | Bacteria | 22050 |
| 210 | Ga0070665_100010264 | 3300005548 | Bacteria | 9478 |
| 211 | Ga0070665_100011006 | 3300005548 | Bacteria | 9146 |
| 212 | Ga0070665_100017050 | 3300005548 | Bacteria | 7285 |
| 213 | Ga0070665_100072254 | 3300005548 | Bacteria | 3458 |
| 214 | Ga0070665_100095775 | 3300005548 | Bacteria | 2973 |
| 215 | Ga0070665_100096345 | 3300005548 | Bacteria | 2964 |
| 216 | Ga0070665_100116162 | 3300005548 | Bacteria | 2678 |
| 217 | Ga0070665_100154255 | 3300005548 | Bacteria | 2298 |
| 218 | Ga0070665_100246946 | 3300005548 | Bacteria | 1785 |
| 219 | Ga0070704_100001159 | 3300005549 | Bacteria | 13760 |
| 220 | Ga0070704_100069702 | 3300005549 | Bacteria | 2549 |
| 221 | Ga0068855_100000010 | 3300005563 | Bacteria | 246022 |
| 222 | Ga0068855_100000195 | 3300005563 | Bacteria | 78223 |
| 223 | Ga0068855_100000988 | 3300005563 | Bacteria | 35353 |
| 224 | Ga0068855_100175538 | 3300005563 | Bacteria | 2425 |
| 225 | Ga0068855_100468470 | 3300005563 | Bacteria | 1373 |
| 226 | Ga0068855_100631052 | 3300005563 | Bacteria | 1153 |
| 227 | Ga0070664_100000007 | 3300005564 | Bacteria | 176744 |
| 228 | Ga0070664_100000030 | 3300005564 | Bacteria | 89030 |
| 229 | Ga0070664_100000969 | 3300005564 | Bacteria | 22461 |
| 230 | Ga0070664_100179353 | 3300005564 | Bacteria | 1882 |
| 231 | Ga0070664_100179661 | 3300005564 | Bacteria | 1880 |
| 232 | Ga0070664_100259160 | 3300005564 | Bacteria | 1564 |
| 233 | Ga0068857_100003083 | 3300005577 | Bacteria | 13783 |
| 234 | Ga0068857_100032292 | 3300005577 | Bacteria | 4629 |
| 235 | Ga0068857_100055108 | 3300005577 | Bacteria | 3529 |
| 236 | Ga0068857_100150582 | 3300005577 | Bacteria | 2107 |
| 237 | Ga0068854_100000045 | 3300005578 | Bacteria | 91844 |
| 238 | Ga0068854_100026179 | 3300005578 | Bacteria | 4006 |
| 239 | Ga0068854_100171255 | 3300005578 | Bacteria | 1690 |
| 240 | Ga0068854_100242391 | 3300005578 | Bacteria | 1436 |
| 241 | Ga0068856_100000004 | 3300005614 | Bacteria | 233761 |
| 242 | Ga0068856_100013928 | 3300005614 | Bacteria | 7778 |
| 243 | Ga0068856_100025963 | 3300005614 | Bacteria | 5713 |
| 244 | Ga0068856_100029524 | 3300005614 | Bacteria | 5356 |
| 245 | Ga0068856_100262477 | 3300005614 | Bacteria | 1743 |
| 246 | Ga0068856_100295311 | 3300005614 | Bacteria | 1637 |
| 247 | Ga0068852_100000027 | 3300005616 | Bacteria | 113819 |
| 248 | Ga0068852_100019019 | 3300005616 | Bacteria | 5426 |
| 249 | Ga0068852_100030075 | 3300005616 | Bacteria | 4467 |
| 250 | Ga0068852_100165037 | 3300005616 | Bacteria | 2071 |
| 251 | Ga0068852_100178284 | 3300005616 | Bacteria | 1996 |
| 252 | Ga0068852_100376523 | 3300005616 | Bacteria | 1392 |
| 253 | Ga0068852_100732168 | 3300005616 | Bacteria | 1000 |
| 254 | Ga0068859_100005533 | 3300005617 | Bacteria | 12866 |
| 255 | Ga0068859_100016446 | 3300005617 | Bacteria | 7430 |
| 256 | Ga0068859_100025880 | 3300005617 | Bacteria | 5887 |
| 257 | Ga0068859_100109335 | 3300005617 | Bacteria | 2826 |
| 258 | Ga0068859_100123093 | 3300005617 | Bacteria | 2661 |
| 259 | Ga0068859_100159809 | 3300005617 | Bacteria | 2332 |
| 260 | Ga0068864_100044086 | 3300005618 | Bacteria | 3821 |
| 261 | Ga0068864_100382007 | 3300005618 | Bacteria | 1335 |
| 262 | Ga0068851_10193651 | 3300005834 | Bacteria | 1131 |
| 263 | Ga0068863_100000683 | 3300005841 | Bacteria | 34221 |
| 264 | Ga0068863_100004808 | 3300005841 | Bacteria | 13303 |
| 265 | Ga0068863_100027028 | 3300005841 | Bacteria | 5472 |
| 266 | Ga0068863_100086368 | 3300005841 | Bacteria | 2972 |
| 267 | Ga0068863_100126667 | 3300005841 | Bacteria | 2437 |
| 268 | Ga0068863_100134507 | 3300005841 | Bacteria | 2362 |
| 269 | Ga0068863_100556352 | 3300005841 | Bacteria | 1133 |
| 270 | Ga0068858_100000111 | 3300005842 | Bacteria | 86228 |
| 271 | Ga0068858_100099300 | 3300005842 | Bacteria | 2714 |
| 272 | Ga0068858_100278124 | 3300005842 | Bacteria | 1594 |
| 273 | Ga0068858_100486729 | 3300005842 | Bacteria | 1191 |
| 274 | Ga0068860_100000439 | 3300005843 | Bacteria | 52876 |
| 275 | Ga0068860_100011376 | 3300005843 | Bacteria | 8769 |
| 276 | Ga0068860_100020906 | 3300005843 | Bacteria | 6341 |
| 277 | Ga0068860_100148663 | 3300005843 | Bacteria | 2255 |
| 278 | Ga0068860_100150557 | 3300005843 | Bacteria | 2240 |
| 279 | Ga0068860_100151007 | 3300005843 | Bacteria | 2237 |
| 280 | Ga0068860_100208932 | 3300005843 | Bacteria | 1893 |
| 281 | Ga0068862_100001572 | 3300005844 | Bacteria | 20809 |
| 282 | Ga0081455_10004123 | 3300005937 | Bacteria | 16434 |
| 283 | Ga0081455_10009027 | 3300005937 | Bacteria | 10291 |
| 284 | Ga0081455_10016579 | 3300005937 | Bacteria | 7105 |
| 285 | Ga0081455_10056445 | 3300005937 | Bacteria | 3334 |
| 286 | Ga0081540_1000092 | 3300005983 | Bacteria | 94188 |
| 287 | Ga0081540_1089809 | 3300005983 | Bacteria | 1354 |
| 288 | Ga0075365_10019425 | 3300006038 | Bacteria | 4194 |
| 289 | Ga0075365_10121510 | 3300006038 | Bacteria | 1802 |
| 290 | Ga0075365_10132810 | 3300006038 | Bacteria | 1723 |
| 291 | Ga0075363_100024052 | 3300006048 | Bacteria | 3094 |
| 292 | Ga0075363_100045564 | 3300006048 | Bacteria | 2326 |
| 293 | Ga0075364_10003881 | 3300006051 | Bacteria | 8574 |
| 294 | Ga0075364_10015008 | 3300006051 | Bacteria | 4797 |
| 295 | Ga0075364_10073375 | 3300006051 | Bacteria | 2255 |
| 296 | Ga0075364_10185860 | 3300006051 | Bacteria | 1407 |
| 297 | Ga0075364_10228449 | 3300006051 | Bacteria | 1264 |
| 298 | Ga0070716_100119615 | 3300006173 | Bacteria | 1647 |
| 299 | Ga0070712_100000126 | 3300006175 | Bacteria | 40420 |
| 300 | Ga0075362_10039953 | 3300006177 | Bacteria | 2064 |
| 301 | Ga0075362_10111342 | 3300006177 | Bacteria | 1289 |
| 302 | Ga0075367_10134593 | 3300006178 | Bacteria | 1529 |
| 303 | Ga0075367_10265123 | 3300006178 | Bacteria | 1078 |
| 304 | Ga0075369_10127115 | 3300006186 | Bacteria | 1156 |
| 305 | Ga0075366_10220974 | 3300006195 | Bacteria | 1154 |
| 306 | Ga0097621_100013057 | 3300006237 | Bacteria | 6176 |
| 307 | Ga0097621_100134389 | 3300006237 | Bacteria | 2108 |
| 308 | Ga0075370_10002020 | 3300006353 | Bacteria | 9197 |
| 309 | Ga0075370_10010184 | 3300006353 | Bacteria | 4903 |
| 310 | Ga0075370_10010830 | 3300006353 | Bacteria | 4779 |
| 311 | Ga0075370_10014013 | 3300006353 | Bacteria | 4269 |
| 312 | Ga0075370_10018625 | 3300006353 | Bacteria | 3768 |
| 313 | Ga0075370_10125169 | 3300006353 | Bacteria | 1498 |
| 314 | Ga0075370_10126994 | 3300006353 | Bacteria | 1487 |
| 315 | Ga0068871_100000739 | 3300006358 | Bacteria | 22191 |
| 316 | Ga0068871_100354221 | 3300006358 | Bacteria | 1299 |
| 317 | Ga0075431_100311316 | 3300006847 | Bacteria | 1589 |
| 318 | Ga0075434_100034079 | 3300006871 | Bacteria | 5027 |
| 319 | Ga0075429_100137495 | 3300006880 | Bacteria | 2138 |
| 320 | Ga0068865_100011752 | 3300006881 | Bacteria | 5484 |
| 321 | Ga0068865_100017394 | 3300006881 | Bacteria | 4624 |
| 322 | Ga0068865_100048661 | 3300006881 | Bacteria | 2918 |
| 323 | Ga0075436_100001843 | 3300006914 | Bacteria | 14538 |
| 324 | Ga0097620_100005533 | 3300006931 | Bacteria | 12866 |
| 325 | Ga0097620_100016446 | 3300006931 | Bacteria | 7430 |
| 326 | Ga0097620_100025879 | 3300006931 | Bacteria | 5887 |
| 327 | Ga0097620_100109334 | 3300006931 | Bacteria | 2826 |
| 328 | Ga0097620_100123094 | 3300006931 | Bacteria | 2661 |
| 329 | Ga0097620_100159817 | 3300006931 | Bacteria | 2332 |
| 330 | Ga0079104_1000205 | 3300006946 | Bacteria | 82673 |
| 331 | Ga0079104_1000609 | 3300006946 | Bacteria | 35243 |
| 332 | Ga0079104_1001874 | 3300006946 | Bacteria | 12740 |
| 333 | Ga0079104_1024481 | 3300006946 | Bacteria | 1589 |
| 334 | Ga0075435_100026548 | 3300007076 | Bacteria | 4520 |
| 335 | Ga0105251_10000008 | 3300009011 | Bacteria | 213669 |
| 336 | Ga0105251_10001647 | 3300009011 | Bacteria | 18903 |
| 337 | Ga0105251_10003617 | 3300009011 | Bacteria | 11114 |
| 338 | Ga0105251_10059009 | 3300009011 | Bacteria | 1811 |
| 339 | Ga0105244_10000037 | 3300009036 | Bacteria | 161621 |
| 340 | Ga0105244_10001078 | 3300009036 | Bacteria | 22727 |
| 341 | Ga0105244_10004885 | 3300009036 | Bacteria | 9083 |
| 342 | Ga0105244_10005575 | 3300009036 | Bacteria | 8328 |
| 343 | Ga0105244_10006665 | 3300009036 | Bacteria | 7434 |
| 344 | Ga0105244_10051119 | 3300009036 | Bacteria | 2106 |
| 345 | Ga0105250_10000088 | 3300009092 | Bacteria | 80904 |
| 346 | Ga0105250_10008534 | 3300009092 | Bacteria | 4345 |
| 347 | Ga0105250_10011325 | 3300009092 | Bacteria | 3700 |
| 348 | Ga0105240_10000222 | 3300009093 | Bacteria | 113825 |
| 349 | Ga0105240_10000278 | 3300009093 | Bacteria | 101540 |
| 350 | Ga0105240_10001873 | 3300009093 | Bacteria | 34963 |
| 351 | Ga0105240_10009924 | 3300009093 | Bacteria | 13426 |
| 352 | Ga0105240_10013307 | 3300009093 | Bacteria | 11309 |
| 353 | Ga0105240_10024462 | 3300009093 | Bacteria | 7957 |
| 354 | Ga0105240_10107270 | 3300009093 | Bacteria | 3387 |
| 355 | Ga0105240_10282393 | 3300009093 | Bacteria | 1907 |
| 356 | Ga0105240_10396954 | 3300009093 | Bacteria | 1554 |
| 357 | Ga0111539_10002000 | 3300009094 | Bacteria | 27198 |
| 358 | Ga0111539_10234427 | 3300009094 | Bacteria | 2137 |
| 359 | Ga0105245_10017670 | 3300009098 | Bacteria | 6225 |
| 360 | Ga0105245_10091060 | 3300009098 | Bacteria | 2806 |
| 361 | Ga0105245_10096504 | 3300009098 | Bacteria | 2728 |
| 362 | Ga0105247_10008991 | 3300009101 | Bacteria | 6086 |
| 363 | Ga0105247_10010617 | 3300009101 | Bacteria | 5562 |
| 364 | Ga0105247_10037292 | 3300009101 | Bacteria | 2966 |
| 365 | Ga0105243_10000184 | 3300009148 | Bacteria | 72611 |
| 366 | Ga0105243_10049156 | 3300009148 | Bacteria | 3326 |
| 367 | Ga0105243_10099274 | 3300009148 | Bacteria | 2413 |
| 368 | Ga0105243_10130061 | 3300009148 | Bacteria | 2135 |
| 369 | Ga0105241_10086549 | 3300009174 | Bacteria | 2465 |
| 370 | Ga0105241_10291453 | 3300009174 | Bacteria | 1397 |
| 371 | Ga0105242_10005891 | 3300009176 | Bacteria | 9450 |
| 372 | Ga0105242_10024858 | 3300009176 | Bacteria | 4734 |
| 373 | Ga0105242_10370020 | 3300009176 | Bacteria | 1329 |
| 374 | Ga0105248_10009030 | 3300009177 | Bacteria | 10965 |
| 375 | Ga0105248_10032391 | 3300009177 | Bacteria | 5841 |
| 376 | Ga0105248_10039423 | 3300009177 | Bacteria | 5290 |
| 377 | Ga0105248_10072968 | 3300009177 | Bacteria | 3857 |
| 378 | Ga0105248_10080310 | 3300009177 | Bacteria | 3665 |
| 379 | Ga0105248_10139302 | 3300009177 | Bacteria | 2737 |
| 380 | Ga0105248_10416741 | 3300009177 | Bacteria | 1512 |
| 381 | Ga0105248_10528633 | 3300009177 | Bacteria | 1330 |
| 382 | Ga0105237_10000277 | 3300009545 | Bacteria | 71828 |
| 383 | Ga0105237_10000328 | 3300009545 | Bacteria | 66981 |
| 384 | Ga0105237_10001925 | 3300009545 | Bacteria | 26498 |
| 385 | Ga0105237_10003357 | 3300009545 | Bacteria | 19066 |
| 386 | Ga0105237_10045750 | 3300009545 | Bacteria | 4403 |
| 387 | Ga0105237_10046135 | 3300009545 | Bacteria | 4384 |
| 388 | Ga0105237_10078992 | 3300009545 | Bacteria | 3280 |
| 389 | Ga0105237_10125353 | 3300009545 | Bacteria | 2563 |
| 390 | Ga0105237_10329753 | 3300009545 | Bacteria | 1530 |
| 391 | Ga0105237_10409426 | 3300009545 | Bacteria | 1361 |
| 392 | Ga0105238_10078371 | 3300009551 | Bacteria | 3294 |
| 393 | Ga0105238_10249629 | 3300009551 | Bacteria | 1752 |
| 394 | Ga0105238_10288025 | 3300009551 | Bacteria | 1624 |
| 395 | Ga0105238_10288474 | 3300009551 | Bacteria | 1623 |
| 396 | Ga0105238_10302791 | 3300009551 | Bacteria | 1582 |
| 397 | Ga0105238_10350279 | 3300009551 | Bacteria | 1466 |
| 398 | Ga0105238_10729561 | 3300009551 | Bacteria | 1004 |
| 399 | Ga0105249_10004739 | 3300009553 | Bacteria | 11740 |
| 400 | Ga0123341_1000005 | 3300009765 | Bacteria | 150422 |
| 401 | Ga0123342_1019923 | 3300009766 | Bacteria | 5008 |
| 402 | Ga0105239_10000433 | 3300010375 | Bacteria | 61072 |
| 403 | Ga0105239_10001783 | 3300010375 | Bacteria | 28310 |
| 404 | Ga0105239_10003475 | 3300010375 | Bacteria | 19275 |
| 405 | Ga0105239_10039674 | 3300010375 | Bacteria | 5158 |
| 406 | Ga0105239_10082341 | 3300010375 | Bacteria | 3543 |
| 407 | Ga0105239_10152204 | 3300010375 | Bacteria | 2582 |
| 408 | Ga0105239_10278197 | 3300010375 | Bacteria | 1884 |
| 409 | Ga0105239_10500927 | 3300010375 | Bacteria | 1381 |
| 410 | Ga0105239_10662342 | 3300010375 | Bacteria | 1192 |
| 411 | Ga0105246_10011352 | 3300011119 | Bacteria | 5530 |
| 412 | Ga0105246_10011744 | 3300011119 | Bacteria | 5443 |
| 413 | Ga0105246_10111152 | 3300011119 | Bacteria | 2013 |
| 414 | Ga0157326_1003400 | 3300012513 | Bacteria | 1677 |
| 415 | Ga0157373_10001122 | 3300013100 | Bacteria | 20561 |
| 416 | Ga0157373_10001155 | 3300013100 | Bacteria | 20224 |
| 417 | Ga0157373_10001724 | 3300013100 | Bacteria | 16611 |
| 418 | Ga0157373_10002821 | 3300013100 | Bacteria | 13144 |
| 419 | Ga0157373_10054688 | 3300013100 | Bacteria | 2836 |
| 420 | Ga0157373_10087440 | 3300013100 | Bacteria | 2196 |
| 421 | Ga0157373_10208343 | 3300013100 | Bacteria | 1378 |
| 422 | Ga0157371_10000028 | 3300013102 | Bacteria | 254964 |
| 423 | Ga0157371_10000136 | 3300013102 | Bacteria | 107554 |
| 424 | Ga0157371_10012605 | 3300013102 | Bacteria | 6453 |
| 425 | Ga0157371_10022871 | 3300013102 | Bacteria | 4573 |
| 426 | Ga0157371_10031350 | 3300013102 | Bacteria | 3830 |
| 427 | Ga0157371_10065925 | 3300013102 | Bacteria | 2565 |
| 428 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 429 | Ga0157370_10000012 | 3300013104 | Bacteria | 201181 |
| 430 | Ga0157370_10000065 | 3300013104 | Bacteria | 113986 |
| 431 | Ga0157370_10001488 | 3300013104 | Bacteria | 29012 |
| 432 | Ga0157370_10002472 | 3300013104 | Bacteria | 22293 |
| 433 | Ga0157370_10013674 | 3300013104 | Bacteria | 8345 |
| 434 | Ga0157370_10039973 | 3300013104 | Bacteria | 4531 |
| 435 | Ga0157370_10043957 | 3300013104 | Bacteria | 4297 |
| 436 | Ga0157369_10000112 | 3300013105 | Bacteria | 114309 |
| 437 | Ga0157369_10001129 | 3300013105 | Bacteria | 33383 |
| 438 | Ga0157369_10002704 | 3300013105 | Bacteria | 21151 |
| 439 | Ga0157369_10008371 | 3300013105 | Bacteria | 11862 |
| 440 | Ga0157369_10053573 | 3300013105 | Bacteria | 4359 |
| 441 | Ga0157369_10198865 | 3300013105 | Bacteria | 2104 |
| 442 | Ga0157369_10485037 | 3300013105 | Bacteria | 1279 |
| 443 | Ga0157374_10003851 | 3300013296 | Bacteria | 12605 |
| 444 | Ga0157374_10092371 | 3300013296 | Bacteria | 2888 |
| 445 | Ga0157374_10251726 | 3300013296 | Bacteria | 1738 |
| 446 | Ga0157374_10332842 | 3300013296 | Bacteria | 1506 |
| 447 | Ga0157378_10535330 | 3300013297 | Bacteria | 1175 |
| 448 | Ga0163162_10160782 | 3300013306 | Bacteria | 2368 |
| 449 | Ga0163162_10171655 | 3300013306 | Bacteria | 2293 |
| 450 | Ga0163162_10181482 | 3300013306 | Bacteria | 2231 |
| 451 | Ga0157372_10000065 | 3300013307 | Bacteria | 114576 |
| 452 | Ga0157372_10000111 | 3300013307 | Bacteria | 86033 |
| 453 | Ga0157372_10163541 | 3300013307 | Bacteria | 2573 |
| 454 | Ga0157372_10389054 | 3300013307 | Bacteria | 1625 |
| 455 | Ga0157372_10512127 | 3300013307 | Bacteria | 1399 |
| 456 | Ga0157375_10005611 | 3300013308 | Bacteria | 10923 |
| 457 | Ga0157375_10008229 | 3300013308 | Bacteria | 9128 |
| 458 | Ga0157375_10028115 | 3300013308 | Bacteria | 5265 |
| 459 | Ga0157375_10416522 | 3300013308 | Bacteria | 1510 |
| 460 | Ga0163163_10003284 | 3300014325 | Bacteria | 13715 |
| 461 | Ga0163163_10012102 | 3300014325 | Bacteria | 7851 |
| 462 | Ga0163163_10338360 | 3300014325 | Bacteria | 1560 |
| 463 | Ga0182008_10001051 | 3300014497 | Bacteria | 19128 |
| 464 | Ga0182008_10021760 | 3300014497 | Bacteria | 3292 |
| 465 | Ga0182008_10054838 | 3300014497 | Bacteria | 1972 |
| 466 | Ga0157377_10023260 | 3300014745 | Bacteria | 3283 |
| 467 | Ga0157379_10024669 | 3300014968 | Bacteria | 5337 |
| 468 | Ga0157379_10071375 | 3300014968 | Bacteria | 3106 |
| 469 | Ga0157379_10078214 | 3300014968 | Bacteria | 2962 |
| 470 | Ga0157379_10079534 | 3300014968 | Bacteria | 2935 |
| 471 | Ga0157379_10139074 | 3300014968 | Bacteria | 2189 |
| 472 | Ga0157379_10226704 | 3300014968 | Bacteria | 1694 |
| 473 | Ga0157376_10008577 | 3300014969 | Bacteria | 7384 |
| 474 | Ga0157376_10083407 | 3300014969 | Bacteria | 2749 |
| 475 | Ga0182006_1000051 | 3300015261 | Bacteria | 183089 |
| 476 | Ga0182006_1000119 | 3300015261 | Bacteria | 85008 |
| 477 | Ga0182006_1000611 | 3300015261 | Bacteria | 25791 |
| 478 | Ga0182006_1016700 | 3300015261 | Bacteria | 3129 |
| 479 | Ga0182006_1030442 | 3300015261 | Bacteria | 2181 |
| 480 | Ga0182007_10001225 | 3300015262 | Bacteria | 13942 |
| 481 | Ga0182007_10001987 | 3300015262 | Bacteria | 10551 |
| 482 | Ga0182005_1000044 | 3300015265 | Bacteria | 139973 |
| 483 | Ga0182005_1000540 | 3300015265 | Bacteria | 19079 |
| 484 | Ga0182005_1001006 | 3300015265 | Bacteria | 12081 |
| 485 | Ga0182005_1002324 | 3300015265 | Bacteria | 6895 |
| 486 | Ga0182005_1004016 | 3300015265 | Bacteria | 4834 |
| 487 | Ga0182005_1048282 | 3300015265 | Bacteria | 1157 |
| 488 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 489 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 490 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 491 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 492 | Ga0163161_10011734 | 3300017792 | Bacteria | 6077 |
| 493 | Ga0206356_10524477 | 3300020070 | Bacteria | 1609 |
| 494 | Ga0206356_11211633 | 3300020070 | Bacteria | 1588 |
| 495 | Ga0206351_10620367 | 3300020077 | Bacteria | 2763 |
| 496 | Ga0206352_10987329 | 3300020078 | Bacteria | 948 |
| 497 | Ga0206354_10057609 | 3300020081 | Bacteria | 3122 |
| 498 | Ga0206353_10393390 | 3300020082 | Bacteria | 1538 |
| 499 | Ga0206353_11351368 | 3300020082 | Bacteria | 3420 |
| 500 | Ga0154015_1386076 | 3300020610 | Bacteria | 1745 |
| 501 | Ga0154015_1629196 | 3300020610 | Bacteria | 6102 |
| 502 | Ga0213872_10009653 | 3300021361 | Bacteria | 4620 |
| 503 | Ga0213872_10032113 | 3300021361 | Bacteria | 2406 |
| 504 | Ga0213872_10048402 | 3300021361 | Bacteria | 1932 |
| 505 | Ga0213874_10053187 | 3300021377 | Bacteria | 1249 |
| 506 | Ga0213876_10001656 | 3300021384 | Bacteria | 13590 |
| 507 | Ga0213876_10019582 | 3300021384 | Bacteria | 3575 |
| 508 | Ga0213875_10002535 | 3300021388 | Bacteria | 10896 |
| 509 | Ga0213875_10075069 | 3300021388 | Bacteria | 1577 |
| 510 | Ga0213871_10030872 | 3300021441 | Bacteria | 1396 |
| 511 | Ga0228598_1000515 | 3300024227 | Bacteria | 8034 |
| 512 | Ga0209436_102863 | 3300025208 | Bacteria | 4882 |
| 513 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 514 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 515 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 516 | Ga0209674_101757 | 3300025226 | Bacteria | 5261 |
| 517 | Ga0209672_100030 | 3300025228 | Bacteria | 337051 |
| 518 | Ga0209672_100040 | 3300025228 | Bacteria | 278858 |
| 519 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 520 | Ga0209672_100068 | 3300025228 | Bacteria | 175572 |
| 521 | Ga0209672_100457 | 3300025228 | Bacteria | 23137 |
| 522 | Ga0209672_102427 | 3300025228 | Bacteria | 4590 |
| 523 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 524 | Ga0209147_100036 | 3300025229 | Bacteria | 337052 |
| 525 | Ga0209147_100048 | 3300025229 | Bacteria | 278858 |
| 526 | Ga0209147_100074 | 3300025229 | Bacteria | 208743 |
| 527 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 528 | Ga0209563_105425 | 3300025230 | Bacteria | 2314 |
| 529 | Ga0207427_100081 | 3300025231 | Bacteria | 144588 |
| 530 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 531 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 532 | Ga0209437_100168 | 3300025233 | Bacteria | 144520 |
| 533 | Ga0209437_100261 | 3300025233 | Bacteria | 82127 |
| 534 | Ga0209437_102301 | 3300025233 | Bacteria | 3752 |
| 535 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 536 | Ga0209258_100056 | 3300025242 | Bacteria | 337051 |
| 537 | Ga0209258_100070 | 3300025242 | Bacteria | 278858 |
| 538 | Ga0209258_100149 | 3300025242 | Bacteria | 162184 |
| 539 | Ga0209258_100164 | 3300025242 | Bacteria | 148838 |
| 540 | Ga0207425_1000741 | 3300025245 | Bacteria | 17115 |
| 541 | Ga0207425_1000744 | 3300025245 | Bacteria | 17015 |
| 542 | Ga0207425_1009765 | 3300025245 | Bacteria | 2370 |
| 543 | Ga0209646_1000077 | 3300025246 | Bacteria | 208262 |
| 544 | Ga0209646_1001239 | 3300025246 | Bacteria | 7264 |
| 545 | Ga0209026_1000231 | 3300025250 | Bacteria | 75789 |
| 546 | Ga0209026_1012581 | 3300025250 | Bacteria | 1469 |
| 547 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 548 | Ga0209677_100267 | 3300025253 | Bacteria | 35499 |
| 549 | Ga0209677_105646 | 3300025253 | Bacteria | 3204 |
| 550 | Ga0209148_1000037 | 3300025254 | Bacteria | 494767 |
| 551 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 552 | Ga0209148_1000143 | 3300025254 | Bacteria | 162184 |
| 553 | Ga0209148_1000178 | 3300025254 | Bacteria | 126383 |
| 554 | Ga0209148_1000461 | 3300025254 | Bacteria | 43728 |
| 555 | Ga0209148_1003235 | 3300025254 | Bacteria | 4633 |
| 556 | Ga0209148_1009411 | 3300025254 | Bacteria | 1903 |
| 557 | Ga0209759_1000249 | 3300025256 | Bacteria | 80341 |
| 558 | Ga0209759_1001303 | 3300025256 | Bacteria | 14731 |
| 559 | Ga0209759_1009524 | 3300025256 | Bacteria | 2931 |
| 560 | Ga0209759_1013780 | 3300025256 | Bacteria | 2170 |
| 561 | Ga0209759_1023371 | 3300025256 | Bacteria | 1362 |
| 562 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 563 | Ga0209129_1000594 | 3300025258 | Bacteria | 24717 |
| 564 | Ga0209129_1004157 | 3300025258 | Bacteria | 5846 |
| 565 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 566 | Ga0209233_1000151 | 3300025261 | Bacteria | 176515 |
| 567 | Ga0209233_1000166 | 3300025261 | Bacteria | 152270 |
| 568 | Ga0209233_1000342 | 3300025261 | Bacteria | 45690 |
| 569 | Ga0209233_1000350 | 3300025261 | Bacteria | 43454 |
| 570 | Ga0209565_1000216 | 3300025263 | Bacteria | 65734 |
| 571 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 572 | Ga0209455_1000036 | 3300025272 | Bacteria | 473309 |
| 573 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 574 | Ga0209455_1000061 | 3300025272 | Bacteria | 337052 |
| 575 | Ga0209455_1000525 | 3300025272 | Bacteria | 27101 |
| 576 | Ga0209673_1000020 | 3300025273 | Bacteria | 430653 |
| 577 | Ga0209673_1000046 | 3300025273 | Bacteria | 289907 |
| 578 | Ga0209673_1000601 | 3300025273 | Bacteria | 55798 |
| 579 | Ga0209673_1000607 | 3300025273 | Bacteria | 55095 |
| 580 | Ga0209673_1001959 | 3300025273 | Bacteria | 16130 |
| 581 | Ga0209673_1002904 | 3300025273 | Bacteria | 10837 |
| 582 | Ga0209673_1004592 | 3300025273 | Bacteria | 7322 |
| 583 | Ga0209673_1005542 | 3300025273 | Bacteria | 6317 |
| 584 | Ga0209673_1020631 | 3300025273 | Bacteria | 2328 |
| 585 | Ga0209130_1000048 | 3300025284 | Bacteria | 233357 |
| 586 | Ga0209130_1000272 | 3300025284 | Bacteria | 64696 |
| 587 | Ga0209675_1000299 | 3300025291 | Bacteria | 45723 |
| 588 | Ga0209675_1002721 | 3300025291 | Bacteria | 8852 |
| 589 | Ga0209675_1026365 | 3300025291 | Bacteria | 1447 |
| 590 | Ga0209676_1004206 | 3300025292 | Bacteria | 8151 |
| 591 | Ga0209676_1039233 | 3300025292 | Bacteria | 1348 |
| 592 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 593 | Ga0209025_1000081 | 3300025294 | Bacteria | 265899 |
| 594 | Ga0209025_1000589 | 3300025294 | Bacteria | 65607 |
| 595 | Ga0209025_1001900 | 3300025294 | Bacteria | 24371 |
| 596 | Ga0209025_1011450 | 3300025294 | Bacteria | 5840 |
| 597 | Ga0209025_1013547 | 3300025294 | Bacteria | 5112 |
| 598 | Ga0209025_1016446 | 3300025294 | Bacteria | 4362 |
| 599 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 600 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 601 | Ga0209564_1000205 | 3300025295 | Bacteria | 135901 |
| 602 | Ga0209564_1000491 | 3300025295 | Bacteria | 65596 |
| 603 | Ga0209564_1000621 | 3300025295 | Bacteria | 54266 |
| 604 | Ga0209564_1001753 | 3300025295 | Bacteria | 20252 |
| 605 | Ga0209564_1001883 | 3300025295 | Bacteria | 18887 |
| 606 | Ga0209564_1006715 | 3300025295 | Bacteria | 6114 |
| 607 | Ga0209564_1013709 | 3300025295 | Bacteria | 3420 |
| 608 | Ga0209564_1023211 | 3300025295 | Bacteria | 2164 |
| 609 | Ga0209758_1000076 | 3300025297 | Bacteria | 270615 |
| 610 | Ga0209758_1000196 | 3300025297 | Bacteria | 133816 |
| 611 | Ga0209758_1003911 | 3300025297 | Bacteria | 12998 |
| 612 | Ga0209758_1004142 | 3300025297 | Bacteria | 12369 |
| 613 | Ga0209050_1003396 | 3300025298 | Bacteria | 11810 |
| 614 | Ga0209050_1021437 | 3300025298 | Bacteria | 2355 |
| 615 | Ga0209256_1000500 | 3300025299 | Bacteria | 57552 |
| 616 | Ga0209256_1000519 | 3300025299 | Bacteria | 56383 |
| 617 | Ga0209256_1002281 | 3300025299 | Bacteria | 16192 |
| 618 | Ga0209256_1005384 | 3300025299 | Bacteria | 7410 |
| 619 | Ga0209256_1006453 | 3300025299 | Bacteria | 6193 |
| 620 | Ga0209256_1014665 | 3300025299 | Bacteria | 2798 |
| 621 | Ga0209256_1018442 | 3300025299 | Bacteria | 2266 |
| 622 | Ga0209256_1028334 | 3300025299 | Bacteria | 1581 |
| 623 | Ga0207426_1000136 | 3300025302 | Bacteria | 201401 |
| 624 | Ga0207426_1000169 | 3300025302 | Bacteria | 164859 |
| 625 | Ga0207426_1000411 | 3300025302 | Bacteria | 71437 |
| 626 | Ga0207426_1001232 | 3300025302 | Bacteria | 22539 |
| 627 | Ga0209051_1001518 | 3300025303 | Bacteria | 19346 |
| 628 | Ga0209051_1032555 | 3300025303 | Bacteria | 1986 |
| 629 | Ga0207697_10073428 | 3300025315 | Bacteria | 1436 |
| 630 | Ga0207696_1000091 | 3300025711 | Bacteria | 187999 |
| 631 | Ga0207696_1007458 | 3300025711 | Bacteria | 4277 |
| 632 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 633 | Ga0207655_1000009 | 3300025728 | Bacteria | 664676 |
| 634 | Ga0207655_1000117 | 3300025728 | Bacteria | 161655 |
| 635 | Ga0207655_1000288 | 3300025728 | Bacteria | 76899 |
| 636 | Ga0207655_1000491 | 3300025728 | Bacteria | 50932 |
| 637 | Ga0207655_1000593 | 3300025728 | Bacteria | 44462 |
| 638 | Ga0207655_1000875 | 3300025728 | Bacteria | 31869 |
| 639 | Ga0207655_1038253 | 3300025728 | Bacteria | 2100 |
| 640 | Ga0207713_1000029 | 3300025735 | Bacteria | 285054 |
| 641 | Ga0207713_1006528 | 3300025735 | Bacteria | 7086 |
| 642 | Ga0207713_1025050 | 3300025735 | Bacteria | 2764 |
| 643 | Ga0207642_10026900 | 3300025899 | Bacteria | 2348 |
| 644 | Ga0207710_10000159 | 3300025900 | Bacteria | 71625 |
| 645 | Ga0207710_10004228 | 3300025900 | Bacteria | 6293 |
| 646 | Ga0207710_10069152 | 3300025900 | Bacteria | 1616 |
| 647 | Ga0207688_10015030 | 3300025901 | Bacteria | 4199 |
| 648 | Ga0207680_10031100 | 3300025903 | Bacteria | 3020 |
| 649 | Ga0207680_10114982 | 3300025903 | Bacteria | 1752 |
| 650 | Ga0207647_10005785 | 3300025904 | Bacteria | 9020 |
| 651 | Ga0207647_10099775 | 3300025904 | Bacteria | 1724 |
| 652 | Ga0207647_10105563 | 3300025904 | Bacteria | 1669 |
| 653 | Ga0207647_10116561 | 3300025904 | Bacteria | 1577 |
| 654 | Ga0207699_10000070 | 3300025906 | Bacteria | 82065 |
| 655 | Ga0207699_10014816 | 3300025906 | Bacteria | 4034 |
| 656 | Ga0207645_10099111 | 3300025907 | Bacteria | 1879 |
| 657 | Ga0207705_10000204 | 3300025909 | Bacteria | 59946 |
| 658 | Ga0207705_10249539 | 3300025909 | Bacteria | 1353 |
| 659 | Ga0207654_10040827 | 3300025911 | Bacteria | 2616 |
| 660 | Ga0207707_10000182 | 3300025912 | Bacteria | 65800 |
| 661 | Ga0207707_10001174 | 3300025912 | Bacteria | 24646 |
| 662 | Ga0207707_10001390 | 3300025912 | Bacteria | 22487 |
| 663 | Ga0207707_10031843 | 3300025912 | Bacteria | 4616 |
| 664 | Ga0207707_10071776 | 3300025912 | Bacteria | 3018 |
| 665 | Ga0207707_10131076 | 3300025912 | Bacteria | 2193 |
| 666 | Ga0207707_10276102 | 3300025912 | Bacteria | 1456 |
| 667 | Ga0207707_10286976 | 3300025912 | Bacteria | 1424 |
| 668 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 669 | Ga0207695_10000171 | 3300025913 | Bacteria | 191448 |
| 670 | Ga0207695_10000376 | 3300025913 | Bacteria | 101548 |
| 671 | Ga0207695_10001369 | 3300025913 | Bacteria | 41341 |
| 672 | Ga0207695_10001956 | 3300025913 | Bacteria | 31955 |
| 673 | Ga0207695_10013742 | 3300025913 | Bacteria | 9633 |
| 674 | Ga0207695_10030552 | 3300025913 | Bacteria | 5929 |
| 675 | Ga0207695_10041583 | 3300025913 | Bacteria | 4919 |
| 676 | Ga0207695_10069666 | 3300025913 | Bacteria | 3598 |
| 677 | Ga0207695_10115904 | 3300025913 | Bacteria | 2653 |
| 678 | Ga0207695_10322789 | 3300025913 | Bacteria | 1433 |
| 679 | Ga0207671_10000732 | 3300025914 | Bacteria | 41620 |
| 680 | Ga0207671_10001785 | 3300025914 | Bacteria | 24118 |
| 681 | Ga0207671_10004719 | 3300025914 | Bacteria | 12877 |
| 682 | Ga0207671_10006622 | 3300025914 | Bacteria | 10276 |
| 683 | Ga0207671_10140872 | 3300025914 | Bacteria | 1858 |
| 684 | Ga0207671_10261685 | 3300025914 | Bacteria | 1361 |
| 685 | Ga0207693_10000102 | 3300025915 | Bacteria | 76687 |
| 686 | Ga0207693_10001497 | 3300025915 | Bacteria | 20622 |
| 687 | Ga0207693_10052430 | 3300025915 | Bacteria | 3200 |
| 688 | Ga0207693_10172131 | 3300025915 | Bacteria | 1705 |
| 689 | Ga0207663_10006827 | 3300025916 | Bacteria | 5875 |
| 690 | Ga0207663_10040563 | 3300025916 | Bacteria | 2831 |
| 691 | Ga0207660_10000587 | 3300025917 | Bacteria | 24526 |
| 692 | Ga0207660_10006169 | 3300025917 | Bacteria | 7783 |
| 693 | Ga0207660_10013602 | 3300025917 | Bacteria | 5335 |
| 694 | Ga0207660_10043962 | 3300025917 | Bacteria | 3141 |
| 695 | Ga0207660_10198352 | 3300025917 | Bacteria | 1566 |
| 696 | Ga0207657_10000110 | 3300025919 | Bacteria | 80294 |
| 697 | Ga0207657_10009002 | 3300025919 | Bacteria | 10083 |
| 698 | Ga0207657_10009421 | 3300025919 | Bacteria | 9815 |
| 699 | Ga0207657_10023144 | 3300025919 | Bacteria | 5791 |
| 700 | Ga0207649_10000044 | 3300025920 | Bacteria | 115741 |
| 701 | Ga0207649_10000070 | 3300025920 | Bacteria | 89018 |
| 702 | Ga0207649_10000074 | 3300025920 | Bacteria | 85018 |
| 703 | Ga0207649_10064494 | 3300025920 | Bacteria | 2316 |
| 704 | Ga0207652_10000161 | 3300025921 | Bacteria | 72715 |
| 705 | Ga0207652_10002347 | 3300025921 | Bacteria | 16024 |
| 706 | Ga0207652_10066294 | 3300025921 | Bacteria | 3129 |
| 707 | Ga0207652_10127717 | 3300025921 | Bacteria | 2266 |
| 708 | Ga0207652_10182322 | 3300025921 | Bacteria | 1887 |
| 709 | Ga0207652_10445574 | 3300025921 | Bacteria | 1167 |
| 710 | Ga0207694_10059529 | 3300025924 | Bacteria | 2971 |
| 711 | Ga0207694_10088854 | 3300025924 | Bacteria | 2436 |
| 712 | Ga0207694_10189488 | 3300025924 | Bacteria | 1670 |
| 713 | Ga0207650_10001503 | 3300025925 | Bacteria | 16688 |
| 714 | Ga0207650_10002042 | 3300025925 | Bacteria | 14130 |
| 715 | Ga0207659_10002302 | 3300025926 | Bacteria | 11378 |
| 716 | Ga0207659_10051136 | 3300025926 | Bacteria | 2938 |
| 717 | Ga0207659_10123986 | 3300025926 | Bacteria | 1984 |
| 718 | Ga0207687_10010250 | 3300025927 | Bacteria | 6122 |
| 719 | Ga0207700_10178472 | 3300025928 | Bacteria | 1776 |
| 720 | Ga0207664_10099261 | 3300025929 | Bacteria | 2402 |
| 721 | Ga0207644_10009521 | 3300025931 | Bacteria | 6383 |
| 722 | Ga0207644_10042431 | 3300025931 | Bacteria | 3224 |
| 723 | Ga0207644_10075266 | 3300025931 | Bacteria | 2480 |
| 724 | Ga0207644_10204362 | 3300025931 | Bacteria | 1559 |
| 725 | Ga0207690_10000016 | 3300025932 | Bacteria | 256657 |
| 726 | Ga0207690_10067965 | 3300025932 | Bacteria | 2446 |
| 727 | Ga0207690_10279055 | 3300025932 | Bacteria | 1301 |
| 728 | Ga0207690_10446273 | 3300025932 | Bacteria | 1039 |
| 729 | Ga0207706_10013496 | 3300025933 | Bacteria | 7424 |
| 730 | Ga0207686_10002966 | 3300025934 | Bacteria | 9147 |
| 731 | Ga0207709_10000466 | 3300025935 | Bacteria | 37282 |
| 732 | Ga0207709_10052065 | 3300025935 | Bacteria | 2512 |
| 733 | Ga0207669_10012678 | 3300025937 | Bacteria | 4154 |
| 734 | Ga0207704_10149773 | 3300025938 | Bacteria | 1645 |
| 735 | Ga0207665_10006300 | 3300025939 | Bacteria | 7868 |
| 736 | Ga0207665_10018609 | 3300025939 | Bacteria | 4564 |
| 737 | Ga0207665_10125320 | 3300025939 | Bacteria | 1818 |
| 738 | Ga0207711_10008496 | 3300025941 | Bacteria | 8591 |
| 739 | Ga0207711_10100310 | 3300025941 | Bacteria | 2561 |
| 740 | Ga0207711_10136445 | 3300025941 | Bacteria | 2204 |
| 741 | Ga0207689_10017003 | 3300025942 | Bacteria | 6154 |
| 742 | Ga0207689_10092095 | 3300025942 | Bacteria | 2490 |
| 743 | Ga0207689_10106981 | 3300025942 | Bacteria | 2298 |
| 744 | Ga0207661_10006389 | 3300025944 | Bacteria | 8336 |
| 745 | Ga0207661_10211282 | 3300025944 | Bacteria | 1710 |
| 746 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 747 | Ga0207679_10000021 | 3300025945 | Bacteria | 221630 |
| 748 | Ga0207679_10076851 | 3300025945 | Bacteria | 2538 |
| 749 | Ga0207679_10105872 | 3300025945 | Bacteria | 2209 |
| 750 | Ga0207679_10163918 | 3300025945 | Bacteria | 1823 |
| 751 | Ga0207679_10283651 | 3300025945 | Bacteria | 1421 |
| 752 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 753 | Ga0207667_10000093 | 3300025949 | Bacteria | 145814 |
| 754 | Ga0207667_10004117 | 3300025949 | Bacteria | 17867 |
| 755 | Ga0207667_10004376 | 3300025949 | Bacteria | 17293 |
| 756 | Ga0207667_10007485 | 3300025949 | Bacteria | 13112 |
| 757 | Ga0207667_10018955 | 3300025949 | Bacteria | 7693 |
| 758 | Ga0207667_10032279 | 3300025949 | Bacteria | 5644 |
| 759 | Ga0207667_10220878 | 3300025949 | Bacteria | 1941 |
| 760 | Ga0207667_10369718 | 3300025949 | Bacteria | 1461 |
| 761 | Ga0207651_10010829 | 3300025960 | Bacteria | 5073 |
| 762 | Ga0207712_10009649 | 3300025961 | Bacteria | 6116 |
| 763 | Ga0207668_10058586 | 3300025972 | Bacteria | 2693 |
| 764 | Ga0207640_10000108 | 3300025981 | Bacteria | 62951 |
| 765 | Ga0207640_10003445 | 3300025981 | Bacteria | 8521 |
| 766 | Ga0207640_10018962 | 3300025981 | Bacteria | 4053 |
| 767 | Ga0207658_10038341 | 3300025986 | Bacteria | 3451 |
| 768 | Ga0207658_10200604 | 3300025986 | Bacteria | 1665 |
| 769 | Ga0207677_10082150 | 3300026023 | Bacteria | 2315 |
| 770 | Ga0207703_10034163 | 3300026035 | Bacteria | 4034 |
| 771 | Ga0207703_10129697 | 3300026035 | Bacteria | 2176 |
| 772 | Ga0207639_10001055 | 3300026041 | Bacteria | 18715 |
| 773 | Ga0207639_10034133 | 3300026041 | Bacteria | 3758 |
| 774 | Ga0207639_10191491 | 3300026041 | Bacteria | 1747 |
| 775 | Ga0207678_10000005 | 3300026067 | Bacteria | 193984 |
| 776 | Ga0207678_10002869 | 3300026067 | Bacteria | 15646 |
| 777 | Ga0207678_10005689 | 3300026067 | Bacteria | 11133 |
| 778 | Ga0207678_10007134 | 3300026067 | Bacteria | 9914 |
| 779 | Ga0207678_10048244 | 3300026067 | Bacteria | 3681 |
| 780 | Ga0207678_10070147 | 3300026067 | Bacteria | 3005 |
| 781 | Ga0207678_10089995 | 3300026067 | Bacteria | 2623 |
| 782 | Ga0207708_10001415 | 3300026075 | Bacteria | 17997 |
| 783 | Ga0207708_10207808 | 3300026075 | Bacteria | 1564 |
| 784 | Ga0207702_10000280 | 3300026078 | Bacteria | 58816 |
| 785 | Ga0207702_10008346 | 3300026078 | Bacteria | 8745 |
| 786 | Ga0207702_10112094 | 3300026078 | Bacteria | 2427 |
| 787 | Ga0207702_10127312 | 3300026078 | Bacteria | 2288 |
| 788 | Ga0207702_10245928 | 3300026078 | Bacteria | 1678 |
| 789 | Ga0207702_10494259 | 3300026078 | Bacteria | 1192 |
| 790 | Ga0207641_10000900 | 3300026088 | Bacteria | 30838 |
| 791 | Ga0207641_10010599 | 3300026088 | Bacteria | 7563 |
| 792 | Ga0207641_10019607 | 3300026088 | Bacteria | 5553 |
| 793 | Ga0207641_10032111 | 3300026088 | Bacteria | 4359 |
| 794 | Ga0207641_10119187 | 3300026088 | Bacteria | 2352 |
| 795 | Ga0207641_10617242 | 3300026088 | Bacteria | 1063 |
| 796 | Ga0207648_10026890 | 3300026089 | Bacteria | 5110 |
| 797 | Ga0207648_10228857 | 3300026089 | Bacteria | 1653 |
| 798 | Ga0207648_10274749 | 3300026089 | Bacteria | 1506 |
| 799 | Ga0207676_10022067 | 3300026095 | Bacteria | 4679 |
| 800 | Ga0207676_10064340 | 3300026095 | Bacteria | 2916 |
| 801 | Ga0207676_10333313 | 3300026095 | Bacteria | 1397 |
| 802 | Ga0207674_10004181 | 3300026116 | Bacteria | 17438 |
| 803 | Ga0207674_10013703 | 3300026116 | Bacteria | 8979 |
| 804 | Ga0207674_10024897 | 3300026116 | Bacteria | 6388 |
| 805 | Ga0207674_10176584 | 3300026116 | Bacteria | 2088 |
| 806 | Ga0207675_100576377 | 3300026118 | Bacteria | 1126 |
| 807 | Ga0207683_10059589 | 3300026121 | Bacteria | 3353 |
| 808 | Ga0207683_10218220 | 3300026121 | Bacteria | 1737 |
| 809 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 810 | Ga0207698_10076498 | 3300026142 | Bacteria | 2679 |
| 811 | Ga0207698_10086585 | 3300026142 | Bacteria | 2548 |
| 812 | Ga0207698_10093242 | 3300026142 | Bacteria | 2472 |
| 813 | Ga0207698_10164919 | 3300026142 | Bacteria | 1943 |
| 814 | Ga0207698_10204609 | 3300026142 | Bacteria | 1771 |
| 815 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 816 | Ga0209281_1000024 | 3300027111 | Bacteria | 499062 |
| 817 | Ga0209281_1000494 | 3300027111 | Bacteria | 53600 |
| 818 | Ga0209281_1000619 | 3300027111 | Bacteria | 39884 |
| 819 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 820 | Ga0209371_1000156 | 3300027312 | Bacteria | 106826 |
| 821 | Ga0209371_1000187 | 3300027312 | Bacteria | 90195 |
| 822 | Ga0209371_1000191 | 3300027312 | Bacteria | 89915 |
| 823 | Ga0209371_1000213 | 3300027312 | Bacteria | 79996 |
| 824 | Ga0209371_1000661 | 3300027312 | Bacteria | 30062 |
| 825 | Ga0209371_1005487 | 3300027312 | Bacteria | 5021 |
| 826 | Ga0209371_1023636 | 3300027312 | Bacteria | 1444 |
| 827 | Ga0207428_10000946 | 3300027907 | Bacteria | 32282 |
| 828 | Ga0268266_10000429 | 3300028379 | Bacteria | 63174 |
| 829 | Ga0268266_10001965 | 3300028379 | Bacteria | 23059 |
| 830 | Ga0268266_10014608 | 3300028379 | Bacteria | 6748 |
| 831 | Ga0268266_10023448 | 3300028379 | Bacteria | 5256 |
| 832 | Ga0268266_10116295 | 3300028379 | Bacteria | 2375 |
| 833 | Ga0268266_10131313 | 3300028379 | Bacteria | 2240 |
| 834 | Ga0268266_10170823 | 3300028379 | Bacteria | 1973 |
| 835 | Ga0268266_10538016 | 3300028379 | Bacteria | 1118 |
| 836 | Ga0268265_10002757 | 3300028380 | Bacteria | 12969 |
| 837 | Ga0268264_10000100 | 3300028381 | Bacteria | 227852 |
| 838 | Ga0268264_10008196 | 3300028381 | Bacteria | 8677 |
| 839 | Ga0268264_10014328 | 3300028381 | Bacteria | 6519 |
| 840 | Ga0268264_10124281 | 3300028381 | Bacteria | 2278 |
| 841 | Ga0268264_10283773 | 3300028381 | Bacteria | 1552 |
| 842 | Ga0265334_10037795 | 3300028573 | Bacteria | 1902 |
| 843 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 844 | Ga0307515_10005985 | 3300028794 | Bacteria | 24500 |
| 845 | Ga0307515_10069225 | 3300028794 | Bacteria | 4829 |
| 846 | Ga0265338_10024738 | 3300028800 | Bacteria | 6123 |
| 847 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 848 | Ga0268256_1000028 | 3300030500 | Bacteria | 433179 |
| 849 | Ga0268256_1000130 | 3300030500 | Bacteria | 106825 |
| 850 | Ga0268256_1000156 | 3300030500 | Bacteria | 90195 |
| 851 | Ga0268256_1000170 | 3300030500 | Bacteria | 79996 |
| 852 | Ga0268256_1005395 | 3300030500 | Bacteria | 5021 |
| 853 | Ga0307511_10028029 | 3300030521 | Bacteria | 5127 |
| 854 | Ga0265770_1002894 | 3300030878 | Bacteria | 2330 |
| 855 | Ga0265760_10020954 | 3300031090 | Bacteria | 1888 |
| 856 | Ga0265330_10007239 | 3300031235 | Bacteria | 5426 |
| 857 | Ga0265330_10007983 | 3300031235 | Bacteria | 5129 |
| 858 | Ga0265329_10039004 | 3300031242 | Bacteria | 1528 |
| 859 | Ga0265340_10003459 | 3300031247 | Bacteria | 8908 |
| 860 | Ga0265340_10008781 | 3300031247 | Bacteria | 5449 |
| 861 | Ga0265339_10003445 | 3300031249 | Bacteria | 11069 |
| 862 | Ga0265331_10005664 | 3300031250 | Bacteria | 7502 |
| 863 | Ga0265327_10021884 | 3300031251 | Bacteria | 3843 |
| 864 | Ga0265327_10082731 | 3300031251 | Bacteria | 1581 |
| 865 | Ga0265316_10031780 | 3300031344 | Bacteria | 4313 |
| 866 | Ga0307513_10325622 | 3300031456 | Bacteria | 1293 |
| 867 | Ga0307509_10427000 | 3300031507 | Bacteria | 1025 |
| 868 | Ga0307408_100028246 | 3300031548 | Bacteria | 3875 |
| 869 | Ga0265313_10126350 | 3300031595 | Bacteria | 1111 |
| 870 | Ga0307514_10006575 | 3300031649 | Bacteria | 10093 |
| 871 | Ga0265342_10021254 | 3300031712 | Bacteria | 4148 |
| 872 | Ga0265342_10030579 | 3300031712 | Bacteria | 3336 |
| 873 | Ga0265342_10033881 | 3300031712 | Bacteria | 3136 |
| 874 | Ga0307516_10001608 | 3300031730 | Bacteria | 31115 |
| 875 | Ga0307406_10005128 | 3300031901 | Bacteria | 7146 |
| 876 | Ga0307406_10120971 | 3300031901 | Bacteria | 1820 |
| 877 | Ga0307412_10000300 | 3300031911 | Bacteria | 31421 |
| 878 | Ga0307411_10390109 | 3300032005 | Bacteria | 1148 |
| 879 | Ga0307510_10057481 | 3300033180 | Bacteria | 4036 |
| 880 | Ga0307510_10166774 | 3300033180 | Bacteria | 1789 |
| 881 | Ga0373939_0023257 | 3300035114 | Bacteria | 1715 |
| 882 | Ga0373953_0007239 | 3300035117 | Bacteria | 3708 |
| 883 | Ga0373943_0081383 | 3300035170 | Bacteria | 1661 |
| 884 | Ga0373931_0020020 | 3300035691 | Bacteria | 3345 |
| 885 | Ga0373927_0177449 | 3300035695 | Bacteria | 1397 |
| 886 | Ga0373947_0244272 | 3300035725 | Bacteria | 1185 |
| 887 | Ga0373925_0130554 | 3300037068 | Bacteria | 1958 |
| 888 | Ga0395899_0020825 | 3300037312 | Bacteria | 4973 |
| 889 | Ga0395899_0049914 | 3300037312 | Bacteria | 3108 |
| 890 | Ga0395899_0063904 | 3300037312 | Bacteria | 2707 |
| 891 | Ga0395900_0021317 | 3300037418 | Bacteria | 6624 |
| 892 | Ga0395900_0023643 | 3300037418 | Bacteria | 6286 |
| 893 | Ga0395900_0095425 | 3300037418 | Unclassified | 3056 |
| 894 | Ga0395900_0102528 | 3300037418 | Bacteria | 2939 |
| 895 | Ga0395898_0000144 | 3300037466 | Bacteria | 187889 |
| 896 | Ga0395898_0017704 | 3300037466 | Bacteria | 7272 |
| 897 | Ga0395898_0021846 | 3300037466 | Bacteria | 6482 |
| 898 | Ga0395898_0028143 | 3300037466 | Bacteria | 5636 |
| 899 | Ga0395898_0088984 | 3300037466 | Bacteria | 2972 |
| 900 | Ga0395898_0242654 | 3300037466 | Bacteria | 1718 |
| 901 | Ga0395905_0002710 | 3300037471 | Bacteria | 19408 |
| 902 | Ga0395905_0049799 | 3300037471 | Unclassified | 3926 |
| 903 | Ga0395905_0236992 | 3300037471 | Bacteria | 1705 |
| 904 | Ga0395905_0286439 | 3300037471 | Bacteria | 1534 |
| 905 | Ga0436364_0044071 | 3300037853 | Bacteria | 12348 |
| 906 | Ga0436364_0081014 | 3300037853 | Bacteria | 7260 |
| 907 | Ga0436364_0139837 | 3300037853 | Bacteria | 1982 |
| 908 | Ga0436364_0333628 | 3300037853 | Bacteria | 1046 |
| 909 | Ga0436364_0542878 | 3300037853 | Bacteria | 12255 |
| 910 | Ga0395901_0004676 | 3300038443 | Bacteria | 13801 |
| 911 | Ga0395901_0033408 | 3300038443 | Bacteria | 5311 |
| 912 | Ga0237819_09536 | 3300038705 | Bacteria | 1297 |
| 913 | Ga0436365_0475170 | 3300039437 | Bacteria | 21720 |
| 914 | Ga0436365_0595564 | 3300039437 | Bacteria | 5724 |
| 915 | Ga0436365_1570145 | 3300039437 | Bacteria | 1503 |
| 916 | Ga0436360_0888954 | 3300039438 | Bacteria | 2253 |
| 917 | Ga0436360_1353135 | 3300039438 | Bacteria | 1729 |
| 918 | Ga0436361_0040126 | 3300039447 | Bacteria | 2515 |
| 919 | Ga0436361_0060388 | 3300039447 | Bacteria | 1629 |
| 920 | Ga0436361_0474832 | 3300039447 | Bacteria | 1047 |
| 921 | Ga0436361_1170673 | 3300039447 | Bacteria | 1497 |
| 922 | Ga0436361_1187256 | 3300039447 | Bacteria | 1331 |
| 923 | Ga0436363_0029129 | 3300039450 | Bacteria | 1461 |
| 924 | Ga0436363_0171997 | 3300039450 | Bacteria | 3001 |
| 925 | Ga0436363_0934761 | 3300039450 | Bacteria | 4848 |
| 926 | Ga0436362_0283733 | 3300039453 | Bacteria | 7161 |
| 927 | Ga0439436_0000001 | 3300041404 | Bacteria | 299341 |
| 928 | Ga0439438_064349 | 3300041405 | Bacteria | 914 |
| 929 | Ga0439466_0045670 | 3300041411 | Bacteria | 1448 |
| 930 | Ga0439465_0007323 | 3300041413 | Bacteria | 3504 |
| 931 | Ga0439465_0058099 | 3300041413 | Bacteria | 1278 |
| 932 | Ga0451793_1206436 | 3300041452 | Bacteria | 1805 |
| 933 | Ga0451839_0853427 | 3300041496 | Bacteria | 2772 |
| 934 | Ga0451841_1419731 | 3300041498 | Bacteria | 915 |
| 935 | Ga0451845_0892693 | 3300041501 | Bacteria | 1810 |
| 936 | Ga0451847_0291915 | 3300041503 | Bacteria | 4019 |
| 937 | Ga0451849_0744664 | 3300041505 | Bacteria | 3344 |
| 938 | Ga0451851_0254806 | 3300041507 | Bacteria | 4020 |
| 939 | Ga0451843_1092677 | 3300041509 | Bacteria | 1384 |
| 940 | Ga0451853_0958912 | 3300041512 | Bacteria | 6230 |
| 941 | Ga0451853_3235739 | 3300041512 | Bacteria | 3934 |
| 942 | Ga0439449_0000965 | 3300042007 | Bacteria | 11289 |
| 943 | Ga0439449_0007872 | 3300042007 | Bacteria | 4047 |
| 944 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 945 | Ga0439452_000248 | 3300042010 | Bacteria | 37260 |
| 946 | Ga0439452_000300 | 3300042010 | Bacteria | 31857 |
| 947 | Ga0439455_0001376 | 3300042012 | Bacteria | 4035 |
| 948 | Ga0439455_0018557 | 3300042012 | Bacteria | 1632 |
| 949 | Ga0439463_005881 | 3300042016 | Bacteria | 3046 |
| 950 | Ga0450899_000439 | 3300042135 | Bacteria | 4636 |
| 951 | Ga0466969_0004763 | 3300044656 | Bacteria | 7222 |
| 952 | Ga0466969_0022928 | 3300044656 | Bacteria | 3218 |
| 953 | Ga0466969_0030124 | 3300044656 | Bacteria | 2766 |
| 954 | Ga0466972_0103632 | 3300044658 | Bacteria | 1346 |
| 955 | Ga0466973_0057243 | 3300044659 | Bacteria | 3556 |
| 956 | Ga0466981_0000002 | 3300044669 | Bacteria | 313036 |
| 957 | Ga0466966_0002610 | 3300044684 | Bacteria | 11817 |
| 958 | Ga0466966_0006513 | 3300044684 | Bacteria | 7725 |
| 959 | Ga0466966_0013288 | 3300044684 | Bacteria | 5451 |
| 960 | Ga0466966_0036335 | 3300044684 | Bacteria | 3180 |
| 961 | Ga0466966_0061811 | 3300044684 | Bacteria | 2362 |
| 962 | Ga0466966_0100568 | 3300044684 | Bacteria | 1788 |
| 963 | Ga0466966_0107924 | 3300044684 | Bacteria | 1717 |
| 964 | Ga0466961_0004115 | 3300044693 | Bacteria | 9079 |
| 965 | Ga0466961_0012941 | 3300044693 | Bacteria | 5336 |
| 966 | Ga0466961_0021366 | 3300044693 | Bacteria | 4166 |
| 967 | Ga0466961_0038093 | 3300044693 | Bacteria | 3084 |
| 968 | Ga0466961_0052262 | 3300044693 | Bacteria | 2607 |
| 969 | Ga0466961_0108367 | 3300044693 | Bacteria | 1748 |
| 970 | Ga0466963_0027613 | 3300044694 | Bacteria | 3636 |
| 971 | Ga0466963_0064461 | 3300044694 | Bacteria | 2455 |
| 972 | Ga0466971_0005973 | 3300044719 | Bacteria | 5298 |
| 973 | Ga0466968_0165840 | 3300044735 | Bacteria | 1021 |
| 974 | Ga0466970_0004814 | 3300044765 | Bacteria | 6668 |
| 975 | Ga0466970_0015119 | 3300044765 | Bacteria | 3969 |
| 976 | Ga0466957_0003433 | 3300044842 | Bacteria | 8695 |
| 977 | Ga0466957_0014643 | 3300044842 | Bacteria | 4570 |
| 978 | Ga0466957_0017015 | 3300044842 | Bacteria | 4254 |
| 979 | Ga0466957_0132513 | 3300044842 | Bacteria | 1598 |
| 980 | Ga0466959_0002415 | 3300045049 | Bacteria | 11927 |
| 981 | Ga0466959_0005606 | 3300045049 | Bacteria | 8630 |
| 982 | Ga0466959_0020051 | 3300045049 | Bacteria | 4921 |
| 983 | Ga0466959_0145881 | 3300045049 | Bacteria | 1670 |
| 984 | Ga0451576_0561399 | 3300045051 | Bacteria | 1199 |
| 985 | Ga0466958_0016651 | 3300045836 | Bacteria | 4236 |
| 986 | Ga0466958_0020405 | 3300045836 | Bacteria | 3863 |
| 987 | Ga0466958_0129906 | 3300045836 | Bacteria | 1581 |
| 988 | Ga0466967_0012429 | 3300045976 | Bacteria | 6511 |
| 989 | Ga0466967_0450077 | 3300045976 | Bacteria | 1258 |
| 990 | Ga0495617_002319 | 3300046452 | Bacteria | 7654 |
| 991 | Ga0495592_0046945 | 3300046454 | Bacteria | 3218 |
| 992 | Ga0495592_0146346 | 3300046454 | Bacteria | 1638 |
| 993 | Ga0495591_000003 | 3300046458 | Bacteria | 449825 |
| 994 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 995 | Ga0495638_0000536 | 3300046460 | Bacteria | 43871 |
| 996 | Ga0495638_0004272 | 3300046460 | Bacteria | 10854 |
| 997 | Ga0495638_0183792 | 3300046460 | Bacteria | 1191 |
| 998 | Ga0495651_0061328 | 3300046462 | Bacteria | 2878 |
| 999 | Ga0495651_0090874 | 3300046462 | Bacteria | 2289 |
| 1000 | Ga0495653_0002018 | 3300046463 | Bacteria | 15971 |
| 1001 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 1002 | Ga0495650_0002581 | 3300046471 | Bacteria | 14275 |
| 1003 | Ga0495580_0046384 | 3300046472 | Bacteria | 3083 |
| 1004 | Ga0495582_0015149 | 3300046473 | Bacteria | 4241 |
| 1005 | Ga0495582_0039683 | 3300046473 | Bacteria | 2592 |
| 1006 | Ga0495605_0018540 | 3300046474 | Bacteria | 3730 |
| 1007 | Ga0495605_0059150 | 3300046474 | Bacteria | 1841 |
| 1008 | Ga0495662_0003706 | 3300046476 | Bacteria | 7700 |
| 1009 | Ga0495662_0028185 | 3300046476 | Bacteria | 2712 |
| 1010 | Ga0495664_0033919 | 3300046477 | Bacteria | 3001 |
| 1011 | Ga0495664_0070603 | 3300046477 | Bacteria | 2086 |
| 1012 | Ga0495584_0132637 | 3300046491 | Bacteria | 1264 |
| 1013 | Ga0495585_0114432 | 3300046492 | Bacteria | 1432 |
| 1014 | Ga0495596_0003174 | 3300046500 | Bacteria | 8466 |
| 1015 | Ga0495607_0000196 | 3300046501 | Bacteria | 63991 |
| 1016 | Ga0495607_0000601 | 3300046501 | Bacteria | 35014 |
| 1017 | Ga0495607_0002888 | 3300046501 | Bacteria | 13568 |
| 1018 | Ga0495607_0035589 | 3300046501 | Bacteria | 3010 |
| 1019 | Ga0495606_0000725 | 3300046507 | Bacteria | 50954 |
| 1020 | Ga0495606_0001436 | 3300046507 | Bacteria | 31966 |
| 1021 | Ga0495606_0006197 | 3300046507 | Bacteria | 11127 |
| 1022 | Ga0495606_0007332 | 3300046507 | Bacteria | 9915 |
| 1023 | Ga0495606_0009875 | 3300046507 | Bacteria | 8001 |
| 1024 | Ga0495606_0106078 | 3300046507 | Bacteria | 1702 |
| 1025 | Ga0495608_0011914 | 3300046511 | Bacteria | 6048 |
| 1026 | Ga0495610_0006875 | 3300046512 | Bacteria | 7710 |
| 1027 | Ga0495610_0012396 | 3300046512 | Bacteria | 5134 |
| 1028 | Ga0495610_0013550 | 3300046512 | Bacteria | 4839 |
| 1029 | Ga0495610_0034453 | 3300046512 | Bacteria | 2607 |
| 1030 | Ga0495610_0090341 | 3300046512 | Bacteria | 1389 |
| 1031 | Ga0495616_0023492 | 3300046513 | Bacteria | 3316 |
| 1032 | Ga0495618_0064279 | 3300046514 | Bacteria | 2331 |
| 1033 | Ga0495620_0000224 | 3300046515 | Bacteria | 42576 |
| 1034 | Ga0495620_0008274 | 3300046515 | Bacteria | 5591 |
| 1035 | Ga0495628_0003636 | 3300046516 | Bacteria | 13766 |
| 1036 | Ga0495628_0014644 | 3300046516 | Bacteria | 6568 |
| 1037 | Ga0495628_0021277 | 3300046516 | Bacteria | 5339 |
| 1038 | Ga0495628_0112163 | 3300046516 | Bacteria | 2096 |
| 1039 | Ga0495630_0126874 | 3300046517 | Bacteria | 1937 |
| 1040 | Ga0495631_0001169 | 3300046518 | Bacteria | 16226 |
| 1041 | Ga0495632_0004284 | 3300046519 | Bacteria | 9742 |
| 1042 | Ga0495632_0046986 | 3300046519 | Bacteria | 2143 |
| 1043 | Ga0495637_0002197 | 3300046520 | Bacteria | 10910 |
| 1044 | Ga0495637_0003672 | 3300046520 | Bacteria | 8126 |
| 1045 | Ga0495637_0095983 | 3300046520 | Bacteria | 1163 |
| 1046 | Ga0495643_0000041 | 3300046522 | Bacteria | 231342 |
| 1047 | Ga0495643_0001110 | 3300046522 | Bacteria | 26795 |
| 1048 | Ga0495643_0039054 | 3300046522 | Bacteria | 2597 |
| 1049 | Ga0495643_0098671 | 3300046522 | Bacteria | 1499 |
| 1050 | Ga0495644_0008900 | 3300046523 | Bacteria | 3861 |
| 1051 | Ga0495644_0079124 | 3300046523 | Bacteria | 1238 |
| 1052 | Ga0495648_0040987 | 3300046524 | Bacteria | 2929 |
| 1053 | Ga0495648_0072599 | 3300046524 | Bacteria | 1991 |
| 1054 | Ga0495652_0021270 | 3300046529 | Bacteria | 5768 |
| 1055 | Ga0495652_0041537 | 3300046529 | Bacteria | 3969 |
| 1056 | Ga0495652_0093283 | 3300046529 | Bacteria | 2458 |
| 1057 | Ga0495652_0193210 | 3300046529 | Bacteria | 1551 |
| 1058 | Ga0495654_0004082 | 3300046530 | Bacteria | 8761 |
| 1059 | Ga0495654_0048912 | 3300046530 | Bacteria | 2073 |
| 1060 | Ga0495665_0073252 | 3300046531 | Bacteria | 1804 |
| 1061 | Ga0495587_0053024 | 3300046536 | Bacteria | 2392 |
| 1062 | Ga0495609_0021536 | 3300046538 | Bacteria | 2974 |
| 1063 | Ga0495609_0040470 | 3300046538 | Bacteria | 2097 |
| 1064 | Ga0495597_0016444 | 3300046542 | Bacteria | 3491 |
| 1065 | Ga0495597_0048353 | 3300046542 | Bacteria | 1882 |
| 1066 | Ga0495622_0028567 | 3300046557 | Bacteria | 2605 |
| 1067 | Ga0495633_0028953 | 3300046558 | Bacteria | 2695 |
| 1068 | Ga0495668_0012255 | 3300046616 | Bacteria | 5090 |
| 1069 | Ga0495611_0000034 | 3300046648 | Bacteria | 103287 |
| 1070 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 1071 | Ga0495625_0102901 | 3300046660 | Bacteria | 1959 |
| 1072 | Ga0495625_0292695 | 3300046660 | Bacteria | 1044 |
| 1073 | Ga0495635_0072330 | 3300046663 | Bacteria | 2363 |
| 1074 | Ga0495661_0001990 | 3300046665 | Bacteria | 16147 |
| 1075 | Ga0495661_0177674 | 3300046665 | Bacteria | 1130 |
| 1076 | Ga0495657_0127482 | 3300046675 | Bacteria | 1597 |
| 1077 | Ga0495599_0003643 | 3300046678 | Bacteria | 9032 |
| 1078 | Ga0495599_0044563 | 3300046678 | Bacteria | 2782 |
| 1079 | Ga0495623_0096483 | 3300046679 | Bacteria | 1806 |
| 1080 | Ga0495646_0005124 | 3300046680 | Bacteria | 8266 |
| 1081 | Ga0495646_0136491 | 3300046680 | Bacteria | 1376 |
| 1082 | Ga0495624_0006209 | 3300046690 | Bacteria | 8493 |
| 1083 | Ga0495670_0000639 | 3300046691 | Bacteria | 16722 |
| 1084 | Ga0495670_0015900 | 3300046691 | Bacteria | 3697 |
| 1085 | Ga0495670_0062638 | 3300046691 | Bacteria | 1872 |
| 1086 | Ga0495671_0031775 | 3300046692 | Bacteria | 2697 |
| 1087 | Ga0495671_0119024 | 3300046692 | Bacteria | 1289 |
| 1088 | Ga0495649_0082527 | 3300046694 | Bacteria | 1718 |
| 1089 | Ga0495589_0000192 | 3300046794 | Bacteria | 53416 |
| 1090 | Ga0495589_0000490 | 3300046794 | Bacteria | 28284 |
| 1091 | Ga0495589_0066227 | 3300046794 | Bacteria | 1769 |
| 1092 | Ga0495600_0002922 | 3300046809 | Bacteria | 9955 |
| 1093 | Ga0495600_0035414 | 3300046809 | Bacteria | 3242 |
| 1094 | Ga0495660_0000011 | 3300046810 | Bacteria | 361397 |
| 1095 | Ga0495660_0000156 | 3300046810 | Bacteria | 74271 |
| 1096 | Ga0495581_0113817 | 3300047315 | Bacteria | 1573 |
| 1097 | Ga0495604_0001772 | 3300047317 | Bacteria | 17617 |
| 1098 | Ga0495604_0005708 | 3300047317 | Bacteria | 9870 |
| 1099 | Ga0495604_0024541 | 3300047317 | Bacteria | 4810 |
| 1100 | Ga0495604_0116601 | 3300047317 | Bacteria | 1938 |
| 1101 | Ga0495636_0072139 | 3300047318 | Bacteria | 1475 |
| 1102 | Ga0495674_0247268 | 3300047319 | Bacteria | 1468 |
| 1103 | Ga0495672_0016603 | 3300047320 | Bacteria | 4954 |
| 1104 | Ga0495672_0077325 | 3300047320 | Bacteria | 1866 |
| 1105 | Ga0495672_0083174 | 3300047320 | Bacteria | 1778 |
| 1106 | Ga0495672_0103863 | 3300047320 | Bacteria | 1536 |
| 1107 | Ga0495676_0100364 | 3300047321 | Bacteria | 2143 |
| 1108 | Ga0495680_0166343 | 3300047322 | Bacteria | 1599 |
| 1109 | Ga0495687_003645 | 3300047443 | Bacteria | 10981 |
| 1110 | Ga0495687_012580 | 3300047443 | Bacteria | 4465 |
| 1111 | Ga0495675_0005488 | 3300047444 | Bacteria | 7737 |
| 1112 | Ga0495675_0015361 | 3300047444 | Bacteria | 4843 |
| 1113 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 1114 | Ga0495679_000830 | 3300047446 | Bacteria | 19679 |
| 1115 | Ga0495679_007769 | 3300047446 | Bacteria | 4430 |
| 1116 | Ga0495673_0000070 | 3300047469 | Bacteria | 217453 |
| 1117 | Ga0495673_0020096 | 3300047469 | Bacteria | 3331 |
| 1118 | Ga0495681_0004774 | 3300047470 | Bacteria | 9180 |
| 1119 | Ga0495686_0001536 | 3300047472 | Bacteria | 24751 |
| 1120 | Ga0495686_0005493 | 3300047472 | Bacteria | 9977 |
| 1121 | Ga0495686_0007185 | 3300047472 | Bacteria | 8384 |
| 1122 | Ga0495686_0009091 | 3300047472 | Bacteria | 7200 |
| 1123 | Ga0495686_0149627 | 3300047472 | Bacteria | 1371 |
| 1124 | Ga0495593_0004348 | 3300047673 | Bacteria | 8431 |
| 1125 | Ga0495602_0039549 | 3300048088 | Bacteria | 4340 |
| 1126 | Ga0495602_0239692 | 3300048088 | Bacteria | 1357 |
| 1127 | Ga0495626_0001268 | 3300048091 | Bacteria | 20659 |
| 1128 | Ga0495626_0020911 | 3300048091 | Bacteria | 3255 |
| 1129 | Ga0496100_0014245 | 3300048903 | Bacteria | 4612 |
| 1130 | Ga0496100_0320638 | 3300048903 | Bacteria | 1164 |
| 1131 | Ga0496100_0411805 | 3300048903 | Bacteria | 1031 |
| 1132 | Ga0496101_0009116 | 3300048904 | Bacteria | 6511 |
| 1133 | Ga0496101_0056526 | 3300048904 | Bacteria | 2837 |
| 1134 | Ga0496101_0194628 | 3300048904 | Bacteria | 1566 |
| 1135 | Ga0496101_0330133 | 3300048904 | Bacteria | 1197 |
| 1136 | Ga0496102_0006737 | 3300048905 | Bacteria | 9814 |
| 1137 | Ga0496102_0016623 | 3300048905 | Bacteria | 6432 |
| 1138 | Ga0496102_0274219 | 3300048905 | Bacteria | 1590 |
| 1139 | Ga0496102_0333118 | 3300048905 | Bacteria | 1429 |
| 1140 | Ga0496102_0386712 | 3300048905 | Bacteria | 1316 |
| 1141 | Ga0496103_0030844 | 3300048906 | Bacteria | 3263 |
| 1142 | Ga0496103_0152998 | 3300048906 | Bacteria | 1478 |
| 1143 | Ga0496103_0206039 | 3300048906 | Bacteria | 1265 |
| 1144 | Ga0496104_0000144 | 3300048907 | Bacteria | 65594 |
| 1145 | Ga0496104_0118725 | 3300048907 | Bacteria | 2539 |
| 1146 | Ga0496104_0282359 | 3300048907 | Bacteria | 1573 |
| 1147 | Ga0496105_0001656 | 3300048908 | Bacteria | 15879 |
| 1148 | Ga0496105_0093583 | 3300048908 | Bacteria | 2482 |
| 1149 | Ga0496105_0220517 | 3300048908 | Bacteria | 1544 |
| 1150 | Ga0496106_0002011 | 3300048909 | Bacteria | 15292 |
| 1151 | Ga0496106_0035516 | 3300048909 | Bacteria | 3727 |
| 1152 | Ga0496107_0117139 | 3300048910 | Bacteria | 1961 |
| 1153 | Ga0496108_0003772 | 3300048911 | Bacteria | 12130 |
| 1154 | Ga0496108_0049839 | 3300048911 | Bacteria | 3503 |
| 1155 | Ga0496108_0076179 | 3300048911 | Bacteria | 2835 |
| 1156 | Ga0496108_0469968 | 3300048911 | Bacteria | 1099 |
| 1157 | Ga0496109_0004165 | 3300048912 | Bacteria | 12074 |
| 1158 | Ga0496109_0364182 | 3300048912 | Bacteria | 1366 |
| 1159 | Ga0496110_0089966 | 3300048913 | Bacteria | 2744 |
| 1160 | Ga0496110_0099908 | 3300048913 | Bacteria | 2600 |
| 1161 | Ga0496110_0256355 | 3300048913 | Bacteria | 1592 |
| 1162 | Ga0496111_0189189 | 3300048914 | Bacteria | 1530 |
| 1163 | Ga0496112_0002096 | 3300048915 | Bacteria | 15835 |
| 1164 | Ga0496112_0099298 | 3300048915 | Bacteria | 2881 |
| 1165 | Ga0496112_0221230 | 3300048915 | Bacteria | 1849 |
| 1166 | Ga0496112_0587969 | 3300048915 | Bacteria | 1045 |
| 1167 | Ga0496113_0096216 | 3300048916 | Bacteria | 2289 |
| 1168 | Ga0496113_0177443 | 3300048916 | Bacteria | 1688 |
| 1169 | Ga0496114_0174910 | 3300048917 | Bacteria | 1873 |
| 1170 | Ga0496115_0009933 | 3300048918 | Bacteria | 7090 |
| 1171 | Ga0496115_0299904 | 3300048918 | Bacteria | 1317 |
| 1172 | Ga0496116_0004768 | 3300048919 | Bacteria | 12795 |
| 1173 | Ga0496116_0029359 | 3300048919 | Bacteria | 3966 |
| 1174 | Ga0496116_0036507 | 3300048919 | Bacteria | 3437 |
| 1175 | Ga0496116_0065446 | 3300048919 | Bacteria | 2332 |
| 1176 | Ga0496116_0068600 | 3300048919 | Bacteria | 2258 |
| 1177 | Ga0496116_0068784 | 3300048919 | Bacteria | 2254 |
| 1178 | Ga0496116_0076471 | 3300048919 | Bacteria | 2096 |
| 1179 | Ga0496116_0078994 | 3300048919 | Bacteria | 2049 |
| 1180 | Ga0496116_0134302 | 3300048919 | Bacteria | 1404 |
| 1181 | Ga0496116_0137098 | 3300048919 | Bacteria | 1383 |
| 1182 | Ga0496117_0000020 | 3300048920 | Bacteria | 458405 |
| 1183 | Ga0496117_0000033 | 3300048920 | Bacteria | 345605 |
| 1184 | Ga0496117_0003961 | 3300048920 | Bacteria | 16741 |
| 1185 | Ga0496117_0008695 | 3300048920 | Bacteria | 9598 |
| 1186 | Ga0496117_0019573 | 3300048920 | Bacteria | 5554 |
| 1187 | Ga0496117_0025946 | 3300048920 | Bacteria | 4594 |
| 1188 | Ga0496117_0058680 | 3300048920 | Bacteria | 2664 |
| 1189 | Ga0496117_0105021 | 3300048920 | Bacteria | 1776 |
| 1190 | Ga0496117_0167852 | 3300048920 | Bacteria | 1277 |
| 1191 | Ga0496118_0000015 | 3300048921 | Bacteria | 551359 |
| 1192 | Ga0496118_0000477 | 3300048921 | Bacteria | 66433 |
| 1193 | Ga0496118_0000594 | 3300048921 | Bacteria | 59894 |
| 1194 | Ga0496118_0002815 | 3300048921 | Bacteria | 22770 |
| 1195 | Ga0496118_0004254 | 3300048921 | Bacteria | 17134 |
| 1196 | Ga0496118_0008241 | 3300048921 | Bacteria | 10810 |
| 1197 | Ga0496118_0008545 | 3300048921 | Bacteria | 10558 |
| 1198 | Ga0496118_0008797 | 3300048921 | Bacteria | 10345 |
| 1199 | Ga0496118_0010211 | 3300048921 | Bacteria | 9322 |
| 1200 | Ga0496118_0070858 | 3300048921 | Bacteria | 2513 |
| 1201 | Ga0496118_0079034 | 3300048921 | Bacteria | 2323 |
| 1202 | Ga0496118_0081909 | 3300048921 | Bacteria | 2263 |
| 1203 | Ga0496118_0145444 | 3300048921 | Bacteria | 1494 |
| 1204 | Ga0496119_0001524 | 3300048922 | Bacteria | 27691 |
| 1205 | Ga0496119_0003299 | 3300048922 | Bacteria | 16859 |
| 1206 | Ga0496119_0013005 | 3300048922 | Bacteria | 6686 |
| 1207 | Ga0496119_0022474 | 3300048922 | Bacteria | 4513 |
| 1208 | Ga0496119_0022836 | 3300048922 | Bacteria | 4460 |
| 1209 | Ga0496119_0063569 | 3300048922 | Bacteria | 2194 |
| 1210 | Ga0496119_0066478 | 3300048922 | Bacteria | 2130 |
| 1211 | Ga0496119_0068500 | 3300048922 | Bacteria | 2089 |
| 1212 | Ga0496119_0085679 | 3300048922 | Bacteria | 1803 |
| 1213 | Ga0496119_0089162 | 3300048922 | Bacteria | 1757 |
| 1214 | Ga0496119_0102933 | 3300048922 | Bacteria | 1600 |
| 1215 | Ga0496119_0105054 | 3300048922 | Bacteria | 1578 |
| 1216 | Ga0496120_0000430 | 3300048923 | Bacteria | 66414 |
| 1217 | Ga0496120_0001435 | 3300048923 | Bacteria | 28631 |
| 1218 | Ga0496120_0003272 | 3300048923 | Bacteria | 14942 |
| 1219 | Ga0496120_0005266 | 3300048923 | Bacteria | 10390 |
| 1220 | Ga0496120_0005908 | 3300048923 | Bacteria | 9547 |
| 1221 | Ga0496120_0005910 | 3300048923 | Bacteria | 9546 |
| 1222 | Ga0496120_0014600 | 3300048923 | Bacteria | 5225 |
| 1223 | Ga0496120_0044448 | 3300048923 | Bacteria | 2580 |
| 1224 | Ga0496120_0051102 | 3300048923 | Bacteria | 2363 |
| 1225 | Ga0496120_0182351 | 3300048923 | Bacteria | 1029 |
| 1226 | Ga0496120_0193235 | 3300048923 | Bacteria | 990 |
| 1227 | Ga0496121_0001223 | 3300048924 | Bacteria | 44700 |
| 1228 | Ga0496121_0002468 | 3300048924 | Bacteria | 28227 |
| 1229 | Ga0496121_0003240 | 3300048924 | Bacteria | 23396 |
| 1230 | Ga0496121_0003417 | 3300048924 | Bacteria | 22706 |
| 1231 | Ga0496121_0005209 | 3300048924 | Bacteria | 16843 |
| 1232 | Ga0496121_0014421 | 3300048924 | Bacteria | 8389 |
| 1233 | Ga0496121_0017345 | 3300048924 | Bacteria | 7363 |
| 1234 | Ga0496121_0018132 | 3300048924 | Bacteria | 7120 |
| 1235 | Ga0496121_0034918 | 3300048924 | Bacteria | 4514 |
| 1236 | Ga0496121_0041049 | 3300048924 | Bacteria | 4050 |
| 1237 | Ga0496121_0098424 | 3300048924 | Bacteria | 2263 |
| 1238 | Ga0496121_0135769 | 3300048924 | Bacteria | 1833 |
| 1239 | Ga0496121_0160543 | 3300048924 | Bacteria | 1644 |
| 1240 | Ga0496121_0253631 | 3300048924 | Bacteria | 1218 |
| 1241 | Ga0496121_0299650 | 3300048924 | Bacteria | 1091 |
| 1242 | Ga0496121_0325250 | 3300048924 | Bacteria | 1034 |
| 1243 | Ga0496122_0000005 | 3300048925 | Bacteria | 630659 |
| 1244 | Ga0496122_0000068 | 3300048925 | Bacteria | 226155 |
| 1245 | Ga0496122_0000944 | 3300048925 | Bacteria | 52790 |
| 1246 | Ga0496122_0002234 | 3300048925 | Bacteria | 28156 |
| 1247 | Ga0496122_0009630 | 3300048925 | Bacteria | 10119 |
| 1248 | Ga0496122_0016703 | 3300048925 | Bacteria | 6919 |
| 1249 | Ga0496122_0020375 | 3300048925 | Bacteria | 5995 |
| 1250 | Ga0496122_0021200 | 3300048925 | Bacteria | 5828 |
| 1251 | Ga0496122_0022004 | 3300048925 | Bacteria | 5681 |
| 1252 | Ga0496122_0089321 | 3300048925 | Bacteria | 2107 |
| 1253 | Ga0496122_0131664 | 3300048925 | Bacteria | 1587 |
| 1254 | Ga0496122_0241207 | 3300048925 | Bacteria | 1019 |
| 1255 | Ga0496123_0000008 | 3300048926 | Bacteria | 630628 |
| 1256 | Ga0496123_0000059 | 3300048926 | Bacteria | 226155 |
| 1257 | Ga0496123_0000735 | 3300048926 | Bacteria | 53174 |
| 1258 | Ga0496123_0002032 | 3300048926 | Bacteria | 26137 |
| 1259 | Ga0496123_0002301 | 3300048926 | Bacteria | 23983 |
| 1260 | Ga0496123_0003605 | 3300048926 | Bacteria | 17157 |
| 1261 | Ga0496123_0004045 | 3300048926 | Bacteria | 15807 |
| 1262 | Ga0496123_0004391 | 3300048926 | Bacteria | 14872 |
| 1263 | Ga0496123_0005469 | 3300048926 | Bacteria | 12781 |
| 1264 | Ga0496123_0015385 | 3300048926 | Bacteria | 6276 |
| 1265 | Ga0496123_0047344 | 3300048926 | Bacteria | 2907 |
| 1266 | Ga0496123_0079939 | 3300048926 | Bacteria | 1995 |
| 1267 | Ga0496123_0124884 | 3300048926 | Bacteria | 1438 |
| 1268 | Ga0496123_0154979 | 3300048926 | Bacteria | 1230 |
| 1269 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 1270 | Ga0496124_0000381 | 3300048927 | Bacteria | 81000 |
| 1271 | Ga0496124_0001882 | 3300048927 | Bacteria | 28891 |
| 1272 | Ga0496124_0002113 | 3300048927 | Bacteria | 26747 |
| 1273 | Ga0496124_0002996 | 3300048927 | Bacteria | 21123 |
| 1274 | Ga0496124_0005469 | 3300048927 | Bacteria | 14276 |
| 1275 | Ga0496124_0025077 | 3300048927 | Bacteria | 5406 |
| 1276 | Ga0496124_0031468 | 3300048927 | Bacteria | 4696 |
| 1277 | Ga0496124_0070719 | 3300048927 | Bacteria | 2894 |
| 1278 | Ga0496124_0084278 | 3300048927 | Bacteria | 2607 |
| 1279 | Ga0496124_0128191 | 3300048927 | Bacteria | 2019 |
| 1280 | Ga0496124_0173315 | 3300048927 | Bacteria | 1668 |
| 1281 | Ga0496124_0189209 | 3300048927 | Bacteria | 1577 |
| 1282 | Ga0496124_0273547 | 3300048927 | Bacteria | 1235 |
| 1283 | Ga0496124_0286367 | 3300048927 | Bacteria | 1198 |
| 1284 | Ga0496125_0001098 | 3300048928 | Bacteria | 41637 |
| 1285 | Ga0496125_0001290 | 3300048928 | Bacteria | 37143 |
| 1286 | Ga0496125_0001825 | 3300048928 | Bacteria | 29428 |
| 1287 | Ga0496125_0002418 | 3300048928 | Bacteria | 24276 |
| 1288 | Ga0496125_0004678 | 3300048928 | Bacteria | 15593 |
| 1289 | Ga0496125_0011643 | 3300048928 | Bacteria | 8781 |
| 1290 | Ga0496125_0013477 | 3300048928 | Bacteria | 8033 |
| 1291 | Ga0496125_0021147 | 3300048928 | Bacteria | 6079 |
| 1292 | Ga0496125_0044375 | 3300048928 | Bacteria | 3760 |
| 1293 | Ga0496125_0048051 | 3300048928 | Bacteria | 3562 |
| 1294 | Ga0496125_0069583 | 3300048928 | Bacteria | 2761 |
| 1295 | Ga0496125_0082957 | 3300048928 | Bacteria | 2441 |
| 1296 | Ga0496125_0092339 | 3300048928 | Bacteria | 2263 |
| 1297 | Ga0496125_0145481 | 3300048928 | Bacteria | 1639 |
| 1298 | Ga0496125_0148636 | 3300048928 | Bacteria | 1614 |
| 1299 | Ga0496125_0192351 | 3300048928 | Bacteria | 1346 |
| 1300 | Ga0496126_0000669 | 3300048929 | Bacteria | 63371 |
| 1301 | Ga0496126_0015558 | 3300048929 | Bacteria | 7645 |
| 1302 | Ga0496126_0016186 | 3300048929 | Bacteria | 7469 |
| 1303 | Ga0496126_0020308 | 3300048929 | Bacteria | 6518 |
| 1304 | Ga0496126_0023623 | 3300048929 | Bacteria | 5956 |
| 1305 | Ga0496126_0106373 | 3300048929 | Bacteria | 2448 |
| 1306 | Ga0496126_0217165 | 3300048929 | Bacteria | 1608 |
| 1307 | Ga0495678_000026 | 3300049459 | Bacteria | 226978 |
| 1308 | Ga0495682_0000004 | 3300049460 | Bacteria | 378337 |
| 1309 | Ga0501032_0184529 | 3300049569 | Bacteria | 1365 |
| 1310 | Ga0501033_0001198 | 3300049570 | Bacteria | 23371 |
| 1311 | Ga0501033_0017974 | 3300049570 | Bacteria | 5339 |
| 1312 | Ga0501033_0040914 | 3300049570 | Bacteria | 3459 |
| 1313 | Ga0501034_0093395 | 3300049571 | Bacteria | 3005 |
| 1314 | Ga0501037_0000077 | 3300049573 | Bacteria | 91081 |
| 1315 | Ga0501037_0119811 | 3300049573 | Bacteria | 1893 |
| 1316 | Ga0501037_0247171 | 3300049573 | Bacteria | 1249 |
| 1317 | Ga0501037_0265846 | 3300049573 | Bacteria | 1198 |
| 1318 | Ga0501037_0285442 | 3300049573 | Bacteria | 1149 |
| 1319 | Ga0501038_0084447 | 3300049574 | Bacteria | 2671 |
| 1320 | Ga0501043_0000114 | 3300049579 | Bacteria | 75782 |
| 1321 | Ga0501043_0009282 | 3300049579 | Bacteria | 7730 |
| 1322 | Ga0501047_0004190 | 3300049581 | Bacteria | 13573 |
| 1323 | Ga0501047_0176606 | 3300049581 | Bacteria | 2003 |
| 1324 | Ga0501047_0321306 | 3300049581 | Bacteria | 1388 |
| 1325 | Ga0501067_0017287 | 3300049583 | Bacteria | 3985 |
| 1326 | Ga0501068_0165285 | 3300049584 | Bacteria | 1396 |
| 1327 | Ga0501069_0000016 | 3300049585 | Bacteria | 142565 |
| 1328 | Ga0501069_0049767 | 3300049585 | Bacteria | 2329 |
| 1329 | Ga0501069_0223125 | 3300049585 | Bacteria | 1096 |
| 1330 | Ga0501070_0000450 | 3300049586 | Bacteria | 37447 |
| 1331 | Ga0501070_0014387 | 3300049586 | Bacteria | 6657 |
| 1332 | Ga0501070_0022723 | 3300049586 | Bacteria | 5251 |
| 1333 | Ga0501070_0078089 | 3300049586 | Bacteria | 2740 |
| 1334 | Ga0501071_0006392 | 3300049587 | Bacteria | 7649 |
| 1335 | Ga0501071_0147504 | 3300049587 | Bacteria | 1754 |
| 1336 | Ga0501072_0231524 | 3300049588 | Bacteria | 1472 |
| 1337 | Ga0501073_0001442 | 3300049589 | Bacteria | 17577 |
| 1338 | Ga0501073_0004199 | 3300049589 | Bacteria | 10800 |
| 1339 | Ga0501073_0039577 | 3300049589 | Bacteria | 3339 |
| 1340 | Ga0501073_0055590 | 3300049589 | Bacteria | 2769 |
| 1341 | Ga0501074_0000067 | 3300049590 | Bacteria | 49686 |
| 1342 | Ga0501074_0000095 | 3300049590 | Bacteria | 42376 |
| 1343 | Ga0501079_0054343 | 3300049741 | Bacteria | 3089 |
| 1344 | Ga0501080_0000250 | 3300049742 | Bacteria | 40604 |
| 1345 | Ga0501080_0000591 | 3300049742 | Bacteria | 28648 |
| 1346 | Ga0501080_0035544 | 3300049742 | Bacteria | 4649 |
| 1347 | Ga0501080_0082904 | 3300049742 | Bacteria | 2979 |
| 1348 | Ga0501083_0000111 | 3300049744 | Bacteria | 55529 |
| 1349 | Ga0501083_0103355 | 3300049744 | Bacteria | 1877 |
| 1350 | Ga0501241_010227 | 3300049758 | Bacteria | 1707 |
| 1351 | Ga0501266_001145 | 3300049763 | Bacteria | 3400 |
| 1352 | Ga0501035_0000048 | 3300049822 | Bacteria | 146466 |
| 1353 | Ga0501035_0001937 | 3300049822 | Bacteria | 20727 |
| 1354 | Ga0501035_0002791 | 3300049822 | Bacteria | 16891 |
| 1355 | Ga0501035_0003776 | 3300049822 | Bacteria | 14433 |
| 1356 | Ga0501035_0188292 | 3300049822 | Bacteria | 1775 |
| 1357 | Ga0501035_0454422 | 3300049822 | Bacteria | 1059 |
| 1358 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 1359 | Ga0501044_0001869 | 3300049823 | Bacteria | 24413 |
| 1360 | Ga0501044_0008702 | 3300049823 | Bacteria | 11108 |
| 1361 | Ga0501044_0027890 | 3300049823 | Bacteria | 5960 |
| 1362 | Ga0501044_0178024 | 3300049823 | Bacteria | 2095 |
| 1363 | Ga0501044_0525652 | 3300049823 | Bacteria | 1082 |
| 1364 | nmdc:mga03n38_109244_c1 | 3300050490 | Bacteria | 1344 |
| 1365 | nmdc:mga03n38_33255_c1 | 3300050490 | Bacteria | 2192 |
| 1366 | nmdc:mga03n38_55514_c1 | 3300050490 | Bacteria | 1785 |
| 1367 | nmdc:mga03n38_65779_c1 | 3300050490 | Bacteria | 1663 |
| 1368 | nmdc:mga00v17_155812_c1 | 3300050491 | Bacteria | 1469 |
| 1369 | nmdc:mga00v17_1594_c1 | 3300050491 | Bacteria | 11845 |
| 1370 | nmdc:mga00v17_213265_c1 | 3300050491 | Bacteria | 1249 |
| 1371 | nmdc:mga00v17_30433_c1 | 3300050491 | Bacteria | 3177 |
| 1372 | nmdc:mga00v17_8_c1 | 3300050491 | Bacteria | 141008 |
| 1373 | nmdc:mga0yw44_153095_c1 | 3300050492 | Bacteria | 1505 |
| 1374 | nmdc:mga0yw44_222463_c1 | 3300050492 | Bacteria | 1251 |
| 1375 | nmdc:mga0yw44_41686_c2 | 3300050492 | Bacteria | 2533 |
| 1376 | nmdc:mga0yw44_54127_c1 | 3300050492 | Bacteria | 2438 |
| 1377 | nmdc:mga0yw44_57872_c1 | 3300050492 | Bacteria | 2366 |
| 1378 | nmdc:mga0yw44_72213_c1 | 3300050492 | Bacteria | 2145 |
| 1379 | nmdc:mga0k408_204020_c1 | 3300050493 | Bacteria | 1180 |
| 1380 | nmdc:mga0k408_35672_c1 | 3300050493 | Bacteria | 2852 |
| 1381 | nmdc:mga06z11_103442_c1 | 3300050494 | Bacteria | 1566 |
| 1382 | nmdc:mga06z11_162189_c1 | 3300050494 | Bacteria | 1278 |
| 1383 | nmdc:mga06z11_86835_c1 | 3300050494 | Bacteria | 1690 |
| 1384 | nmdc:mga07m45_115185_c1 | 3300050496 | Bacteria | 1550 |
| 1385 | nmdc:mga07m45_116580_c1 | 3300050496 | Bacteria | 1541 |
| 1386 | nmdc:mga07m45_19984_c1 | 3300050496 | Bacteria | 3634 |
| 1387 | nmdc:mga07m45_24549_c1 | 3300050496 | Bacteria | 3304 |
| 1388 | nmdc:mga07m45_34685_c1 | 3300050496 | Bacteria | 2805 |
| 1389 | nmdc:mga07m45_81169_c1 | 3300050496 | Bacteria | 1852 |
| 1390 | nmdc:mga05p37_2055_c1 | 3300050507 | Bacteria | 23464 |
| 1391 | nmdc:mga09592_18432_c1 | 3300050508 | Bacteria | 5726 |
| 1392 | nmdc:mga0qj67_5481_c1 | 3300050509 | Bacteria | 9275 |
| 1393 | nmdc:mga08y16_490352_c1 | 3300050511 | Bacteria | 1249 |
| 1394 | nmdc:mga08y16_778154_c1 | 3300050511 | Bacteria | 951 |
| 1395 | nmdc:mga08y16_9243_c1 | 3300050511 | Bacteria | 10340 |
| 1396 | nmdc:mga0n895_254103_c1 | 3300050512 | Bacteria | 1784 |
| 1397 | nmdc:mga0n895_274736_c1 | 3300050512 | Bacteria | 1709 |
| 1398 | nmdc:mga0n895_27571_c1 | 3300050512 | Bacteria | 5398 |
| 1399 | nmdc:mga0n895_77027_c1 | 3300050512 | Bacteria | 3317 |
| 1400 | nmdc:mga0rr50_13239_c1 | 3300050513 | Bacteria | 5364 |
| 1401 | nmdc:mga0rr50_235646_c1 | 3300050513 | Bacteria | 1516 |
| 1402 | nmdc:mga08x19_33532_c1 | 3300050514 | Bacteria | 3241 |
| 1403 | nmdc:mga0sz30_599_c1 | 3300050516 | Bacteria | 13429 |
| 1404 | nmdc:mga0sz30_6341_c1 | 3300050516 | Bacteria | 4389 |
| 1405 | Ga0495601_0024660 | 3300053077 | Bacteria | 3704 |
| 1406 | Ga0495601_0056379 | 3300053077 | Bacteria | 2488 |
| 1407 | Ga0495601_0293508 | 3300053077 | Bacteria | 1059 |
| 1408 | Ga0500578_0020392 | 3300053086 | Bacteria | 4259 |
| 1409 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 1410 | Ga0500643_000138 | 3300053087 | Bacteria | 73474 |
| 1411 | Ga0500643_025724 | 3300053087 | Bacteria | 1852 |
| 1412 | Ga0500644_0002712 | 3300053088 | Bacteria | 4424 |
| 1413 | Ga0500583_0012961 | 3300053092 | Bacteria | 3204 |
| 1414 | Ga0500583_0056423 | 3300053092 | Bacteria | 1840 |
| 1415 | Ga0500651_0022954 | 3300053093 | Bacteria | 3903 |
| 1416 | Ga0500566_0190547 | 3300053094 | Bacteria | 1044 |
| 1417 | Ga0500641_0127578 | 3300053096 | Bacteria | 1097 |
| 1418 | Ga0500641_0128268 | 3300053096 | Bacteria | 1094 |
| 1419 | Ga0500554_003013 | 3300053102 | Bacteria | 3390 |
| 1420 | Ga0500555_001236 | 3300053103 | Bacteria | 8222 |
| 1421 | Ga0500572_001289 | 3300053111 | Bacteria | 7015 |
| 1422 | Ga0500591_017361 | 3300053115 | Bacteria | 3477 |
| 1423 | Ga0500594_0007310 | 3300053118 | Bacteria | 2498 |
| 1424 | Ga0500595_000458 | 3300053119 | Bacteria | 25358 |
| 1425 | Ga0500595_005177 | 3300053119 | Bacteria | 5719 |
| 1426 | Ga0500607_137328 | 3300053121 | Bacteria | 1156 |
| 1427 | Ga0500618_003301 | 3300053125 | Bacteria | 5596 |
| 1428 | Ga0500628_006877 | 3300053129 | Bacteria | 1934 |
| 1429 | Ga0500652_014351 | 3300053131 | Bacteria | 2830 |
| 1430 | Ga0500655_001613 | 3300053133 | Bacteria | 4249 |
| 1431 | Ga0500658_0000075 | 3300053134 | Bacteria | 45932 |
| 1432 | Ga0500659_0120482 | 3300053135 | Bacteria | 1340 |
| 1433 | Ga0500559_0000002 | 3300053136 | Bacteria | 262002 |
| 1434 | Ga0500559_0000027 | 3300053136 | Bacteria | 118758 |
| 1435 | Ga0500559_0000217 | 3300053136 | Bacteria | 46155 |
| 1436 | Ga0500559_0002459 | 3300053136 | Bacteria | 9585 |
| 1437 | Ga0500561_0000020 | 3300053137 | Bacteria | 39471 |
| 1438 | Ga0500574_000164 | 3300053141 | Bacteria | 7746 |
| 1439 | Ga0500588_0046396 | 3300053146 | Bacteria | 1335 |
| 1440 | Ga0500590_001048 | 3300053148 | Bacteria | 10801 |
| 1441 | Ga0500604_0003449 | 3300053151 | Bacteria | 4258 |
| 1442 | Ga0500616_0005615 | 3300053153 | Bacteria | 8471 |
| 1443 | Ga0500616_0006871 | 3300053153 | Bacteria | 7345 |
| 1444 | Ga0500616_0012233 | 3300053153 | Bacteria | 5024 |
| 1445 | Ga0500616_0033959 | 3300053153 | Bacteria | 2782 |
| 1446 | Ga0500616_0052145 | 3300053153 | Bacteria | 2152 |
| 1447 | Ga0500619_032717 | 3300053154 | Bacteria | 1595 |
| 1448 | Ga0500622_0010898 | 3300053156 | Bacteria | 4965 |
| 1449 | Ga0500627_0073105 | 3300053158 | Bacteria | 1521 |
| 1450 | Ga0500634_0000022 | 3300053161 | Bacteria | 95424 |
| 1451 | Ga0500634_0000709 | 3300053161 | Bacteria | 11446 |
| 1452 | Ga0500639_030895 | 3300053163 | Bacteria | 2831 |
| 1453 | Ga0500636_0048143 | 3300053177 | Bacteria | 2510 |
| 1454 | Ga0500636_0122489 | 3300053177 | Bacteria | 1457 |
| 1455 | Ga0500645_000360 | 3300053730 | Bacteria | 32459 |
| 1456 | Ga0500645_010045 | 3300053730 | Bacteria | 3152 |
| 1457 | Ga0500596_001019 | 3300053735 | Bacteria | 5611 |
| 1458 | Ga0500587_005739 | 3300053739 | Bacteria | 1661 |
| 1459 | Ga0501082_0010634 | 3300060353 | Bacteria | 7922 |
| 1460 | Ga0466962_0004668 | 3300061719 | Bacteria | 6579 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10288474 | Ga0105238_102884742 | 223 |
| 2 | 3300048912 | Ga0496109_0364182 | Ga0496109_0364182_537_1274 | 242 |
| 3 | 3300013105 | Ga0157369_10485037 | Ga0157369_104850374 | 248 |
| 4 | 3300013307 | Ga0157372_10389054 | Ga0157372_103890542 | 248 |
| 5 | 3300041405 | Ga0439438_064349 | Ga0439438_064349_126_902 | 257 |
| 6 | 3300026089 | Ga0207648_10274749 | Ga0207648_102747492 | 262 |
| 7 | 3300049581 | Ga0501047_0321306 | Ga0501047_0321306_534_1355 | 267 |
| 8 | 3300009177 | Ga0105248_10032391 | Ga0105248_100323914 | 268 |
| 9 | 3300035170 | Ga0373943_0081383 | Ga0373943_0081383_29_850 | 269 |
| 10 | 3300039438 | Ga0436360_1353135 | Ga0436360_1353135_588_1430 | 269 |
| 11 | 3300039450 | Ga0436363_0934761 | Ga0436363_0934761_1526_2368 | 269 |
| 12 | 3300049587 | Ga0501071_0147504 | Ga0501071_0147504_896_1717 | 269 |
| 13 | 3300037418 | Ga0395900_0095425 | Ga0395900_0095425_1528_2400 | 271 |
| 14 | 3300037471 | Ga0395905_0049799 | Ga0395905_0049799_2879_3751 | 271 |
| 15 | 3300048924 | Ga0496121_0299650 | Ga0496121_0299650_30_860 | 271 |
| 16 | 3300005338 | Ga0068868_100028727 | Ga0068868_1000287272 | 273 |
| 17 | 3300005843 | Ga0068860_100011376 | Ga0068860_1000113765 | 273 |
| 18 | 3300009093 | Ga0105240_10009924 | Ga0105240_100099248 | 273 |
| 19 | 3300009545 | Ga0105237_10000277 | Ga0105237_1000027714 | 273 |
| 20 | 3300010375 | Ga0105239_10000433 | Ga0105239_1000043320 | 273 |
| 21 | 3300013100 | Ga0157373_10054688 | Ga0157373_100546881 | 273 |
| 22 | 3300025914 | Ga0207671_10004719 | Ga0207671_100047192 | 273 |
| 23 | 3300026023 | Ga0207677_10082150 | Ga0207677_100821502 | 273 |
| 24 | 3300028381 | Ga0268264_10008196 | Ga0268264_100081963 | 273 |
| 25 | 3300046460 | Ga0495638_0183792 | Ga0495638_0183792_312_1145 | 273 |
| 26 | 3300048918 | Ga0496115_0299904 | Ga0496115_0299904_219_1100 | 273 |
| 27 | 3300042012 | Ga0439455_0001376 | Ga0439455_0001376_670_1572 | 274 |
| 28 | 3300046473 | Ga0495582_0039683 | Ga0495582_0039683_666_1550 | 274 |
| 29 | 3300046474 | Ga0495605_0059150 | Ga0495605_0059150_449_1315 | 274 |
| 30 | 3300046477 | Ga0495664_0070603 | Ga0495664_0070603_693_1577 | 274 |
| 31 | 3300046501 | Ga0495607_0002888 | Ga0495607_0002888_7291_8157 | 274 |
| 32 | 3300047315 | Ga0495581_0113817 | Ga0495581_0113817_231_1115 | 274 |
| 33 | 3300047320 | Ga0495672_0077325 | Ga0495672_0077325_968_1834 | 274 |
| 34 | 3300050511 | nmdc:mga08y16_490352_c1 | nmdc:mga08y16_490352_c1_35_883 | 274 |
| 35 | iso_pu_bacteria | 8004361976 | 8004368385 | 274 |
| 36 | 3300048924 | Ga0496121_0325250 | Ga0496121_0325250_30_914 | 275 |
| 37 | iso_pu_bacteria | 2958137437 | 2958137983 | 275 |
| 38 | iso_pu_bacteria | 2965047637 | 2965052070 | 275 |
| 39 | 3300002737 | JGI25162J39368_1000775 | JGI25162J39368_10007753 | 276 |
| 40 | 3300003320 | rootH2_10037401 | rootH2_100374013 | 276 |
| 41 | 3300003323 | rootH1_10003256 | rootH1_1000325618 | 276 |
| 42 | 3300003323 | rootH1_10189607 | rootH1_101896071 | 276 |
| 43 | 3300005459 | Ga0068867_100554336 | Ga0068867_1005543361 | 276 |
| 44 | 3300005563 | Ga0068855_100000195 | Ga0068855_10000019582 | 276 |
| 45 | 3300005563 | Ga0068855_100000988 | Ga0068855_10000098820 | 276 |
| 46 | 3300005614 | Ga0068856_100029524 | Ga0068856_1000295244 | 276 |
| 47 | 3300009545 | Ga0105237_10125353 | Ga0105237_101253532 | 276 |
| 48 | 3300009545 | Ga0105237_10329753 | Ga0105237_103297532 | 276 |
| 49 | 3300020078 | Ga0206352_10987329 | Ga0206352_109873291 | 276 |
| 50 | 3300025949 | Ga0207667_10000046 | Ga0207667_100000465 | 276 |
| 51 | 3300025949 | Ga0207667_10007485 | Ga0207667_100074859 | 276 |
| 52 | 3300026078 | Ga0207702_10245928 | Ga0207702_102459282 | 276 |
| 53 | 3300028800 | Ga0265338_10024738 | Ga0265338_100247383 | 276 |
| 54 | iso_pu_bacteria | 2891088606 | 2891093132 | 276 |
| 55 | 3300005539 | Ga0068853_100238535 | Ga0068853_1002385352 | 277 |
| 56 | 3300009177 | Ga0105248_10072968 | Ga0105248_100729682 | 277 |
| 57 | 3300046531 | Ga0495665_0073252 | Ga0495665_0073252_233_1066 | 277 |
| 58 | iso_pu_bacteria | 2821131069 | 2821133927 | 277 |
| 59 | iso_pu_bacteria | 2857564685 | 2857565719 | 277 |
| 60 | 3300041413 | Ga0439465_0058099 | Ga0439465_0058099_207_1052 | 278 |
| 61 | 3300042007 | Ga0439449_0000965 | Ga0439449_0000965_5812_6657 | 278 |
| 62 | 3300044765 | Ga0466970_0015119 | Ga0466970_0015119_2189_3211 | 278 |
| 63 | 3300045836 | Ga0466958_0020405 | Ga0466958_0020405_1461_2483 | 278 |
| 64 | 3300048920 | Ga0496117_0003961 | Ga0496117_0003961_1345_2181 | 278 |
| 65 | 3300050513 | nmdc:mga0rr50_235646_c1 | nmdc:mga0rr50_235646_c1_488_1348 | 278 |
| 66 | 3300009093 | Ga0105240_10282393 | Ga0105240_102823932 | 280 |
| 67 | 3300009551 | Ga0105238_10078371 | Ga0105238_100783712 | 280 |
| 68 | 3300025924 | Ga0207694_10059529 | Ga0207694_100595292 | 280 |
| 69 | 3300048922 | Ga0496119_0066478 | Ga0496119_0066478_420_1262 | 280 |
| 70 | iso_pu_bacteria | 2945961074 | 2945962402 | 280 |
| 71 | iso_pu_bacteria | 8001845381 | 8001849216 | 280 |
| 72 | 3300003771 | Ga0055526_1000353 | Ga0055526_10003535 | 281 |
| 73 | 3300005367 | Ga0070667_100100477 | Ga0070667_1001004772 | 281 |
| 74 | 3300005563 | Ga0068855_100631052 | Ga0068855_1006310521 | 281 |
| 75 | 3300005614 | Ga0068856_100262477 | Ga0068856_1002624773 | 281 |
| 76 | 3300005841 | Ga0068863_100000683 | Ga0068863_10000068321 | 281 |
| 77 | 3300005843 | Ga0068860_100000439 | Ga0068860_1000004397 | 281 |
| 78 | 3300009036 | Ga0105244_10004885 | Ga0105244_100048858 | 281 |
| 79 | 3300010375 | Ga0105239_10082341 | Ga0105239_100823411 | 281 |
| 80 | 3300011119 | Ga0105246_10111152 | Ga0105246_101111522 | 281 |
| 81 | 3300025295 | Ga0209564_1000038 | Ga0209564_1000038232 | 281 |
| 82 | 3300025728 | Ga0207655_1038253 | Ga0207655_10382532 | 281 |
| 83 | 3300025903 | Ga0207680_10114982 | Ga0207680_101149822 | 281 |
| 84 | 3300025904 | Ga0207647_10105563 | Ga0207647_101055632 | 281 |
| 85 | 3300025911 | Ga0207654_10040827 | Ga0207654_100408272 | 281 |
| 86 | 3300026078 | Ga0207702_10127312 | Ga0207702_101273122 | 281 |
| 87 | 3300026088 | Ga0207641_10000900 | Ga0207641_100009008 | 281 |
| 88 | 3300028381 | Ga0268264_10000100 | Ga0268264_10000100113 | 281 |
| 89 | 3300035114 | Ga0373939_0023257 | Ga0373939_0023257_674_1528 | 281 |
| 90 | 3300037312 | Ga0395899_0063904 | Ga0395899_0063904_1751_2596 | 281 |
| 91 | 3300037418 | Ga0395900_0102528 | Ga0395900_0102528_1967_2812 | 281 |
| 92 | 3300044684 | Ga0466966_0100568 | Ga0466966_0100568_626_1471 | 281 |
| 93 | 3300047443 | Ga0495687_003645 | Ga0495687_003645_128_1054 | 281 |
| 94 | 3300048909 | Ga0496106_0035516 | Ga0496106_0035516_2767_3612 | 281 |
| 95 | 3300048910 | Ga0496107_0117139 | Ga0496107_0117139_1097_1942 | 281 |
| 96 | iso_pu_bacteria | 2524023209 | 2524457562 | 281 |
| 97 | iso_pu_bacteria | 2643221664 | 2644358185 | 281 |
| 98 | iso_pu_bacteria | 2842298080 | 2842300823 | 281 |
| 99 | iso_pu_bacteria | 2842357229 | 2842358057 | 281 |
| 100 | iso_pu_bacteria | 2884086401 | 2884088636 | 281 |
| 101 | iso_pu_bacteria | 8004312739 | 8004315299 | 281 |
| 102 | 3300021388 | Ga0213875_10002535 | Ga0213875_100025359 | 282 |
| 103 | 3300031242 | Ga0265329_10039004 | Ga0265329_100390042 | 282 |
| 104 | 3300031250 | Ga0265331_10005664 | Ga0265331_100056648 | 282 |
| 105 | 3300031251 | Ga0265327_10021884 | Ga0265327_100218842 | 282 |
| 106 | 3300031344 | Ga0265316_10031780 | Ga0265316_100317802 | 282 |
| 107 | 3300037853 | Ga0436364_0542878 | Ga0436364_0542878_844_1707 | 282 |
| 108 | iso_pu_bacteria | 2511231026 | 2511385540 | 282 |
| 109 | iso_pu_bacteria | 2855730933 | 2855732388 | 282 |
| 110 | iso_pu_bacteria | 2855767633 | 2855769096 | 282 |
| 111 | iso_pu_bacteria | 2932406140 | 2932408889 | 282 |
| 112 | iso_pu_bacteria | 2939577877 | 2939582021 | 282 |
| 113 | 3300003316 | rootH1_10012089 | rootH1_100120899 | 283 |
| 114 | 3300005545 | Ga0070695_100059422 | Ga0070695_1000594222 | 283 |
| 115 | 3300005549 | Ga0070704_100069702 | Ga0070704_1000697023 | 283 |
| 116 | 3300005577 | Ga0068857_100032292 | Ga0068857_1000322923 | 283 |
| 117 | 3300005617 | Ga0068859_100159809 | Ga0068859_1001598094 | 283 |
| 118 | 3300005937 | Ga0081455_10009027 | Ga0081455_100090279 | 283 |
| 119 | 3300006177 | Ga0075362_10039953 | Ga0075362_100399532 | 283 |
| 120 | 3300006931 | Ga0097620_100159817 | Ga0097620_1001598174 | 283 |
| 121 | 3300009551 | Ga0105238_10288025 | Ga0105238_102880252 | 283 |
| 122 | 3300026116 | Ga0207674_10024897 | Ga0207674_100248977 | 283 |
| 123 | 3300037471 | Ga0395905_0236992 | Ga0395905_0236992_482_1336 | 283 |
| 124 | 3300046513 | Ga0495616_0023492 | Ga0495616_0023492_2049_2909 | 283 |
| 125 | 3300046523 | Ga0495644_0079124 | Ga0495644_0079124_366_1226 | 283 |
| 126 | 3300046810 | Ga0495660_0000011 | Ga0495660_0000011_307449_308309 | 283 |
| 127 | 3300048928 | Ga0496125_0192351 | Ga0496125_0192351_465_1316 | 283 |
| 128 | 3300049460 | Ga0495682_0000004 | Ga0495682_0000004_304567_305427 | 283 |
| 129 | 3300050490 | nmdc:mga03n38_109244_c1 | nmdc:mga03n38_109244_c1_419_1291 | 283 |
| 130 | 3300050491 | nmdc:mga00v17_213265_c1 | nmdc:mga00v17_213265_c1_156_1028 | 283 |
| 131 | 3300053096 | Ga0500641_0128268 | Ga0500641_0128268_207_1058 | 283 |
| 132 | iso_pu_bacteria | 2516143018 | 2516204846 | 283 |
| 133 | iso_pu_bacteria | 2744054900 | 2746086289 | 283 |
| 134 | iso_pu_bacteria | 2744054901 | 2746096958 | 283 |
| 135 | iso_pu_bacteria | 2765235942 | 2766068311 | 283 |
| 136 | iso_pu_bacteria | 2844425489 | 2844427359 | 283 |
| 137 | iso_pu_bacteria | 2848694841 | 2848700259 | 283 |
| 138 | iso_pu_bacteria | 2881161766 | 2881161893 | 283 |
| 139 | iso_pu_bacteria | 3004268573 | 3004272379 | 283 |
| 140 | iso_pu_bacteria | 8054002106 | 8054008264 | 283 |
| 141 | 3300005293 | Ga0065715_10110171 | Ga0065715_101101713 | 284 |
| 142 | 3300005330 | Ga0070690_100020249 | Ga0070690_1000202496 | 284 |
| 143 | 3300005334 | Ga0068869_100121152 | Ga0068869_1001211522 | 284 |
| 144 | 3300005335 | Ga0070666_10041064 | Ga0070666_100410644 | 284 |
| 145 | 3300005338 | Ga0068868_100010007 | Ga0068868_1000100075 | 284 |
| 146 | 3300005344 | Ga0070661_100127868 | Ga0070661_1001278683 | 284 |
| 147 | 3300005354 | Ga0070675_100062107 | Ga0070675_1000621072 | 284 |
| 148 | 3300005355 | Ga0070671_100067148 | Ga0070671_1000671482 | 284 |
| 149 | 3300005364 | Ga0070673_100002004 | Ga0070673_10000200412 | 284 |
| 150 | 3300005365 | Ga0070688_100000670 | Ga0070688_10000067016 | 284 |
| 151 | 3300005366 | Ga0070659_100138341 | Ga0070659_1001383412 | 284 |
| 152 | 3300005367 | Ga0070667_100058983 | Ga0070667_1000589835 | 284 |
| 153 | 3300005406 | Ga0070703_10056291 | Ga0070703_100562912 | 284 |
| 154 | 3300005438 | Ga0070701_10124100 | Ga0070701_101241002 | 284 |
| 155 | 3300005456 | Ga0070678_100178486 | Ga0070678_1001784863 | 284 |
| 156 | 3300005457 | Ga0070662_100089051 | Ga0070662_1000890511 | 284 |
| 157 | 3300005466 | Ga0070685_10004218 | Ga0070685_100042185 | 284 |
| 158 | 3300005544 | Ga0070686_100042207 | Ga0070686_1000422072 | 284 |
| 159 | 3300005546 | Ga0070696_100291242 | Ga0070696_1002912422 | 284 |
| 160 | 3300005548 | Ga0070665_100116162 | Ga0070665_1001161622 | 284 |
| 161 | 3300005548 | Ga0070665_100154255 | Ga0070665_1001542552 | 284 |
| 162 | 3300005564 | Ga0070664_100000969 | Ga0070664_10000096918 | 284 |
| 163 | 3300005617 | Ga0068859_100109335 | Ga0068859_1001093353 | 284 |
| 164 | 3300005618 | Ga0068864_100382007 | Ga0068864_1003820072 | 284 |
| 165 | 3300005841 | Ga0068863_100004808 | Ga0068863_1000048088 | 284 |
| 166 | 3300005842 | Ga0068858_100278124 | Ga0068858_1002781242 | 284 |
| 167 | 3300005843 | Ga0068860_100151007 | Ga0068860_1001510073 | 284 |
| 168 | 3300006237 | Ga0097621_100013057 | Ga0097621_1000130572 | 284 |
| 169 | 3300006358 | Ga0068871_100000739 | Ga0068871_10000073913 | 284 |
| 170 | 3300006358 | Ga0068871_100354221 | Ga0068871_1003542212 | 284 |
| 171 | 3300006847 | Ga0075431_100311316 | Ga0075431_1003113163 | 284 |
| 172 | 3300006871 | Ga0075434_100034079 | Ga0075434_1000340794 | 284 |
| 173 | 3300006880 | Ga0075429_100137495 | Ga0075429_1001374953 | 284 |
| 174 | 3300006881 | Ga0068865_100011752 | Ga0068865_1000117526 | 284 |
| 175 | 3300006881 | Ga0068865_100017394 | Ga0068865_1000173944 | 284 |
| 176 | 3300006914 | Ga0075436_100001843 | Ga0075436_10000184316 | 284 |
| 177 | 3300006931 | Ga0097620_100109334 | Ga0097620_1001093343 | 284 |
| 178 | 3300007076 | Ga0075435_100026548 | Ga0075435_1000265483 | 284 |
| 179 | 3300009094 | Ga0111539_10002000 | Ga0111539_100020005 | 284 |
| 180 | 3300009094 | Ga0111539_10234427 | Ga0111539_102344271 | 284 |
| 181 | 3300009098 | Ga0105245_10017670 | Ga0105245_100176705 | 284 |
| 182 | 3300009176 | Ga0105242_10005891 | Ga0105242_100058919 | 284 |
| 183 | 3300009176 | Ga0105242_10370020 | Ga0105242_103700202 | 284 |
| 184 | 3300009177 | Ga0105248_10139302 | Ga0105248_101393022 | 284 |
| 185 | 3300009177 | Ga0105248_10528633 | Ga0105248_105286331 | 284 |
| 186 | 3300013306 | Ga0163162_10181482 | Ga0163162_101814822 | 284 |
| 187 | 3300013308 | Ga0157375_10005611 | Ga0157375_1000561114 | 284 |
| 188 | 3300013308 | Ga0157375_10416522 | Ga0157375_104165222 | 284 |
| 189 | 3300014745 | Ga0157377_10023260 | Ga0157377_100232601 | 284 |
| 190 | 3300014968 | Ga0157379_10079534 | Ga0157379_100795342 | 284 |
| 191 | 3300014968 | Ga0157379_10139074 | Ga0157379_101390741 | 284 |
| 192 | 3300014969 | Ga0157376_10008577 | Ga0157376_100085777 | 284 |
| 193 | 3300025315 | Ga0207697_10073428 | Ga0207697_100734282 | 284 |
| 194 | 3300025901 | Ga0207688_10015030 | Ga0207688_100150304 | 284 |
| 195 | 3300025903 | Ga0207680_10031100 | Ga0207680_100311004 | 284 |
| 196 | 3300025906 | Ga0207699_10000070 | Ga0207699_1000007037 | 284 |
| 197 | 3300025907 | Ga0207645_10099111 | Ga0207645_100991113 | 284 |
| 198 | 3300025926 | Ga0207659_10002302 | Ga0207659_100023029 | 284 |
| 199 | 3300025926 | Ga0207659_10051136 | Ga0207659_100511363 | 284 |
| 200 | 3300025927 | Ga0207687_10010250 | Ga0207687_100102505 | 284 |
| 201 | 3300025931 | Ga0207644_10042431 | Ga0207644_100424314 | 284 |
| 202 | 3300025933 | Ga0207706_10013496 | Ga0207706_1001349614 | 284 |
| 203 | 3300025934 | Ga0207686_10002966 | Ga0207686_100029667 | 284 |
| 204 | 3300025937 | Ga0207669_10012678 | Ga0207669_100126784 | 284 |
| 205 | 3300025939 | Ga0207665_10018609 | Ga0207665_100186092 | 284 |
| 206 | 3300025941 | Ga0207711_10008496 | Ga0207711_100084965 | 284 |
| 207 | 3300025941 | Ga0207711_10100310 | Ga0207711_101003102 | 284 |
| 208 | 3300025941 | Ga0207711_10136445 | Ga0207711_101364451 | 284 |
| 209 | 3300025942 | Ga0207689_10092095 | Ga0207689_100920953 | 284 |
| 210 | 3300025945 | Ga0207679_10105872 | Ga0207679_101058721 | 284 |
| 211 | 3300025960 | Ga0207651_10010829 | Ga0207651_1001082910 | 284 |
| 212 | 3300025986 | Ga0207658_10200604 | Ga0207658_102006042 | 284 |
| 213 | 3300026035 | Ga0207703_10129697 | Ga0207703_101296972 | 284 |
| 214 | 3300026088 | Ga0207641_10010599 | Ga0207641_100105996 | 284 |
| 215 | 3300026089 | Ga0207648_10026890 | Ga0207648_100268903 | 284 |
| 216 | 3300026095 | Ga0207676_10333313 | Ga0207676_103333132 | 284 |
| 217 | 3300026118 | Ga0207675_100576377 | Ga0207675_1005763772 | 284 |
| 218 | 3300026121 | Ga0207683_10218220 | Ga0207683_102182202 | 284 |
| 219 | 3300027907 | Ga0207428_10000946 | Ga0207428_1000094634 | 284 |
| 220 | 3300028381 | Ga0268264_10124281 | Ga0268264_101242813 | 284 |
| 221 | 3300038705 | Ga0237819_09536 | Ga0237819_09536_15_905 | 284 |
| 222 | 3300045051 | Ga0451576_0561399 | Ga0451576_0561399_206_1069 | 284 |
| 223 | 3300046501 | Ga0495607_0035589 | Ga0495607_0035589_757_1611 | 284 |
| 224 | 3300046507 | Ga0495606_0000725 | Ga0495606_0000725_32706_33560 | 284 |
| 225 | 3300046522 | Ga0495643_0039054 | Ga0495643_0039054_1064_1918 | 284 |
| 226 | 3300046794 | Ga0495589_0000490 | Ga0495589_0000490_26107_26961 | 284 |
| 227 | 3300047318 | Ga0495636_0072139 | Ga0495636_0072139_574_1437 | 284 |
| 228 | 3300047446 | Ga0495679_007769 | Ga0495679_007769_2305_3159 | 284 |
| 229 | 3300048911 | Ga0496108_0469968 | Ga0496108_0469968_117_1001 | 284 |
| 230 | 3300050507 | nmdc:mga05p37_2055_c1 | nmdc:mga05p37_2055_c1_5923_6786 | 284 |
| 231 | 3300050508 | nmdc:mga09592_18432_c1 | nmdc:mga09592_18432_c1_4239_5102 | 284 |
| 232 | 3300050509 | nmdc:mga0qj67_5481_c1 | nmdc:mga0qj67_5481_c1_7062_7925 | 284 |
| 233 | 3300050511 | nmdc:mga08y16_9243_c1 | nmdc:mga08y16_9243_c1_5618_6481 | 284 |
| 234 | 3300050512 | nmdc:mga0n895_254103_c1 | nmdc:mga0n895_254103_c1_227_1090 | 284 |
| 235 | 3300050512 | nmdc:mga0n895_27571_c1 | nmdc:mga0n895_27571_c1_2470_3330 | 284 |
| 236 | 3300050512 | nmdc:mga0n895_77027_c1 | nmdc:mga0n895_77027_c1_17_880 | 284 |
| 237 | 3300050513 | nmdc:mga0rr50_13239_c1 | nmdc:mga0rr50_13239_c1_2520_3380 | 284 |
| 238 | 3300050514 | nmdc:mga08x19_33532_c1 | nmdc:mga08x19_33532_c1_2271_3131 | 284 |
| 239 | 3300053096 | Ga0500641_0127578 | Ga0500641_0127578_167_1048 | 284 |
| 240 | iso_pu_bacteria | 2503198000 | 2503201166 | 284 |
| 241 | iso_pu_bacteria | 2508501123 | 2509118560 | 284 |
| 242 | iso_pu_bacteria | 2508501127 | 2509145239 | 284 |
| 243 | iso_pu_bacteria | 2508501128 | 2509153238 | 284 |
| 244 | iso_pu_bacteria | 2509276018 | 2509372430 | 284 |
| 245 | iso_pu_bacteria | 2509276021 | 2509391016 | 284 |
| 246 | iso_pu_bacteria | 2509276022 | 2509395917 | 284 |
| 247 | iso_pu_bacteria | 2509276033 | 2509441825 | 284 |
| 248 | iso_pu_bacteria | 2510065019 | 2510137433 | 284 |
| 249 | iso_pu_bacteria | 2510917022 | 2511137117 | 284 |
| 250 | iso_pu_bacteria | 2512047086 | 2512533315 | 284 |
| 251 | iso_pu_bacteria | 2512875016 | 2512931929 | 284 |
| 252 | iso_pu_bacteria | 2512875024 | 2512959879 | 284 |
| 253 | iso_pu_bacteria | 2513237085 | 2513576015 | 284 |
| 254 | iso_pu_bacteria | 2513237144 | 2513908891 | 284 |
| 255 | iso_pu_bacteria | 2513237164 | 2514036100 | 284 |
| 256 | iso_pu_bacteria | 2513237305 | 2514418758 | 284 |
| 257 | iso_pu_bacteria | 2513237351 | 2514589737 | 284 |
| 258 | iso_pu_bacteria | 2515075009 | 2515109498 | 284 |
| 259 | iso_pu_bacteria | 2515154113 | 2515634272 | 284 |
| 260 | iso_pu_bacteria | 2515154123 | 2515690632 | 284 |
| 261 | iso_pu_bacteria | 2515154134 | 2515742562 | 284 |
| 262 | iso_pu_bacteria | 2516653085 | 2517081478 | 284 |
| 263 | iso_pu_bacteria | 2517093000 | 2517100132 | 284 |
| 264 | iso_pu_bacteria | 2517287029 | 2517411330 | 284 |
| 265 | iso_pu_bacteria | 2519103095 | 2519463134 | 284 |
| 266 | iso_pu_bacteria | 2529292951 | 2530648553 | 284 |
| 267 | iso_pu_bacteria | 2547132416 | 2548652292 | 284 |
| 268 | iso_pu_bacteria | 2554235003 | 2554249522 | 284 |
| 269 | iso_pu_bacteria | 2558860242 | 2559298147 | 284 |
| 270 | iso_pu_bacteria | 2582581283 | 2585165258 | 284 |
| 271 | iso_pu_bacteria | 2582581298 | 2585226528 | 284 |
| 272 | iso_pu_bacteria | 2582581304 | 2585256876 | 284 |
| 273 | iso_pu_bacteria | 2582581306 | 2585265110 | 284 |
| 274 | iso_pu_bacteria | 2582581307 | 2585273630 | 284 |
| 275 | iso_pu_bacteria | 2582581311 | 2585293482 | 284 |
| 276 | iso_pu_bacteria | 2582581315 | 2585325935 | 284 |
| 277 | iso_pu_bacteria | 2582581316 | 2585330104 | 284 |
| 278 | iso_pu_bacteria | 2582581865 | 2585385759 | 284 |
| 279 | iso_pu_bacteria | 2585427528 | 2585538868 | 284 |
| 280 | iso_pu_bacteria | 2585427529 | 2585549602 | 284 |
| 281 | iso_pu_bacteria | 2585427530 | 2585557026 | 284 |
| 282 | iso_pu_bacteria | 2585427531 | 2585559804 | 284 |
| 283 | iso_pu_bacteria | 2585427593 | 2585836819 | 284 |
| 284 | iso_pu_bacteria | 2585427608 | 2585900485 | 284 |
| 285 | iso_pu_bacteria | 2585427609 | 2585906018 | 284 |
| 286 | iso_pu_bacteria | 2585428125 | 2587978867 | 284 |
| 287 | iso_pu_bacteria | 2588253730 | 2588517785 | 284 |
| 288 | iso_pu_bacteria | 2595698237 | 2596375044 | 284 |
| 289 | iso_pu_bacteria | 2596583598 | 2597028123 | 284 |
| 290 | iso_pu_bacteria | 2597489875 | 2597814445 | 284 |
| 291 | iso_pu_bacteria | 2599185178 | 2599444844 | 284 |
| 292 | iso_pu_bacteria | 2599185236 | 2599720082 | 284 |
| 293 | iso_pu_bacteria | 2599185240 | 2599743691 | 284 |
| 294 | iso_pu_bacteria | 2599185292 | 2599907420 | 284 |
| 295 | iso_pu_bacteria | 2599185303 | 2599946963 | 284 |
| 296 | iso_pu_bacteria | 2599185354 | 2600200266 | 284 |
| 297 | iso_pu_bacteria | 2599185355 | 2600209239 | 284 |
| 298 | iso_pu_bacteria | 2602042047 | 2603642594 | 284 |
| 299 | iso_pu_bacteria | 2602042066 | 2603698368 | 284 |
| 300 | iso_pu_bacteria | 2602042067 | 2603703186 | 284 |
| 301 | iso_pu_bacteria | 2615840624 | 2616294273 | 284 |
| 302 | iso_pu_bacteria | 2615840626 | 2616306278 | 284 |
| 303 | iso_pu_bacteria | 2615840698 | 2616553456 | 284 |
| 304 | iso_pu_bacteria | 2617270735 | 2617346501 | 284 |
| 305 | iso_pu_bacteria | 2617270742 | 2617383693 | 284 |
| 306 | iso_pu_bacteria | 2643221568 | 2643858116 | 284 |
| 307 | iso_pu_bacteria | 2643221592 | 2643969452 | 284 |
| 308 | iso_pu_bacteria | 2643221595 | 2643986840 | 284 |
| 309 | iso_pu_bacteria | 2643221607 | 2644046888 | 284 |
| 310 | iso_pu_bacteria | 2643221625 | 2644143752 | 284 |
| 311 | iso_pu_bacteria | 2643221627 | 2644157683 | 284 |
| 312 | iso_pu_bacteria | 2643221636 | 2644202580 | 284 |
| 313 | iso_pu_bacteria | 2643221648 | 2644276542 | 284 |
| 314 | iso_pu_bacteria | 2643221686 | 2644479677 | 284 |
| 315 | iso_pu_bacteria | 2643221689 | 2644497217 | 284 |
| 316 | iso_pu_bacteria | 2643221693 | 2644523581 | 284 |
| 317 | iso_pu_bacteria | 2667528172 | 2671103122 | 284 |
| 318 | iso_pu_bacteria | 2667528174 | 2671112413 | 284 |
| 319 | iso_pu_bacteria | 2675903129 | 2676742522 | 284 |
| 320 | iso_pu_bacteria | 2681812866 | 2681997732 | 284 |
| 321 | iso_pu_bacteria | 2681812869 | 2682006744 | 284 |
| 322 | iso_pu_bacteria | 2687453392 | 2688599792 | 284 |
| 323 | iso_pu_bacteria | 2718217882 | 2719184244 | 284 |
| 324 | iso_pu_bacteria | 2718217927 | 2719389988 | 284 |
| 325 | iso_pu_bacteria | 2718218009 | 2719729817 | 284 |
| 326 | iso_pu_bacteria | 2718218232 | 2720610936 | 284 |
| 327 | iso_pu_bacteria | 2718218233 | 2720616817 | 284 |
| 328 | iso_pu_bacteria | 2718218235 | 2720628173 | 284 |
| 329 | iso_pu_bacteria | 2718218269 | 2720771753 | 284 |
| 330 | iso_pu_bacteria | 2718218363 | 2721144067 | 284 |
| 331 | iso_pu_bacteria | 2718218365 | 2721156756 | 284 |
| 332 | iso_pu_bacteria | 2718218366 | 2721161442 | 284 |
| 333 | iso_pu_bacteria | 2718218423 | 2721403627 | 284 |
| 334 | iso_pu_bacteria | 2721755514 | 2722837395 | 284 |
| 335 | iso_pu_bacteria | 2721755556 | 2723031007 | 284 |
| 336 | iso_pu_bacteria | 2721755684 | 2723563513 | 284 |
| 337 | iso_pu_bacteria | 2721755685 | 2723571507 | 284 |
| 338 | iso_pu_bacteria | 2721755686 | 2723576569 | 284 |
| 339 | iso_pu_bacteria | 2721755809 | 2724035203 | 284 |
| 340 | iso_pu_bacteria | 2721755810 | 2724040971 | 284 |
| 341 | iso_pu_bacteria | 2721755819 | 2724087302 | 284 |
| 342 | iso_pu_bacteria | 2721755822 | 2724101013 | 284 |
| 343 | iso_pu_bacteria | 2721755823 | 2724108255 | 284 |
| 344 | iso_pu_bacteria | 2728369352 | 2730105473 | 284 |
| 345 | iso_pu_bacteria | 2728369365 | 2730162384 | 284 |
| 346 | iso_pu_bacteria | 2728369397 | 2730295517 | 284 |
| 347 | iso_pu_bacteria | 2738541277 | 2738721026 | 284 |
| 348 | iso_pu_bacteria | 2738541307 | 2738881037 | 284 |
| 349 | iso_pu_bacteria | 2738541333 | 2739034290 | 284 |
| 350 | iso_pu_bacteria | 2738543019 | 2739280225 | 284 |
| 351 | iso_pu_bacteria | 2751185846 | 2753568516 | 284 |
| 352 | iso_pu_bacteria | 2751185897 | 2753763957 | 284 |
| 353 | iso_pu_bacteria | 2751185917 | 2753855809 | 284 |
| 354 | iso_pu_bacteria | 2765235842 | 2765588803 | 284 |
| 355 | iso_pu_bacteria | 2775506706 | 2775538810 | 284 |
| 356 | iso_pu_bacteria | 2775507266 | 2778174216 | 284 |
| 357 | iso_pu_bacteria | 2791355123 | 2792745906 | 284 |
| 358 | iso_pu_bacteria | 2791355259 | 2793312845 | 284 |
| 359 | iso_pu_bacteria | 2791355260 | 2793321864 | 284 |
| 360 | iso_pu_bacteria | 2791355261 | 2793326893 | 284 |
| 361 | iso_pu_bacteria | 2791355264 | 2793348563 | 284 |
| 362 | iso_pu_bacteria | 2791355265 | 2793354186 | 284 |
| 363 | iso_pu_bacteria | 2791355266 | 2793361728 | 284 |
| 364 | iso_pu_bacteria | 2791355275 | 2793405447 | 284 |
| 365 | iso_pu_bacteria | 2802429605 | 2805929807 | 284 |
| 366 | iso_pu_bacteria | 2802429606 | 2805933157 | 284 |
| 367 | iso_pu_bacteria | 2802429633 | 2806043091 | 284 |
| 368 | iso_pu_bacteria | 2802429634 | 2806051043 | 284 |
| 369 | iso_pu_bacteria | 2802429635 | 2806057788 | 284 |
| 370 | iso_pu_bacteria | 2802429636 | 2806065495 | 284 |
| 371 | iso_pu_bacteria | 2802429637 | 2806075264 | 284 |
| 372 | iso_pu_bacteria | 2808606387 | 2808989343 | 284 |
| 373 | iso_pu_bacteria | 2816332253 | 2817263483 | 284 |
| 374 | iso_pu_bacteria | 2816332256 | 2817276860 | 284 |
| 375 | iso_pu_bacteria | 2816332286 | 2817452972 | 284 |
| 376 | iso_pu_bacteria | 2818991436 | 2819543100 | 284 |
| 377 | iso_pu_bacteria | 2818991453 | 2819643560 | 284 |
| 378 | iso_pu_bacteria | 2818991457 | 2819661897 | 284 |
| 379 | iso_pu_bacteria | 2821118458 | 2821119612 | 284 |
| 380 | iso_pu_bacteria | 2823373977 | 2823374593 | 284 |
| 381 | iso_pu_bacteria | 2824696289 | 2824702954 | 284 |
| 382 | iso_pu_bacteria | 2838016132 | 2838019649 | 284 |
| 383 | iso_pu_bacteria | 2838022645 | 2838027148 | 284 |
| 384 | iso_pu_bacteria | 2838029111 | 2838029249 | 284 |
| 385 | iso_pu_bacteria | 2838061910 | 2838066428 | 284 |
| 386 | iso_pu_bacteria | 2838068647 | 2838072520 | 284 |
| 387 | iso_pu_bacteria | 2838680041 | 2838686038 | 284 |
| 388 | iso_pu_bacteria | 2838686498 | 2838688497 | 284 |
| 389 | iso_pu_bacteria | 2838694306 | 2838700591 | 284 |
| 390 | iso_pu_bacteria | 2838707686 | 2838713870 | 284 |
| 391 | iso_pu_bacteria | 2838729681 | 2838734369 | 284 |
| 392 | iso_pu_bacteria | 2838742623 | 2838746828 | 284 |
| 393 | iso_pu_bacteria | 2841734538 | 2841740749 | 284 |
| 394 | iso_pu_bacteria | 2841851746 | 2841852237 | 284 |
| 395 | iso_pu_bacteria | 2841864319 | 2841865647 | 284 |
| 396 | iso_pu_bacteria | 2841941048 | 2841944756 | 284 |
| 397 | iso_pu_bacteria | 2841949485 | 2841955953 | 284 |
| 398 | iso_pu_bacteria | 2841966195 | 2841969910 | 284 |
| 399 | iso_pu_bacteria | 2841974524 | 2841978659 | 284 |
| 400 | iso_pu_bacteria | 2842077413 | 2842082976 | 284 |
| 401 | iso_pu_bacteria | 2842118031 | 2842124215 | 284 |
| 402 | iso_pu_bacteria | 2842156927 | 2842158688 | 284 |
| 403 | iso_pu_bacteria | 2842163707 | 2842166112 | 284 |
| 404 | iso_pu_bacteria | 2842180545 | 2842182302 | 284 |
| 405 | iso_pu_bacteria | 2842192696 | 2842193922 | 284 |
| 406 | iso_pu_bacteria | 2842198810 | 2842200622 | 284 |
| 407 | iso_pu_bacteria | 2842229732 | 2842234685 | 284 |
| 408 | iso_pu_bacteria | 2842237096 | 2842243283 | 284 |
| 409 | iso_pu_bacteria | 2842243621 | 2842248418 | 284 |
| 410 | iso_pu_bacteria | 2842257432 | 2842262409 | 284 |
| 411 | iso_pu_bacteria | 2842271015 | 2842272553 | 284 |
| 412 | iso_pu_bacteria | 2842285085 | 2842289188 | 284 |
| 413 | iso_pu_bacteria | 2842291075 | 2842297235 | 284 |
| 414 | iso_pu_bacteria | 2842304105 | 2842308006 | 284 |
| 415 | iso_pu_bacteria | 2842311132 | 2842313242 | 284 |
| 416 | iso_pu_bacteria | 2842317721 | 2842319336 | 284 |
| 417 | iso_pu_bacteria | 2842341865 | 2842345577 | 284 |
| 418 | iso_pu_bacteria | 2842363717 | 2842363874 | 284 |
| 419 | iso_pu_bacteria | 2842370503 | 2842376343 | 284 |
| 420 | iso_pu_bacteria | 2842377471 | 2842383629 | 284 |
| 421 | iso_pu_bacteria | 2842384541 | 2842390768 | 284 |
| 422 | iso_pu_bacteria | 2842402390 | 2842407394 | 284 |
| 423 | iso_pu_bacteria | 2842409023 | 2842413357 | 284 |
| 424 | iso_pu_bacteria | 2842415677 | 2842420000 | 284 |
| 425 | iso_pu_bacteria | 2842422224 | 2842426032 | 284 |
| 426 | iso_pu_bacteria | 2842447887 | 2842452453 | 284 |
| 427 | iso_pu_bacteria | 2842475841 | 2842476321 | 284 |
| 428 | iso_pu_bacteria | 2842482326 | 2842482397 | 284 |
| 429 | iso_pu_bacteria | 2842489311 | 2842490675 | 284 |
| 430 | iso_pu_bacteria | 2842495871 | 2842498912 | 284 |
| 431 | iso_pu_bacteria | 2842502639 | 2842502777 | 284 |
| 432 | iso_pu_bacteria | 2842780639 | 2842782529 | 284 |
| 433 | iso_pu_bacteria | 2842914999 | 2842917209 | 284 |
| 434 | iso_pu_bacteria | 2842918807 | 2842919102 | 284 |
| 435 | iso_pu_bacteria | 2844454524 | 2844461451 | 284 |
| 436 | iso_pu_bacteria | 2847939898 | 2847947443 | 284 |
| 437 | iso_pu_bacteria | 2852387548 | 2852395064 | 284 |
| 438 | iso_pu_bacteria | 2852684882 | 2852688563 | 284 |
| 439 | iso_pu_bacteria | 2854916844 | 2854919307 | 284 |
| 440 | iso_pu_bacteria | 2856320880 | 2856326952 | 284 |
| 441 | iso_pu_bacteria | 2856328259 | 2856333071 | 284 |
| 442 | iso_pu_bacteria | 2856334872 | 2856337629 | 284 |
| 443 | iso_pu_bacteria | 2856342000 | 2856349276 | 284 |
| 444 | iso_pu_bacteria | 2857367948 | 2857368988 | 284 |
| 445 | iso_pu_bacteria | 2863421361 | 2863423436 | 284 |
| 446 | iso_pu_bacteria | 2869162929 | 2869166882 | 284 |
| 447 | iso_pu_bacteria | 2869169390 | 2869169763 | 284 |
| 448 | iso_pu_bacteria | 2869234852 | 2869236193 | 284 |
| 449 | iso_pu_bacteria | 2869242130 | 2869244352 | 284 |
| 450 | iso_pu_bacteria | 2869249662 | 2869252902 | 284 |
| 451 | iso_pu_bacteria | 2869256925 | 2869257051 | 284 |
| 452 | iso_pu_bacteria | 2869264136 | 2869267428 | 284 |
| 453 | iso_pu_bacteria | 2869271264 | 2869273433 | 284 |
| 454 | iso_pu_bacteria | 2869278585 | 2869283501 | 284 |
| 455 | iso_pu_bacteria | 2870068957 | 2870074594 | 284 |
| 456 | iso_pu_bacteria | 2871435913 | 2871441178 | 284 |
| 457 | iso_pu_bacteria | 2871451962 | 2871455051 | 284 |
| 458 | iso_pu_bacteria | 2871459585 | 2871465325 | 284 |
| 459 | iso_pu_bacteria | 2871474448 | 2871478708 | 284 |
| 460 | iso_pu_bacteria | 2871481445 | 2871481928 | 284 |
| 461 | iso_pu_bacteria | 2874109183 | 2874116471 | 284 |
| 462 | iso_pu_bacteria | 2874116593 | 2874123398 | 284 |
| 463 | iso_pu_bacteria | 2874123672 | 2874126165 | 284 |
| 464 | iso_pu_bacteria | 2874131515 | 2874134472 | 284 |
| 465 | iso_pu_bacteria | 2874139085 | 2874143811 | 284 |
| 466 | iso_pu_bacteria | 2874162495 | 2874166196 | 284 |
| 467 | iso_pu_bacteria | 2874168670 | 2874170248 | 284 |
| 468 | iso_pu_bacteria | 2876363079 | 2876368917 | 284 |
| 469 | iso_pu_bacteria | 2876386047 | 2876386788 | 284 |
| 470 | iso_pu_bacteria | 2876399893 | 2876403472 | 284 |
| 471 | iso_pu_bacteria | 2876406927 | 2876413183 | 284 |
| 472 | iso_pu_bacteria | 2876420981 | 2876426574 | 284 |
| 473 | iso_pu_bacteria | 2878730984 | 2878735906 | 284 |
| 474 | iso_pu_bacteria | 2878738818 | 2878739071 | 284 |
| 475 | iso_pu_bacteria | 2878774303 | 2878778177 | 284 |
| 476 | iso_pu_bacteria | 2878781027 | 2878783386 | 284 |
| 477 | iso_pu_bacteria | 2878788777 | 2878794232 | 284 |
| 478 | iso_pu_bacteria | 2882456835 | 2882457773 | 284 |
| 479 | iso_pu_bacteria | 2882632389 | 2882633373 | 284 |
| 480 | iso_pu_bacteria | 2885305155 | 2885310781 | 284 |
| 481 | iso_pu_bacteria | 2885312484 | 2885316739 | 284 |
| 482 | iso_pu_bacteria | 2885326080 | 2885330695 | 284 |
| 483 | iso_pu_bacteria | 2886627955 | 2886633395 | 284 |
| 484 | iso_pu_bacteria | 2888343758 | 2888348178 | 284 |
| 485 | iso_pu_bacteria | 2899792073 | 2899793820 | 284 |
| 486 | iso_pu_bacteria | 2899845264 | 2899846751 | 284 |
| 487 | iso_pu_bacteria | 2900577576 | 2900582781 | 284 |
| 488 | iso_pu_bacteria | 2903448605 | 2903450858 | 284 |
| 489 | iso_pu_bacteria | 2903513507 | 2903513651 | 284 |
| 490 | iso_pu_bacteria | 2903521522 | 2903527915 | 284 |
| 491 | iso_pu_bacteria | 2903528002 | 2903529773 | 284 |
| 492 | iso_pu_bacteria | 2904541872 | 2904545423 | 284 |
| 493 | iso_pu_bacteria | 2904564687 | 2904569692 | 284 |
| 494 | iso_pu_bacteria | 2904571731 | 2904577003 | 284 |
| 495 | iso_pu_bacteria | 2906363423 | 2906364756 | 284 |
| 496 | iso_pu_bacteria | 2906370794 | 2906371295 | 284 |
| 497 | iso_pu_bacteria | 2906386501 | 2906392451 | 284 |
| 498 | iso_pu_bacteria | 2906393657 | 2906400746 | 284 |
| 499 | iso_pu_bacteria | 2906401398 | 2906405847 | 284 |
| 500 | iso_pu_bacteria | 2906408224 | 2906409497 | 284 |
| 501 | iso_pu_bacteria | 2908446538 | 2908449442 | 284 |
| 502 | iso_pu_bacteria | 2909042592 | 2909044943 | 284 |
| 503 | iso_pu_bacteria | 2916035215 | 2916040689 | 284 |
| 504 | iso_pu_bacteria | 2919085039 | 2919086260 | 284 |
| 505 | iso_pu_bacteria | 2919130084 | 2919133805 | 284 |
| 506 | iso_pu_bacteria | 2919166419 | 2919169909 | 284 |
| 507 | iso_pu_bacteria | 2919408235 | 2919408847 | 284 |
| 508 | iso_pu_bacteria | 2920760137 | 2920767133 | 284 |
| 509 | iso_pu_bacteria | 2922151315 | 2922155020 | 284 |
| 510 | iso_pu_bacteria | 2922172374 | 2922175902 | 284 |
| 511 | iso_pu_bacteria | 2923634449 | 2923634681 | 284 |
| 512 | iso_pu_bacteria | 2924710171 | 2924714255 | 284 |
| 513 | iso_pu_bacteria | 2924718760 | 2924723619 | 284 |
| 514 | iso_pu_bacteria | 2924733363 | 2924735033 | 284 |
| 515 | iso_pu_bacteria | 2924748358 | 2924752049 | 284 |
| 516 | iso_pu_bacteria | 2924754689 | 2924756886 | 284 |
| 517 | iso_pu_bacteria | 2924776078 | 2924776433 | 284 |
| 518 | iso_pu_bacteria | 2926760298 | 2926765563 | 284 |
| 519 | iso_pu_bacteria | 2927833300 | 2927834268 | 284 |
| 520 | iso_pu_bacteria | 2928058823 | 2928059976 | 284 |
| 521 | iso_pu_bacteria | 2928125067 | 2928126392 | 284 |
| 522 | iso_pu_bacteria | 2928157003 | 2928162309 | 284 |
| 523 | iso_pu_bacteria | 2928163908 | 2928166272 | 284 |
| 524 | iso_pu_bacteria | 2928536128 | 2928536908 | 284 |
| 525 | iso_pu_bacteria | 2929160207 | 2929168072 | 284 |
| 526 | iso_pu_bacteria | 2929195423 | 2929199902 | 284 |
| 527 | iso_pu_bacteria | 2933570622 | 2933574455 | 284 |
| 528 | iso_pu_bacteria | 2935630451 | 2935635988 | 284 |
| 529 | iso_pu_bacteria | 2935894831 | 2935900907 | 284 |
| 530 | iso_pu_bacteria | 2935901341 | 2935906551 | 284 |
| 531 | iso_pu_bacteria | 2936381700 | 2936382571 | 284 |
| 532 | iso_pu_bacteria | 2937539931 | 2937541835 | 284 |
| 533 | iso_pu_bacteria | 2937836603 | 2937836920 | 284 |
| 534 | iso_pu_bacteria | 2937848649 | 2937852620 | 284 |
| 535 | iso_pu_bacteria | 2937861824 | 2937862438 | 284 |
| 536 | iso_pu_bacteria | 2937877337 | 2937884113 | 284 |
| 537 | iso_pu_bacteria | 2937972304 | 2937979781 | 284 |
| 538 | iso_pu_bacteria | 2939568625 | 2939569029 | 284 |
| 539 | iso_pu_bacteria | 2939642701 | 2939643922 | 284 |
| 540 | iso_pu_bacteria | 2939669807 | 2939670164 | 284 |
| 541 | iso_pu_bacteria | 2941507105 | 2941512708 | 284 |
| 542 | iso_pu_bacteria | 2941515067 | 2941520454 | 284 |
| 543 | iso_pu_bacteria | 2941523033 | 2941528468 | 284 |
| 544 | iso_pu_bacteria | 2958034702 | 2958040013 | 284 |
| 545 | iso_pu_bacteria | 2958041894 | 2958054357 | 284 |
| 546 | iso_pu_bacteria | 2958064165 | 2958071134 | 284 |
| 547 | iso_pu_bacteria | 2958071322 | 2958076807 | 284 |
| 548 | iso_pu_bacteria | 2958084443 | 2958091424 | 284 |
| 549 | iso_pu_bacteria | 2958092219 | 2958098785 | 284 |
| 550 | iso_pu_bacteria | 2958108152 | 2958111171 | 284 |
| 551 | iso_pu_bacteria | 2958122699 | 2958122701 | 284 |
| 552 | iso_pu_bacteria | 2958144490 | 2958146655 | 284 |
| 553 | iso_pu_bacteria | 2958158011 | 2958160696 | 284 |
| 554 | iso_pu_bacteria | 2961136820 | 2961139380 | 284 |
| 555 | iso_pu_bacteria | 2961183825 | 2961188626 | 284 |
| 556 | iso_pu_bacteria | 2963644680 | 2963647279 | 284 |
| 557 | iso_pu_bacteria | 2964698721 | 2964700452 | 284 |
| 558 | iso_pu_bacteria | 2965025482 | 2965028038 | 284 |
| 559 | iso_pu_bacteria | 2965032056 | 2965039197 | 284 |
| 560 | iso_pu_bacteria | 2965040258 | 2965044930 | 284 |
| 561 | iso_pu_bacteria | 2965089291 | 2965092937 | 284 |
| 562 | iso_pu_bacteria | 2965102966 | 2965106856 | 284 |
| 563 | iso_pu_bacteria | 2965110997 | 2965118794 | 284 |
| 564 | iso_pu_bacteria | 2968016561 | 2968018856 | 284 |
| 565 | iso_pu_bacteria | 2968083720 | 2968087886 | 284 |
| 566 | iso_pu_bacteria | 2970469710 | 2970470971 | 284 |
| 567 | iso_pu_bacteria | 2970489779 | 2970495392 | 284 |
| 568 | iso_pu_bacteria | 2970524798 | 2970531497 | 284 |
| 569 | iso_pu_bacteria | 2970532167 | 2970535179 | 284 |
| 570 | iso_pu_bacteria | 2970540015 | 2970546227 | 284 |
| 571 | iso_pu_bacteria | 2970547951 | 2970549130 | 284 |
| 572 | iso_pu_bacteria | 2970593180 | 2970598074 | 284 |
| 573 | iso_pu_bacteria | 2970619444 | 2970622825 | 284 |
| 574 | iso_pu_bacteria | 2970627176 | 2970628006 | 284 |
| 575 | iso_pu_bacteria | 2974310843 | 2974312275 | 284 |
| 576 | iso_pu_bacteria | 2977851361 | 2977858043 | 284 |
| 577 | iso_pu_bacteria | 2977872689 | 2977873123 | 284 |
| 578 | iso_pu_bacteria | 2977898635 | 2977904200 | 284 |
| 579 | iso_pu_bacteria | 2977907340 | 2977910721 | 284 |
| 580 | iso_pu_bacteria | 2977935797 | 2977939243 | 284 |
| 581 | iso_pu_bacteria | 2977950692 | 2977951561 | 284 |
| 582 | iso_pu_bacteria | 2977957713 | 2977958611 | 284 |
| 583 | iso_pu_bacteria | 2977986579 | 2977989568 | 284 |
| 584 | iso_pu_bacteria | 2978969890 | 2978972367 | 284 |
| 585 | iso_pu_bacteria | 2979100975 | 2979103325 | 284 |
| 586 | iso_pu_bacteria | 2979764755 | 2979767215 | 284 |
| 587 | iso_pu_bacteria | 2979772303 | 2979775880 | 284 |
| 588 | iso_pu_bacteria | 2979793036 | 2979797511 | 284 |
| 589 | iso_pu_bacteria | 2980125574 | 2980127584 | 284 |
| 590 | iso_pu_bacteria | 2981990288 | 2981995642 | 284 |
| 591 | iso_pu_bacteria | 2984587000 | 2984590616 | 284 |
| 592 | iso_pu_bacteria | 2987645492 | 2987645995 | 284 |
| 593 | iso_pu_bacteria | 2987673487 | 2987675956 | 284 |
| 594 | iso_pu_bacteria | 2996310559 | 2996312951 | 284 |
| 595 | iso_pu_bacteria | 2996348954 | 2996349717 | 284 |
| 596 | iso_pu_bacteria | 2996386984 | 2996389435 | 284 |
| 597 | iso_pu_bacteria | 2996893221 | 2996894809 | 284 |
| 598 | iso_pu_bacteria | 3000135777 | 3000136362 | 284 |
| 599 | iso_pu_bacteria | 3004167301 | 3004170504 | 284 |
| 600 | iso_pu_bacteria | 3004195979 | 3004203164 | 284 |
| 601 | iso_pu_bacteria | 3004232784 | 3004237826 | 284 |
| 602 | iso_pu_bacteria | 3004239961 | 3004242948 | 284 |
| 603 | iso_pu_bacteria | 3004248173 | 3004248886 | 284 |
| 604 | iso_pu_bacteria | 3004275668 | 3004276423 | 284 |
| 605 | iso_pu_bacteria | 3004289098 | 3004289098 | 284 |
| 606 | iso_pu_bacteria | 3004334049 | 3004334973 | 284 |
| 607 | iso_pu_bacteria | 3005416602 | 3005422765 | 284 |
| 608 | iso_pu_bacteria | 637000159 | 637075026 | 284 |
| 609 | iso_pu_bacteria | 641736154 | 642414341 | 284 |
| 610 | iso_pu_bacteria | 643692032 | 643822484 | 284 |
| 611 | iso_pu_bacteria | 649633066 | 649874298 | 284 |
| 612 | iso_pu_bacteria | 650716007 | 650741767 | 284 |
| 613 | iso_pu_bacteria | 8004300914 | 8004307336 | 284 |
| 614 | iso_pu_bacteria | 8004395343 | 8004402280 | 284 |
| 615 | iso_pu_bacteria | 8004633249 | 8004640056 | 284 |
| 616 | iso_pu_bacteria | 8004727605 | 8004727943 | 284 |
| 617 | iso_pu_bacteria | 8005275841 | 8005276112 | 284 |
| 618 | iso_pu_bacteria | 8005282627 | 8005287344 | 284 |
| 619 | iso_pu_bacteria | 8005289223 | 8005289918 | 284 |
| 620 | iso_pu_bacteria | 8005307578 | 8005311547 | 284 |
| 621 | iso_pu_bacteria | 8005314921 | 8005321699 | 284 |
| 622 | iso_pu_bacteria | 8005382845 | 8005389285 | 284 |
| 623 | iso_pu_bacteria | 8005395548 | 8005396852 | 284 |
| 624 | iso_pu_bacteria | 8005430974 | 8005435740 | 284 |
| 625 | iso_pu_bacteria | 8005460587 | 8005466239 | 284 |
| 626 | iso_pu_bacteria | 8005484373 | 8005486095 | 284 |
| 627 | iso_pu_bacteria | 8005497431 | 8005503484 | 284 |
| 628 | iso_pu_bacteria | 8005556819 | 8005563241 | 284 |
| 629 | iso_pu_bacteria | 8005570704 | 8005575942 | 284 |
| 630 | iso_pu_bacteria | 8005619151 | 8005625786 | 284 |
| 631 | iso_pu_bacteria | 8005626139 | 8005632043 | 284 |
| 632 | iso_pu_bacteria | 8005668836 | 8005675362 | 284 |
| 633 | iso_pu_bacteria | 8005682033 | 8005685071 | 284 |
| 634 | iso_pu_bacteria | 8005688590 | 8005688683 | 284 |
| 635 | iso_pu_bacteria | 8005695170 | 8005695293 | 284 |
| 636 | iso_pu_bacteria | 8018127388 | 8018134586 | 284 |
| 637 | iso_pu_bacteria | 8018176218 | 8018180697 | 284 |
| 638 | iso_pu_bacteria | 8018221730 | 8018222357 | 284 |
| 639 | iso_pu_bacteria | 8018405270 | 8018408304 | 284 |
| 640 | iso_pu_bacteria | 8020807995 | 8020813463 | 284 |
| 641 | iso_pu_bacteria | 8020938398 | 8020940623 | 284 |
| 642 | iso_pu_bacteria | 8020945358 | 8020953049 | 284 |
| 643 | iso_pu_bacteria | 8020953355 | 8020954203 | 284 |
| 644 | iso_pu_bacteria | 8023680758 | 8023686066 | 284 |
| 645 | iso_pu_bacteria | 8040167225 | 8040170077 | 284 |
| 646 | iso_pu_bacteria | 8040173305 | 8040175300 | 284 |
| 647 | iso_pu_bacteria | 8046767195 | 8046768940 | 284 |
| 648 | iso_pu_bacteria | 8054844752 | 8054848149 | 284 |
| 649 | iso_pu_bacteria | 8054849141 | 8054852599 | 284 |
| 650 | iso_pu_bacteria | 8055431914 | 8055434737 | 284 |
| 651 | iso_pu_bacteria | 8055617313 | 8055622297 | 284 |
| 652 | iso_pu_bacteria | 8056375014 | 8056381925 | 284 |
| 653 | 3300002738 | JGI25154J39366_1000451 | JGI25154J39366_100045125 | 285 |
| 654 | 3300005548 | Ga0070665_100095775 | Ga0070665_1000957752 | 285 |
| 655 | 3300005548 | Ga0070665_100246946 | Ga0070665_1002469462 | 285 |
| 656 | 3300009036 | Ga0105244_10000037 | Ga0105244_10000037136 | 285 |
| 657 | 3300009545 | Ga0105237_10000328 | Ga0105237_1000032865 | 285 |
| 658 | 3300010375 | Ga0105239_10001783 | Ga0105239_1000178320 | 285 |
| 659 | 3300013105 | Ga0157369_10008371 | Ga0157369_100083717 | 285 |
| 660 | 3300025233 | Ga0209437_102301 | Ga0209437_1023012 | 285 |
| 661 | 3300025246 | Ga0209646_1000077 | Ga0209646_1000077138 | 285 |
| 662 | 3300025728 | Ga0207655_1000117 | Ga0207655_1000117136 | 285 |
| 663 | 3300025914 | Ga0207671_10001785 | Ga0207671_1000178519 | 285 |
| 664 | 3300025916 | Ga0207663_10040563 | Ga0207663_100405632 | 285 |
| 665 | 3300028379 | Ga0268266_10000429 | Ga0268266_1000042955 | 285 |
| 666 | 3300028379 | Ga0268266_10014608 | Ga0268266_100146087 | 285 |
| 667 | 3300028379 | Ga0268266_10538016 | Ga0268266_105380161 | 285 |
| 668 | 3300031090 | Ga0265760_10020954 | Ga0265760_100209542 | 285 |
| 669 | 3300035117 | Ga0373953_0007239 | Ga0373953_0007239_1211_2089 | 285 |
| 670 | 3300046462 | Ga0495651_0061328 | Ga0495651_0061328_1785_2663 | 285 |
| 671 | 3300046507 | Ga0495606_0007332 | Ga0495606_0007332_7358_8239 | 285 |
| 672 | 3300046516 | Ga0495628_0112163 | Ga0495628_0112163_842_1720 | 285 |
| 673 | 3300046678 | Ga0495599_0044563 | Ga0495599_0044563_1491_2369 | 285 |
| 674 | 3300046679 | Ga0495623_0096483 | Ga0495623_0096483_89_967 | 285 |
| 675 | 3300053077 | Ga0495601_0056379 | Ga0495601_0056379_1329_2207 | 285 |
| 676 | 3300053177 | Ga0500636_0122489 | Ga0500636_0122489_240_1112 | 285 |
| 677 | iso_pu_bacteria | 2513237146 | 2513929226 | 285 |
| 678 | iso_pu_bacteria | 2599185170 | 2599415547 | 285 |
| 679 | iso_pu_bacteria | 2643221596 | 2643990715 | 285 |
| 680 | iso_pu_bacteria | 2838035591 | 2838035663 | 285 |
| 681 | iso_pu_bacteria | 2838661181 | 2838665281 | 285 |
| 682 | 3300003323 | rootH1_10192974 | rootH1_101929742 | 286 |
| 683 | 3300005564 | Ga0070664_100179353 | Ga0070664_1001793532 | 286 |
| 684 | 3300005841 | Ga0068863_100556352 | Ga0068863_1005563521 | 286 |
| 685 | 3300005843 | Ga0068860_100148663 | Ga0068860_1001486632 | 286 |
| 686 | 3300006051 | Ga0075364_10003881 | Ga0075364_1000388110 | 286 |
| 687 | 3300006353 | Ga0075370_10018625 | Ga0075370_100186253 | 286 |
| 688 | 3300009093 | Ga0105240_10024462 | Ga0105240_100244628 | 286 |
| 689 | 3300009177 | Ga0105248_10009030 | Ga0105248_100090302 | 286 |
| 690 | 3300010375 | Ga0105239_10500927 | Ga0105239_105009272 | 286 |
| 691 | 3300013296 | Ga0157374_10003851 | Ga0157374_1000385110 | 286 |
| 692 | 3300014325 | Ga0163163_10003284 | Ga0163163_100032844 | 286 |
| 693 | 3300014968 | Ga0157379_10024669 | Ga0157379_100246693 | 286 |
| 694 | 3300021361 | Ga0213872_10009653 | Ga0213872_100096534 | 286 |
| 695 | 3300021377 | Ga0213874_10053187 | Ga0213874_100531872 | 286 |
| 696 | 3300021384 | Ga0213876_10001656 | Ga0213876_1000165614 | 286 |
| 697 | 3300021384 | Ga0213876_10019582 | Ga0213876_100195822 | 286 |
| 698 | 3300025913 | Ga0207695_10069666 | Ga0207695_100696662 | 286 |
| 699 | 3300025913 | Ga0207695_10115904 | Ga0207695_101159043 | 286 |
| 700 | 3300025945 | Ga0207679_10163918 | Ga0207679_101639182 | 286 |
| 701 | 3300026075 | Ga0207708_10207808 | Ga0207708_102078082 | 286 |
| 702 | 3300026088 | Ga0207641_10617242 | Ga0207641_106172421 | 286 |
| 703 | 3300027312 | Ga0209371_1005487 | Ga0209371_10054872 | 286 |
| 704 | 3300030500 | Ga0268256_1005395 | Ga0268256_10053954 | 286 |
| 705 | 3300031507 | Ga0307509_10427000 | Ga0307509_104270002 | 286 |
| 706 | 3300033180 | Ga0307510_10166774 | Ga0307510_101667741 | 286 |
| 707 | 3300039437 | Ga0436365_0475170 | Ga0436365_0475170_3388_4260 | 286 |
| 708 | 3300039438 | Ga0436360_0888954 | Ga0436360_0888954_918_1823 | 286 |
| 709 | 3300039447 | Ga0436361_0040126 | Ga0436361_0040126_588_1487 | 286 |
| 710 | 3300039447 | Ga0436361_0060388 | Ga0436361_0060388_114_1019 | 286 |
| 711 | 3300039447 | Ga0436361_0474832 | Ga0436361_0474832_16_921 | 286 |
| 712 | 3300039447 | Ga0436361_1170673 | Ga0436361_1170673_134_1039 | 286 |
| 713 | 3300039450 | Ga0436363_0029129 | Ga0436363_0029129_406_1296 | 286 |
| 714 | 3300044658 | Ga0466972_0103632 | Ga0466972_0103632_51_911 | 286 |
| 715 | 3300044684 | Ga0466966_0036335 | Ga0466966_0036335_140_1000 | 286 |
| 716 | 3300044684 | Ga0466966_0107924 | Ga0466966_0107924_718_1578 | 286 |
| 717 | 3300044693 | Ga0466961_0108367 | Ga0466961_0108367_170_1030 | 286 |
| 718 | 3300045049 | Ga0466959_0020051 | Ga0466959_0020051_361_1221 | 286 |
| 719 | 3300046471 | Ga0495650_0002581 | Ga0495650_0002581_13208_14095 | 286 |
| 720 | 3300046491 | Ga0495584_0132637 | Ga0495584_0132637_316_1212 | 286 |
| 721 | 3300046500 | Ga0495596_0003174 | Ga0495596_0003174_187_1074 | 286 |
| 722 | 3300046520 | Ga0495637_0095983 | Ga0495637_0095983_34_921 | 286 |
| 723 | 3300046524 | Ga0495648_0040987 | Ga0495648_0040987_1944_2804 | 286 |
| 724 | 3300046538 | Ga0495609_0021536 | Ga0495609_0021536_203_1090 | 286 |
| 725 | 3300046794 | Ga0495589_0066227 | Ga0495589_0066227_821_1708 | 286 |
| 726 | 3300047320 | Ga0495672_0083174 | Ga0495672_0083174_248_1135 | 286 |
| 727 | 3300047321 | Ga0495676_0100364 | Ga0495676_0100364_1196_2083 | 286 |
| 728 | 3300048905 | Ga0496102_0333118 | Ga0496102_0333118_146_1006 | 286 |
| 729 | 3300048906 | Ga0496103_0206039 | Ga0496103_0206039_96_956 | 286 |
| 730 | 3300048907 | Ga0496104_0118725 | Ga0496104_0118725_533_1435 | 286 |
| 731 | 3300048911 | Ga0496108_0003772 | Ga0496108_0003772_9698_10600 | 286 |
| 732 | 3300048912 | Ga0496109_0004165 | Ga0496109_0004165_5070_5972 | 286 |
| 733 | 3300048913 | Ga0496110_0099908 | Ga0496110_0099908_1221_2123 | 286 |
| 734 | 3300048915 | Ga0496112_0002096 | Ga0496112_0002096_11481_12383 | 286 |
| 735 | 3300048928 | Ga0496125_0069583 | Ga0496125_0069583_1885_2748 | 286 |
| 736 | 3300049589 | Ga0501073_0001442 | Ga0501073_0001442_10242_11135 | 286 |
| 737 | 3300049590 | Ga0501074_0000095 | Ga0501074_0000095_36449_37342 | 286 |
| 738 | 3300049742 | Ga0501080_0000250 | Ga0501080_0000250_3263_4156 | 286 |
| 739 | 3300049758 | Ga0501241_010227 | Ga0501241_010227_768_1640 | 286 |
| 740 | 3300049763 | Ga0501266_001145 | Ga0501266_001145_1101_1988 | 286 |
| 741 | 3300050494 | nmdc:mga06z11_86835_c1 | nmdc:mga06z11_86835_c1_619_1521 | 286 |
| 742 | 3300050496 | nmdc:mga07m45_24549_c1 | nmdc:mga07m45_24549_c1_299_1201 | 286 |
| 743 | 3300050512 | nmdc:mga0n895_274736_c1 | nmdc:mga0n895_274736_c1_462_1376 | 286 |
| 744 | 3300053125 | Ga0500618_003301 | Ga0500618_003301_3220_4083 | 286 |
| 745 | iso_pu_bacteria | 2734482264 | 2735834320 | 286 |
| 746 | iso_pu_bacteria | 2842718218 | 2842720365 | 286 |
| 747 | iso_pu_bacteria | 2933016740 | 2933022091 | 286 |
| 748 | 3300002737 | JGI25162J39368_1006232 | JGI25162J39368_10062322 | 287 |
| 749 | 3300003187 | JGI25151J46595_10002329 | JGI25151J46595_1000232916 | 287 |
| 750 | 3300003320 | rootH2_10057798 | rootH2_100577982 | 287 |
| 751 | 3300003771 | Ga0055526_1001272 | Ga0055526_10012729 | 287 |
| 752 | 3300003775 | Ga0055524_1001036 | Ga0055524_100103617 | 287 |
| 753 | 3300003784 | Ga0055534_1000981 | Ga0055534_10009814 | 287 |
| 754 | 3300005337 | Ga0070682_100041799 | Ga0070682_1000417992 | 287 |
| 755 | 3300005544 | Ga0070686_100227886 | Ga0070686_1002278862 | 287 |
| 756 | 3300005548 | Ga0070665_100011006 | Ga0070665_1000110068 | 287 |
| 757 | 3300005841 | Ga0068863_100134507 | Ga0068863_1001345072 | 287 |
| 758 | 3300005937 | Ga0081455_10004123 | Ga0081455_1000412312 | 287 |
| 759 | 3300006038 | Ga0075365_10132810 | Ga0075365_101328102 | 287 |
| 760 | 3300006051 | Ga0075364_10228449 | Ga0075364_102284492 | 287 |
| 761 | 3300006177 | Ga0075362_10111342 | Ga0075362_101113422 | 287 |
| 762 | 3300006178 | Ga0075367_10134593 | Ga0075367_101345932 | 287 |
| 763 | 3300006195 | Ga0075366_10220974 | Ga0075366_102209742 | 287 |
| 764 | 3300013100 | Ga0157373_10001122 | Ga0157373_1000112215 | 287 |
| 765 | 3300015261 | Ga0182006_1000051 | Ga0182006_100005198 | 287 |
| 766 | 3300015261 | Ga0182006_1016700 | Ga0182006_10167002 | 287 |
| 767 | 3300021388 | Ga0213875_10075069 | Ga0213875_100750692 | 287 |
| 768 | 3300025233 | Ga0209437_100261 | Ga0209437_1002615 | 287 |
| 769 | 3300025263 | Ga0209565_1000216 | Ga0209565_100021635 | 287 |
| 770 | 3300025273 | Ga0209673_1005542 | Ga0209673_10055427 | 287 |
| 771 | 3300025291 | Ga0209675_1000299 | Ga0209675_100029943 | 287 |
| 772 | 3300025294 | Ga0209025_1000589 | Ga0209025_100058935 | 287 |
| 773 | 3300025295 | Ga0209564_1000491 | Ga0209564_100049142 | 287 |
| 774 | 3300025299 | Ga0209256_1000519 | Ga0209256_100051942 | 287 |
| 775 | 3300026088 | Ga0207641_10119187 | Ga0207641_101191872 | 287 |
| 776 | 3300028379 | Ga0268266_10023448 | Ga0268266_100234485 | 287 |
| 777 | 3300037853 | Ga0436364_0081014 | Ga0436364_0081014_4920_5801 | 287 |
| 778 | 3300041512 | Ga0451853_0958912 | Ga0451853_0958912_3846_4709 | 287 |
| 779 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_965651_966517 | 287 |
| 780 | 3300042016 | Ga0439463_005881 | Ga0439463_005881_2049_2912 | 287 |
| 781 | 3300044842 | Ga0466957_0132513 | Ga0466957_0132513_556_1431 | 287 |
| 782 | 3300046463 | Ga0495653_0002018 | Ga0495653_0002018_891_1775 | 287 |
| 783 | 3300046472 | Ga0495580_0046384 | Ga0495580_0046384_400_1284 | 287 |
| 784 | 3300046516 | Ga0495628_0021277 | Ga0495628_0021277_3882_4766 | 287 |
| 785 | 3300046680 | Ga0495646_0005124 | Ga0495646_0005124_3984_4868 | 287 |
| 786 | 3300046690 | Ga0495624_0006209 | Ga0495624_0006209_4463_5347 | 287 |
| 787 | 3300047317 | Ga0495604_0005708 | Ga0495604_0005708_5013_5876 | 287 |
| 788 | 3300047320 | Ga0495672_0103863 | Ga0495672_0103863_598_1461 | 287 |
| 789 | 3300047444 | Ga0495675_0015361 | Ga0495675_0015361_1152_2015 | 287 |
| 790 | 3300047673 | Ga0495593_0004348 | Ga0495593_0004348_10_894 | 287 |
| 791 | 3300048919 | Ga0496116_0029359 | Ga0496116_0029359_2100_2975 | 287 |
| 792 | 3300048920 | Ga0496117_0058680 | Ga0496117_0058680_66_929 | 287 |
| 793 | 3300049570 | Ga0501033_0040914 | Ga0501033_0040914_2459_3355 | 287 |
| 794 | 3300049571 | Ga0501034_0093395 | Ga0501034_0093395_1053_1949 | 287 |
| 795 | 3300049573 | Ga0501037_0247171 | Ga0501037_0247171_326_1222 | 287 |
| 796 | 3300049573 | Ga0501037_0265846 | Ga0501037_0265846_272_1159 | 287 |
| 797 | 3300049581 | Ga0501047_0004190 | Ga0501047_0004190_11257_12153 | 287 |
| 798 | 3300049586 | Ga0501070_0022723 | Ga0501070_0022723_2553_3440 | 287 |
| 799 | 3300049742 | Ga0501080_0082904 | Ga0501080_0082904_455_1342 | 287 |
| 800 | 3300049822 | Ga0501035_0001937 | Ga0501035_0001937_7089_7985 | 287 |
| 801 | 3300049823 | Ga0501044_0001869 | Ga0501044_0001869_12489_13385 | 287 |
| 802 | 3300049823 | Ga0501044_0525652 | Ga0501044_0525652_27_914 | 287 |
| 803 | 3300050492 | nmdc:mga0yw44_153095_c1 | nmdc:mga0yw44_153095_c1_203_1081 | 287 |
| 804 | 3300050494 | nmdc:mga06z11_162189_c1 | nmdc:mga06z11_162189_c1_15_893 | 287 |
| 805 | 3300050511 | nmdc:mga08y16_778154_c1 | nmdc:mga08y16_778154_c1_23_901 | 287 |
| 806 | iso_pu_bacteria | 2831864461 | 2831865222 | 287 |
| 807 | 2162886007 | SwRhRL2b_contig_1809446 | SwRhRL2b_0289.00006090 | 288 |
| 808 | 2162886007 | SwRhRL2b_contig_239577 | SwRhRL2b_0191.00002310 | 288 |
| 809 | 2162886007 | SwRhRL2b_contig_97959 | SwRhRL2b_0733.00004650 | 288 |
| 810 | 2162886011 | MRS1b_contig_984201 | MRS1b_0819.00002140 | 288 |
| 811 | 3300001915 | JGI24741J21665_1000141 | JGI24741J21665_10001416 | 288 |
| 812 | 3300001915 | JGI24741J21665_1003056 | JGI24741J21665_10030562 | 288 |
| 813 | 3300001979 | JGI24740J21852_10000026 | JGI24740J21852_1000002643 | 288 |
| 814 | 3300001979 | JGI24740J21852_10001737 | JGI24740J21852_100017372 | 288 |
| 815 | 3300001989 | JGI24739J22299_10034747 | JGI24739J22299_100347472 | 288 |
| 816 | 3300002075 | JGI24738J21930_10000927 | JGI24738J21930_100009277 | 288 |
| 817 | 3300002705 | JGI25156J39149_1003279 | JGI25156J39149_10032792 | 288 |
| 818 | 3300002705 | JGI25156J39149_1007730 | JGI25156J39149_10077303 | 288 |
| 819 | 3300002737 | JGI25162J39368_1000177 | JGI25162J39368_100017710 | 288 |
| 820 | 3300002737 | JGI25162J39368_1000323 | JGI25162J39368_100032316 | 288 |
| 821 | 3300002737 | JGI25162J39368_1000803 | JGI25162J39368_100080312 | 288 |
| 822 | 3300002741 | JGI25157J39369_1001008 | JGI25157J39369_10010088 | 288 |
| 823 | 3300002772 | JGI25164J39214_1000032 | JGI25164J39214_100003229 | 288 |
| 824 | 3300002773 | JGI25152J39213_1000657 | JGI25152J39213_100065717 | 288 |
| 825 | 3300002773 | JGI25152J39213_1002074 | JGI25152J39213_10020744 | 288 |
| 826 | 3300002773 | JGI25152J39213_1007876 | JGI25152J39213_10078762 | 288 |
| 827 | 3300002987 | JGI25159J45721_1000276 | JGI25159J45721_100027610 | 288 |
| 828 | 3300003187 | JGI25151J46595_10000341 | JGI25151J46595_100003418 | 288 |
| 829 | 3300003187 | JGI25151J46595_10000485 | JGI25151J46595_1000048534 | 288 |
| 830 | 3300003214 | JGI25165J46597_1000136 | JGI25165J46597_100013688 | 288 |
| 831 | 3300003214 | JGI25165J46597_1000406 | JGI25165J46597_100040629 | 288 |
| 832 | 3300003214 | JGI25165J46597_1000415 | JGI25165J46597_100041510 | 288 |
| 833 | 3300003214 | JGI25165J46597_1007210 | JGI25165J46597_10072102 | 288 |
| 834 | 3300003215 | JGI25153J46596_10000344 | JGI25153J46596_1000034430 | 288 |
| 835 | 3300003215 | JGI25153J46596_10003378 | JGI25153J46596_100033789 | 288 |
| 836 | 3300003215 | JGI25153J46596_10004937 | JGI25153J46596_100049379 | 288 |
| 837 | 3300003316 | rootH1_10028145 | rootH1_100281456 | 288 |
| 838 | 3300003316 | rootH1_10052697 | rootH1_100526975 | 288 |
| 839 | 3300003320 | rootH2_10054426 | rootH2_100544263 | 288 |
| 840 | 3300003322 | rootL2_10070782 | rootL2_100707823 | 288 |
| 841 | 3300003323 | rootH1_10072615 | rootH1_100726152 | 288 |
| 842 | 3300003354 | JGI25160J50197_1000023 | JGI25160J50197_100002399 | 288 |
| 843 | 3300003354 | JGI25160J50197_1000384 | JGI25160J50197_100038417 | 288 |
| 844 | 3300003374 | JGI25161J50226_1000012 | JGI25161J50226_100001299 | 288 |
| 845 | 3300003374 | JGI25161J50226_1001233 | JGI25161J50226_10012335 | 288 |
| 846 | 3300003751 | Ga0055538_1003626 | Ga0055538_10036262 | 288 |
| 847 | 3300003751 | Ga0055538_1005754 | Ga0055538_10057541 | 288 |
| 848 | 3300003752 | Ga0055539_1000053 | Ga0055539_100005346 | 288 |
| 849 | 3300003752 | Ga0055539_1003561 | Ga0055539_10035612 | 288 |
| 850 | 3300003756 | Ga0055533_1003976 | Ga0055533_10039762 | 288 |
| 851 | 3300003756 | Ga0055533_1003999 | Ga0055533_10039992 | 288 |
| 852 | 3300003758 | Ga0055532_1000033 | Ga0055532_100003388 | 288 |
| 853 | 3300003758 | Ga0055532_1000301 | Ga0055532_100030120 | 288 |
| 854 | 3300003758 | Ga0055532_1000363 | Ga0055532_100036310 | 288 |
| 855 | 3300003758 | Ga0055532_1000680 | Ga0055532_10006802 | 288 |
| 856 | 3300003759 | Ga0055525_1000310 | Ga0055525_100031018 | 288 |
| 857 | 3300003760 | Ga0055527_1000279 | Ga0055527_100027920 | 288 |
| 858 | 3300003760 | Ga0055527_1004474 | Ga0055527_10044742 | 288 |
| 859 | 3300003760 | Ga0055527_1005898 | Ga0055527_10058982 | 288 |
| 860 | 3300003761 | Ga0055535_1000024 | Ga0055535_100002488 | 288 |
| 861 | 3300003761 | Ga0055535_1000589 | Ga0055535_100058920 | 288 |
| 862 | 3300003761 | Ga0055535_1000781 | Ga0055535_10007812 | 288 |
| 863 | 3300003761 | Ga0055535_1001563 | Ga0055535_10015636 | 288 |
| 864 | 3300003761 | Ga0055535_1003702 | Ga0055535_10037022 | 288 |
| 865 | 3300003762 | Ga0055542_1000390 | Ga0055542_100039054 | 288 |
| 866 | 3300003762 | Ga0055542_1000565 | Ga0055542_100056523 | 288 |
| 867 | 3300003762 | Ga0055542_1003574 | Ga0055542_10035744 | 288 |
| 868 | 3300003762 | Ga0055542_1003740 | Ga0055542_10037404 | 288 |
| 869 | 3300003762 | Ga0055542_1016377 | Ga0055542_10163771 | 288 |
| 870 | 3300003763 | Ga0055529_1000044 | Ga0055529_100004488 | 288 |
| 871 | 3300003763 | Ga0055529_1000183 | Ga0055529_10001832 | 288 |
| 872 | 3300003763 | Ga0055529_1000247 | Ga0055529_100024729 | 288 |
| 873 | 3300003763 | Ga0055529_1001634 | Ga0055529_10016346 | 288 |
| 874 | 3300003771 | Ga0055526_1000295 | Ga0055526_100029531 | 288 |
| 875 | 3300003771 | Ga0055526_1000400 | Ga0055526_10004005 | 288 |
| 876 | 3300003771 | Ga0055526_1006591 | Ga0055526_10065914 | 288 |
| 877 | 3300003771 | Ga0055526_1010319 | Ga0055526_10103192 | 288 |
| 878 | 3300003771 | Ga0055526_1026948 | Ga0055526_10269482 | 288 |
| 879 | 3300003775 | Ga0055524_1005033 | Ga0055524_10050332 | 288 |
| 880 | 3300003775 | Ga0055524_1010008 | Ga0055524_10100082 | 288 |
| 881 | 3300003775 | Ga0055524_1017046 | Ga0055524_10170462 | 288 |
| 882 | 3300003775 | Ga0055524_1026965 | Ga0055524_10269652 | 288 |
| 883 | 3300003775 | Ga0055524_1027816 | Ga0055524_10278162 | 288 |
| 884 | 3300003790 | Ga0055528_1000034 | Ga0055528_10000344 | 288 |
| 885 | 3300003790 | Ga0055528_1005932 | Ga0055528_10059322 | 288 |
| 886 | 3300003790 | Ga0055528_1007720 | Ga0055528_10077204 | 288 |
| 887 | 3300003790 | Ga0055528_1017273 | Ga0055528_10172732 | 288 |
| 888 | 3300003790 | Ga0055528_1024757 | Ga0055528_10247572 | 288 |
| 889 | 3300003792 | Ga0055540_1008434 | Ga0055540_10084343 | 288 |
| 890 | 3300003841 | Ga0055541_1006780 | Ga0055541_10067802 | 288 |
| 891 | 3300003856 | Ga0058692_1000057 | Ga0058692_100005755 | 288 |
| 892 | 3300003856 | Ga0058692_1000187 | Ga0058692_100018723 | 288 |
| 893 | 3300003856 | Ga0058692_1000790 | Ga0058692_10007907 | 288 |
| 894 | 3300003856 | Ga0058692_1001172 | Ga0058692_10011729 | 288 |
| 895 | 3300003856 | Ga0058692_1002515 | Ga0058692_10025158 | 288 |
| 896 | 3300003911 | JGI25405J52794_10021798 | JGI25405J52794_100217982 | 288 |
| 897 | 3300004625 | Ga0055543_1000009 | Ga0055543_100000999 | 288 |
| 898 | 3300004625 | Ga0055543_1000505 | Ga0055543_100050510 | 288 |
| 899 | 3300004625 | Ga0055543_1001297 | Ga0055543_10012973 | 288 |
| 900 | 3300005262 | Ga0065165_1000064 | Ga0065165_100006499 | 288 |
| 901 | 3300005262 | Ga0065165_1003434 | Ga0065165_10034347 | 288 |
| 902 | 3300005289 | Ga0065704_10000492 | Ga0065704_1000049219 | 288 |
| 903 | 3300005289 | Ga0065704_10002773 | Ga0065704_100027736 | 288 |
| 904 | 3300005289 | Ga0065704_10003241 | Ga0065704_100032411 | 288 |
| 905 | 3300005289 | Ga0065704_10005983 | Ga0065704_100059833 | 288 |
| 906 | 3300005290 | Ga0065712_10080638 | Ga0065712_100806383 | 288 |
| 907 | 3300005327 | Ga0070658_10027491 | Ga0070658_100274915 | 288 |
| 908 | 3300005327 | Ga0070658_10057535 | Ga0070658_100575353 | 288 |
| 909 | 3300005327 | Ga0070658_10086719 | Ga0070658_100867193 | 288 |
| 910 | 3300005327 | Ga0070658_10166371 | Ga0070658_101663712 | 288 |
| 911 | 3300005327 | Ga0070658_10179465 | Ga0070658_101794652 | 288 |
| 912 | 3300005329 | Ga0070683_100109746 | Ga0070683_1001097461 | 288 |
| 913 | 3300005330 | Ga0070690_100271451 | Ga0070690_1002714511 | 288 |
| 914 | 3300005331 | Ga0070670_100000416 | Ga0070670_10000041616 | 288 |
| 915 | 3300005331 | Ga0070670_100000697 | Ga0070670_10000069717 | 288 |
| 916 | 3300005331 | Ga0070670_100029918 | Ga0070670_1000299182 | 288 |
| 917 | 3300005334 | Ga0068869_100399246 | Ga0068869_1003992461 | 288 |
| 918 | 3300005336 | Ga0070680_100001870 | Ga0070680_10000187014 | 288 |
| 919 | 3300005336 | Ga0070680_100004874 | Ga0070680_1000048741 | 288 |
| 920 | 3300005336 | Ga0070680_100005276 | Ga0070680_1000052767 | 288 |
| 921 | 3300005336 | Ga0070680_100005898 | Ga0070680_1000058986 | 288 |
| 922 | 3300005336 | Ga0070680_100042214 | Ga0070680_1000422142 | 288 |
| 923 | 3300005336 | Ga0070680_100042511 | Ga0070680_1000425112 | 288 |
| 924 | 3300005338 | Ga0068868_100036766 | Ga0068868_1000367663 | 288 |
| 925 | 3300005339 | Ga0070660_100000261 | Ga0070660_10000026122 | 288 |
| 926 | 3300005339 | Ga0070660_100017615 | Ga0070660_1000176155 | 288 |
| 927 | 3300005339 | Ga0070660_100315809 | Ga0070660_1003158091 | 288 |
| 928 | 3300005341 | Ga0070691_10060783 | Ga0070691_100607831 | 288 |
| 929 | 3300005341 | Ga0070691_10124799 | Ga0070691_101247991 | 288 |
| 930 | 3300005344 | Ga0070661_100000021 | Ga0070661_10000002197 | 288 |
| 931 | 3300005344 | Ga0070661_100000901 | Ga0070661_10000090120 | 288 |
| 932 | 3300005344 | Ga0070661_100042774 | Ga0070661_1000427742 | 288 |
| 933 | 3300005344 | Ga0070661_100062414 | Ga0070661_1000624143 | 288 |
| 934 | 3300005345 | Ga0070692_10100401 | Ga0070692_101004012 | 288 |
| 935 | 3300005354 | Ga0070675_100139825 | Ga0070675_1001398252 | 288 |
| 936 | 3300005355 | Ga0070671_100064953 | Ga0070671_1000649531 | 288 |
| 937 | 3300005355 | Ga0070671_100158401 | Ga0070671_1001584012 | 288 |
| 938 | 3300005365 | Ga0070688_100061932 | Ga0070688_1000619322 | 288 |
| 939 | 3300005365 | Ga0070688_100131186 | Ga0070688_1001311862 | 288 |
| 940 | 3300005366 | Ga0070659_100000108 | Ga0070659_10000010838 | 288 |
| 941 | 3300005366 | Ga0070659_100098295 | Ga0070659_1000982952 | 288 |
| 942 | 3300005366 | Ga0070659_100105743 | Ga0070659_1001057433 | 288 |
| 943 | 3300005366 | Ga0070659_100213551 | Ga0070659_1002135512 | 288 |
| 944 | 3300005367 | Ga0070667_100024748 | Ga0070667_1000247483 | 288 |
| 945 | 3300005367 | Ga0070667_100040088 | Ga0070667_1000400884 | 288 |
| 946 | 3300005367 | Ga0070667_100041372 | Ga0070667_1000413721 | 288 |
| 947 | 3300005406 | Ga0070703_10002464 | Ga0070703_100024644 | 288 |
| 948 | 3300005434 | Ga0070709_10061571 | Ga0070709_100615711 | 288 |
| 949 | 3300005439 | Ga0070711_100000154 | Ga0070711_10000015429 | 288 |
| 950 | 3300005439 | Ga0070711_100118168 | Ga0070711_1001181681 | 288 |
| 951 | 3300005440 | Ga0070705_100000105 | Ga0070705_10000010530 | 288 |
| 952 | 3300005441 | Ga0070700_100001122 | Ga0070700_1000011222 | 288 |
| 953 | 3300005444 | Ga0070694_100004390 | Ga0070694_1000043904 | 288 |
| 954 | 3300005455 | Ga0070663_100000004 | Ga0070663_100000004106 | 288 |
| 955 | 3300005455 | Ga0070663_100002324 | Ga0070663_1000023244 | 288 |
| 956 | 3300005455 | Ga0070663_100005266 | Ga0070663_1000052664 | 288 |
| 957 | 3300005455 | Ga0070663_100083158 | Ga0070663_1000831581 | 288 |
| 958 | 3300005457 | Ga0070662_100383957 | Ga0070662_1003839571 | 288 |
| 959 | 3300005458 | Ga0070681_10000874 | Ga0070681_1000087410 | 288 |
| 960 | 3300005458 | Ga0070681_10004469 | Ga0070681_1000446919 | 288 |
| 961 | 3300005458 | Ga0070681_10007901 | Ga0070681_100079011 | 288 |
| 962 | 3300005458 | Ga0070681_10322169 | Ga0070681_103221691 | 288 |
| 963 | 3300005458 | Ga0070681_10328815 | Ga0070681_103288152 | 288 |
| 964 | 3300005518 | Ga0070699_100000330 | Ga0070699_1000003308 | 288 |
| 965 | 3300005530 | Ga0070679_100000934 | Ga0070679_10000093410 | 288 |
| 966 | 3300005530 | Ga0070679_100007558 | Ga0070679_1000075581 | 288 |
| 967 | 3300005530 | Ga0070679_100081078 | Ga0070679_1000810784 | 288 |
| 968 | 3300005535 | Ga0070684_100044131 | Ga0070684_1000441313 | 288 |
| 969 | 3300005535 | Ga0070684_100444376 | Ga0070684_1004443761 | 288 |
| 970 | 3300005539 | Ga0068853_100189380 | Ga0068853_1001893802 | 288 |
| 971 | 3300005539 | Ga0068853_100214779 | Ga0068853_1002147791 | 288 |
| 972 | 3300005545 | Ga0070695_100001309 | Ga0070695_10000130910 | 288 |
| 973 | 3300005546 | Ga0070696_100000069 | Ga0070696_10000006943 | 288 |
| 974 | 3300005547 | Ga0070693_100084080 | Ga0070693_1000840802 | 288 |
| 975 | 3300005548 | Ga0070665_100002139 | Ga0070665_10000213915 | 288 |
| 976 | 3300005548 | Ga0070665_100010264 | Ga0070665_1000102646 | 288 |
| 977 | 3300005548 | Ga0070665_100017050 | Ga0070665_1000170503 | 288 |
| 978 | 3300005548 | Ga0070665_100072254 | Ga0070665_1000722541 | 288 |
| 979 | 3300005548 | Ga0070665_100096345 | Ga0070665_1000963453 | 288 |
| 980 | 3300005549 | Ga0070704_100001159 | Ga0070704_1000011597 | 288 |
| 981 | 3300005563 | Ga0068855_100000010 | Ga0068855_10000001030 | 288 |
| 982 | 3300005563 | Ga0068855_100175538 | Ga0068855_1001755381 | 288 |
| 983 | 3300005563 | Ga0068855_100468470 | Ga0068855_1004684702 | 288 |
| 984 | 3300005564 | Ga0070664_100000007 | Ga0070664_100000007106 | 288 |
| 985 | 3300005564 | Ga0070664_100000030 | Ga0070664_10000003077 | 288 |
| 986 | 3300005564 | Ga0070664_100179661 | Ga0070664_1001796612 | 288 |
| 987 | 3300005564 | Ga0070664_100259160 | Ga0070664_1002591601 | 288 |
| 988 | 3300005577 | Ga0068857_100003083 | Ga0068857_1000030836 | 288 |
| 989 | 3300005577 | Ga0068857_100055108 | Ga0068857_1000551082 | 288 |
| 990 | 3300005577 | Ga0068857_100150582 | Ga0068857_1001505822 | 288 |
| 991 | 3300005578 | Ga0068854_100000045 | Ga0068854_10000004569 | 288 |
| 992 | 3300005578 | Ga0068854_100026179 | Ga0068854_1000261791 | 288 |
| 993 | 3300005578 | Ga0068854_100171255 | Ga0068854_1001712553 | 288 |
| 994 | 3300005578 | Ga0068854_100242391 | Ga0068854_1002423912 | 288 |
| 995 | 3300005614 | Ga0068856_100000004 | Ga0068856_10000000491 | 288 |
| 996 | 3300005614 | Ga0068856_100013928 | Ga0068856_1000139284 | 288 |
| 997 | 3300005614 | Ga0068856_100025963 | Ga0068856_1000259633 | 288 |
| 998 | 3300005614 | Ga0068856_100295311 | Ga0068856_1002953113 | 288 |
| 999 | 3300005616 | Ga0068852_100000027 | Ga0068852_10000002787 | 288 |
| 1000 | 3300005616 | Ga0068852_100019019 | Ga0068852_1000190196 | 288 |
| 1001 | 3300005616 | Ga0068852_100030075 | Ga0068852_1000300753 | 288 |
| 1002 | 3300005616 | Ga0068852_100165037 | Ga0068852_1001650373 | 288 |
| 1003 | 3300005616 | Ga0068852_100178284 | Ga0068852_1001782842 | 288 |
| 1004 | 3300005616 | Ga0068852_100376523 | Ga0068852_1003765232 | 288 |
| 1005 | 3300005616 | Ga0068852_100732168 | Ga0068852_1007321681 | 288 |
| 1006 | 3300005617 | Ga0068859_100005533 | Ga0068859_1000055338 | 288 |
| 1007 | 3300005617 | Ga0068859_100016446 | Ga0068859_1000164465 | 288 |
| 1008 | 3300005617 | Ga0068859_100025880 | Ga0068859_1000258803 | 288 |
| 1009 | 3300005617 | Ga0068859_100123093 | Ga0068859_1001230933 | 288 |
| 1010 | 3300005618 | Ga0068864_100044086 | Ga0068864_1000440864 | 288 |
| 1011 | 3300005834 | Ga0068851_10193651 | Ga0068851_101936512 | 288 |
| 1012 | 3300005841 | Ga0068863_100027028 | Ga0068863_1000270284 | 288 |
| 1013 | 3300005841 | Ga0068863_100086368 | Ga0068863_1000863682 | 288 |
| 1014 | 3300005841 | Ga0068863_100126667 | Ga0068863_1001266672 | 288 |
| 1015 | 3300005842 | Ga0068858_100000111 | Ga0068858_1000001113 | 288 |
| 1016 | 3300005842 | Ga0068858_100099300 | Ga0068858_1000993002 | 288 |
| 1017 | 3300005842 | Ga0068858_100486729 | Ga0068858_1004867291 | 288 |
| 1018 | 3300005843 | Ga0068860_100020906 | Ga0068860_1000209065 | 288 |
| 1019 | 3300005843 | Ga0068860_100150557 | Ga0068860_1001505571 | 288 |
| 1020 | 3300005843 | Ga0068860_100208932 | Ga0068860_1002089322 | 288 |
| 1021 | 3300005844 | Ga0068862_100001572 | Ga0068862_10000157215 | 288 |
| 1022 | 3300005937 | Ga0081455_10016579 | Ga0081455_100165798 | 288 |
| 1023 | 3300005937 | Ga0081455_10056445 | Ga0081455_100564453 | 288 |
| 1024 | 3300005983 | Ga0081540_1000092 | Ga0081540_100009292 | 288 |
| 1025 | 3300005983 | Ga0081540_1089809 | Ga0081540_10898092 | 288 |
| 1026 | 3300006038 | Ga0075365_10019425 | Ga0075365_100194252 | 288 |
| 1027 | 3300006038 | Ga0075365_10121510 | Ga0075365_101215102 | 288 |
| 1028 | 3300006048 | Ga0075363_100024052 | Ga0075363_1000240523 | 288 |
| 1029 | 3300006048 | Ga0075363_100045564 | Ga0075363_1000455643 | 288 |
| 1030 | 3300006051 | Ga0075364_10015008 | Ga0075364_100150084 | 288 |
| 1031 | 3300006051 | Ga0075364_10073375 | Ga0075364_100733752 | 288 |
| 1032 | 3300006051 | Ga0075364_10185860 | Ga0075364_101858601 | 288 |
| 1033 | 3300006173 | Ga0070716_100119615 | Ga0070716_1001196152 | 288 |
| 1034 | 3300006175 | Ga0070712_100000126 | Ga0070712_10000012617 | 288 |
| 1035 | 3300006178 | Ga0075367_10265123 | Ga0075367_102651231 | 288 |
| 1036 | 3300006186 | Ga0075369_10127115 | Ga0075369_101271151 | 288 |
| 1037 | 3300006237 | Ga0097621_100134389 | Ga0097621_1001343892 | 288 |
| 1038 | 3300006353 | Ga0075370_10002020 | Ga0075370_100020205 | 288 |
| 1039 | 3300006353 | Ga0075370_10010184 | Ga0075370_100101844 | 288 |
| 1040 | 3300006353 | Ga0075370_10010830 | Ga0075370_100108302 | 288 |
| 1041 | 3300006353 | Ga0075370_10014013 | Ga0075370_100140135 | 288 |
| 1042 | 3300006353 | Ga0075370_10125169 | Ga0075370_101251692 | 288 |
| 1043 | 3300006353 | Ga0075370_10126994 | Ga0075370_101269941 | 288 |
| 1044 | 3300006881 | Ga0068865_100048661 | Ga0068865_1000486613 | 288 |
| 1045 | 3300006931 | Ga0097620_100005533 | Ga0097620_1000055338 | 288 |
| 1046 | 3300006931 | Ga0097620_100016446 | Ga0097620_1000164465 | 288 |
| 1047 | 3300006931 | Ga0097620_100025879 | Ga0097620_1000258795 | 288 |
| 1048 | 3300006931 | Ga0097620_100123094 | Ga0097620_1001230943 | 288 |
| 1049 | 3300006946 | Ga0079104_1000205 | Ga0079104_100020573 | 288 |
| 1050 | 3300006946 | Ga0079104_1000609 | Ga0079104_100060932 | 288 |
| 1051 | 3300006946 | Ga0079104_1001874 | Ga0079104_10018749 | 288 |
| 1052 | 3300006946 | Ga0079104_1024481 | Ga0079104_10244811 | 288 |
| 1053 | 3300009011 | Ga0105251_10000008 | Ga0105251_1000000826 | 288 |
| 1054 | 3300009011 | Ga0105251_10001647 | Ga0105251_1000164713 | 288 |
| 1055 | 3300009011 | Ga0105251_10003617 | Ga0105251_100036177 | 288 |
| 1056 | 3300009011 | Ga0105251_10059009 | Ga0105251_100590092 | 288 |
| 1057 | 3300009036 | Ga0105244_10001078 | Ga0105244_100010787 | 288 |
| 1058 | 3300009036 | Ga0105244_10005575 | Ga0105244_100055756 | 288 |
| 1059 | 3300009036 | Ga0105244_10006665 | Ga0105244_100066657 | 288 |
| 1060 | 3300009036 | Ga0105244_10051119 | Ga0105244_100511192 | 288 |
| 1061 | 3300009092 | Ga0105250_10000088 | Ga0105250_100000889 | 288 |
| 1062 | 3300009092 | Ga0105250_10008534 | Ga0105250_100085342 | 288 |
| 1063 | 3300009092 | Ga0105250_10011325 | Ga0105250_100113253 | 288 |
| 1064 | 3300009093 | Ga0105240_10000222 | Ga0105240_1000022283 | 288 |
| 1065 | 3300009093 | Ga0105240_10000278 | Ga0105240_1000027872 | 288 |
| 1066 | 3300009093 | Ga0105240_10001873 | Ga0105240_1000187333 | 288 |
| 1067 | 3300009093 | Ga0105240_10013307 | Ga0105240_100133076 | 288 |
| 1068 | 3300009093 | Ga0105240_10107270 | Ga0105240_101072702 | 288 |
| 1069 | 3300009093 | Ga0105240_10396954 | Ga0105240_103969542 | 288 |
| 1070 | 3300009098 | Ga0105245_10091060 | Ga0105245_100910602 | 288 |
| 1071 | 3300009098 | Ga0105245_10096504 | Ga0105245_100965043 | 288 |
| 1072 | 3300009101 | Ga0105247_10008991 | Ga0105247_100089915 | 288 |
| 1073 | 3300009101 | Ga0105247_10010617 | Ga0105247_100106173 | 288 |
| 1074 | 3300009101 | Ga0105247_10037292 | Ga0105247_100372922 | 288 |
| 1075 | 3300009148 | Ga0105243_10000184 | Ga0105243_1000018428 | 288 |
| 1076 | 3300009148 | Ga0105243_10049156 | Ga0105243_100491562 | 288 |
| 1077 | 3300009148 | Ga0105243_10099274 | Ga0105243_100992743 | 288 |
| 1078 | 3300009148 | Ga0105243_10130061 | Ga0105243_101300613 | 288 |
| 1079 | 3300009174 | Ga0105241_10086549 | Ga0105241_100865493 | 288 |
| 1080 | 3300009174 | Ga0105241_10291453 | Ga0105241_102914532 | 288 |
| 1081 | 3300009176 | Ga0105242_10024858 | Ga0105242_100248584 | 288 |
| 1082 | 3300009177 | Ga0105248_10039423 | Ga0105248_100394234 | 288 |
| 1083 | 3300009177 | Ga0105248_10080310 | Ga0105248_100803103 | 288 |
| 1084 | 3300009177 | Ga0105248_10416741 | Ga0105248_104167411 | 288 |
| 1085 | 3300009545 | Ga0105237_10001925 | Ga0105237_1000192523 | 288 |
| 1086 | 3300009545 | Ga0105237_10003357 | Ga0105237_100033579 | 288 |
| 1087 | 3300009545 | Ga0105237_10045750 | Ga0105237_100457504 | 288 |
| 1088 | 3300009545 | Ga0105237_10046135 | Ga0105237_100461352 | 288 |
| 1089 | 3300009545 | Ga0105237_10078992 | Ga0105237_100789924 | 288 |
| 1090 | 3300009545 | Ga0105237_10409426 | Ga0105237_104094262 | 288 |
| 1091 | 3300009551 | Ga0105238_10249629 | Ga0105238_102496292 | 288 |
| 1092 | 3300009551 | Ga0105238_10302791 | Ga0105238_103027912 | 288 |
| 1093 | 3300009551 | Ga0105238_10350279 | Ga0105238_103502791 | 288 |
| 1094 | 3300009551 | Ga0105238_10729561 | Ga0105238_107295612 | 288 |
| 1095 | 3300009553 | Ga0105249_10004739 | Ga0105249_100047395 | 288 |
| 1096 | 3300009765 | Ga0123341_1000005 | Ga0123341_1000005104 | 288 |
| 1097 | 3300009766 | Ga0123342_1019923 | Ga0123342_10199237 | 288 |
| 1098 | 3300010375 | Ga0105239_10003475 | Ga0105239_100034754 | 288 |
| 1099 | 3300010375 | Ga0105239_10039674 | Ga0105239_100396747 | 288 |
| 1100 | 3300010375 | Ga0105239_10152204 | Ga0105239_101522042 | 288 |
| 1101 | 3300010375 | Ga0105239_10278197 | Ga0105239_102781972 | 288 |
| 1102 | 3300010375 | Ga0105239_10662342 | Ga0105239_106623421 | 288 |
| 1103 | 3300011119 | Ga0105246_10011352 | Ga0105246_100113524 | 288 |
| 1104 | 3300011119 | Ga0105246_10011744 | Ga0105246_100117443 | 288 |
| 1105 | 3300012513 | Ga0157326_1003400 | Ga0157326_10034002 | 288 |
| 1106 | 3300013100 | Ga0157373_10001155 | Ga0157373_1000115510 | 288 |
| 1107 | 3300013100 | Ga0157373_10001724 | Ga0157373_100017247 | 288 |
| 1108 | 3300013100 | Ga0157373_10002821 | Ga0157373_100028219 | 288 |
| 1109 | 3300013100 | Ga0157373_10087440 | Ga0157373_100874401 | 288 |
| 1110 | 3300013100 | Ga0157373_10208343 | Ga0157373_102083432 | 288 |
| 1111 | 3300013102 | Ga0157371_10000028 | Ga0157371_10000028120 | 288 |
| 1112 | 3300013102 | Ga0157371_10000136 | Ga0157371_10000136102 | 288 |
| 1113 | 3300013102 | Ga0157371_10012605 | Ga0157371_100126056 | 288 |
| 1114 | 3300013102 | Ga0157371_10022871 | Ga0157371_100228712 | 288 |
| 1115 | 3300013102 | Ga0157371_10031350 | Ga0157371_100313502 | 288 |
| 1116 | 3300013102 | Ga0157371_10065925 | Ga0157371_100659252 | 288 |
| 1117 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002103 | 288 |
| 1118 | 3300013104 | Ga0157370_10000012 | Ga0157370_10000012120 | 288 |
| 1119 | 3300013104 | Ga0157370_10000065 | Ga0157370_1000006525 | 288 |
| 1120 | 3300013104 | Ga0157370_10001488 | Ga0157370_1000148815 | 288 |
| 1121 | 3300013104 | Ga0157370_10002472 | Ga0157370_1000247213 | 288 |
| 1122 | 3300013104 | Ga0157370_10013674 | Ga0157370_100136742 | 288 |
| 1123 | 3300013104 | Ga0157370_10039973 | Ga0157370_100399735 | 288 |
| 1124 | 3300013104 | Ga0157370_10043957 | Ga0157370_100439573 | 288 |
| 1125 | 3300013105 | Ga0157369_10000112 | Ga0157369_1000011284 | 288 |
| 1126 | 3300013105 | Ga0157369_10001129 | Ga0157369_1000112921 | 288 |
| 1127 | 3300013105 | Ga0157369_10002704 | Ga0157369_1000270416 | 288 |
| 1128 | 3300013105 | Ga0157369_10053573 | Ga0157369_100535734 | 288 |
| 1129 | 3300013105 | Ga0157369_10198865 | Ga0157369_101988652 | 288 |
| 1130 | 3300013296 | Ga0157374_10092371 | Ga0157374_100923712 | 288 |
| 1131 | 3300013296 | Ga0157374_10251726 | Ga0157374_102517262 | 288 |
| 1132 | 3300013296 | Ga0157374_10332842 | Ga0157374_103328421 | 288 |
| 1133 | 3300013297 | Ga0157378_10535330 | Ga0157378_105353302 | 288 |
| 1134 | 3300013306 | Ga0163162_10160782 | Ga0163162_101607822 | 288 |
| 1135 | 3300013306 | Ga0163162_10171655 | Ga0163162_101716553 | 288 |
| 1136 | 3300013307 | Ga0157372_10000065 | Ga0157372_1000006510 | 288 |
| 1137 | 3300013307 | Ga0157372_10000111 | Ga0157372_1000011123 | 288 |
| 1138 | 3300013307 | Ga0157372_10163541 | Ga0157372_101635412 | 288 |
| 1139 | 3300013307 | Ga0157372_10512127 | Ga0157372_105121272 | 288 |
| 1140 | 3300013308 | Ga0157375_10008229 | Ga0157375_100082293 | 288 |
| 1141 | 3300013308 | Ga0157375_10028115 | Ga0157375_100281153 | 288 |
| 1142 | 3300014325 | Ga0163163_10012102 | Ga0163163_100121024 | 288 |
| 1143 | 3300014325 | Ga0163163_10338360 | Ga0163163_103383602 | 288 |
| 1144 | 3300014497 | Ga0182008_10001051 | Ga0182008_1000105119 | 288 |
| 1145 | 3300014497 | Ga0182008_10021760 | Ga0182008_100217602 | 288 |
| 1146 | 3300014497 | Ga0182008_10054838 | Ga0182008_100548382 | 288 |
| 1147 | 3300014968 | Ga0157379_10071375 | Ga0157379_100713753 | 288 |
| 1148 | 3300014968 | Ga0157379_10078214 | Ga0157379_100782142 | 288 |
| 1149 | 3300014968 | Ga0157379_10226704 | Ga0157379_102267042 | 288 |
| 1150 | 3300014969 | Ga0157376_10083407 | Ga0157376_100834072 | 288 |
| 1151 | 3300015261 | Ga0182006_1000119 | Ga0182006_100011981 | 288 |
| 1152 | 3300015261 | Ga0182006_1000611 | Ga0182006_100061127 | 288 |
| 1153 | 3300015261 | Ga0182006_1030442 | Ga0182006_10304422 | 288 |
| 1154 | 3300015262 | Ga0182007_10001225 | Ga0182007_100012255 | 288 |
| 1155 | 3300015262 | Ga0182007_10001987 | Ga0182007_1000198711 | 288 |
| 1156 | 3300015265 | Ga0182005_1000044 | Ga0182005_100004452 | 288 |
| 1157 | 3300015265 | Ga0182005_1000540 | Ga0182005_100054017 | 288 |
| 1158 | 3300015265 | Ga0182005_1001006 | Ga0182005_10010064 | 288 |
| 1159 | 3300015265 | Ga0182005_1002324 | Ga0182005_10023244 | 288 |
| 1160 | 3300015265 | Ga0182005_1004016 | Ga0182005_10040163 | 288 |
| 1161 | 3300015265 | Ga0182005_1048282 | Ga0182005_10482821 | 288 |
| 1162 | 3300015679 | Ga0183366_1001 | Ga0183366_10011188 | 288 |
| 1163 | 3300015680 | Ga0183370_1001 | Ga0183370_10011188 | 288 |
| 1164 | 3300015685 | Ga0183369_1001 | Ga0183369_10011188 | 288 |
| 1165 | 3300015687 | Ga0183368_1001 | Ga0183368_10011188 | 288 |
| 1166 | 3300017792 | Ga0163161_10011734 | Ga0163161_100117346 | 288 |
| 1167 | 3300020070 | Ga0206356_10524477 | Ga0206356_105244771 | 288 |
| 1168 | 3300020070 | Ga0206356_11211633 | Ga0206356_112116332 | 288 |
| 1169 | 3300020077 | Ga0206351_10620367 | Ga0206351_106203672 | 288 |
| 1170 | 3300020081 | Ga0206354_10057609 | Ga0206354_100576092 | 288 |
| 1171 | 3300020082 | Ga0206353_10393390 | Ga0206353_103933902 | 288 |
| 1172 | 3300020082 | Ga0206353_11351368 | Ga0206353_113513685 | 288 |
| 1173 | 3300020610 | Ga0154015_1386076 | Ga0154015_13860762 | 288 |
| 1174 | 3300020610 | Ga0154015_1629196 | Ga0154015_16291963 | 288 |
| 1175 | 3300021361 | Ga0213872_10032113 | Ga0213872_100321132 | 288 |
| 1176 | 3300021361 | Ga0213872_10048402 | Ga0213872_100484022 | 288 |
| 1177 | 3300021441 | Ga0213871_10030872 | Ga0213871_100308722 | 288 |
| 1178 | 3300024227 | Ga0228598_1000515 | Ga0228598_10005153 | 288 |
| 1179 | 3300025208 | Ga0209436_102863 | Ga0209436_1028634 | 288 |
| 1180 | 3300025224 | Ga0209784_100024 | Ga0209784_10002498 | 288 |
| 1181 | 3300025225 | Ga0209566_100018 | Ga0209566_10001898 | 288 |
| 1182 | 3300025226 | Ga0209674_100046 | Ga0209674_100046265 | 288 |
| 1183 | 3300025226 | Ga0209674_101757 | Ga0209674_1017571 | 288 |
| 1184 | 3300025228 | Ga0209672_100030 | Ga0209672_100030253 | 288 |
| 1185 | 3300025228 | Ga0209672_100040 | Ga0209672_100040148 | 288 |
| 1186 | 3300025228 | Ga0209672_100058 | Ga0209672_10005867 | 288 |
| 1187 | 3300025228 | Ga0209672_100068 | Ga0209672_10006821 | 288 |
| 1188 | 3300025228 | Ga0209672_100457 | Ga0209672_10045713 | 288 |
| 1189 | 3300025228 | Ga0209672_102427 | Ga0209672_1024272 | 288 |
| 1190 | 3300025229 | Ga0209147_100008 | Ga0209147_100008274 | 288 |
| 1191 | 3300025229 | Ga0209147_100036 | Ga0209147_10003686 | 288 |
| 1192 | 3300025229 | Ga0209147_100048 | Ga0209147_100048148 | 288 |
| 1193 | 3300025229 | Ga0209147_100074 | Ga0209147_100074194 | 288 |
| 1194 | 3300025230 | Ga0209563_100039 | Ga0209563_100039265 | 288 |
| 1195 | 3300025230 | Ga0209563_105425 | Ga0209563_1054252 | 288 |
| 1196 | 3300025231 | Ga0207427_100081 | Ga0207427_10008128 | 288 |
| 1197 | 3300025233 | Ga0209437_100036 | Ga0209437_10003675 | 288 |
| 1198 | 3300025233 | Ga0209437_100086 | Ga0209437_100086175 | 288 |
| 1199 | 3300025233 | Ga0209437_100168 | Ga0209437_10016828 | 288 |
| 1200 | 3300025242 | Ga0209258_100013 | Ga0209258_100013274 | 288 |
| 1201 | 3300025242 | Ga0209258_100056 | Ga0209258_100056253 | 288 |
| 1202 | 3300025242 | Ga0209258_100070 | Ga0209258_100070148 | 288 |
| 1203 | 3300025242 | Ga0209258_100149 | Ga0209258_1001492 | 288 |
| 1204 | 3300025242 | Ga0209258_100164 | Ga0209258_10016473 | 288 |
| 1205 | 3300025245 | Ga0207425_1000741 | Ga0207425_100074120 | 288 |
| 1206 | 3300025245 | Ga0207425_1000744 | Ga0207425_10007441 | 288 |
| 1207 | 3300025245 | Ga0207425_1009765 | Ga0207425_10097652 | 288 |
| 1208 | 3300025246 | Ga0209646_1001239 | Ga0209646_10012397 | 288 |
| 1209 | 3300025250 | Ga0209026_1000231 | Ga0209026_100023131 | 288 |
| 1210 | 3300025250 | Ga0209026_1012581 | Ga0209026_10125813 | 288 |
| 1211 | 3300025253 | Ga0209677_100024 | Ga0209677_100024263 | 288 |
| 1212 | 3300025253 | Ga0209677_100267 | Ga0209677_10026734 | 288 |
| 1213 | 3300025253 | Ga0209677_105646 | Ga0209677_1056464 | 288 |
| 1214 | 3300025254 | Ga0209148_1000037 | Ga0209148_1000037178 | 288 |
| 1215 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039144 | 288 |
| 1216 | 3300025254 | Ga0209148_1000143 | Ga0209148_10001432 | 288 |
| 1217 | 3300025254 | Ga0209148_1000178 | Ga0209148_100017835 | 288 |
| 1218 | 3300025254 | Ga0209148_1000461 | Ga0209148_100046117 | 288 |
| 1219 | 3300025254 | Ga0209148_1003235 | Ga0209148_10032351 | 288 |
| 1220 | 3300025254 | Ga0209148_1009411 | Ga0209148_10094112 | 288 |
| 1221 | 3300025256 | Ga0209759_1000249 | Ga0209759_100024961 | 288 |
| 1222 | 3300025256 | Ga0209759_1001303 | Ga0209759_10013036 | 288 |
| 1223 | 3300025256 | Ga0209759_1009524 | Ga0209759_10095243 | 288 |
| 1224 | 3300025256 | Ga0209759_1013780 | Ga0209759_10137802 | 288 |
| 1225 | 3300025256 | Ga0209759_1023371 | Ga0209759_10233711 | 288 |
| 1226 | 3300025258 | Ga0209129_1000025 | Ga0209129_1000025137 | 288 |
| 1227 | 3300025258 | Ga0209129_1000594 | Ga0209129_100059422 | 288 |
| 1228 | 3300025258 | Ga0209129_1004157 | Ga0209129_10041573 | 288 |
| 1229 | 3300025261 | Ga0209233_1000110 | Ga0209233_100011072 | 288 |
| 1230 | 3300025261 | Ga0209233_1000151 | Ga0209233_100015128 | 288 |
| 1231 | 3300025261 | Ga0209233_1000166 | Ga0209233_100016675 | 288 |
| 1232 | 3300025261 | Ga0209233_1000342 | Ga0209233_100034229 | 288 |
| 1233 | 3300025261 | Ga0209233_1000350 | Ga0209233_100035036 | 288 |
| 1234 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034145 | 288 |
| 1235 | 3300025272 | Ga0209455_1000036 | Ga0209455_1000036155 | 288 |
| 1236 | 3300025272 | Ga0209455_1000042 | Ga0209455_1000042274 | 288 |
| 1237 | 3300025272 | Ga0209455_1000061 | Ga0209455_100006186 | 288 |
| 1238 | 3300025272 | Ga0209455_1000525 | Ga0209455_100052510 | 288 |
| 1239 | 3300025273 | Ga0209673_1000020 | Ga0209673_1000020192 | 288 |
| 1240 | 3300025273 | Ga0209673_1000046 | Ga0209673_100004618 | 288 |
| 1241 | 3300025273 | Ga0209673_1000601 | Ga0209673_100060132 | 288 |
| 1242 | 3300025273 | Ga0209673_1000607 | Ga0209673_100060733 | 288 |
| 1243 | 3300025273 | Ga0209673_1001959 | Ga0209673_10019594 | 288 |
| 1244 | 3300025273 | Ga0209673_1002904 | Ga0209673_10029042 | 288 |
| 1245 | 3300025273 | Ga0209673_1004592 | Ga0209673_10045922 | 288 |
| 1246 | 3300025273 | Ga0209673_1020631 | Ga0209673_10206312 | 288 |
| 1247 | 3300025284 | Ga0209130_1000048 | Ga0209130_100004899 | 288 |
| 1248 | 3300025284 | Ga0209130_1000272 | Ga0209130_100027218 | 288 |
| 1249 | 3300025291 | Ga0209675_1002721 | Ga0209675_100272110 | 288 |
| 1250 | 3300025291 | Ga0209675_1026365 | Ga0209675_10263652 | 288 |
| 1251 | 3300025292 | Ga0209676_1004206 | Ga0209676_10042062 | 288 |
| 1252 | 3300025292 | Ga0209676_1039233 | Ga0209676_10392332 | 288 |
| 1253 | 3300025294 | Ga0209025_1000029 | Ga0209025_1000029329 | 288 |
| 1254 | 3300025294 | Ga0209025_1000081 | Ga0209025_1000081108 | 288 |
| 1255 | 3300025294 | Ga0209025_1001900 | Ga0209025_100190018 | 288 |
| 1256 | 3300025294 | Ga0209025_1011450 | Ga0209025_10114502 | 288 |
| 1257 | 3300025294 | Ga0209025_1013547 | Ga0209025_10135472 | 288 |
| 1258 | 3300025294 | Ga0209025_1016446 | Ga0209025_10164462 | 288 |
| 1259 | 3300025295 | Ga0209564_1000039 | Ga0209564_1000039137 | 288 |
| 1260 | 3300025295 | Ga0209564_1000205 | Ga0209564_10002054 | 288 |
| 1261 | 3300025295 | Ga0209564_1000621 | Ga0209564_10006214 | 288 |
| 1262 | 3300025295 | Ga0209564_1001753 | Ga0209564_100175315 | 288 |
| 1263 | 3300025295 | Ga0209564_1001883 | Ga0209564_100188318 | 288 |
| 1264 | 3300025295 | Ga0209564_1006715 | Ga0209564_10067152 | 288 |
| 1265 | 3300025295 | Ga0209564_1013709 | Ga0209564_10137093 | 288 |
| 1266 | 3300025295 | Ga0209564_1023211 | Ga0209564_10232113 | 288 |
| 1267 | 3300025297 | Ga0209758_1000076 | Ga0209758_100007690 | 288 |
| 1268 | 3300025297 | Ga0209758_1000196 | Ga0209758_100019618 | 288 |
| 1269 | 3300025297 | Ga0209758_1003911 | Ga0209758_100391117 | 288 |
| 1270 | 3300025297 | Ga0209758_1004142 | Ga0209758_10041423 | 288 |
| 1271 | 3300025298 | Ga0209050_1003396 | Ga0209050_10033962 | 288 |
| 1272 | 3300025298 | Ga0209050_1021437 | Ga0209050_10214372 | 288 |
| 1273 | 3300025299 | Ga0209256_1000500 | Ga0209256_100050025 | 288 |
| 1274 | 3300025299 | Ga0209256_1002281 | Ga0209256_100228116 | 288 |
| 1275 | 3300025299 | Ga0209256_1005384 | Ga0209256_10053845 | 288 |
| 1276 | 3300025299 | Ga0209256_1006453 | Ga0209256_10064536 | 288 |
| 1277 | 3300025299 | Ga0209256_1014665 | Ga0209256_10146653 | 288 |
| 1278 | 3300025299 | Ga0209256_1018442 | Ga0209256_10184422 | 288 |
| 1279 | 3300025299 | Ga0209256_1028334 | Ga0209256_10283341 | 288 |
| 1280 | 3300025302 | Ga0207426_1000136 | Ga0207426_100013699 | 288 |
| 1281 | 3300025302 | Ga0207426_1000169 | Ga0207426_100016947 | 288 |
| 1282 | 3300025302 | Ga0207426_1000411 | Ga0207426_100041147 | 288 |
| 1283 | 3300025302 | Ga0207426_1001232 | Ga0207426_100123221 | 288 |
| 1284 | 3300025303 | Ga0209051_1001518 | Ga0209051_100151819 | 288 |
| 1285 | 3300025303 | Ga0209051_1032555 | Ga0209051_10325551 | 288 |
| 1286 | 3300025711 | Ga0207696_1000091 | Ga0207696_1000091149 | 288 |
| 1287 | 3300025711 | Ga0207696_1007458 | Ga0207696_10074583 | 288 |
| 1288 | 3300025728 | Ga0207655_1000001 | Ga0207655_10000011261 | 288 |
| 1289 | 3300025728 | Ga0207655_1000009 | Ga0207655_1000009435 | 288 |
| 1290 | 3300025728 | Ga0207655_1000288 | Ga0207655_100028814 | 288 |
| 1291 | 3300025728 | Ga0207655_1000491 | Ga0207655_100049140 | 288 |
| 1292 | 3300025728 | Ga0207655_1000593 | Ga0207655_10005934 | 288 |
| 1293 | 3300025728 | Ga0207655_1000875 | Ga0207655_10008753 | 288 |
| 1294 | 3300025735 | Ga0207713_1000029 | Ga0207713_100002972 | 288 |
| 1295 | 3300025735 | Ga0207713_1006528 | Ga0207713_10065285 | 288 |
| 1296 | 3300025735 | Ga0207713_1025050 | Ga0207713_10250502 | 288 |
| 1297 | 3300025899 | Ga0207642_10026900 | Ga0207642_100269002 | 288 |
| 1298 | 3300025900 | Ga0207710_10000159 | Ga0207710_1000015944 | 288 |
| 1299 | 3300025900 | Ga0207710_10004228 | Ga0207710_100042283 | 288 |
| 1300 | 3300025900 | Ga0207710_10069152 | Ga0207710_100691522 | 288 |
| 1301 | 3300025904 | Ga0207647_10005785 | Ga0207647_100057855 | 288 |
| 1302 | 3300025904 | Ga0207647_10099775 | Ga0207647_100997751 | 288 |
| 1303 | 3300025904 | Ga0207647_10116561 | Ga0207647_101165612 | 288 |
| 1304 | 3300025906 | Ga0207699_10014816 | Ga0207699_100148165 | 288 |
| 1305 | 3300025909 | Ga0207705_10000204 | Ga0207705_100002045 | 288 |
| 1306 | 3300025909 | Ga0207705_10249539 | Ga0207705_102495391 | 288 |
| 1307 | 3300025912 | Ga0207707_10000182 | Ga0207707_1000018252 | 288 |
| 1308 | 3300025912 | Ga0207707_10001174 | Ga0207707_1000117411 | 288 |
| 1309 | 3300025912 | Ga0207707_10001390 | Ga0207707_100013903 | 288 |
| 1310 | 3300025912 | Ga0207707_10031843 | Ga0207707_100318432 | 288 |
| 1311 | 3300025912 | Ga0207707_10071776 | Ga0207707_100717761 | 288 |
| 1312 | 3300025912 | Ga0207707_10131076 | Ga0207707_101310762 | 288 |
| 1313 | 3300025912 | Ga0207707_10276102 | Ga0207707_102761021 | 288 |
| 1314 | 3300025912 | Ga0207707_10286976 | Ga0207707_102869762 | 288 |
| 1315 | 3300025913 | Ga0207695_10000028 | Ga0207695_10000028135 | 288 |
| 1316 | 3300025913 | Ga0207695_10000171 | Ga0207695_1000017172 | 288 |
| 1317 | 3300025913 | Ga0207695_10000376 | Ga0207695_1000037672 | 288 |
| 1318 | 3300025913 | Ga0207695_10001369 | Ga0207695_1000136925 | 288 |
| 1319 | 3300025913 | Ga0207695_10001956 | Ga0207695_100019562 | 288 |
| 1320 | 3300025913 | Ga0207695_10013742 | Ga0207695_100137424 | 288 |
| 1321 | 3300025913 | Ga0207695_10030552 | Ga0207695_100305526 | 288 |
| 1322 | 3300025913 | Ga0207695_10041583 | Ga0207695_100415836 | 288 |
| 1323 | 3300025913 | Ga0207695_10322789 | Ga0207695_103227892 | 288 |
| 1324 | 3300025914 | Ga0207671_10000732 | Ga0207671_1000073215 | 288 |
| 1325 | 3300025914 | Ga0207671_10006622 | Ga0207671_100066223 | 288 |
| 1326 | 3300025914 | Ga0207671_10140872 | Ga0207671_101408722 | 288 |
| 1327 | 3300025914 | Ga0207671_10261685 | Ga0207671_102616852 | 288 |
| 1328 | 3300025915 | Ga0207693_10000102 | Ga0207693_1000010240 | 288 |
| 1329 | 3300025915 | Ga0207693_10001497 | Ga0207693_100014978 | 288 |
| 1330 | 3300025915 | Ga0207693_10052430 | Ga0207693_100524302 | 288 |
| 1331 | 3300025915 | Ga0207693_10172131 | Ga0207693_101721312 | 288 |
| 1332 | 3300025916 | Ga0207663_10006827 | Ga0207663_100068273 | 288 |
| 1333 | 3300025917 | Ga0207660_10000587 | Ga0207660_100005871 | 288 |
| 1334 | 3300025917 | Ga0207660_10006169 | Ga0207660_100061693 | 288 |
| 1335 | 3300025917 | Ga0207660_10013602 | Ga0207660_100136022 | 288 |
| 1336 | 3300025917 | Ga0207660_10043962 | Ga0207660_100439622 | 288 |
| 1337 | 3300025917 | Ga0207660_10198352 | Ga0207660_101983522 | 288 |
| 1338 | 3300025919 | Ga0207657_10000110 | Ga0207657_1000011023 | 288 |
| 1339 | 3300025919 | Ga0207657_10009002 | Ga0207657_100090021 | 288 |
| 1340 | 3300025919 | Ga0207657_10009421 | Ga0207657_100094211 | 288 |
| 1341 | 3300025919 | Ga0207657_10023144 | Ga0207657_100231446 | 288 |
| 1342 | 3300025920 | Ga0207649_10000044 | Ga0207649_1000004458 | 288 |
| 1343 | 3300025920 | Ga0207649_10000070 | Ga0207649_100000702 | 288 |
| 1344 | 3300025920 | Ga0207649_10000074 | Ga0207649_1000007431 | 288 |
| 1345 | 3300025920 | Ga0207649_10064494 | Ga0207649_100644943 | 288 |
| 1346 | 3300025921 | Ga0207652_10000161 | Ga0207652_100001611 | 288 |
| 1347 | 3300025921 | Ga0207652_10002347 | Ga0207652_100023475 | 288 |
| 1348 | 3300025921 | Ga0207652_10066294 | Ga0207652_100662942 | 288 |
| 1349 | 3300025921 | Ga0207652_10127717 | Ga0207652_101277172 | 288 |
| 1350 | 3300025921 | Ga0207652_10182322 | Ga0207652_101823221 | 288 |
| 1351 | 3300025921 | Ga0207652_10445574 | Ga0207652_104455742 | 288 |
| 1352 | 3300025924 | Ga0207694_10088854 | Ga0207694_100888542 | 288 |
| 1353 | 3300025924 | Ga0207694_10189488 | Ga0207694_101894881 | 288 |
| 1354 | 3300025925 | Ga0207650_10001503 | Ga0207650_100015036 | 288 |
| 1355 | 3300025925 | Ga0207650_10002042 | Ga0207650_100020429 | 288 |
| 1356 | 3300025926 | Ga0207659_10123986 | Ga0207659_101239862 | 288 |
| 1357 | 3300025928 | Ga0207700_10178472 | Ga0207700_101784722 | 288 |
| 1358 | 3300025929 | Ga0207664_10099261 | Ga0207664_100992612 | 288 |
| 1359 | 3300025931 | Ga0207644_10009521 | Ga0207644_100095214 | 288 |
| 1360 | 3300025931 | Ga0207644_10075266 | Ga0207644_100752663 | 288 |
| 1361 | 3300025931 | Ga0207644_10204362 | Ga0207644_102043622 | 288 |
| 1362 | 3300025932 | Ga0207690_10000016 | Ga0207690_10000016172 | 288 |
| 1363 | 3300025932 | Ga0207690_10067965 | Ga0207690_100679652 | 288 |
| 1364 | 3300025932 | Ga0207690_10279055 | Ga0207690_102790551 | 288 |
| 1365 | 3300025932 | Ga0207690_10446273 | Ga0207690_104462732 | 288 |
| 1366 | 3300025935 | Ga0207709_10000466 | Ga0207709_1000046618 | 288 |
| 1367 | 3300025935 | Ga0207709_10052065 | Ga0207709_100520653 | 288 |
| 1368 | 3300025938 | Ga0207704_10149773 | Ga0207704_101497732 | 288 |
| 1369 | 3300025939 | Ga0207665_10006300 | Ga0207665_100063003 | 288 |
| 1370 | 3300025939 | Ga0207665_10125320 | Ga0207665_101253202 | 288 |
| 1371 | 3300025942 | Ga0207689_10017003 | Ga0207689_100170031 | 288 |
| 1372 | 3300025942 | Ga0207689_10106981 | Ga0207689_101069813 | 288 |
| 1373 | 3300025944 | Ga0207661_10006389 | Ga0207661_100063895 | 288 |
| 1374 | 3300025944 | Ga0207661_10211282 | Ga0207661_102112822 | 288 |
| 1375 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004290 | 288 |
| 1376 | 3300025945 | Ga0207679_10000021 | Ga0207679_1000002176 | 288 |
| 1377 | 3300025945 | Ga0207679_10076851 | Ga0207679_100768513 | 288 |
| 1378 | 3300025945 | Ga0207679_10283651 | Ga0207679_102836511 | 288 |
| 1379 | 3300025949 | Ga0207667_10000093 | Ga0207667_1000009318 | 288 |
| 1380 | 3300025949 | Ga0207667_10004117 | Ga0207667_1000411711 | 288 |
| 1381 | 3300025949 | Ga0207667_10004376 | Ga0207667_1000437614 | 288 |
| 1382 | 3300025949 | Ga0207667_10018955 | Ga0207667_100189557 | 288 |
| 1383 | 3300025949 | Ga0207667_10032279 | Ga0207667_100322792 | 288 |
| 1384 | 3300025949 | Ga0207667_10220878 | Ga0207667_102208781 | 288 |
| 1385 | 3300025949 | Ga0207667_10369718 | Ga0207667_103697182 | 288 |
| 1386 | 3300025961 | Ga0207712_10009649 | Ga0207712_100096492 | 288 |
| 1387 | 3300025972 | Ga0207668_10058586 | Ga0207668_100585863 | 288 |
| 1388 | 3300025981 | Ga0207640_10000108 | Ga0207640_1000010848 | 288 |
| 1389 | 3300025981 | Ga0207640_10003445 | Ga0207640_100034452 | 288 |
| 1390 | 3300025981 | Ga0207640_10018962 | Ga0207640_100189622 | 288 |
| 1391 | 3300025986 | Ga0207658_10038341 | Ga0207658_100383413 | 288 |
| 1392 | 3300026035 | Ga0207703_10034163 | Ga0207703_100341633 | 288 |
| 1393 | 3300026041 | Ga0207639_10001055 | Ga0207639_100010559 | 288 |
| 1394 | 3300026041 | Ga0207639_10034133 | Ga0207639_100341332 | 288 |
| 1395 | 3300026041 | Ga0207639_10191491 | Ga0207639_101914912 | 288 |
| 1396 | 3300026067 | Ga0207678_10000005 | Ga0207678_10000005106 | 288 |
| 1397 | 3300026067 | Ga0207678_10002869 | Ga0207678_1000286915 | 288 |
| 1398 | 3300026067 | Ga0207678_10005689 | Ga0207678_100056894 | 288 |
| 1399 | 3300026067 | Ga0207678_10007134 | Ga0207678_100071345 | 288 |
| 1400 | 3300026067 | Ga0207678_10048244 | Ga0207678_100482442 | 288 |
| 1401 | 3300026067 | Ga0207678_10070147 | Ga0207678_100701474 | 288 |
| 1402 | 3300026067 | Ga0207678_10089995 | Ga0207678_100899953 | 288 |
| 1403 | 3300026075 | Ga0207708_10001415 | Ga0207708_100014152 | 288 |
| 1404 | 3300026078 | Ga0207702_10000280 | Ga0207702_1000028038 | 288 |
| 1405 | 3300026078 | Ga0207702_10008346 | Ga0207702_100083463 | 288 |
| 1406 | 3300026078 | Ga0207702_10112094 | Ga0207702_101120942 | 288 |
| 1407 | 3300026078 | Ga0207702_10494259 | Ga0207702_104942592 | 288 |
| 1408 | 3300026088 | Ga0207641_10019607 | Ga0207641_100196074 | 288 |
| 1409 | 3300026088 | Ga0207641_10032111 | Ga0207641_100321112 | 288 |
| 1410 | 3300026089 | Ga0207648_10228857 | Ga0207648_102288572 | 288 |
| 1411 | 3300026095 | Ga0207676_10022067 | Ga0207676_100220671 | 288 |
| 1412 | 3300026095 | Ga0207676_10064340 | Ga0207676_100643402 | 288 |
| 1413 | 3300026116 | Ga0207674_10004181 | Ga0207674_100041814 | 288 |
| 1414 | 3300026116 | Ga0207674_10013703 | Ga0207674_100137039 | 288 |
| 1415 | 3300026116 | Ga0207674_10176584 | Ga0207674_101765842 | 288 |
| 1416 | 3300026121 | Ga0207683_10059589 | Ga0207683_100595893 | 288 |
| 1417 | 3300026142 | Ga0207698_10000021 | Ga0207698_1000002140 | 288 |
| 1418 | 3300026142 | Ga0207698_10076498 | Ga0207698_100764983 | 288 |
| 1419 | 3300026142 | Ga0207698_10086585 | Ga0207698_100865853 | 288 |
| 1420 | 3300026142 | Ga0207698_10093242 | Ga0207698_100932422 | 288 |
| 1421 | 3300026142 | Ga0207698_10164919 | Ga0207698_101649192 | 288 |
| 1422 | 3300026142 | Ga0207698_10204609 | Ga0207698_102046092 | 288 |
| 1423 | 3300027111 | Ga0209281_1000004 | Ga0209281_10000041178 | 288 |
| 1424 | 3300027111 | Ga0209281_1000024 | Ga0209281_1000024459 | 288 |
| 1425 | 3300027111 | Ga0209281_1000494 | Ga0209281_10004945 | 288 |
| 1426 | 3300027111 | Ga0209281_1000619 | Ga0209281_10006196 | 288 |
| 1427 | 3300027312 | Ga0209371_1000001 | Ga0209371_10000011113 | 288 |
| 1428 | 3300027312 | Ga0209371_1000156 | Ga0209371_100015620 | 288 |
| 1429 | 3300027312 | Ga0209371_1000187 | Ga0209371_10001879 | 288 |
| 1430 | 3300027312 | Ga0209371_1000191 | Ga0209371_100019156 | 288 |
| 1431 | 3300027312 | Ga0209371_1000213 | Ga0209371_100021320 | 288 |
| 1432 | 3300027312 | Ga0209371_1000661 | Ga0209371_100066132 | 288 |
| 1433 | 3300027312 | Ga0209371_1023636 | Ga0209371_10236362 | 288 |
| 1434 | 3300028379 | Ga0268266_10001965 | Ga0268266_1000196511 | 288 |
| 1435 | 3300028379 | Ga0268266_10116295 | Ga0268266_101162953 | 288 |
| 1436 | 3300028379 | Ga0268266_10131313 | Ga0268266_101313133 | 288 |
| 1437 | 3300028379 | Ga0268266_10170823 | Ga0268266_101708232 | 288 |
| 1438 | 3300028380 | Ga0268265_10002757 | Ga0268265_1000275713 | 288 |
| 1439 | 3300028381 | Ga0268264_10014328 | Ga0268264_100143283 | 288 |
| 1440 | 3300028381 | Ga0268264_10283773 | Ga0268264_102837732 | 288 |
| 1441 | 3300028573 | Ga0265334_10037795 | Ga0265334_100377952 | 288 |
| 1442 | 3300028794 | Ga0307515_10000034 | Ga0307515_1000003478 | 288 |
| 1443 | 3300028794 | Ga0307515_10005985 | Ga0307515_1000598522 | 288 |
| 1444 | 3300028794 | Ga0307515_10069225 | Ga0307515_100692254 | 288 |
| 1445 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000011528 | 288 |
| 1446 | 3300030500 | Ga0268256_1000028 | Ga0268256_100002840 | 288 |
| 1447 | 3300030500 | Ga0268256_1000130 | Ga0268256_100013057 | 288 |
| 1448 | 3300030500 | Ga0268256_1000156 | Ga0268256_100015679 | 288 |
| 1449 | 3300030500 | Ga0268256_1000170 | Ga0268256_100017020 | 288 |
| 1450 | 3300030521 | Ga0307511_10028029 | Ga0307511_100280296 | 288 |
| 1451 | 3300030878 | Ga0265770_1002894 | Ga0265770_10028941 | 288 |
| 1452 | 3300031235 | Ga0265330_10007239 | Ga0265330_100072396 | 288 |
| 1453 | 3300031235 | Ga0265330_10007983 | Ga0265330_100079837 | 288 |
| 1454 | 3300031247 | Ga0265340_10003459 | Ga0265340_100034598 | 288 |
| 1455 | 3300031247 | Ga0265340_10008781 | Ga0265340_100087814 | 288 |
| 1456 | 3300031249 | Ga0265339_10003445 | Ga0265339_1000344512 | 288 |
| 1457 | 3300031251 | Ga0265327_10082731 | Ga0265327_100827311 | 288 |
| 1458 | 3300031456 | Ga0307513_10325622 | Ga0307513_103256222 | 288 |
| 1459 | 3300031548 | Ga0307408_100028246 | Ga0307408_1000282464 | 288 |
| 1460 | 3300031595 | Ga0265313_10126350 | Ga0265313_101263502 | 288 |
| 1461 | 3300031649 | Ga0307514_10006575 | Ga0307514_100065753 | 288 |
| 1462 | 3300031712 | Ga0265342_10021254 | Ga0265342_100212543 | 288 |
| 1463 | 3300031712 | Ga0265342_10030579 | Ga0265342_100305793 | 288 |
| 1464 | 3300031712 | Ga0265342_10033881 | Ga0265342_100338815 | 288 |
| 1465 | 3300031730 | Ga0307516_10001608 | Ga0307516_1000160811 | 288 |
| 1466 | 3300031901 | Ga0307406_10005128 | Ga0307406_100051285 | 288 |
| 1467 | 3300031901 | Ga0307406_10120971 | Ga0307406_101209712 | 288 |
| 1468 | 3300031911 | Ga0307412_10000300 | Ga0307412_1000030023 | 288 |
| 1469 | 3300032005 | Ga0307411_10390109 | Ga0307411_103901092 | 288 |
| 1470 | 3300033180 | Ga0307510_10057481 | Ga0307510_100574814 | 288 |
| 1471 | 3300035691 | Ga0373931_0020020 | Ga0373931_0020020_629_1501 | 288 |
| 1472 | 3300035695 | Ga0373927_0177449 | Ga0373927_0177449_257_1198 | 288 |
| 1473 | 3300035725 | Ga0373947_0244272 | Ga0373947_0244272_144_1019 | 288 |
| 1474 | 3300037068 | Ga0373925_0130554 | Ga0373925_0130554_315_1190 | 288 |
| 1475 | 3300037312 | Ga0395899_0020825 | Ga0395899_0020825_3357_4235 | 288 |
| 1476 | 3300037312 | Ga0395899_0049914 | Ga0395899_0049914_1941_2810 | 288 |
| 1477 | 3300037418 | Ga0395900_0021317 | Ga0395900_0021317_4069_4947 | 288 |
| 1478 | 3300037418 | Ga0395900_0023643 | Ga0395900_0023643_5293_6162 | 288 |
| 1479 | 3300037466 | Ga0395898_0000144 | Ga0395898_0000144_108521_109408 | 288 |
| 1480 | 3300037466 | Ga0395898_0017704 | Ga0395898_0017704_6276_7145 | 288 |
| 1481 | 3300037466 | Ga0395898_0021846 | Ga0395898_0021846_3604_4482 | 288 |
| 1482 | 3300037466 | Ga0395898_0028143 | Ga0395898_0028143_2026_2907 | 288 |
| 1483 | 3300037466 | Ga0395898_0088984 | Ga0395898_0088984_198_1067 | 288 |
| 1484 | 3300037466 | Ga0395898_0242654 | Ga0395898_0242654_29_904 | 288 |
| 1485 | 3300037471 | Ga0395905_0002710 | Ga0395905_0002710_7389_8267 | 288 |
| 1486 | 3300037471 | Ga0395905_0286439 | Ga0395905_0286439_562_1431 | 288 |
| 1487 | 3300037853 | Ga0436364_0044071 | Ga0436364_0044071_9945_10823 | 288 |
| 1488 | 3300037853 | Ga0436364_0139837 | Ga0436364_0139837_1021_1899 | 288 |
| 1489 | 3300037853 | Ga0436364_0333628 | Ga0436364_0333628_37_924 | 288 |
| 1490 | 3300038443 | Ga0395901_0004676 | Ga0395901_0004676_12561_13430 | 288 |
| 1491 | 3300038443 | Ga0395901_0033408 | Ga0395901_0033408_2405_3283 | 288 |
| 1492 | 3300039437 | Ga0436365_0595564 | Ga0436365_0595564_4394_5281 | 288 |
| 1493 | 3300039437 | Ga0436365_1570145 | Ga0436365_1570145_599_1483 | 288 |
| 1494 | 3300039447 | Ga0436361_1187256 | Ga0436361_1187256_110_1006 | 288 |
| 1495 | 3300039450 | Ga0436363_0171997 | Ga0436363_0171997_390_1277 | 288 |
| 1496 | 3300039453 | Ga0436362_0283733 | Ga0436362_0283733_2649_3578 | 288 |
| 1497 | 3300041404 | Ga0439436_0000001 | Ga0439436_0000001_29682_30557 | 288 |
| 1498 | 3300041411 | Ga0439466_0045670 | Ga0439466_0045670_400_1293 | 288 |
| 1499 | 3300041413 | Ga0439465_0007323 | Ga0439465_0007323_1553_2422 | 288 |
| 1500 | 3300041452 | Ga0451793_1206436 | Ga0451793_1206436_622_1524 | 288 |
| 1501 | 3300041496 | Ga0451839_0853427 | Ga0451839_0853427_1442_2317 | 288 |
| 1502 | 3300041498 | Ga0451841_1419731 | Ga0451841_1419731_10_885 | 288 |
| 1503 | 3300041501 | Ga0451845_0892693 | Ga0451845_0892693_372_1247 | 288 |
| 1504 | 3300041503 | Ga0451847_0291915 | Ga0451847_0291915_1307_2182 | 288 |
| 1505 | 3300041505 | Ga0451849_0744664 | Ga0451849_0744664_544_1419 | 288 |
| 1506 | 3300041507 | Ga0451851_0254806 | Ga0451851_0254806_1804_2679 | 288 |
| 1507 | 3300041509 | Ga0451843_1092677 | Ga0451843_1092677_186_1061 | 288 |
| 1508 | 3300041512 | Ga0451853_3235739 | Ga0451853_3235739_2003_2884 | 288 |
| 1509 | 3300042007 | Ga0439449_0007872 | Ga0439449_0007872_1399_2292 | 288 |
| 1510 | 3300042010 | Ga0439452_000248 | Ga0439452_000248_22147_23013 | 288 |
| 1511 | 3300042010 | Ga0439452_000300 | Ga0439452_000300_6710_7591 | 288 |
| 1512 | 3300042012 | Ga0439455_0018557 | Ga0439455_0018557_133_1020 | 288 |
| 1513 | 3300042135 | Ga0450899_000439 | Ga0450899_000439_1309_2175 | 288 |
| 1514 | 3300044656 | Ga0466969_0004763 | Ga0466969_0004763_205_1101 | 288 |
| 1515 | 3300044656 | Ga0466969_0022928 | Ga0466969_0022928_585_1475 | 288 |
| 1516 | 3300044656 | Ga0466969_0030124 | Ga0466969_0030124_1864_2739 | 288 |
| 1517 | 3300044659 | Ga0466973_0057243 | Ga0466973_0057243_16_894 | 288 |
| 1518 | 3300044669 | Ga0466981_0000002 | Ga0466981_0000002_263117_263998 | 288 |
| 1519 | 3300044684 | Ga0466966_0002610 | Ga0466966_0002610_1894_2916 | 288 |
| 1520 | 3300044684 | Ga0466966_0006513 | Ga0466966_0006513_5265_6155 | 288 |
| 1521 | 3300044684 | Ga0466966_0013288 | Ga0466966_0013288_3327_4223 | 288 |
| 1522 | 3300044684 | Ga0466966_0061811 | Ga0466966_0061811_1473_2342 | 288 |
| 1523 | 3300044693 | Ga0466961_0004115 | Ga0466961_0004115_4538_5428 | 288 |
| 1524 | 3300044693 | Ga0466961_0012941 | Ga0466961_0012941_3278_4156 | 288 |
| 1525 | 3300044693 | Ga0466961_0021366 | Ga0466961_0021366_2598_3479 | 288 |
| 1526 | 3300044693 | Ga0466961_0038093 | Ga0466961_0038093_1797_2675 | 288 |
| 1527 | 3300044693 | Ga0466961_0052262 | Ga0466961_0052262_1149_2024 | 288 |
| 1528 | 3300044694 | Ga0466963_0027613 | Ga0466963_0027613_2700_3587 | 288 |
| 1529 | 3300044694 | Ga0466963_0064461 | Ga0466963_0064461_256_1137 | 288 |
| 1530 | 3300044719 | Ga0466971_0005973 | Ga0466971_0005973_2854_3732 | 288 |
| 1531 | 3300044735 | Ga0466968_0165840 | Ga0466968_0165840_52_927 | 288 |
| 1532 | 3300044765 | Ga0466970_0004814 | Ga0466970_0004814_4209_5099 | 288 |
| 1533 | 3300044842 | Ga0466957_0003433 | Ga0466957_0003433_1626_2504 | 288 |
| 1534 | 3300044842 | Ga0466957_0014643 | Ga0466957_0014643_1124_2146 | 288 |
| 1535 | 3300044842 | Ga0466957_0017015 | Ga0466957_0017015_2235_3110 | 288 |
| 1536 | 3300045049 | Ga0466959_0002415 | Ga0466959_0002415_1862_2740 | 288 |
| 1537 | 3300045049 | Ga0466959_0005606 | Ga0466959_0005606_4003_4893 | 288 |
| 1538 | 3300045049 | Ga0466959_0145881 | Ga0466959_0145881_116_985 | 288 |
| 1539 | 3300045836 | Ga0466958_0016651 | Ga0466958_0016651_193_1071 | 288 |
| 1540 | 3300045836 | Ga0466958_0129906 | Ga0466958_0129906_427_1308 | 288 |
| 1541 | 3300045976 | Ga0466967_0012429 | Ga0466967_0012429_3697_4584 | 288 |
| 1542 | 3300045976 | Ga0466967_0450077 | Ga0466967_0450077_11_889 | 288 |
| 1543 | 3300046452 | Ga0495617_002319 | Ga0495617_002319_4738_5616 | 288 |
| 1544 | 3300046454 | Ga0495592_0046945 | Ga0495592_0046945_386_1264 | 288 |
| 1545 | 3300046454 | Ga0495592_0146346 | Ga0495592_0146346_741_1610 | 288 |
| 1546 | 3300046458 | Ga0495591_000003 | Ga0495591_000003_428192_429058 | 288 |
| 1547 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_221776_222678 | 288 |
| 1548 | 3300046460 | Ga0495638_0000536 | Ga0495638_0000536_18176_19054 | 288 |
| 1549 | 3300046460 | Ga0495638_0004272 | Ga0495638_0004272_45_911 | 288 |
| 1550 | 3300046462 | Ga0495651_0090874 | Ga0495651_0090874_151_1029 | 288 |
| 1551 | 3300046471 | Ga0495650_0000005 | Ga0495650_0000005_616803_617684 | 288 |
| 1552 | 3300046473 | Ga0495582_0015149 | Ga0495582_0015149_709_1578 | 288 |
| 1553 | 3300046474 | Ga0495605_0018540 | Ga0495605_0018540_2521_3396 | 288 |
| 1554 | 3300046476 | Ga0495662_0003706 | Ga0495662_0003706_2248_3117 | 288 |
| 1555 | 3300046476 | Ga0495662_0028185 | Ga0495662_0028185_450_1391 | 288 |
| 1556 | 3300046477 | Ga0495664_0033919 | Ga0495664_0033919_1490_2359 | 288 |
| 1557 | 3300046492 | Ga0495585_0114432 | Ga0495585_0114432_338_1303 | 288 |
| 1558 | 3300046501 | Ga0495607_0000196 | Ga0495607_0000196_38270_39148 | 288 |
| 1559 | 3300046501 | Ga0495607_0000601 | Ga0495607_0000601_12620_13489 | 288 |
| 1560 | 3300046507 | Ga0495606_0001436 | Ga0495606_0001436_29701_30579 | 288 |
| 1561 | 3300046507 | Ga0495606_0006197 | Ga0495606_0006197_1981_2856 | 288 |
| 1562 | 3300046507 | Ga0495606_0009875 | Ga0495606_0009875_1322_2197 | 288 |
| 1563 | 3300046507 | Ga0495606_0106078 | Ga0495606_0106078_275_1150 | 288 |
| 1564 | 3300046511 | Ga0495608_0011914 | Ga0495608_0011914_1291_2169 | 288 |
| 1565 | 3300046512 | Ga0495610_0006875 | Ga0495610_0006875_2895_3770 | 288 |
| 1566 | 3300046512 | Ga0495610_0012396 | Ga0495610_0012396_1717_2583 | 288 |
| 1567 | 3300046512 | Ga0495610_0013550 | Ga0495610_0013550_1247_2113 | 288 |
| 1568 | 3300046512 | Ga0495610_0034453 | Ga0495610_0034453_877_1746 | 288 |
| 1569 | 3300046512 | Ga0495610_0090341 | Ga0495610_0090341_408_1289 | 288 |
| 1570 | 3300046514 | Ga0495618_0064279 | Ga0495618_0064279_989_1879 | 288 |
| 1571 | 3300046515 | Ga0495620_0000224 | Ga0495620_0000224_38354_39220 | 288 |
| 1572 | 3300046515 | Ga0495620_0008274 | Ga0495620_0008274_603_1478 | 288 |
| 1573 | 3300046516 | Ga0495628_0003636 | Ga0495628_0003636_918_1796 | 288 |
| 1574 | 3300046516 | Ga0495628_0014644 | Ga0495628_0014644_1796_2674 | 288 |
| 1575 | 3300046517 | Ga0495630_0126874 | Ga0495630_0126874_345_1235 | 288 |
| 1576 | 3300046518 | Ga0495631_0001169 | Ga0495631_0001169_6509_7375 | 288 |
| 1577 | 3300046519 | Ga0495632_0004284 | Ga0495632_0004284_1452_2327 | 288 |
| 1578 | 3300046519 | Ga0495632_0046986 | Ga0495632_0046986_1121_1987 | 288 |
| 1579 | 3300046520 | Ga0495637_0002197 | Ga0495637_0002197_6812_7690 | 288 |
| 1580 | 3300046520 | Ga0495637_0003672 | Ga0495637_0003672_1223_2089 | 288 |
| 1581 | 3300046522 | Ga0495643_0000041 | Ga0495643_0000041_95544_96413 | 288 |
| 1582 | 3300046522 | Ga0495643_0001110 | Ga0495643_0001110_22511_23386 | 288 |
| 1583 | 3300046522 | Ga0495643_0098671 | Ga0495643_0098671_211_1080 | 288 |
| 1584 | 3300046523 | Ga0495644_0008900 | Ga0495644_0008900_130_999 | 288 |
| 1585 | 3300046524 | Ga0495648_0072599 | Ga0495648_0072599_849_1730 | 288 |
| 1586 | 3300046529 | Ga0495652_0021270 | Ga0495652_0021270_4242_5111 | 288 |
| 1587 | 3300046529 | Ga0495652_0041537 | Ga0495652_0041537_1934_2806 | 288 |
| 1588 | 3300046529 | Ga0495652_0093283 | Ga0495652_0093283_293_1171 | 288 |
| 1589 | 3300046529 | Ga0495652_0193210 | Ga0495652_0193210_45_923 | 288 |
| 1590 | 3300046530 | Ga0495654_0004082 | Ga0495654_0004082_715_1581 | 288 |
| 1591 | 3300046530 | Ga0495654_0048912 | Ga0495654_0048912_85_960 | 288 |
| 1592 | 3300046536 | Ga0495587_0053024 | Ga0495587_0053024_1182_2051 | 288 |
| 1593 | 3300046538 | Ga0495609_0040470 | Ga0495609_0040470_512_1387 | 288 |
| 1594 | 3300046542 | Ga0495597_0016444 | Ga0495597_0016444_1764_2639 | 288 |
| 1595 | 3300046542 | Ga0495597_0048353 | Ga0495597_0048353_857_1723 | 288 |
| 1596 | 3300046557 | Ga0495622_0028567 | Ga0495622_0028567_873_1751 | 288 |
| 1597 | 3300046558 | Ga0495633_0028953 | Ga0495633_0028953_181_1059 | 288 |
| 1598 | 3300046616 | Ga0495668_0012255 | Ga0495668_0012255_1912_2796 | 288 |
| 1599 | 3300046648 | Ga0495611_0000034 | Ga0495611_0000034_64737_65615 | 288 |
| 1600 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_774772_775650 | 288 |
| 1601 | 3300046660 | Ga0495625_0102901 | Ga0495625_0102901_135_1001 | 288 |
| 1602 | 3300046660 | Ga0495625_0292695 | Ga0495625_0292695_68_946 | 288 |
| 1603 | 3300046663 | Ga0495635_0072330 | Ga0495635_0072330_78_956 | 288 |
| 1604 | 3300046665 | Ga0495661_0001990 | Ga0495661_0001990_5490_6356 | 288 |
| 1605 | 3300046665 | Ga0495661_0177674 | Ga0495661_0177674_36_914 | 288 |
| 1606 | 3300046675 | Ga0495657_0127482 | Ga0495657_0127482_331_1245 | 288 |
| 1607 | 3300046678 | Ga0495599_0003643 | Ga0495599_0003643_7384_8262 | 288 |
| 1608 | 3300046680 | Ga0495646_0136491 | Ga0495646_0136491_44_922 | 288 |
| 1609 | 3300046691 | Ga0495670_0000639 | Ga0495670_0000639_15696_16571 | 288 |
| 1610 | 3300046691 | Ga0495670_0015900 | Ga0495670_0015900_1885_2763 | 288 |
| 1611 | 3300046691 | Ga0495670_0062638 | Ga0495670_0062638_800_1735 | 288 |
| 1612 | 3300046692 | Ga0495671_0031775 | Ga0495671_0031775_766_1644 | 288 |
| 1613 | 3300046692 | Ga0495671_0119024 | Ga0495671_0119024_343_1224 | 288 |
| 1614 | 3300046694 | Ga0495649_0082527 | Ga0495649_0082527_20_895 | 288 |
| 1615 | 3300046794 | Ga0495589_0000192 | Ga0495589_0000192_23830_24708 | 288 |
| 1616 | 3300046809 | Ga0495600_0002922 | Ga0495600_0002922_6227_7105 | 288 |
| 1617 | 3300046809 | Ga0495600_0035414 | Ga0495600_0035414_1658_2545 | 288 |
| 1618 | 3300046810 | Ga0495660_0000156 | Ga0495660_0000156_36733_37611 | 288 |
| 1619 | 3300047317 | Ga0495604_0001772 | Ga0495604_0001772_13987_14856 | 288 |
| 1620 | 3300047317 | Ga0495604_0024541 | Ga0495604_0024541_1147_2016 | 288 |
| 1621 | 3300047317 | Ga0495604_0116601 | Ga0495604_0116601_525_1403 | 288 |
| 1622 | 3300047319 | Ga0495674_0247268 | Ga0495674_0247268_206_1096 | 288 |
| 1623 | 3300047320 | Ga0495672_0016603 | Ga0495672_0016603_3658_4533 | 288 |
| 1624 | 3300047322 | Ga0495680_0166343 | Ga0495680_0166343_662_1540 | 288 |
| 1625 | 3300047443 | Ga0495687_012580 | Ga0495687_012580_2621_3496 | 288 |
| 1626 | 3300047444 | Ga0495675_0005488 | Ga0495675_0005488_95_964 | 288 |
| 1627 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_24796_25674 | 288 |
| 1628 | 3300047446 | Ga0495679_000830 | Ga0495679_000830_9379_10245 | 288 |
| 1629 | 3300047469 | Ga0495673_0000070 | Ga0495673_0000070_82222_83088 | 288 |
| 1630 | 3300047469 | Ga0495673_0020096 | Ga0495673_0020096_1754_2632 | 288 |
| 1631 | 3300047470 | Ga0495681_0004774 | Ga0495681_0004774_6014_6880 | 288 |
| 1632 | 3300047472 | Ga0495686_0001536 | Ga0495686_0001536_22318_23196 | 288 |
| 1633 | 3300047472 | Ga0495686_0005493 | Ga0495686_0005493_4249_5121 | 288 |
| 1634 | 3300047472 | Ga0495686_0007185 | Ga0495686_0007185_3569_4444 | 288 |
| 1635 | 3300047472 | Ga0495686_0009091 | Ga0495686_0009091_2946_3827 | 288 |
| 1636 | 3300047472 | Ga0495686_0149627 | Ga0495686_0149627_254_1132 | 288 |
| 1637 | 3300048088 | Ga0495602_0039549 | Ga0495602_0039549_3095_3973 | 288 |
| 1638 | 3300048088 | Ga0495602_0239692 | Ga0495602_0239692_98_976 | 288 |
| 1639 | 3300048091 | Ga0495626_0001268 | Ga0495626_0001268_5913_6785 | 288 |
| 1640 | 3300048091 | Ga0495626_0020911 | Ga0495626_0020911_1527_2399 | 288 |
| 1641 | 3300048903 | Ga0496100_0014245 | Ga0496100_0014245_1353_2243 | 288 |
| 1642 | 3300048903 | Ga0496100_0320638 | Ga0496100_0320638_170_1063 | 288 |
| 1643 | 3300048903 | Ga0496100_0411805 | Ga0496100_0411805_92_997 | 288 |
| 1644 | 3300048904 | Ga0496101_0009116 | Ga0496101_0009116_3302_4189 | 288 |
| 1645 | 3300048904 | Ga0496101_0056526 | Ga0496101_0056526_1448_2323 | 288 |
| 1646 | 3300048904 | Ga0496101_0194628 | Ga0496101_0194628_422_1291 | 288 |
| 1647 | 3300048904 | Ga0496101_0330133 | Ga0496101_0330133_208_1113 | 288 |
| 1648 | 3300048905 | Ga0496102_0006737 | Ga0496102_0006737_4181_5086 | 288 |
| 1649 | 3300048905 | Ga0496102_0016623 | Ga0496102_0016623_3353_4243 | 288 |
| 1650 | 3300048905 | Ga0496102_0274219 | Ga0496102_0274219_347_1216 | 288 |
| 1651 | 3300048905 | Ga0496102_0386712 | Ga0496102_0386712_71_985 | 288 |
| 1652 | 3300048906 | Ga0496103_0030844 | Ga0496103_0030844_1334_2224 | 288 |
| 1653 | 3300048906 | Ga0496103_0152998 | Ga0496103_0152998_144_1037 | 288 |
| 1654 | 3300048907 | Ga0496104_0000144 | Ga0496104_0000144_58002_58868 | 288 |
| 1655 | 3300048907 | Ga0496104_0282359 | Ga0496104_0282359_420_1289 | 288 |
| 1656 | 3300048908 | Ga0496105_0001656 | Ga0496105_0001656_14549_15415 | 288 |
| 1657 | 3300048908 | Ga0496105_0093583 | Ga0496105_0093583_1472_2386 | 288 |
| 1658 | 3300048908 | Ga0496105_0220517 | Ga0496105_0220517_363_1232 | 288 |
| 1659 | 3300048909 | Ga0496106_0002011 | Ga0496106_0002011_9780_10685 | 288 |
| 1660 | 3300048911 | Ga0496108_0049839 | Ga0496108_0049839_254_1168 | 288 |
| 1661 | 3300048911 | Ga0496108_0076179 | Ga0496108_0076179_415_1302 | 288 |
| 1662 | 3300048913 | Ga0496110_0089966 | Ga0496110_0089966_1744_2631 | 288 |
| 1663 | 3300048913 | Ga0496110_0256355 | Ga0496110_0256355_345_1214 | 288 |
| 1664 | 3300048914 | Ga0496111_0189189 | Ga0496111_0189189_295_1164 | 288 |
| 1665 | 3300048915 | Ga0496112_0099298 | Ga0496112_0099298_50_964 | 288 |
| 1666 | 3300048915 | Ga0496112_0221230 | Ga0496112_0221230_298_1182 | 288 |
| 1667 | 3300048915 | Ga0496112_0587969 | Ga0496112_0587969_120_995 | 288 |
| 1668 | 3300048916 | Ga0496113_0096216 | Ga0496113_0096216_1379_2272 | 288 |
| 1669 | 3300048916 | Ga0496113_0177443 | Ga0496113_0177443_426_1292 | 288 |
| 1670 | 3300048917 | Ga0496114_0174910 | Ga0496114_0174910_628_1497 | 288 |
| 1671 | 3300048918 | Ga0496115_0009933 | Ga0496115_0009933_2028_2906 | 288 |
| 1672 | 3300048919 | Ga0496116_0004768 | Ga0496116_0004768_2985_3866 | 288 |
| 1673 | 3300048919 | Ga0496116_0036507 | Ga0496116_0036507_751_1617 | 288 |
| 1674 | 3300048919 | Ga0496116_0065446 | Ga0496116_0065446_1372_2244 | 288 |
| 1675 | 3300048919 | Ga0496116_0068600 | Ga0496116_0068600_1084_1968 | 288 |
| 1676 | 3300048919 | Ga0496116_0068784 | Ga0496116_0068784_137_1003 | 288 |
| 1677 | 3300048919 | Ga0496116_0076471 | Ga0496116_0076471_247_1122 | 288 |
| 1678 | 3300048919 | Ga0496116_0078994 | Ga0496116_0078994_12_890 | 288 |
| 1679 | 3300048919 | Ga0496116_0134302 | Ga0496116_0134302_203_1072 | 288 |
| 1680 | 3300048919 | Ga0496116_0137098 | Ga0496116_0137098_139_1014 | 288 |
| 1681 | 3300048920 | Ga0496117_0000020 | Ga0496117_0000020_390129_391010 | 288 |
| 1682 | 3300048920 | Ga0496117_0000033 | Ga0496117_0000033_219840_220706 | 288 |
| 1683 | 3300048920 | Ga0496117_0008695 | Ga0496117_0008695_1963_2853 | 288 |
| 1684 | 3300048920 | Ga0496117_0019573 | Ga0496117_0019573_3923_4789 | 288 |
| 1685 | 3300048920 | Ga0496117_0025946 | Ga0496117_0025946_1307_2173 | 288 |
| 1686 | 3300048920 | Ga0496117_0105021 | Ga0496117_0105021_452_1327 | 288 |
| 1687 | 3300048920 | Ga0496117_0167852 | Ga0496117_0167852_300_1166 | 288 |
| 1688 | 3300048921 | Ga0496118_0000015 | Ga0496118_0000015_405340_406221 | 288 |
| 1689 | 3300048921 | Ga0496118_0000477 | Ga0496118_0000477_35598_36473 | 288 |
| 1690 | 3300048921 | Ga0496118_0000594 | Ga0496118_0000594_17796_18662 | 288 |
| 1691 | 3300048921 | Ga0496118_0002815 | Ga0496118_0002815_6746_7636 | 288 |
| 1692 | 3300048921 | Ga0496118_0004254 | Ga0496118_0004254_7337_8203 | 288 |
| 1693 | 3300048921 | Ga0496118_0008241 | Ga0496118_0008241_6195_7061 | 288 |
| 1694 | 3300048921 | Ga0496118_0008545 | Ga0496118_0008545_5943_6809 | 288 |
| 1695 | 3300048921 | Ga0496118_0008797 | Ga0496118_0008797_1298_2167 | 288 |
| 1696 | 3300048921 | Ga0496118_0010211 | Ga0496118_0010211_2497_3363 | 288 |
| 1697 | 3300048921 | Ga0496118_0070858 | Ga0496118_0070858_151_1026 | 288 |
| 1698 | 3300048921 | Ga0496118_0079034 | Ga0496118_0079034_1027_1902 | 288 |
| 1699 | 3300048921 | Ga0496118_0081909 | Ga0496118_0081909_1140_2015 | 288 |
| 1700 | 3300048921 | Ga0496118_0145444 | Ga0496118_0145444_296_1174 | 288 |
| 1701 | 3300048922 | Ga0496119_0001524 | Ga0496119_0001524_7785_8651 | 288 |
| 1702 | 3300048922 | Ga0496119_0003299 | Ga0496119_0003299_1172_2053 | 288 |
| 1703 | 3300048922 | Ga0496119_0013005 | Ga0496119_0013005_2828_3709 | 288 |
| 1704 | 3300048922 | Ga0496119_0022474 | Ga0496119_0022474_985_1851 | 288 |
| 1705 | 3300048922 | Ga0496119_0022836 | Ga0496119_0022836_3012_3890 | 288 |
| 1706 | 3300048922 | Ga0496119_0063569 | Ga0496119_0063569_78_944 | 288 |
| 1707 | 3300048922 | Ga0496119_0068500 | Ga0496119_0068500_160_1041 | 288 |
| 1708 | 3300048922 | Ga0496119_0085679 | Ga0496119_0085679_780_1661 | 288 |
| 1709 | 3300048922 | Ga0496119_0089162 | Ga0496119_0089162_84_959 | 288 |
| 1710 | 3300048922 | Ga0496119_0102933 | Ga0496119_0102933_73_966 | 288 |
| 1711 | 3300048922 | Ga0496119_0105054 | Ga0496119_0105054_371_1240 | 288 |
| 1712 | 3300048923 | Ga0496120_0000430 | Ga0496120_0000430_35911_36777 | 288 |
| 1713 | 3300048923 | Ga0496120_0001435 | Ga0496120_0001435_22450_23316 | 288 |
| 1714 | 3300048923 | Ga0496120_0003272 | Ga0496120_0003272_11767_12633 | 288 |
| 1715 | 3300048923 | Ga0496120_0005266 | Ga0496120_0005266_1175_2056 | 288 |
| 1716 | 3300048923 | Ga0496120_0005908 | Ga0496120_0005908_6088_6978 | 288 |
| 1717 | 3300048923 | Ga0496120_0005910 | Ga0496120_0005910_8115_8996 | 288 |
| 1718 | 3300048923 | Ga0496120_0014600 | Ga0496120_0014600_1083_1949 | 288 |
| 1719 | 3300048923 | Ga0496120_0044448 | Ga0496120_0044448_1132_1998 | 288 |
| 1720 | 3300048923 | Ga0496120_0051102 | Ga0496120_0051102_792_1658 | 288 |
| 1721 | 3300048923 | Ga0496120_0182351 | Ga0496120_0182351_14_880 | 288 |
| 1722 | 3300048923 | Ga0496120_0193235 | Ga0496120_0193235_89_955 | 288 |
| 1723 | 3300048924 | Ga0496121_0001223 | Ga0496121_0001223_30158_31039 | 288 |
| 1724 | 3300048924 | Ga0496121_0002468 | Ga0496121_0002468_19438_20307 | 288 |
| 1725 | 3300048924 | Ga0496121_0003240 | Ga0496121_0003240_15134_16024 | 288 |
| 1726 | 3300048924 | Ga0496121_0003417 | Ga0496121_0003417_4702_5583 | 288 |
| 1727 | 3300048924 | Ga0496121_0005209 | Ga0496121_0005209_3674_4555 | 288 |
| 1728 | 3300048924 | Ga0496121_0014421 | Ga0496121_0014421_4949_5827 | 288 |
| 1729 | 3300048924 | Ga0496121_0017345 | Ga0496121_0017345_3259_4152 | 288 |
| 1730 | 3300048924 | Ga0496121_0018132 | Ga0496121_0018132_2274_3140 | 288 |
| 1731 | 3300048924 | Ga0496121_0034918 | Ga0496121_0034918_2068_2934 | 288 |
| 1732 | 3300048924 | Ga0496121_0041049 | Ga0496121_0041049_2917_3792 | 288 |
| 1733 | 3300048924 | Ga0496121_0098424 | Ga0496121_0098424_179_1045 | 288 |
| 1734 | 3300048924 | Ga0496121_0135769 | Ga0496121_0135769_826_1704 | 288 |
| 1735 | 3300048924 | Ga0496121_0160543 | Ga0496121_0160543_645_1520 | 288 |
| 1736 | 3300048924 | Ga0496121_0253631 | Ga0496121_0253631_174_1040 | 288 |
| 1737 | 3300048925 | Ga0496122_0000005 | Ga0496122_0000005_155197_156063 | 288 |
| 1738 | 3300048925 | Ga0496122_0000068 | Ga0496122_0000068_168323_169189 | 288 |
| 1739 | 3300048925 | Ga0496122_0000944 | Ga0496122_0000944_6110_6976 | 288 |
| 1740 | 3300048925 | Ga0496122_0002234 | Ga0496122_0002234_5462_6343 | 288 |
| 1741 | 3300048925 | Ga0496122_0009630 | Ga0496122_0009630_7551_8444 | 288 |
| 1742 | 3300048925 | Ga0496122_0016703 | Ga0496122_0016703_239_1120 | 288 |
| 1743 | 3300048925 | Ga0496122_0020375 | Ga0496122_0020375_1122_1994 | 288 |
| 1744 | 3300048925 | Ga0496122_0021200 | Ga0496122_0021200_1756_2646 | 288 |
| 1745 | 3300048925 | Ga0496122_0022004 | Ga0496122_0022004_3575_4456 | 288 |
| 1746 | 3300048925 | Ga0496122_0089321 | Ga0496122_0089321_473_1351 | 288 |
| 1747 | 3300048925 | Ga0496122_0131664 | Ga0496122_0131664_345_1214 | 288 |
| 1748 | 3300048925 | Ga0496122_0241207 | Ga0496122_0241207_76_945 | 288 |
| 1749 | 3300048926 | Ga0496123_0000008 | Ga0496123_0000008_474566_475432 | 288 |
| 1750 | 3300048926 | Ga0496123_0000059 | Ga0496123_0000059_56967_57833 | 288 |
| 1751 | 3300048926 | Ga0496123_0000735 | Ga0496123_0000735_6295_7161 | 288 |
| 1752 | 3300048926 | Ga0496123_0002032 | Ga0496123_0002032_4344_5225 | 288 |
| 1753 | 3300048926 | Ga0496123_0002301 | Ga0496123_0002301_21150_22022 | 288 |
| 1754 | 3300048926 | Ga0496123_0003605 | Ga0496123_0003605_6551_7417 | 288 |
| 1755 | 3300048926 | Ga0496123_0004045 | Ga0496123_0004045_5168_6034 | 288 |
| 1756 | 3300048926 | Ga0496123_0004391 | Ga0496123_0004391_8923_9825 | 288 |
| 1757 | 3300048926 | Ga0496123_0005469 | Ga0496123_0005469_6791_7672 | 288 |
| 1758 | 3300048926 | Ga0496123_0015385 | Ga0496123_0015385_3427_4317 | 288 |
| 1759 | 3300048926 | Ga0496123_0047344 | Ga0496123_0047344_1904_2797 | 288 |
| 1760 | 3300048926 | Ga0496123_0079939 | Ga0496123_0079939_154_1035 | 288 |
| 1761 | 3300048926 | Ga0496123_0124884 | Ga0496123_0124884_300_1166 | 288 |
| 1762 | 3300048926 | Ga0496123_0154979 | Ga0496123_0154979_143_1012 | 288 |
| 1763 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_415856_416722 | 288 |
| 1764 | 3300048927 | Ga0496124_0000381 | Ga0496124_0000381_74435_75307 | 288 |
| 1765 | 3300048927 | Ga0496124_0001882 | Ga0496124_0001882_11500_12366 | 288 |
| 1766 | 3300048927 | Ga0496124_0002113 | Ga0496124_0002113_18330_19196 | 288 |
| 1767 | 3300048927 | Ga0496124_0002996 | Ga0496124_0002996_12491_13366 | 288 |
| 1768 | 3300048927 | Ga0496124_0005469 | Ga0496124_0005469_9685_10566 | 288 |
| 1769 | 3300048927 | Ga0496124_0025077 | Ga0496124_0025077_3030_3911 | 288 |
| 1770 | 3300048927 | Ga0496124_0031468 | Ga0496124_0031468_716_1594 | 288 |
| 1771 | 3300048927 | Ga0496124_0070719 | Ga0496124_0070719_97_999 | 288 |
| 1772 | 3300048927 | Ga0496124_0084278 | Ga0496124_0084278_569_1438 | 288 |
| 1773 | 3300048927 | Ga0496124_0128191 | Ga0496124_0128191_427_1296 | 288 |
| 1774 | 3300048927 | Ga0496124_0173315 | Ga0496124_0173315_563_1429 | 288 |
| 1775 | 3300048927 | Ga0496124_0189209 | Ga0496124_0189209_332_1207 | 288 |
| 1776 | 3300048927 | Ga0496124_0273547 | Ga0496124_0273547_60_950 | 288 |
| 1777 | 3300048927 | Ga0496124_0286367 | Ga0496124_0286367_148_1017 | 288 |
| 1778 | 3300048928 | Ga0496125_0001098 | Ga0496125_0001098_37874_38740 | 288 |
| 1779 | 3300048928 | Ga0496125_0001290 | Ga0496125_0001290_35269_36135 | 288 |
| 1780 | 3300048928 | Ga0496125_0001825 | Ga0496125_0001825_14808_15689 | 288 |
| 1781 | 3300048928 | Ga0496125_0002418 | Ga0496125_0002418_1504_2388 | 288 |
| 1782 | 3300048928 | Ga0496125_0004678 | Ga0496125_0004678_11040_11921 | 288 |
| 1783 | 3300048928 | Ga0496125_0011643 | Ga0496125_0011643_2352_3218 | 288 |
| 1784 | 3300048928 | Ga0496125_0013477 | Ga0496125_0013477_6775_7668 | 288 |
| 1785 | 3300048928 | Ga0496125_0021147 | Ga0496125_0021147_2072_2962 | 288 |
| 1786 | 3300048928 | Ga0496125_0044375 | Ga0496125_0044375_1824_2690 | 288 |
| 1787 | 3300048928 | Ga0496125_0048051 | Ga0496125_0048051_1922_2788 | 288 |
| 1788 | 3300048928 | Ga0496125_0082957 | Ga0496125_0082957_1411_2286 | 288 |
| 1789 | 3300048928 | Ga0496125_0092339 | Ga0496125_0092339_179_1045 | 288 |
| 1790 | 3300048928 | Ga0496125_0145481 | Ga0496125_0145481_475_1350 | 288 |
| 1791 | 3300048928 | Ga0496125_0148636 | Ga0496125_0148636_371_1240 | 288 |
| 1792 | 3300048929 | Ga0496126_0000669 | Ga0496126_0000669_30313_31194 | 288 |
| 1793 | 3300048929 | Ga0496126_0015558 | Ga0496126_0015558_4385_5251 | 288 |
| 1794 | 3300048929 | Ga0496126_0016186 | Ga0496126_0016186_436_1311 | 288 |
| 1795 | 3300048929 | Ga0496126_0020308 | Ga0496126_0020308_1531_2397 | 288 |
| 1796 | 3300048929 | Ga0496126_0023623 | Ga0496126_0023623_4470_5345 | 288 |
| 1797 | 3300048929 | Ga0496126_0106373 | Ga0496126_0106373_1286_2167 | 288 |
| 1798 | 3300048929 | Ga0496126_0217165 | Ga0496126_0217165_335_1204 | 288 |
| 1799 | 3300049459 | Ga0495678_000026 | Ga0495678_000026_201283_202161 | 288 |
| 1800 | 3300049569 | Ga0501032_0184529 | Ga0501032_0184529_330_1208 | 288 |
| 1801 | 3300049570 | Ga0501033_0001198 | Ga0501033_0001198_1335_2297 | 288 |
| 1802 | 3300049570 | Ga0501033_0017974 | Ga0501033_0017974_4362_5237 | 288 |
| 1803 | 3300049573 | Ga0501037_0000077 | Ga0501037_0000077_65718_66680 | 288 |
| 1804 | 3300049573 | Ga0501037_0119811 | Ga0501037_0119811_774_1652 | 288 |
| 1805 | 3300049573 | Ga0501037_0285442 | Ga0501037_0285442_129_1016 | 288 |
| 1806 | 3300049574 | Ga0501038_0084447 | Ga0501038_0084447_1304_2182 | 288 |
| 1807 | 3300049579 | Ga0501043_0000114 | Ga0501043_0000114_24070_25032 | 288 |
| 1808 | 3300049579 | Ga0501043_0009282 | Ga0501043_0009282_2620_3498 | 288 |
| 1809 | 3300049581 | Ga0501047_0176606 | Ga0501047_0176606_1038_1916 | 288 |
| 1810 | 3300049583 | Ga0501067_0017287 | Ga0501067_0017287_2515_3477 | 288 |
| 1811 | 3300049584 | Ga0501068_0165285 | Ga0501068_0165285_88_966 | 288 |
| 1812 | 3300049585 | Ga0501069_0000016 | Ga0501069_0000016_51190_52152 | 288 |
| 1813 | 3300049585 | Ga0501069_0049767 | Ga0501069_0049767_922_1800 | 288 |
| 1814 | 3300049585 | Ga0501069_0223125 | Ga0501069_0223125_140_1021 | 288 |
| 1815 | 3300049586 | Ga0501070_0000450 | Ga0501070_0000450_9643_10605 | 288 |
| 1816 | 3300049586 | Ga0501070_0014387 | Ga0501070_0014387_1023_1901 | 288 |
| 1817 | 3300049586 | Ga0501070_0078089 | Ga0501070_0078089_112_990 | 288 |
| 1818 | 3300049587 | Ga0501071_0006392 | Ga0501071_0006392_1056_2018 | 288 |
| 1819 | 3300049588 | Ga0501072_0231524 | Ga0501072_0231524_395_1273 | 288 |
| 1820 | 3300049589 | Ga0501073_0004199 | Ga0501073_0004199_7808_8770 | 288 |
| 1821 | 3300049589 | Ga0501073_0039577 | Ga0501073_0039577_1338_2216 | 288 |
| 1822 | 3300049589 | Ga0501073_0055590 | Ga0501073_0055590_451_1329 | 288 |
| 1823 | 3300049590 | Ga0501074_0000067 | Ga0501074_0000067_35738_36700 | 288 |
| 1824 | 3300049741 | Ga0501079_0054343 | Ga0501079_0054343_1827_2705 | 288 |
| 1825 | 3300049742 | Ga0501080_0000591 | Ga0501080_0000591_14806_15768 | 288 |
| 1826 | 3300049742 | Ga0501080_0035544 | Ga0501080_0035544_2172_3050 | 288 |
| 1827 | 3300049744 | Ga0501083_0000111 | Ga0501083_0000111_51990_52952 | 288 |
| 1828 | 3300049744 | Ga0501083_0103355 | Ga0501083_0103355_545_1423 | 288 |
| 1829 | 3300049822 | Ga0501035_0000048 | Ga0501035_0000048_127224_128186 | 288 |
| 1830 | 3300049822 | Ga0501035_0002791 | Ga0501035_0002791_241_1119 | 288 |
| 1831 | 3300049822 | Ga0501035_0003776 | Ga0501035_0003776_1425_2312 | 288 |
| 1832 | 3300049822 | Ga0501035_0188292 | Ga0501035_0188292_316_1191 | 288 |
| 1833 | 3300049822 | Ga0501035_0454422 | Ga0501035_0454422_121_999 | 288 |
| 1834 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_125792_126754 | 288 |
| 1835 | 3300049823 | Ga0501044_0008702 | Ga0501044_0008702_8955_9842 | 288 |
| 1836 | 3300049823 | Ga0501044_0027890 | Ga0501044_0027890_843_1721 | 288 |
| 1837 | 3300049823 | Ga0501044_0178024 | Ga0501044_0178024_569_1444 | 288 |
| 1838 | 3300050490 | nmdc:mga03n38_33255_c1 | nmdc:mga03n38_33255_c1_711_1595 | 288 |
| 1839 | 3300050490 | nmdc:mga03n38_55514_c1 | nmdc:mga03n38_55514_c1_909_1775 | 288 |
| 1840 | 3300050490 | nmdc:mga03n38_65779_c1 | nmdc:mga03n38_65779_c1_457_1332 | 288 |
| 1841 | 3300050491 | nmdc:mga00v17_155812_c1 | nmdc:mga00v17_155812_c1_70_936 | 288 |
| 1842 | 3300050491 | nmdc:mga00v17_1594_c1 | nmdc:mga00v17_1594_c1_4191_5057 | 288 |
| 1843 | 3300050491 | nmdc:mga00v17_30433_c1 | nmdc:mga00v17_30433_c1_883_1764 | 288 |
| 1844 | 3300050491 | nmdc:mga00v17_8_c1 | nmdc:mga00v17_8_c1_58533_59399 | 288 |
| 1845 | 3300050492 | nmdc:mga0yw44_222463_c1 | nmdc:mga0yw44_222463_c1_185_1054 | 288 |
| 1846 | 3300050492 | nmdc:mga0yw44_41686_c2 | nmdc:mga0yw44_41686_c2_811_1695 | 288 |
| 1847 | 3300050492 | nmdc:mga0yw44_54127_c1 | nmdc:mga0yw44_54127_c1_278_1156 | 288 |
| 1848 | 3300050492 | nmdc:mga0yw44_57872_c1 | nmdc:mga0yw44_57872_c1_1313_2185 | 288 |
| 1849 | 3300050492 | nmdc:mga0yw44_72213_c1 | nmdc:mga0yw44_72213_c1_1114_1980 | 288 |
| 1850 | 3300050493 | nmdc:mga0k408_204020_c1 | nmdc:mga0k408_204020_c1_55_969 | 288 |
| 1851 | 3300050493 | nmdc:mga0k408_35672_c1 | nmdc:mga0k408_35672_c1_469_1344 | 288 |
| 1852 | 3300050494 | nmdc:mga06z11_103442_c1 | nmdc:mga06z11_103442_c1_433_1308 | 288 |
| 1853 | 3300050496 | nmdc:mga07m45_115185_c1 | nmdc:mga07m45_115185_c1_523_1398 | 288 |
| 1854 | 3300050496 | nmdc:mga07m45_116580_c1 | nmdc:mga07m45_116580_c1_103_978 | 288 |
| 1855 | 3300050496 | nmdc:mga07m45_19984_c1 | nmdc:mga07m45_19984_c1_1535_2419 | 288 |
| 1856 | 3300050496 | nmdc:mga07m45_34685_c1 | nmdc:mga07m45_34685_c1_146_1036 | 288 |
| 1857 | 3300050496 | nmdc:mga07m45_81169_c1 | nmdc:mga07m45_81169_c1_449_1426 | 288 |
| 1858 | 3300050516 | nmdc:mga0sz30_599_c1 | nmdc:mga0sz30_599_c1_7620_8486 | 288 |
| 1859 | 3300050516 | nmdc:mga0sz30_6341_c1 | nmdc:mga0sz30_6341_c1_147_1019 | 288 |
| 1860 | 3300053077 | Ga0495601_0024660 | Ga0495601_0024660_2558_3436 | 288 |
| 1861 | 3300053077 | Ga0495601_0293508 | Ga0495601_0293508_105_995 | 288 |
| 1862 | 3300053086 | Ga0500578_0020392 | Ga0500578_0020392_3280_4155 | 288 |
| 1863 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_495040_495924 | 288 |
| 1864 | 3300053087 | Ga0500643_000138 | Ga0500643_000138_34751_35629 | 288 |
| 1865 | 3300053087 | Ga0500643_025724 | Ga0500643_025724_681_1580 | 288 |
| 1866 | 3300053088 | Ga0500644_0002712 | Ga0500644_0002712_2287_3168 | 288 |
| 1867 | 3300053092 | Ga0500583_0012961 | Ga0500583_0012961_952_1881 | 288 |
| 1868 | 3300053092 | Ga0500583_0056423 | Ga0500583_0056423_746_1612 | 288 |
| 1869 | 3300053093 | Ga0500651_0022954 | Ga0500651_0022954_2746_3627 | 288 |
| 1870 | 3300053094 | Ga0500566_0190547 | Ga0500566_0190547_91_975 | 288 |
| 1871 | 3300053102 | Ga0500554_003013 | Ga0500554_003013_869_1747 | 288 |
| 1872 | 3300053103 | Ga0500555_001236 | Ga0500555_001236_4787_5665 | 288 |
| 1873 | 3300053111 | Ga0500572_001289 | Ga0500572_001289_2754_3629 | 288 |
| 1874 | 3300053115 | Ga0500591_017361 | Ga0500591_017361_1355_2221 | 288 |
| 1875 | 3300053118 | Ga0500594_0007310 | Ga0500594_0007310_550_1431 | 288 |
| 1876 | 3300053119 | Ga0500595_000458 | Ga0500595_000458_20576_21475 | 288 |
| 1877 | 3300053119 | Ga0500595_005177 | Ga0500595_005177_885_1763 | 288 |
| 1878 | 3300053121 | Ga0500607_137328 | Ga0500607_137328_125_1009 | 288 |
| 1879 | 3300053129 | Ga0500628_006877 | Ga0500628_006877_632_1504 | 288 |
| 1880 | 3300053131 | Ga0500652_014351 | Ga0500652_014351_155_1039 | 288 |
| 1881 | 3300053133 | Ga0500655_001613 | Ga0500655_001613_592_1521 | 288 |
| 1882 | 3300053134 | Ga0500658_0000075 | Ga0500658_0000075_38155_39030 | 288 |
| 1883 | 3300053135 | Ga0500659_0120482 | Ga0500659_0120482_416_1291 | 288 |
| 1884 | 3300053136 | Ga0500559_0000002 | Ga0500559_0000002_128396_129274 | 288 |
| 1885 | 3300053136 | Ga0500559_0000027 | Ga0500559_0000027_11929_12810 | 288 |
| 1886 | 3300053136 | Ga0500559_0000217 | Ga0500559_0000217_20837_21712 | 288 |
| 1887 | 3300053136 | Ga0500559_0002459 | Ga0500559_0002459_3790_4668 | 288 |
| 1888 | 3300053137 | Ga0500561_0000020 | Ga0500561_0000020_12874_13740 | 288 |
| 1889 | 3300053141 | Ga0500574_000164 | Ga0500574_000164_197_1075 | 288 |
| 1890 | 3300053146 | Ga0500588_0046396 | Ga0500588_0046396_126_992 | 288 |
| 1891 | 3300053148 | Ga0500590_001048 | Ga0500590_001048_8320_9234 | 288 |
| 1892 | 3300053151 | Ga0500604_0003449 | Ga0500604_0003449_3296_4225 | 288 |
| 1893 | 3300053153 | Ga0500616_0005615 | Ga0500616_0005615_6355_7230 | 288 |
| 1894 | 3300053153 | Ga0500616_0006871 | Ga0500616_0006871_1293_2177 | 288 |
| 1895 | 3300053153 | Ga0500616_0012233 | Ga0500616_0012233_3818_4699 | 288 |
| 1896 | 3300053153 | Ga0500616_0033959 | Ga0500616_0033959_1439_2320 | 288 |
| 1897 | 3300053153 | Ga0500616_0052145 | Ga0500616_0052145_490_1371 | 288 |
| 1898 | 3300053154 | Ga0500619_032717 | Ga0500619_032717_201_1079 | 288 |
| 1899 | 3300053156 | Ga0500622_0010898 | Ga0500622_0010898_474_1355 | 288 |
| 1900 | 3300053158 | Ga0500627_0073105 | Ga0500627_0073105_48_923 | 288 |
| 1901 | 3300053161 | Ga0500634_0000022 | Ga0500634_0000022_6003_6881 | 288 |
| 1902 | 3300053161 | Ga0500634_0000709 | Ga0500634_0000709_5203_6069 | 288 |
| 1903 | 3300053163 | Ga0500639_030895 | Ga0500639_030895_650_1525 | 288 |
| 1904 | 3300053177 | Ga0500636_0048143 | Ga0500636_0048143_329_1210 | 288 |
| 1905 | 3300053730 | Ga0500645_000360 | Ga0500645_000360_9262_10146 | 288 |
| 1906 | 3300053730 | Ga0500645_010045 | Ga0500645_010045_1043_1960 | 288 |
| 1907 | 3300053735 | Ga0500596_001019 | Ga0500596_001019_3396_4271 | 288 |
| 1908 | 3300053739 | Ga0500587_005739 | Ga0500587_005739_732_1613 | 288 |
| 1909 | 3300060353 | Ga0501082_0010634 | Ga0501082_0010634_1587_2549 | 288 |
| 1910 | 3300061719 | Ga0466962_0004668 | Ga0466962_0004668_5032_5910 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9424 | 2 | 283 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9106 | 2 | 283 |
| 4xap-assembly1.cif.gz_A | crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 | 0.8722 | 9 | 283 |
| 6ky6-assembly2.cif.gz_B | crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc | 0.8654 | 9 | 286 |
| 4exa-assembly1.cif.gz_B | crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa | 0.8607 | 8 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25906_7_286_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9865 | 11 | 287 | 3.20.20.100 |
| af_P25906_7_286_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9725 | 11 | 287 | 3.20.20.100 |
| af_O94315_19_306_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9299 | 12 | 285 | 3.20.20.100 |
| af_A0A0R0I9K3_1_172_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8881 | 151 | 286 | 3.20.20.100 |
| af_A0A1D6QTZ0_289_448_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.8851 | 179 | 286 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840K117-F1-model_v4 | deleted | 0.9915 | 2 | 288 |
|
| AF-A0A3N2QZW5-F1-model_v4 | Aldo/keto reductase family oxidoreductase | 0.9879 | 1 | 286 |
GO:0004033
GO:0005737 |
| AF-A0A3D1C8P2-F1-model_v4 | deleted | 0.9877 | 188 | 287 |
|
| AF-A0A659YI34-F1-model_v4 | deleted | 0.9875 | 186 | 286 |
|
| AF-A0A0Q8NZJ9-F1-model_v4 | Oxidoreductase | 0.9867 | 1 | 287 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar