F496021

General Info

Members Datasets Scaffolds Average Seq Length
1904 433 3808 113

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_101675223|Ga0070674_1016752231
Length 135
Sequence MLRLEFAEAMTWRPVGTAVQENVNMDQPYKDALLRKRGEILSTGGGVKPLPATMEVNSRQGDLADQASGNNEVHIQLKLKQTDAKILQAIEEALYRMEKGTYGICRDCGEPIAPARLNAIPWTRVCITCKEKQNS

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
125 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
249 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
257 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
261 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
262 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
267 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
270 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
271 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
272 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
273 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
274 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
275 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
276 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
277 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
280 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
281 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
344 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
345 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
346 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
374 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
375 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
376 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
377 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
378 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
379 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
380 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
381 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
382 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
383 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
384 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
385 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
389 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
390 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
391 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
394 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
395 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
396 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
407 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
420 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
423 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
424 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 3.05
Rhizosphere 94.28
Stem 0
Stem Tuber 0
Unclassified 25.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_101675223 3300005356 Bacteria 575
2 ARSoilOldRDRAFT_c020637 3300000044 Unclassified 581
3 JGI24746J21847_1006920 3300001977 Bacteria 1742
4 JGI24750J21931_1024926 3300002070 Unclassified 855
5 JGI24745J21846_1023412 3300002073 Unclassified 731
6 JGI24749J21850_1076484 3300002076 Unclassified 522
7 JGI24035J26624_1024272 3300002126 Unclassified 648
8 JGI24033J26618_1003820 3300002155 Bacteria 1603
9 JGI24033J26618_1028540 3300002155 Unclassified 742
10 JGI24034J26672_10117660 3300002239 Unclassified 512
11 JGI24742J22300_10085476 3300002244 Unclassified 599
12 JGI24742J22300_10116928 3300002244 Unclassified 524
13 JGI24751J29686_10077786 3300002459 Bacteria 687
14 JGI24751J29686_10121676 3300002459 Bacteria 549
15 JGI24751J29686_10137735 3300002459 Unclassified 516
16 Ga0058859_11527305 3300004798 Unclassified 513
17 Ga0058860_11945108 3300004801 Bacteria 959
18 Ga0065714_10317131 3300005288 Bacteria 673
19 Ga0065714_10372059 3300005288 Unclassified 615
20 Ga0065704_10448172 3300005289 Bacteria 708
21 Ga0065704_10864364 3300005289 Unclassified 505
22 Ga0065712_10000775 3300005290 Bacteria 8881
23 Ga0065712_10012333 3300005290 Unclassified 3386
24 Ga0065712_10115560 3300005290 Unclassified 1749
25 Ga0065712_10168983 3300005290 Bacteria 1255
26 Ga0065712_10170177 3300005290 Bacteria 1248
27 Ga0065712_10201384 3300005290 Unclassified 1107
28 Ga0065712_10235507 3300005290 Unclassified 983
29 Ga0065712_10377769 3300005290 Bacteria 755
30 Ga0065712_10527480 3300005290 Bacteria 632
31 Ga0065715_10001070 3300005293 Bacteria 9000
32 Ga0065715_10009998 3300005293 Bacteria 2532
33 Ga0065715_10029765 3300005293 Bacteria 1818
34 Ga0065715_10033698 3300005293 Bacteria 1230
35 Ga0065715_10126661 3300005293 Bacteria 2104
36 Ga0065715_10176037 3300005293 Bacteria 1511
37 Ga0065715_10215752 3300005293 Unclassified 1294
38 Ga0065715_10223288 3300005293 Bacteria 1263
39 Ga0065715_10363450 3300005293 Bacteria 932
40 Ga0065715_10436698 3300005293 Unclassified 841
41 Ga0065715_10656521 3300005293 Unclassified 675
42 Ga0065715_10765485 3300005293 Unclassified 610
43 Ga0065715_10870389 3300005293 Bacteria 572
44 Ga0065715_10935636 3300005293 Unclassified 564
45 Ga0065707_10098873 3300005295 Bacteria 3050
46 Ga0065707_10114639 3300005295 Unclassified 2283
47 Ga0065707_10141208 3300005295 Bacteria 1770
48 Ga0065707_10162916 3300005295 Bacteria 1547
49 Ga0065707_10187785 3300005295 Bacteria 1362
50 Ga0065707_10337811 3300005295 Bacteria 938
51 Ga0065707_10528200 3300005295 Unclassified 737
52 Ga0065707_10792263 3300005295 Unclassified 602
53 Ga0070676_10005668 3300005328 Bacteria 6649
54 Ga0070676_10008405 3300005328 Bacteria 5564
55 Ga0070676_10014235 3300005328 Bacteria 4371
56 Ga0070676_10157544 3300005328 Bacteria 1459
57 Ga0070676_10311852 3300005328 Bacteria 1070
58 Ga0070676_10625560 3300005328 Bacteria 779
59 Ga0070676_11076418 3300005328 Bacteria 607
60 Ga0070683_100012700 3300005329 Bacteria 7325
61 Ga0070683_100028485 3300005329 Bacteria 5049
62 Ga0070683_101492807 3300005329 Bacteria 650
63 Ga0070690_100001367 3300005330 Bacteria 12682
64 Ga0070690_100138636 3300005330 Bacteria 1649
65 Ga0070690_100199496 3300005330 Bacteria 1392
66 Ga0070690_100293840 3300005330 Bacteria 1163
67 Ga0070690_100463396 3300005330 Bacteria 942
68 Ga0070690_100664152 3300005330 Unclassified 797
69 Ga0070670_100001056 3300005331 Bacteria 21882
70 Ga0070670_100003418 3300005331 Bacteria 13174
71 Ga0070670_100011917 3300005331 Bacteria 7435
72 Ga0070670_100014644 3300005331 Bacteria 6732
73 Ga0070670_100026445 3300005331 Bacteria 4992
74 Ga0070670_100176707 3300005331 Bacteria 1853
75 Ga0070670_100260554 3300005331 Bacteria 1511
76 Ga0070670_100270920 3300005331 Bacteria 1481
77 Ga0070670_100551870 3300005331 Bacteria 1028
78 Ga0070670_100580087 3300005331 Bacteria 1002
79 Ga0070670_101144369 3300005331 Unclassified 710
80 Ga0070670_101781279 3300005331 Bacteria 567
81 Ga0070677_10001098 3300005333 Bacteria 8696
82 Ga0070677_10060979 3300005333 Unclassified 1556
83 Ga0068869_100012287 3300005334 Bacteria 5653
84 Ga0068869_100029336 3300005334 Bacteria 3853
85 Ga0068869_100052708 3300005334 Bacteria 2955
86 Ga0068869_100164584 3300005334 Bacteria 1729
87 Ga0068869_100337876 3300005334 Bacteria 1225
88 Ga0068869_100683836 3300005334 Bacteria 874
89 Ga0068869_100772395 3300005334 Bacteria 824
90 Ga0068869_101088818 3300005334 Bacteria 699
91 Ga0070666_10004920 3300005335 Bacteria 8167
92 Ga0070666_10004925 3300005335 Bacteria 8165
93 Ga0070666_10105649 3300005335 Bacteria 1945
94 Ga0070666_10209687 3300005335 Bacteria 1372
95 Ga0070666_10373478 3300005335 Bacteria 1023
96 Ga0070666_10925786 3300005335 Bacteria 645
97 Ga0070666_10967852 3300005335 Unclassified 631
98 Ga0070680_100371989 3300005336 Unclassified 1216
99 Ga0070680_100534839 3300005336 Bacteria 1004
100 Ga0070680_100851949 3300005336 Unclassified 786
101 Ga0068868_100026032 3300005338 Bacteria 4455
102 Ga0068868_100051760 3300005338 Bacteria 3232
103 Ga0068868_100063469 3300005338 Bacteria 2930
104 Ga0068868_100183316 3300005338 Unclassified 1738
105 Ga0068868_100361891 3300005338 Bacteria 1245
106 Ga0068868_100601652 3300005338 Bacteria 974
107 Ga0068868_100613978 3300005338 Bacteria 965
108 Ga0070689_100009831 3300005340 Bacteria 6800
109 Ga0070689_100012440 3300005340 Bacteria 6131
110 Ga0070689_100013722 3300005340 Bacteria 5869
111 Ga0070689_100261171 3300005340 Bacteria 1431
112 Ga0070689_100287319 3300005340 Bacteria 1366
113 Ga0070689_101851251 3300005340 Bacteria 551
114 Ga0070691_10017999 3300005341 Bacteria 3254
115 Ga0070691_10109418 3300005341 Bacteria 1381
116 Ga0070691_11075113 3300005341 Unclassified 506
117 Ga0070687_100002563 3300005343 Bacteria 6857
118 Ga0070687_100956309 3300005343 Unclassified 618
119 Ga0070661_100035901 3300005344 Unclassified 3603
120 Ga0070661_100073228 3300005344 Bacteria 2522
121 Ga0070661_100500796 3300005344 Unclassified 972
122 Ga0070661_100693705 3300005344 Bacteria 829
123 Ga0070661_101258851 3300005344 Unclassified 620
124 Ga0070692_10018548 3300005345 Bacteria 3349
125 Ga0070692_10591514 3300005345 Bacteria 733
126 Ga0070668_100025802 3300005347 Bacteria 4458
127 Ga0070668_100077094 3300005347 Bacteria 2605
128 Ga0070668_100252662 3300005347 Bacteria 1464
129 Ga0070668_100411244 3300005347 Bacteria 1157
130 Ga0070668_100745261 3300005347 Unclassified 867
131 Ga0070668_100912053 3300005347 Bacteria 786
132 Ga0070668_101578750 3300005347 Bacteria 601
133 Ga0070669_100003160 3300005353 Bacteria 11845
134 Ga0070669_100004710 3300005353 Bacteria 9845
135 Ga0070669_100007510 3300005353 Bacteria 7808
136 Ga0070669_100081082 3300005353 Bacteria 2416
137 Ga0070669_100125892 3300005353 Archaea 1960
138 Ga0070669_100194685 3300005353 Bacteria 1592
139 Ga0070669_100209228 3300005353 Bacteria 1538
140 Ga0070669_100279416 3300005353 Bacteria 1337
141 Ga0070669_100305547 3300005353 Bacteria 1281
142 Ga0070669_100553144 3300005353 Unclassified 960
143 Ga0070669_100916964 3300005353 Bacteria 749
144 Ga0070669_101192359 3300005353 Unclassified 657
145 Ga0070669_101283931 3300005353 Unclassified 634
146 Ga0070675_100000502 3300005354 Bacteria 26891
147 Ga0070675_100003069 3300005354 Bacteria 12614
148 Ga0070675_100041219 3300005354 Bacteria 3771
149 Ga0070675_100048836 3300005354 Bacteria 3471
150 Ga0070675_100145233 3300005354 Bacteria 2031
151 Ga0070675_100185401 3300005354 Bacteria 1801
152 Ga0070675_100187537 3300005354 Archaea 1791
153 Ga0070675_100199568 3300005354 Bacteria 1736
154 Ga0070675_100217107 3300005354 Bacteria 1664
155 Ga0070675_100246104 3300005354 Bacteria 1563
156 Ga0070675_100416211 3300005354 Bacteria 1201
157 Ga0070675_101319585 3300005354 Bacteria 665
158 Ga0070675_101715054 3300005354 Bacteria 580
159 Ga0070675_101844339 3300005354 Unclassified 558
160 Ga0070671_100010260 3300005355 Bacteria 7519
161 Ga0070671_100024040 3300005355 Bacteria 4987
162 Ga0070671_100110296 3300005355 Unclassified 2311
163 Ga0070671_100118277 3300005355 Unclassified 2229
164 Ga0070671_100202966 3300005355 Bacteria 1681
165 Ga0070671_100466625 3300005355 Bacteria 1084
166 Ga0070671_100747456 3300005355 Bacteria 850
167 Ga0070674_100001237 3300005356 Bacteria 13429
168 Ga0070674_100010170 3300005356 Bacteria 5669
169 Ga0070674_100018217 3300005356 Bacteria 4435
170 Ga0070674_100020127 3300005356 Bacteria 4256
171 Ga0070674_100058419 3300005356 Bacteria 2681
172 Ga0070674_100131325 3300005356 Bacteria 1867
173 Ga0070674_100176053 3300005356 Bacteria 1635
174 Ga0070674_100246787 3300005356 Bacteria 1400
175 Ga0070674_100413629 3300005356 Bacteria 1105
176 Ga0070674_100454421 3300005356 Bacteria 1058
177 Ga0070674_101494348 3300005356 Bacteria 607
178 Ga0070673_100005561 3300005364 Bacteria 8081
179 Ga0070673_100046195 3300005364 Unclassified 3381
180 Ga0070673_100070450 3300005364 Bacteria 2806
181 Ga0070673_100105269 3300005364 Bacteria 2330
182 Ga0070673_100131442 3300005364 Unclassified 2101
183 Ga0070673_100506332 3300005364 Bacteria 1093
184 Ga0070673_100506353 3300005364 Bacteria 1093
185 Ga0070673_101220851 3300005364 Unclassified 705
186 Ga0070688_100030480 3300005365 Bacteria 3238
187 Ga0070688_100061437 3300005365 Bacteria 2375
188 Ga0070688_100062720 3300005365 Bacteria 2353
189 Ga0070688_100087397 3300005365 Bacteria 2031
190 Ga0070688_100199789 3300005365 Bacteria 1398
191 Ga0070688_100236770 3300005365 Bacteria 1294
192 Ga0070688_100283533 3300005365 Bacteria 1191
193 Ga0070688_100703084 3300005365 Bacteria 783
194 Ga0070688_101190390 3300005365 Unclassified 612
195 Ga0070659_100211607 3300005366 Bacteria 1598
196 Ga0070659_100660524 3300005366 Unclassified 902
197 Ga0070659_101703495 3300005366 Bacteria 564
198 Ga0070667_100026061 3300005367 Bacteria 4862
199 Ga0070667_100296295 3300005367 Bacteria 1456
200 Ga0070667_100644923 3300005367 Unclassified 977
201 Ga0070703_10018391 3300005406 Bacteria 2020
202 Ga0070703_10326271 3300005406 Bacteria 648
203 Ga0070703_10516218 3300005406 Bacteria 540
204 Ga0070701_10008872 3300005438 Bacteria 4374
205 Ga0070701_10013648 3300005438 Bacteria 3702
206 Ga0070701_10020213 3300005438 Bacteria 3158
207 Ga0070701_10033554 3300005438 Bacteria 2566
208 Ga0070701_10132863 3300005438 Bacteria 1416
209 Ga0070701_10196455 3300005438 Bacteria 1190
210 Ga0070701_10208892 3300005438 Bacteria 1158
211 Ga0070701_10289827 3300005438 Bacteria 1002
212 Ga0070701_10725795 3300005438 Unclassified 671
213 Ga0070705_100003386 3300005440 Bacteria 7818
214 Ga0070705_100021073 3300005440 Bacteria 3462
215 Ga0070705_100038561 3300005440 Bacteria 2704
216 Ga0070705_100106277 3300005440 Bacteria 1784
217 Ga0070705_100112868 3300005440 Bacteria 1740
218 Ga0070705_100113714 3300005440 Bacteria 1735
219 Ga0070705_100291587 3300005440 Unclassified 1165
220 Ga0070705_100736792 3300005440 Unclassified 778
221 Ga0070705_101305640 3300005440 Unclassified 602
222 Ga0070700_100007080 3300005441 Bacteria 6030
223 Ga0070700_100012620 3300005441 Bacteria 4723
224 Ga0070700_100038066 3300005441 Bacteria 2930
225 Ga0070700_100057171 3300005441 Unclassified 2447
226 Ga0070700_100099421 3300005441 Bacteria 1914
227 Ga0070700_100213178 3300005441 Bacteria 1364
228 Ga0070700_100328204 3300005441 Unclassified 1127
229 Ga0070700_100432690 3300005441 Bacteria 997
230 Ga0070700_100531037 3300005441 Bacteria 911
231 Ga0070700_100578188 3300005441 Bacteria 877
232 Ga0070700_100595061 3300005441 Bacteria 866
233 Ga0070694_100013503 3300005444 Bacteria 5101
234 Ga0070694_100014816 3300005444 Bacteria 4885
235 Ga0070694_100134230 3300005444 Bacteria 1792
236 Ga0070694_100200845 3300005444 Bacteria 1486
237 Ga0070694_100533792 3300005444 Bacteria 937
238 Ga0070694_101183803 3300005444 Bacteria 640
239 Ga0070694_101804888 3300005444 Unclassified 521
240 Ga0070708_100953576 3300005445 Unclassified 805
241 Ga0070663_100043507 3300005455 Bacteria 3161
242 Ga0070663_100191003 3300005455 Bacteria 1594
243 Ga0070663_101100873 3300005455 Bacteria 694
244 Ga0070663_101481456 3300005455 Unclassified 603
245 Ga0070663_101720232 3300005455 Unclassified 561
246 Ga0070663_101935265 3300005455 Bacteria 530
247 Ga0070678_100019903 3300005456 Unclassified 4390
248 Ga0070678_100087016 3300005456 Unclassified 2385
249 Ga0070678_100154203 3300005456 Unclassified 1854
250 Ga0070678_100205398 3300005456 Unclassified 1628
251 Ga0070678_101012876 3300005456 Bacteria 764
252 Ga0070678_101112991 3300005456 Bacteria 730
253 Ga0070678_101483653 3300005456 Bacteria 635
254 Ga0070662_100021377 3300005457 Bacteria 4417
255 Ga0070662_100171151 3300005457 Unclassified 1706
256 Ga0070662_100258788 3300005457 Bacteria 1402
257 Ga0070662_100388408 3300005457 Unclassified 1150
258 Ga0070662_100389733 3300005457 Bacteria 1148
259 Ga0070662_100415852 3300005457 Unclassified 1112
260 Ga0070662_100520832 3300005457 Bacteria 993
261 Ga0070662_101597035 3300005457 Bacteria 563
262 Ga0068867_100002404 3300005459 Bacteria 13169
263 Ga0068867_100098587 3300005459 Bacteria 2229
264 Ga0068867_100141719 3300005459 Bacteria 1880
265 Ga0068867_100174438 3300005459 Bacteria 1705
266 Ga0068867_100202972 3300005459 Bacteria 1588
267 Ga0068867_100295913 3300005459 Bacteria 1333
268 Ga0068867_100302571 3300005459 Bacteria 1319
269 Ga0068867_100389991 3300005459 Unclassified 1172
270 Ga0068867_100706954 3300005459 Unclassified 890
271 Ga0068867_100756257 3300005459 Bacteria 863
272 Ga0068867_101398937 3300005459 Bacteria 649
273 Ga0068867_101534951 3300005459 Bacteria 621
274 Ga0070685_10042272 3300005466 Bacteria 2600
275 Ga0070685_10093149 3300005466 Bacteria 1827
276 Ga0070685_10095899 3300005466 Bacteria 1804
277 Ga0070685_10177467 3300005466 Bacteria 1369
278 Ga0070685_10252329 3300005466 Bacteria 1169
279 Ga0070706_100077287 3300005467 Unclassified 3081
280 Ga0070706_100102584 3300005467 Bacteria 2660
281 Ga0070707_100044771 3300005468 Bacteria 4236
282 Ga0070707_100399187 3300005468 Unclassified 1335
283 Ga0070707_102162271 3300005468 Bacteria 524
284 Ga0070698_100059421 3300005471 Bacteria 3861
285 Ga0070698_100129763 3300005471 Bacteria 2477
286 Ga0070698_100320405 3300005471 Bacteria 1481
287 Ga0070698_100469297 3300005471 Bacteria 1195
288 Ga0070699_100000937 3300005518 Bacteria 27205
289 Ga0070699_100005227 3300005518 Bacteria 11403
290 Ga0070699_100018475 3300005518 Bacteria 5988
291 Ga0070699_100037639 3300005518 Bacteria 4189
292 Ga0070699_100102803 3300005518 Bacteria 2505
293 Ga0070699_100553478 3300005518 Bacteria 1047
294 Ga0070699_101769376 3300005518 Bacteria 566
295 Ga0070679_101623948 3300005530 Bacteria 594
296 Ga0070684_100005319 3300005535 Bacteria 9856
297 Ga0070684_100572681 3300005535 Bacteria 1049
298 Ga0070684_100963693 3300005535 Bacteria 800
299 Ga0070684_101411069 3300005535 Unclassified 656
300 Ga0070697_100039196 3300005536 Bacteria 3830
301 Ga0070697_101161873 3300005536 Unclassified 688
302 Ga0068853_101077282 3300005539 Unclassified 775
303 Ga0068853_101574083 3300005539 Bacteria 637
304 Ga0070672_100019741 3300005543 Bacteria 4899
305 Ga0070672_100028590 3300005543 Bacteria 4172
306 Ga0070672_100049657 3300005543 Bacteria 3265
307 Ga0070672_100082515 3300005543 Bacteria 2579
308 Ga0070672_100113382 3300005543 Unclassified 2212
309 Ga0070672_100129890 3300005543 Bacteria 2069
310 Ga0070672_100277951 3300005543 Bacteria 1415
311 Ga0070672_100296448 3300005543 Unclassified 1370
312 Ga0070672_100398192 3300005543 Unclassified 1180
313 Ga0070672_100814984 3300005543 Unclassified 822
314 Ga0070672_100877871 3300005543 Bacteria 791
315 Ga0070672_101309036 3300005543 Bacteria 647
316 Ga0070686_100003121 3300005544 Bacteria 9082
317 Ga0070686_100011544 3300005544 Bacteria 5012
318 Ga0070686_100124546 3300005544 Bacteria 1774
319 Ga0070686_100283134 3300005544 Bacteria 1223
320 Ga0070686_100431468 3300005544 Unclassified 1009
321 Ga0070686_100499251 3300005544 Bacteria 944
322 Ga0070686_100717507 3300005544 Unclassified 799
323 Ga0070695_100000182 3300005545 Bacteria 30036
324 Ga0070695_100027508 3300005545 Bacteria 3523
325 Ga0070695_100071115 3300005545 Bacteria 2277
326 Ga0070695_100580507 3300005545 Unclassified 877
327 Ga0070695_101604067 3300005545 Unclassified 543
328 Ga0070696_100016048 3300005546 Bacteria 5037
329 Ga0070696_100016512 3300005546 Bacteria 4973
330 Ga0070696_100126621 3300005546 Unclassified 1854
331 Ga0070696_100145134 3300005546 Bacteria 1738
332 Ga0070696_100500007 3300005546 Bacteria 967
333 Ga0070693_100012094 3300005547 Unclassified 4359
334 Ga0070693_100017627 3300005547 Bacteria 3715
335 Ga0070693_100969899 3300005547 Unclassified 641
336 Ga0070665_100004472 3300005548 Bacteria 14687
337 Ga0070665_100039569 3300005548 Bacteria 4741
338 Ga0070665_100051301 3300005548 Bacteria 4137
339 Ga0070665_100718622 3300005548 Bacteria 1012
340 Ga0070704_100000072 3300005549 Bacteria 33905
341 Ga0070704_100001134 3300005549 Bacteria 13899
342 Ga0070704_100010082 3300005549 Bacteria 5743
343 Ga0070704_100012184 3300005549 Bacteria 5307
344 Ga0070704_100019061 3300005549 Bacteria 4402
345 Ga0070704_100070530 3300005549 Bacteria 2536
346 Ga0070704_100188351 3300005549 Bacteria 1656
347 Ga0070704_100253819 3300005549 Bacteria 1446
348 Ga0070704_100289930 3300005549 Unclassified 1359
349 Ga0070704_100401331 3300005549 Bacteria 1170
350 Ga0070704_100483383 3300005549 Bacteria 1072
351 Ga0070704_100593529 3300005549 Unclassified 973
352 Ga0070704_100677745 3300005549 Bacteria 912
353 Ga0068855_100439046 3300005563 Bacteria 1426
354 Ga0070664_100007496 3300005564 Bacteria 8809
355 Ga0070664_100009434 3300005564 Bacteria 7910
356 Ga0070664_100020954 3300005564 Bacteria 5386
357 Ga0070664_100073756 3300005564 Bacteria 2929
358 Ga0070664_100109493 3300005564 Bacteria 2410
359 Ga0070664_100190945 3300005564 Unclassified 1825
360 Ga0070664_100250947 3300005564 Unclassified 1590
361 Ga0070664_100356734 3300005564 Bacteria 1331
362 Ga0070664_100862736 3300005564 Unclassified 848
363 Ga0070664_101043680 3300005564 Bacteria 769
364 Ga0070664_101900868 3300005564 Unclassified 565
365 Ga0068857_100024374 3300005577 Bacteria 5325
366 Ga0068857_100051939 3300005577 Bacteria 3638
367 Ga0068857_100081857 3300005577 Bacteria 2883
368 Ga0068857_100215773 3300005577 Bacteria 1751
369 Ga0068857_100355069 3300005577 Unclassified 1358
370 Ga0068857_100704045 3300005577 Bacteria 960
371 Ga0068857_100830788 3300005577 Bacteria 883
372 Ga0068857_100978096 3300005577 Archaea 814
373 Ga0068857_101927961 3300005577 Unclassified 579
374 Ga0068854_100024563 3300005578 Bacteria 4128
375 Ga0068854_100077444 3300005578 Bacteria 2447
376 Ga0068854_100827211 3300005578 Unclassified 809
377 Ga0068854_101130639 3300005578 Unclassified 699
378 Ga0070702_100014380 3300005615 Bacteria 4014
379 Ga0070702_100026067 3300005615 Bacteria 3138
380 Ga0070702_100032348 3300005615 Bacteria 2870
381 Ga0070702_100119827 3300005615 Bacteria 1645
382 Ga0070702_100382459 3300005615 Bacteria 1001
383 Ga0068852_100566576 3300005616 Bacteria 1137
384 Ga0068852_102639636 3300005616 Unclassified 522
385 Ga0068859_100005205 3300005617 Bacteria 13216
386 Ga0068859_100007562 3300005617 Bacteria 11037
387 Ga0068859_100007755 3300005617 Bacteria 10898
388 Ga0068859_100033302 3300005617 Bacteria 5175
389 Ga0068859_100316127 3300005617 Unclassified 1655
390 Ga0068859_100535674 3300005617 Bacteria 1266
391 Ga0068859_100596850 3300005617 Bacteria 1197
392 Ga0068859_100855329 3300005617 Bacteria 995
393 Ga0068859_100950010 3300005617 Unclassified 943
394 Ga0068859_101051931 3300005617 Archaea 895
395 Ga0068859_101235910 3300005617 Bacteria 823
396 Ga0068859_101305215 3300005617 Bacteria 800
397 Ga0068864_100011350 3300005618 Bacteria 7361
398 Ga0068864_100026714 3300005618 Bacteria 4869
399 Ga0068864_100028503 3300005618 Bacteria 4721
400 Ga0068864_100048189 3300005618 Bacteria 3662
401 Ga0068864_100166745 3300005618 Bacteria 2006
402 Ga0068864_100503402 3300005618 Bacteria 1166
403 Ga0068864_100708571 3300005618 Unclassified 984
404 Ga0068864_100795811 3300005618 Bacteria 929
405 Ga0068864_101382335 3300005618 Unclassified 705
406 Ga0068866_10090978 3300005718 Bacteria 1662
407 Ga0068866_10167730 3300005718 Bacteria 1286
408 Ga0068866_10338679 3300005718 Unclassified 952
409 Ga0068866_10341313 3300005718 Unclassified 949
410 Ga0068861_100000239 3300005719 Bacteria 30192
411 Ga0068861_100014721 3300005719 Bacteria 5495
412 Ga0068861_100084340 3300005719 Bacteria 2494
413 Ga0068861_100129061 3300005719 Unclassified 2050
414 Ga0068861_100162454 3300005719 Bacteria 1843
415 Ga0068861_100274539 3300005719 Bacteria 1449
416 Ga0068861_100282164 3300005719 Bacteria 1431
417 Ga0068861_100397006 3300005719 Bacteria 1223
418 Ga0068861_100459097 3300005719 Bacteria 1143
419 Ga0068861_100483623 3300005719 Bacteria 1116
420 Ga0068861_100513865 3300005719 Unclassified 1085
421 Ga0068861_100610290 3300005719 Bacteria 1003
422 Ga0068861_100939516 3300005719 Bacteria 821
423 Ga0068861_101055615 3300005719 Bacteria 778
424 Ga0068851_10248815 3300005834 Bacteria 1008
425 Ga0068851_10573325 3300005834 Unclassified 684
426 Ga0068870_10003677 3300005840 Bacteria 6515
427 Ga0068870_10006313 3300005840 Bacteria 5218
428 Ga0068870_10046545 3300005840 Unclassified 2275
429 Ga0068870_10101013 3300005840 Bacteria 1630
430 Ga0068870_10131258 3300005840 Bacteria 1455
431 Ga0068870_10185451 3300005840 Bacteria 1252
432 Ga0068870_10294494 3300005840 Unclassified 1022
433 Ga0068870_10430009 3300005840 Unclassified 866
434 Ga0068863_100021570 3300005841 Bacteria 6143
435 Ga0068863_100047013 3300005841 Bacteria 4095
436 Ga0068863_100226327 3300005841 Bacteria 1803
437 Ga0068863_100247865 3300005841 Bacteria 1720
438 Ga0068863_100462798 3300005841 Unclassified 1245
439 Ga0068858_100012319 3300005842 Bacteria 8063
440 Ga0068858_100014103 3300005842 Bacteria 7537
441 Ga0068858_100045281 3300005842 Bacteria 4077
442 Ga0068858_100071743 3300005842 Bacteria 3212
443 Ga0068858_100216705 3300005842 Bacteria 1812
444 Ga0068858_100637644 3300005842 Unclassified 1035
445 Ga0068858_100638201 3300005842 Bacteria 1034
446 Ga0068858_101013755 3300005842 Bacteria 814
447 Ga0068858_101955661 3300005842 Bacteria 580
448 Ga0068858_102551206 3300005842 Unclassified 505
449 Ga0068860_100003239 3300005843 Bacteria 16782
450 Ga0068860_100010475 3300005843 Bacteria 9165
451 Ga0068860_100138759 3300005843 Bacteria 2335
452 Ga0068860_100172637 3300005843 Unclassified 2088
453 Ga0068860_100404359 3300005843 Bacteria 1351
454 Ga0068860_100545826 3300005843 Bacteria 1161
455 Ga0068860_100770055 3300005843 Bacteria 975
456 Ga0068860_101267007 3300005843 Bacteria 758
457 Ga0068860_101346835 3300005843 Bacteria 735
458 Ga0068862_100000540 3300005844 Bacteria 39568
459 Ga0068862_100004222 3300005844 Bacteria 12170
460 Ga0068862_100045653 3300005844 Bacteria 3738
461 Ga0068862_100074049 3300005844 Bacteria 2943
462 Ga0068862_100093928 3300005844 Bacteria 2616
463 Ga0068862_100142852 3300005844 Bacteria 2125
464 Ga0068862_100662335 3300005844 Unclassified 1008
465 Ga0068862_100722121 3300005844 Bacteria 967
466 Ga0068862_101376138 3300005844 Unclassified 708
467 Ga0081455_10206486 3300005937 Unclassified 1467
468 Ga0081538_10186823 3300005981 Unclassified 877
469 Ga0075365_10009426 3300006038 Bacteria 5612
470 Ga0075365_10338996 3300006038 Unclassified 1059
471 Ga0075368_10004232 3300006042 Bacteria 4846
472 Ga0075368_10045410 3300006042 Bacteria 1736
473 Ga0075368_10168945 3300006042 Bacteria 918
474 Ga0075363_100119107 3300006048 Bacteria 1473
475 Ga0075364_10013927 3300006051 Bacteria 4956
476 Ga0075364_10020344 3300006051 Bacteria 4174
477 Ga0075364_10088018 3300006051 Unclassified 2059
478 Ga0075432_10254567 3300006058 Unclassified 714
479 Ga0070715_10786534 3300006163 Unclassified 576
480 Ga0070712_100122546 3300006175 Bacteria 1958
481 Ga0075362_10003449 3300006177 Bacteria 5525
482 Ga0075362_10544573 3300006177 Bacteria 596
483 Ga0075367_10016079 3300006178 Bacteria 4080
484 Ga0075367_10461787 3300006178 Bacteria 805
485 Ga0075367_10648119 3300006178 Archaea 671
486 Ga0075366_10029281 3300006195 Bacteria 3235
487 Ga0075366_10046686 3300006195 Bacteria 2567
488 Ga0097621_100022373 3300006237 Bacteria 4907
489 Ga0097621_100050969 3300006237 Bacteria 3367
490 Ga0097621_100106966 3300006237 Bacteria 2360
491 Ga0097621_100164275 3300006237 Unclassified 1910
492 Ga0097621_100990110 3300006237 Bacteria 786
493 Ga0097621_101344127 3300006237 Bacteria 676
494 Ga0075370_10050245 3300006353 Bacteria 2365
495 Ga0068871_100007573 3300006358 Bacteria 7768
496 Ga0068871_100019826 3300006358 Bacteria 5140
497 Ga0068871_100242448 3300006358 Bacteria 1567
498 Ga0068871_100781496 3300006358 Bacteria 879
499 Ga0068871_100792729 3300006358 Bacteria 873
500 Ga0068871_100831379 3300006358 Bacteria 853
501 Ga0068871_101726884 3300006358 Unclassified 594
502 Ga0075428_100000131 3300006844 Bacteria 65649
503 Ga0075428_100002180 3300006844 Bacteria 21189
504 Ga0075428_100013531 3300006844 Bacteria 9083
505 Ga0075428_100023551 3300006844 Bacteria 6816
506 Ga0075428_100026076 3300006844 Bacteria 6472
507 Ga0075428_100027620 3300006844 Bacteria 6278
508 Ga0075428_100040836 3300006844 Bacteria 5102
509 Ga0075428_100076697 3300006844 Unclassified 3649
510 Ga0075428_100202157 3300006844 Bacteria 2147
511 Ga0075428_100463463 3300006844 Bacteria 1357
512 Ga0075428_100679837 3300006844 Bacteria 1097
513 Ga0075428_102035199 3300006844 Unclassified 595
514 Ga0075430_100000946 3300006846 Bacteria 22825
515 Ga0075430_100003944 3300006846 Bacteria 12518
516 Ga0075430_100004795 3300006846 Bacteria 11378
517 Ga0075430_100007269 3300006846 Bacteria 9351
518 Ga0075430_100007760 3300006846 Bacteria 9066
519 Ga0075430_100008077 3300006846 Bacteria 8893
520 Ga0075430_100042648 3300006846 Bacteria 3836
521 Ga0075430_100174026 3300006846 Unclassified 1791
522 Ga0075430_100395860 3300006846 Viruses 1140
523 Ga0075430_100640134 3300006846 Bacteria 877
524 Ga0075430_100711615 3300006846 Bacteria 828
525 Ga0075430_101201792 3300006846 Bacteria 624
526 Ga0075431_100001520 3300006847 Bacteria 21495
527 Ga0075431_100014267 3300006847 Bacteria 8035
528 Ga0075431_100033361 3300006847 Bacteria 5306
529 Ga0075431_100033995 3300006847 Bacteria 5254
530 Ga0075431_100046844 3300006847 Bacteria 4459
531 Ga0075431_100091842 3300006847 Bacteria 3133
532 Ga0075431_100154554 3300006847 Unclassified 2361
533 Ga0075431_100162065 3300006847 Bacteria 2299
534 Ga0075431_100228688 3300006847 Bacteria 1896
535 Ga0075431_100356258 3300006847 Bacteria 1470
536 Ga0075431_100647008 3300006847 Bacteria 1038
537 Ga0075431_100647621 3300006847 Bacteria 1037
538 Ga0075431_100849997 3300006847 Bacteria 884
539 Ga0075431_101895670 3300006847 Bacteria 552
540 Ga0075433_10014906 3300006852 Bacteria 6362
541 Ga0075433_10061592 3300006852 Unclassified 3287
542 Ga0075433_10068578 3300006852 Bacteria 3114
543 Ga0075433_10082154 3300006852 Bacteria 2841
544 Ga0075433_10148108 3300006852 Bacteria 2087
545 Ga0075433_10158463 3300006852 Bacteria 2014
546 Ga0075433_10213926 3300006852 Bacteria 1713
547 Ga0075433_10249561 3300006852 Unclassified 1575
548 Ga0075433_10537474 3300006852 Bacteria 1028
549 Ga0075434_100008967 3300006871 Bacteria 9316
550 Ga0075434_100030333 3300006871 Bacteria 5324
551 Ga0075434_100031190 3300006871 Bacteria 5254
552 Ga0075434_100042013 3300006871 Bacteria 4532
553 Ga0075434_100043313 3300006871 Bacteria 4464
554 Ga0075434_100074921 3300006871 Bacteria 3378
555 Ga0075434_100099044 3300006871 Bacteria 2920
556 Ga0075434_100367429 3300006871 Unclassified 1460
557 Ga0075434_100971041 3300006871 Bacteria 864
558 Ga0075434_102249446 3300006871 Bacteria 549
559 Ga0075434_102307476 3300006871 Unclassified 541
560 Ga0075429_100014314 3300006880 Bacteria 6880
561 Ga0075429_100016994 3300006880 Bacteria 6290
562 Ga0075429_100064406 3300006880 Unclassified 3193
563 Ga0075429_100069968 3300006880 Bacteria 3055
564 Ga0075429_100077831 3300006880 Bacteria 2890
565 Ga0075429_100140731 3300006880 Bacteria 2112
566 Ga0075429_100161149 3300006880 Unclassified 1965
567 Ga0075429_100177863 3300006880 Unclassified 1864
568 Ga0075429_100280218 3300006880 Unclassified 1460
569 Ga0075429_100292204 3300006880 Bacteria 1427
570 Ga0075429_100532339 3300006880 Unclassified 1030
571 Ga0068865_100005245 3300006881 Bacteria 7836
572 Ga0068865_100105098 3300006881 Bacteria 2074
573 Ga0068865_100107524 3300006881 Bacteria 2052
574 Ga0068865_100112679 3300006881 Bacteria 2010
575 Ga0068865_101061520 3300006881 Bacteria 712
576 Ga0068865_101120404 3300006881 Bacteria 694
577 Ga0068865_102159524 3300006881 Bacteria 507
578 Ga0075436_100145695 3300006914 Bacteria 1665
579 Ga0075436_100749751 3300006914 Unclassified 725
580 Ga0097620_100005205 3300006931 Bacteria 13216
581 Ga0097620_100007562 3300006931 Bacteria 11037
582 Ga0097620_100007754 3300006931 Bacteria 10898
583 Ga0097620_100033302 3300006931 Bacteria 5175
584 Ga0097620_100316109 3300006931 Unclassified 1655
585 Ga0097620_100535662 3300006931 Bacteria 1266
586 Ga0097620_100596811 3300006931 Bacteria 1197
587 Ga0097620_100855269 3300006931 Bacteria 995
588 Ga0097620_100950026 3300006931 Unclassified 943
589 Ga0097620_101051764 3300006931 Archaea 895
590 Ga0097620_101236133 3300006931 Bacteria 823
591 Ga0097620_101305101 3300006931 Bacteria 800
592 Ga0075435_100009189 3300007076 Bacteria 7137
593 Ga0075435_100012169 3300007076 Bacteria 6362
594 Ga0075435_100021458 3300007076 Bacteria 4968
595 Ga0075435_100027554 3300007076 Bacteria 4446
596 Ga0075435_100028428 3300007076 Bacteria 4386
597 Ga0075435_100137368 3300007076 Bacteria 2049
598 Ga0075435_100190796 3300007076 Bacteria 1734
599 Ga0075435_100247296 3300007076 Bacteria 1518
600 Ga0075435_100400302 3300007076 Bacteria 1181
601 Ga0075435_100538514 3300007076 Unclassified 1011
602 Ga0075435_101102717 3300007076 Bacteria 694
603 Ga0105244_10513098 3300009036 Unclassified 552
604 Ga0105250_10329423 3300009092 Bacteria 665
605 Ga0105240_10786168 3300009093 Bacteria 1032
606 Ga0111539_10000496 3300009094 Bacteria 49999
607 Ga0111539_10003605 3300009094 Bacteria 20407
608 Ga0111539_10005340 3300009094 Bacteria 16620
609 Ga0111539_10012002 3300009094 Bacteria 10862
610 Ga0111539_10047580 3300009094 Bacteria 5126
611 Ga0111539_10096204 3300009094 Unclassified 3478
612 Ga0111539_10158323 3300009094 Bacteria 2649
613 Ga0111539_10212397 3300009094 Bacteria 2254
614 Ga0111539_10223251 3300009094 Unclassified 2194
615 Ga0111539_10350387 3300009094 Bacteria 1718
616 Ga0111539_10392151 3300009094 Bacteria 1617
617 Ga0111539_10453806 3300009094 Bacteria 1493
618 Ga0111539_11068868 3300009094 Bacteria 938
619 Ga0111539_11382167 3300009094 Unclassified 817
620 Ga0111539_11921817 3300009094 Bacteria 686
621 Ga0111539_12139684 3300009094 Bacteria 649
622 Ga0111539_12936762 3300009094 Bacteria 551
623 Ga0105245_10012577 3300009098 Bacteria 7367
624 Ga0105245_10058993 3300009098 Bacteria 3455
625 Ga0105245_10489407 3300009098 Bacteria 1244
626 Ga0105245_10796727 3300009098 Bacteria 983
627 Ga0105245_10876826 3300009098 Bacteria 938
628 Ga0105245_11027259 3300009098 Unclassified 869
629 Ga0105247_10010152 3300009101 Bacteria 5705
630 Ga0105247_10376399 3300009101 Unclassified 1005
631 Ga0105247_10667321 3300009101 Bacteria 779
632 Ga0105247_10754140 3300009101 Bacteria 738
633 Ga0105247_11066701 3300009101 Unclassified 635
634 Ga0114129_10000636 3300009147 Bacteria 43766
635 Ga0114129_10005356 3300009147 Bacteria 18108
636 Ga0114129_10005578 3300009147 Bacteria 17796
637 Ga0114129_10023854 3300009147 Bacteria 8670
638 Ga0114129_10042630 3300009147 Bacteria 6387
639 Ga0114129_10061500 3300009147 Bacteria 5248
640 Ga0114129_10077143 3300009147 Bacteria 4636
641 Ga0114129_10129848 3300009147 Bacteria 3462
642 Ga0114129_10211013 3300009147 Bacteria 2625
643 Ga0114129_10269383 3300009147 Bacteria 2279
644 Ga0114129_10297152 3300009147 Unclassified 2154
645 Ga0114129_10305015 3300009147 Bacteria 2121
646 Ga0114129_10346419 3300009147 Bacteria 1969
647 Ga0114129_10358724 3300009147 Bacteria 1929
648 Ga0114129_10367352 3300009147 Bacteria 1903
649 Ga0114129_10583288 3300009147 Bacteria 1450
650 Ga0114129_10976957 3300009147 Bacteria 1068
651 Ga0114129_12103244 3300009147 Unclassified 681
652 Ga0105243_10006928 3300009148 Bacteria 8735
653 Ga0105243_10016206 3300009148 Bacteria 5639
654 Ga0105243_10124386 3300009148 Bacteria 2179
655 Ga0105243_10221767 3300009148 Bacteria 1672
656 Ga0105243_10271327 3300009148 Bacteria 1523
657 Ga0105243_10338037 3300009148 Bacteria 1378
658 Ga0105243_10872494 3300009148 Unclassified 893
659 Ga0105243_11113324 3300009148 Bacteria 799
660 Ga0105243_11301612 3300009148 Bacteria 744
661 Ga0105243_11792539 3300009148 Unclassified 645
662 Ga0105243_12192747 3300009148 Unclassified 589
663 Ga0105241_10258397 3300009174 Bacteria 1479
664 Ga0105241_11110690 3300009174 Unclassified 745
665 Ga0105241_11175998 3300009174 Bacteria 725
666 Ga0105242_10003771 3300009176 Bacteria 11784
667 Ga0105242_10079797 3300009176 Bacteria 2733
668 Ga0105242_10157812 3300009176 Bacteria 1983
669 Ga0105242_10163055 3300009176 Bacteria 1953
670 Ga0105242_10334599 3300009176 Bacteria 1393
671 Ga0105242_10525498 3300009176 Bacteria 1130
672 Ga0105242_10786086 3300009176 Bacteria 941
673 Ga0105242_10807788 3300009176 Unclassified 929
674 Ga0105248_10014701 3300009177 Bacteria 8615
675 Ga0105248_10031522 3300009177 Bacteria 5925
676 Ga0105248_10133687 3300009177 Bacteria 2799
677 Ga0105248_10150508 3300009177 Bacteria 2625
678 Ga0105248_10193937 3300009177 Bacteria 2289
679 Ga0105248_10206360 3300009177 Bacteria 2214
680 Ga0105248_10285667 3300009177 Unclassified 1857
681 Ga0105248_10322531 3300009177 Bacteria 1740
682 Ga0105248_10436459 3300009177 Bacteria 1475
683 Ga0105248_10480394 3300009177 Bacteria 1401
684 Ga0105248_10529979 3300009177 Bacteria 1328
685 Ga0105248_10583482 3300009177 Bacteria 1261
686 Ga0105248_10587489 3300009177 Bacteria 1257
687 Ga0105248_11044867 3300009177 Unclassified 923
688 Ga0105248_11187615 3300009177 Bacteria 863
689 Ga0105248_11417563 3300009177 Unclassified 786
690 Ga0105248_12134243 3300009177 Unclassified 637
691 Ga0105248_12545347 3300009177 Bacteria 583
692 Ga0105248_13113854 3300009177 Bacteria 528
693 Ga0105237_10076309 3300009545 Bacteria 3342
694 Ga0105237_11412279 3300009545 Bacteria 702
695 Ga0105237_11750603 3300009545 Bacteria 629
696 Ga0105238_10383273 3300009551 Bacteria 1397
697 Ga0105238_10677996 3300009551 Bacteria 1042
698 Ga0105238_11094493 3300009551 Unclassified 819
699 Ga0105249_10001782 3300009553 Bacteria 18761
700 Ga0105249_10001851 3300009553 Bacteria 18372
701 Ga0105249_10010938 3300009553 Bacteria 7976
702 Ga0105249_10100212 3300009553 Bacteria 2723
703 Ga0105249_10126916 3300009553 Bacteria 2430
704 Ga0105249_10186127 3300009553 Bacteria 2023
705 Ga0105249_10429554 3300009553 Bacteria 1356
706 Ga0105249_10443821 3300009553 Bacteria 1335
707 Ga0105249_10509109 3300009553 Bacteria 1250
708 Ga0105249_10760621 3300009553 Bacteria 1031
709 Ga0105249_11189580 3300009553 Unclassified 833
710 Ga0105249_12083019 3300009553 Bacteria 640
711 Ga0105249_12899344 3300009553 Bacteria 550
712 Ga0105249_13210001 3300009553 Bacteria 526
713 Ga0105239_10306116 3300010375 Bacteria 1790
714 Ga0105239_10752940 3300010375 Bacteria 1115
715 Ga0105239_11493707 3300010375 Unclassified 781
716 Ga0105239_12373913 3300010375 Unclassified 617
717 Ga0105246_10067739 3300011119 Bacteria 2502
718 Ga0105246_10097922 3300011119 Bacteria 2130
719 Ga0105246_10233965 3300011119 Bacteria 1448
720 Ga0105246_10432807 3300011119 Bacteria 1101
721 Ga0105246_10812444 3300011119 Unclassified 831
722 Ga0105246_10929489 3300011119 Bacteria 782
723 Ga0105246_11287137 3300011119 Bacteria 677
724 Ga0105246_11752268 3300011119 Unclassified 592
725 Ga0105246_11808314 3300011119 Unclassified 584
726 Ga0105246_12089183 3300011119 Bacteria 549
727 Ga0105246_12188252 3300011119 Unclassified 538
728 Ga0157340_1029176 3300012473 Unclassified 507
729 Ga0157338_1032792 3300012515 Bacteria 671
730 Ga0157338_1050815 3300012515 Bacteria 594
731 Ga0157374_10021438 3300013296 Bacteria 5749
732 Ga0157374_10048064 3300013296 Unclassified 3958
733 Ga0157374_10066565 3300013296 Bacteria 3385
734 Ga0157374_11034639 3300013296 Bacteria 841
735 Ga0157374_11362689 3300013296 Bacteria 732
736 Ga0157374_11574076 3300013296 Bacteria 681
737 Ga0157374_11683893 3300013296 Bacteria 659
738 Ga0157378_10394632 3300013297 Unclassified 1362
739 Ga0157378_10650748 3300013297 Unclassified 1069
740 Ga0157378_11074870 3300013297 Bacteria 841
741 Ga0157378_12351507 3300013297 Bacteria 585
742 Ga0157378_12580044 3300013297 Bacteria 560
743 Ga0163162_10004334 3300013306 Bacteria 13660
744 Ga0163162_10152912 3300013306 Bacteria 2426
745 Ga0163162_10182459 3300013306 Bacteria 2225
746 Ga0163162_10713093 3300013306 Bacteria 1124
747 Ga0157372_10955309 3300013307 Unclassified 993
748 Ga0157375_10007634 3300013308 Bacteria 9462
749 Ga0157375_10073762 3300013308 Bacteria 3432
750 Ga0157375_10367371 3300013308 Bacteria 1605
751 Ga0157375_10391922 3300013308 Bacteria 1556
752 Ga0157375_10494410 3300013308 Unclassified 1388
753 Ga0157375_10497327 3300013308 Unclassified 1383
754 Ga0157375_10594134 3300013308 Bacteria 1266
755 Ga0157375_10781761 3300013308 Unclassified 1104
756 Ga0157375_11041688 3300013308 Unclassified 956
757 Ga0157375_11113880 3300013308 Bacteria 924
758 Ga0157375_12235632 3300013308 Bacteria 652
759 Ga0163163_10000102 3300014325 Bacteria 90323
760 Ga0163163_10024395 3300014325 Bacteria 5756
761 Ga0163163_10036402 3300014325 Bacteria 4780
762 Ga0163163_10036637 3300014325 Bacteria 4767
763 Ga0163163_10053163 3300014325 Bacteria 3997
764 Ga0163163_10104850 3300014325 Bacteria 2853
765 Ga0163163_10151564 3300014325 Unclassified 2362
766 Ga0163163_10240703 3300014325 Bacteria 1859
767 Ga0163163_10486578 3300014325 Bacteria 1295
768 Ga0163163_10555345 3300014325 Unclassified 1211
769 Ga0163163_11009901 3300014325 Bacteria 895
770 Ga0163163_11465475 3300014325 Unclassified 744
771 Ga0163163_11751111 3300014325 Unclassified 682
772 Ga0157380_10004941 3300014326 Bacteria 9294
773 Ga0157380_10076184 3300014326 Bacteria 2729
774 Ga0157380_10117078 3300014326 Bacteria 2250
775 Ga0157380_10146531 3300014326 Unclassified 2035
776 Ga0157380_10446625 3300014326 Bacteria 1241
777 Ga0157380_10630304 3300014326 Unclassified 1066
778 Ga0157380_11089834 3300014326 Bacteria 837
779 Ga0157380_11358865 3300014326 Bacteria 760
780 Ga0157380_11521902 3300014326 Bacteria 723
781 Ga0157380_12580915 3300014326 Bacteria 574
782 Ga0157377_10002651 3300014745 Bacteria 7940
783 Ga0157377_10030505 3300014745 Bacteria 2921
784 Ga0157377_10051420 3300014745 Unclassified 2324
785 Ga0157377_10054164 3300014745 Bacteria 2270
786 Ga0157377_10116303 3300014745 Unclassified 1615
787 Ga0157377_10149198 3300014745 Unclassified 1444
788 Ga0157377_10177609 3300014745 Bacteria 1336
789 Ga0157377_10217065 3300014745 Bacteria 1222
790 Ga0157377_10404422 3300014745 Bacteria 931
791 Ga0157377_11335321 3300014745 Bacteria 562
792 Ga0157379_10024281 3300014968 Bacteria 5382
793 Ga0157379_10046835 3300014968 Bacteria 3858
794 Ga0157379_10147237 3300014968 Bacteria 2124
795 Ga0157379_11368901 3300014968 Bacteria 685
796 Ga0157379_11621029 3300014968 Unclassified 632
797 Ga0157379_11936121 3300014968 Unclassified 581
798 Ga0157379_12029221 3300014968 Unclassified 569
799 Ga0157379_12212562 3300014968 Unclassified 546
800 Ga0157376_10012186 3300014969 Bacteria 6372
801 Ga0157376_10019139 3300014969 Bacteria 5268
802 Ga0157376_10044238 3300014969 Bacteria 3659
803 Ga0157376_10090305 3300014969 Bacteria 2651
804 Ga0157376_10250810 3300014969 Bacteria 1653
805 Ga0157376_10453944 3300014969 Bacteria 1251
806 Ga0157376_10989723 3300014969 Bacteria 863
807 Ga0157376_12007452 3300014969 Unclassified 616
808 Ga0182007_10036587 3300015262 Bacteria 1651
809 Ga0163161_10049401 3300017792 Unclassified 3040
810 Ga0163161_10482851 3300017792 Bacteria 1006
811 Ga0163161_10538042 3300017792 Unclassified 956
812 Ga0163161_10913255 3300017792 Unclassified 745
813 Ga0207666_1046093 3300025271 Unclassified 686
814 Ga0207666_1059364 3300025271 Unclassified 611
815 Ga0207666_1082583 3300025271 Unclassified 519
816 Ga0207673_1012663 3300025290 Bacteria 1100
817 Ga0207697_10000557 3300025315 Bacteria 21112
818 Ga0207697_10000899 3300025315 Bacteria 16838
819 Ga0207697_10110981 3300025315 Unclassified 1174
820 Ga0207697_10148539 3300025315 Bacteria 1019
821 Ga0207697_10250085 3300025315 Bacteria 784
822 Ga0207697_10305303 3300025315 Unclassified 706
823 Ga0207697_10512617 3300025315 Unclassified 529
824 Ga0207656_10189509 3300025321 Bacteria 990
825 Ga0207655_1219627 3300025728 Unclassified 555
826 Ga0207653_10127727 3300025885 Unclassified 920
827 Ga0207653_10319498 3300025885 Unclassified 604
828 Ga0207653_10366743 3300025885 Bacteria 563
829 Ga0207653_10367591 3300025885 Bacteria 563
830 Ga0207682_10000186 3300025893 Bacteria 28174
831 Ga0207682_10014137 3300025893 Bacteria 3111
832 Ga0207682_10040344 3300025893 Bacteria 1902
833 Ga0207682_10060826 3300025893 Unclassified 1580
834 Ga0207682_10335232 3300025893 Bacteria 711
835 Ga0207642_10017497 3300025899 Bacteria 2728
836 Ga0207642_10087014 3300025899 Bacteria 1533
837 Ga0207642_10172515 3300025899 Unclassified 1171
838 Ga0207642_11002617 3300025899 Unclassified 538
839 Ga0207710_10725238 3300025900 Bacteria 522
840 Ga0207710_10737924 3300025900 Bacteria 517
841 Ga0207688_10000494 3300025901 Bacteria 18956
842 Ga0207688_10001543 3300025901 Bacteria 12099
843 Ga0207688_10018436 3300025901 Bacteria 3799
844 Ga0207688_10032610 3300025901 Bacteria 2880
845 Ga0207688_10108910 3300025901 Unclassified 1606
846 Ga0207688_10282262 3300025901 Bacteria 1012
847 Ga0207688_10669544 3300025901 Bacteria 656
848 Ga0207688_10715100 3300025901 Bacteria 634
849 Ga0207680_10057352 3300025903 Bacteria 2356
850 Ga0207680_10147302 3300025903 Bacteria 1567
851 Ga0207680_10194094 3300025903 Bacteria 1380
852 Ga0207680_10366087 3300025903 Unclassified 1014
853 Ga0207680_10584443 3300025903 Bacteria 798
854 Ga0207680_11033642 3300025903 Bacteria 588
855 Ga0207647_10134019 3300025904 Bacteria 1454
856 Ga0207647_10359699 3300025904 Unclassified 824
857 Ga0207645_10002060 3300025907 Bacteria 16108
858 Ga0207645_10020853 3300025907 Bacteria 4281
859 Ga0207645_10066251 3300025907 Bacteria 2309
860 Ga0207645_10148707 3300025907 Bacteria 1528
861 Ga0207645_10191644 3300025907 Bacteria 1344
862 Ga0207645_10280837 3300025907 Bacteria 1106
863 Ga0207645_10296201 3300025907 Bacteria 1076
864 Ga0207645_10590277 3300025907 Unclassified 754
865 Ga0207643_10003832 3300025908 Bacteria 8090
866 Ga0207643_10005261 3300025908 Bacteria 6920
867 Ga0207643_10009423 3300025908 Bacteria 5247
868 Ga0207643_10017014 3300025908 Bacteria 3970
869 Ga0207643_10020305 3300025908 Bacteria 3646
870 Ga0207643_10024361 3300025908 Bacteria 3339
871 Ga0207643_10069135 3300025908 Unclassified 2029
872 Ga0207643_10220489 3300025908 Bacteria 1161
873 Ga0207643_10298666 3300025908 Bacteria 1002
874 Ga0207643_10492588 3300025908 Bacteria 783
875 Ga0207643_10881323 3300025908 Bacteria 580
876 Ga0207643_10914073 3300025908 Unclassified 569
877 Ga0207684_10138448 3300025910 Bacteria 2091
878 Ga0207684_10865084 3300025910 Bacteria 761
879 Ga0207684_10867704 3300025910 Bacteria 760
880 Ga0207684_11134593 3300025910 Bacteria 650
881 Ga0207654_10226963 3300025911 Bacteria 1242
882 Ga0207654_11400493 3300025911 Unclassified 510
883 Ga0207695_10521311 3300025913 Unclassified 1070
884 Ga0207671_10534168 3300025914 Bacteria 935
885 Ga0207671_11142824 3300025914 Bacteria 611
886 Ga0207693_10129894 3300025915 Bacteria 1980
887 Ga0207660_10193513 3300025917 Bacteria 1585
888 Ga0207660_10209320 3300025917 Unclassified 1526
889 Ga0207660_10896575 3300025917 Bacteria 724
890 Ga0207662_10002386 3300025918 Bacteria 9418
891 Ga0207662_10005226 3300025918 Bacteria 6891
892 Ga0207662_10033659 3300025918 Unclassified 2989
893 Ga0207662_10049288 3300025918 Bacteria 2498
894 Ga0207662_11140088 3300025918 Unclassified 554
895 Ga0207657_10314099 3300025919 Bacteria 1240
896 Ga0207649_10065923 3300025920 Unclassified 2294
897 Ga0207649_10144310 3300025920 Bacteria 1632
898 Ga0207649_10510801 3300025920 Bacteria 915
899 Ga0207649_10580144 3300025920 Bacteria 861
900 Ga0207652_10776355 3300025921 Unclassified 852
901 Ga0207646_10044784 3300025922 Bacteria 3972
902 Ga0207646_10267934 3300025922 Unclassified 1544
903 Ga0207646_10411180 3300025922 Bacteria 1222
904 Ga0207681_10004356 3300025923 Bacteria 8730
905 Ga0207681_10026187 3300025923 Unclassified 3759
906 Ga0207681_10038136 3300025923 Bacteria 3181
907 Ga0207681_10074874 3300025923 Bacteria 2373
908 Ga0207681_10083145 3300025923 Bacteria 2265
909 Ga0207681_10087869 3300025923 Bacteria 2213
910 Ga0207681_10112670 3300025923 Bacteria 1982
911 Ga0207681_10174157 3300025923 Unclassified 1633
912 Ga0207681_10264821 3300025923 Unclassified 1347
913 Ga0207681_10309460 3300025923 Unclassified 1253
914 Ga0207681_10315046 3300025923 Archaea 1242
915 Ga0207681_10658944 3300025923 Bacteria 868
916 Ga0207681_10897698 3300025923 Bacteria 742
917 Ga0207681_11006233 3300025923 Bacteria 699
918 Ga0207681_11175295 3300025923 Bacteria 644
919 Ga0207681_11856117 3300025923 Bacteria 502
920 Ga0207694_10441609 3300025924 Bacteria 1085
921 Ga0207694_11073690 3300025924 Unclassified 681
922 Ga0207694_11362525 3300025924 Unclassified 600
923 Ga0207650_10011729 3300025925 Bacteria 6042
924 Ga0207650_10025966 3300025925 Bacteria 4176
925 Ga0207650_10043885 3300025925 Bacteria 3284
926 Ga0207650_10046208 3300025925 Bacteria 3206
927 Ga0207650_10047373 3300025925 Bacteria 3168
928 Ga0207650_10079369 3300025925 Bacteria 2485
929 Ga0207650_10089079 3300025925 Unclassified 2354
930 Ga0207650_10499904 3300025925 Bacteria 1016
931 Ga0207650_10709782 3300025925 Unclassified 850
932 Ga0207650_11245098 3300025925 Bacteria 633
933 Ga0207650_11435076 3300025925 Unclassified 587
934 Ga0207659_10000525 3300025926 Bacteria 22880
935 Ga0207659_10001560 3300025926 Bacteria 13610
936 Ga0207659_10010785 3300025926 Bacteria 5750
937 Ga0207659_10015165 3300025926 Bacteria 4986
938 Ga0207659_10028677 3300025926 Bacteria 3785
939 Ga0207659_10090748 3300025926 Bacteria 2281
940 Ga0207659_10137364 3300025926 Bacteria 1894
941 Ga0207659_10170738 3300025926 Unclassified 1715
942 Ga0207659_10175532 3300025926 Unclassified 1693
943 Ga0207659_10183250 3300025926 Bacteria 1661
944 Ga0207659_10346947 3300025926 Unclassified 1231
945 Ga0207659_10395222 3300025926 Bacteria 1155
946 Ga0207659_10426335 3300025926 Unclassified 1113
947 Ga0207659_10464268 3300025926 Bacteria 1068
948 Ga0207659_10692925 3300025926 Bacteria 872
949 Ga0207659_10790215 3300025926 Bacteria 815
950 Ga0207659_10933106 3300025926 Unclassified 746
951 Ga0207687_10020934 3300025927 Bacteria 4341
952 Ga0207687_10043876 3300025927 Bacteria 3083
953 Ga0207687_10216885 3300025927 Unclassified 1504
954 Ga0207687_10244605 3300025927 Bacteria 1423
955 Ga0207687_10361257 3300025927 Bacteria 1185
956 Ga0207700_10077099 3300025928 Unclassified 2588
957 Ga0207644_10013931 3300025931 Bacteria 5373
958 Ga0207644_10049254 3300025931 Bacteria 3015
959 Ga0207644_10078698 3300025931 Bacteria 2431
960 Ga0207644_10146421 3300025931 Bacteria 1824
961 Ga0207644_10163956 3300025931 Bacteria 1730
962 Ga0207644_10419316 3300025931 Bacteria 1096
963 Ga0207644_10618829 3300025931 Bacteria 900
964 Ga0207644_10876194 3300025931 Unclassified 752
965 Ga0207690_10426924 3300025932 Bacteria 1061
966 Ga0207690_10636242 3300025932 Bacteria 873
967 Ga0207690_10700717 3300025932 Unclassified 832
968 Ga0207690_10834413 3300025932 Bacteria 763
969 Ga0207706_10002818 3300025933 Bacteria 16869
970 Ga0207706_10023273 3300025933 Bacteria 5564
971 Ga0207706_10070211 3300025933 Bacteria 3081
972 Ga0207706_10074379 3300025933 Bacteria 2987
973 Ga0207706_10089308 3300025933 Bacteria 2709
974 Ga0207706_10498984 3300025933 Unclassified 1051
975 Ga0207706_10615635 3300025933 Bacteria 932
976 Ga0207706_10917446 3300025933 Bacteria 739
977 Ga0207706_11121711 3300025933 Bacteria 656
978 Ga0207706_11229093 3300025933 Bacteria 622
979 Ga0207686_10022441 3300025934 Bacteria 3635
980 Ga0207686_10082946 3300025934 Bacteria 2097
981 Ga0207686_10260816 3300025934 Bacteria 1271
982 Ga0207686_10285381 3300025934 Bacteria 1220
983 Ga0207686_10735922 3300025934 Unclassified 786
984 Ga0207686_11471527 3300025934 Unclassified 561
985 Ga0207709_10098698 3300025935 Bacteria 1926
986 Ga0207709_10207557 3300025935 Bacteria 1403
987 Ga0207709_10618520 3300025935 Bacteria 859
988 Ga0207709_10721743 3300025935 Bacteria 799
989 Ga0207709_10730091 3300025935 Bacteria 795
990 Ga0207709_11052691 3300025935 Bacteria 667
991 Ga0207709_11523010 3300025935 Unclassified 555
992 Ga0207709_11773756 3300025935 Unclassified 513
993 Ga0207670_10006992 3300025936 Bacteria 6283
994 Ga0207670_10008277 3300025936 Bacteria 5862
995 Ga0207670_10013010 3300025936 Bacteria 4893
996 Ga0207670_10132586 3300025936 Bacteria 1827
997 Ga0207670_10260395 3300025936 Bacteria 1344
998 Ga0207670_10401507 3300025936 Bacteria 1096
999 Ga0207670_10912096 3300025936 Bacteria 736
1000 Ga0207669_10008290 3300025937 Bacteria 4869
1001 Ga0207669_10011854 3300025937 Bacteria 4261
1002 Ga0207669_10025104 3300025937 Bacteria 3214
1003 Ga0207669_10107907 3300025937 Bacteria 1858
1004 Ga0207669_10225599 3300025937 Bacteria 1378
1005 Ga0207669_10234491 3300025937 Bacteria 1356
1006 Ga0207669_11314077 3300025937 Unclassified 614
1007 Ga0207704_10124735 3300025938 Unclassified 1770
1008 Ga0207704_10128765 3300025938 Unclassified 1748
1009 Ga0207704_10822011 3300025938 Bacteria 777
1010 Ga0207704_11161331 3300025938 Unclassified 657
1011 Ga0207691_10000539 3300025940 Bacteria 37872
1012 Ga0207691_10031502 3300025940 Bacteria 4948
1013 Ga0207691_10033194 3300025940 Bacteria 4805
1014 Ga0207691_10051037 3300025940 Bacteria 3784
1015 Ga0207691_10057852 3300025940 Unclassified 3527
1016 Ga0207691_10083406 3300025940 Bacteria 2869
1017 Ga0207691_10098415 3300025940 Bacteria 2613
1018 Ga0207691_10220431 3300025940 Bacteria 1645
1019 Ga0207691_10291201 3300025940 Bacteria 1404
1020 Ga0207691_10319290 3300025940 Bacteria 1332
1021 Ga0207691_10630269 3300025940 Bacteria 907
1022 Ga0207691_10685754 3300025940 Bacteria 864
1023 Ga0207691_10724010 3300025940 Unclassified 838
1024 Ga0207691_11002936 3300025940 Bacteria 697
1025 Ga0207691_11393184 3300025940 Unclassified 576
1026 Ga0207711_10053130 3300025941 Bacteria 3475
1027 Ga0207711_10069281 3300025941 Bacteria 3057
1028 Ga0207711_10087530 3300025941 Bacteria 2733
1029 Ga0207711_10133073 3300025941 Bacteria 2231
1030 Ga0207711_10271029 3300025941 Bacteria 1562
1031 Ga0207711_10334638 3300025941 Bacteria 1401
1032 Ga0207711_10347566 3300025941 Bacteria 1373
1033 Ga0207711_10496356 3300025941 Bacteria 1137
1034 Ga0207711_10546295 3300025941 Bacteria 1081
1035 Ga0207711_10552918 3300025941 Bacteria 1074
1036 Ga0207711_10796268 3300025941 Unclassified 880
1037 Ga0207711_11051947 3300025941 Bacteria 754
1038 Ga0207711_11450141 3300025941 Bacteria 629
1039 Ga0207711_11904628 3300025941 Bacteria 537
1040 Ga0207689_10000847 3300025942 Bacteria 29431
1041 Ga0207689_10017160 3300025942 Bacteria 6127
1042 Ga0207689_10050612 3300025942 Bacteria 3425
1043 Ga0207689_10074868 3300025942 Unclassified 2782
1044 Ga0207689_10099553 3300025942 Unclassified 2389
1045 Ga0207689_10136569 3300025942 Bacteria 2019
1046 Ga0207689_10229442 3300025942 Unclassified 1534
1047 Ga0207689_10236389 3300025942 Bacteria 1510
1048 Ga0207689_10941589 3300025942 Bacteria 729
1049 Ga0207689_11178444 3300025942 Bacteria 645
1050 Ga0207661_10018712 3300025944 Bacteria 5151
1051 Ga0207661_10068325 3300025944 Unclassified 2893
1052 Ga0207679_10054448 3300025945 Bacteria 2945
1053 Ga0207679_10057470 3300025945 Bacteria 2877
1054 Ga0207679_10080819 3300025945 Bacteria 2483
1055 Ga0207679_10102956 3300025945 Bacteria 2237
1056 Ga0207679_10218537 3300025945 Bacteria 1602
1057 Ga0207679_10233603 3300025945 Bacteria 1554
1058 Ga0207679_10326416 3300025945 Unclassified 1330
1059 Ga0207679_10383363 3300025945 Unclassified 1233
1060 Ga0207679_10521891 3300025945 Unclassified 1062
1061 Ga0207679_10850565 3300025945 Bacteria 833
1062 Ga0207667_10923705 3300025949 Bacteria 863
1063 Ga0207651_10039967 3300025960 Bacteria 3098
1064 Ga0207651_10076917 3300025960 Unclassified 2387
1065 Ga0207651_10219296 3300025960 Bacteria 1536
1066 Ga0207651_10225015 3300025960 Bacteria 1519
1067 Ga0207651_10550586 3300025960 Bacteria 1003
1068 Ga0207651_11118538 3300025960 Unclassified 706
1069 Ga0207651_11715163 3300025960 Unclassified 566
1070 Ga0207712_10005058 3300025961 Bacteria 8348
1071 Ga0207712_10005530 3300025961 Bacteria 7971
1072 Ga0207712_10007979 3300025961 Bacteria 6691
1073 Ga0207712_10165018 3300025961 Bacteria 1725
1074 Ga0207712_10201544 3300025961 Bacteria 1578
1075 Ga0207712_10281393 3300025961 Bacteria 1358
1076 Ga0207712_10384740 3300025961 Bacteria 1175
1077 Ga0207712_10459485 3300025961 Bacteria 1081
1078 Ga0207712_11801212 3300025961 Bacteria 549
1079 Ga0207668_10071623 3300025972 Bacteria 2477
1080 Ga0207668_10087722 3300025972 Bacteria 2276
1081 Ga0207668_10097797 3300025972 Unclassified 2173
1082 Ga0207668_10301313 3300025972 Bacteria 1323
1083 Ga0207668_10526411 3300025972 Bacteria 1021
1084 Ga0207668_11082518 3300025972 Unclassified 718
1085 Ga0207668_11191638 3300025972 Bacteria 684
1086 Ga0207640_10092033 3300025981 Bacteria 2102
1087 Ga0207640_10180240 3300025981 Bacteria 1583
1088 Ga0207640_10265080 3300025981 Bacteria 1341
1089 Ga0207640_10356803 3300025981 Bacteria 1176
1090 Ga0207658_10085354 3300025986 Bacteria 2431
1091 Ga0207658_11657046 3300025986 Unclassified 584
1092 Ga0207658_11935517 3300025986 Unclassified 537
1093 Ga0207677_10007225 3300026023 Bacteria 6122
1094 Ga0207677_10123842 3300026023 Bacteria 1950
1095 Ga0207677_10136227 3300026023 Bacteria 1873
1096 Ga0207677_10280917 3300026023 Bacteria 1367
1097 Ga0207677_10588251 3300026023 Bacteria 975
1098 Ga0207677_10602233 3300026023 Unclassified 964
1099 Ga0207677_11588866 3300026023 Bacteria 605
1100 Ga0207703_10008503 3300026035 Bacteria 8108
1101 Ga0207703_10037356 3300026035 Bacteria 3868
1102 Ga0207703_10090077 3300026035 Bacteria 2577
1103 Ga0207703_10191370 3300026035 Bacteria 1812
1104 Ga0207703_10413164 3300026035 Bacteria 1254
1105 Ga0207703_10416561 3300026035 Bacteria 1249
1106 Ga0207703_10627176 3300026035 Unclassified 1018
1107 Ga0207639_10420103 3300026041 Bacteria 1209
1108 Ga0207639_11843054 3300026041 Unclassified 566
1109 Ga0207678_10053358 3300026067 Bacteria 3483
1110 Ga0207678_10075319 3300026067 Bacteria 2891
1111 Ga0207678_10223042 3300026067 Unclassified 1614
1112 Ga0207678_10672467 3300026067 Bacteria 910
1113 Ga0207678_11116314 3300026067 Unclassified 698
1114 Ga0207678_11557866 3300026067 Bacteria 583
1115 Ga0207678_11623460 3300026067 Bacteria 569
1116 Ga0207708_10003479 3300026075 Bacteria 11610
1117 Ga0207708_10008243 3300026075 Bacteria 7718
1118 Ga0207708_10019304 3300026075 Bacteria 5137
1119 Ga0207708_10019428 3300026075 Bacteria 5122
1120 Ga0207708_10034888 3300026075 Bacteria 3827
1121 Ga0207708_10093684 3300026075 Bacteria 2318
1122 Ga0207708_10115418 3300026075 Unclassified 2088
1123 Ga0207708_10209484 3300026075 Unclassified 1558
1124 Ga0207708_10364852 3300026075 Bacteria 1188
1125 Ga0207708_10425630 3300026075 Bacteria 1102
1126 Ga0207708_10681055 3300026075 Unclassified 878
1127 Ga0207708_10949051 3300026075 Bacteria 746
1128 Ga0207708_10975213 3300026075 Unclassified 736
1129 Ga0207641_10169479 3300026088 Bacteria 1991
1130 Ga0207641_10170800 3300026088 Bacteria 1984
1131 Ga0207641_10322997 3300026088 Bacteria 1464
1132 Ga0207641_10376550 3300026088 Unclassified 1358
1133 Ga0207641_10709807 3300026088 Unclassified 991
1134 Ga0207641_10825469 3300026088 Bacteria 918
1135 Ga0207648_10004841 3300026089 Bacteria 13731
1136 Ga0207648_10005699 3300026089 Bacteria 12491
1137 Ga0207648_10012289 3300026089 Bacteria 8017
1138 Ga0207648_10014111 3300026089 Bacteria 7390
1139 Ga0207648_10088244 3300026089 Unclassified 2708
1140 Ga0207648_10181528 3300026089 Bacteria 1863
1141 Ga0207648_10228116 3300026089 Bacteria 1656
1142 Ga0207648_10254657 3300026089 Unclassified 1565
1143 Ga0207648_10299086 3300026089 Bacteria 1443
1144 Ga0207648_10300115 3300026089 Unclassified 1440
1145 Ga0207648_10714936 3300026089 Unclassified 929
1146 Ga0207648_11586731 3300026089 Unclassified 615
1147 Ga0207676_10013947 3300026095 Bacteria 5769
1148 Ga0207676_10039742 3300026095 Bacteria 3601
1149 Ga0207676_10100868 3300026095 Bacteria 2393
1150 Ga0207676_10144125 3300026095 Bacteria 2043
1151 Ga0207676_10400797 3300026095 Bacteria 1282
1152 Ga0207676_10511891 3300026095 Unclassified 1141
1153 Ga0207676_10729006 3300026095 Bacteria 962
1154 Ga0207676_10741621 3300026095 Unclassified 954
1155 Ga0207676_10798715 3300026095 Bacteria 920
1156 Ga0207676_10811396 3300026095 Unclassified 913
1157 Ga0207674_10015066 3300026116 Bacteria 8514
1158 Ga0207674_10016569 3300026116 Bacteria 8060
1159 Ga0207674_10192041 3300026116 Bacteria 1992
1160 Ga0207674_10302986 3300026116 Unclassified 1547
1161 Ga0207674_10417052 3300026116 Unclassified 1297
1162 Ga0207674_10608697 3300026116 Unclassified 1055
1163 Ga0207674_10857797 3300026116 Bacteria 876
1164 Ga0207674_11620808 3300026116 Bacteria 616
1165 Ga0207675_100000755 3300026118 Bacteria 32180
1166 Ga0207675_100010552 3300026118 Bacteria 8654
1167 Ga0207675_100031807 3300026118 Bacteria 4916
1168 Ga0207675_100079772 3300026118 Bacteria 3068
1169 Ga0207675_100140759 3300026118 Bacteria 2292
1170 Ga0207675_100186687 3300026118 Bacteria 1987
1171 Ga0207675_100253757 3300026118 Unclassified 1703
1172 Ga0207675_100256279 3300026118 Bacteria 1695
1173 Ga0207675_100947431 3300026118 Bacteria 878
1174 Ga0207675_101105698 3300026118 Unclassified 812
1175 Ga0207675_101408366 3300026118 Archaea 718
1176 Ga0207675_102376495 3300026118 Unclassified 543
1177 Ga0207683_10014341 3300026121 Bacteria 6752
1178 Ga0207683_10129526 3300026121 Unclassified 2269
1179 Ga0207683_10176125 3300026121 Unclassified 1938
1180 Ga0207683_10212491 3300026121 Bacteria 1761
1181 Ga0207683_10257429 3300026121 Unclassified 1593
1182 Ga0207683_10514864 3300026121 Bacteria 1106
1183 Ga0207698_10037502 3300026142 Bacteria 3571
1184 Ga0209971_1043501 3300027682 Bacteria 1082
1185 Ga0209966_1080682 3300027695 Bacteria 721
1186 Ga0209998_10039227 3300027717 Bacteria 1071
1187 Ga0209813_10050903 3300027866 Bacteria 1294
1188 Ga0209813_10076183 3300027866 Bacteria 1100
1189 Ga0209813_10101398 3300027866 Bacteria 980
1190 Ga0209974_10070987 3300027876 Bacteria 1188
1191 Ga0209974_10092288 3300027876 Unclassified 1051
1192 Ga0207428_10001458 3300027907 Bacteria 24726
1193 Ga0207428_10006998 3300027907 Bacteria 10330
1194 Ga0207428_10016020 3300027907 Bacteria 6461
1195 Ga0207428_10017364 3300027907 Bacteria 6177
1196 Ga0207428_10027241 3300027907 Bacteria 4760
1197 Ga0207428_10046391 3300027907 Bacteria 3495
1198 Ga0207428_10252306 3300027907 Unclassified 1315
1199 Ga0207428_10564489 3300027907 Unclassified 822
1200 Ga0268266_10001356 3300028379 Bacteria 29568
1201 Ga0268266_10027926 3300028379 Bacteria 4799
1202 Ga0268266_10226764 3300028379 Bacteria 1719
1203 Ga0268266_10818023 3300028379 Bacteria 900
1204 Ga0268265_10002680 3300028380 Bacteria 13198
1205 Ga0268265_10011758 3300028380 Bacteria 5921
1206 Ga0268265_10026033 3300028380 Bacteria 4158
1207 Ga0268265_10057883 3300028380 Bacteria 2957
1208 Ga0268265_10201570 3300028380 Bacteria 1727
1209 Ga0268265_10281830 3300028380 Unclassified 1487
1210 Ga0268265_10284537 3300028380 Bacteria 1481
1211 Ga0268265_10393119 3300028380 Bacteria 1279
1212 Ga0268265_10399966 3300028380 Bacteria 1269
1213 Ga0268265_10972563 3300028380 Bacteria 837
1214 Ga0268265_11113613 3300028380 Bacteria 784
1215 Ga0268265_11639726 3300028380 Unclassified 648
1216 Ga0268265_11654696 3300028380 Bacteria 645
1217 Ga0268264_10011509 3300028381 Bacteria 7308
1218 Ga0268264_10078214 3300028381 Bacteria 2819
1219 Ga0268264_10118588 3300028381 Bacteria 2329
1220 Ga0268264_10201191 3300028381 Bacteria 1822
1221 Ga0268264_10311222 3300028381 Bacteria 1486
1222 Ga0268264_10571068 3300028381 Unclassified 1112
1223 Ga0307408_100002942 3300031548 Bacteria 11800
1224 Ga0307408_100005179 3300031548 Bacteria 8745
1225 Ga0307408_100019020 3300031548 Bacteria 4620
1226 Ga0307408_100194772 3300031548 Bacteria 1636
1227 Ga0307408_100240672 3300031548 Bacteria 1487
1228 Ga0307408_100264891 3300031548 Unclassified 1424
1229 Ga0307408_100287332 3300031548 Bacteria 1372
1230 Ga0307408_100394406 3300031548 Bacteria 1187
1231 Ga0307408_100435977 3300031548 Bacteria 1133
1232 Ga0307408_100495288 3300031548 Unclassified 1069
1233 Ga0307408_100895013 3300031548 Bacteria 812
1234 Ga0307408_101015345 3300031548 Unclassified 765
1235 Ga0307408_101213449 3300031548 Unclassified 704
1236 Ga0307405_10000924 3300031731 Bacteria 11681
1237 Ga0307405_10504047 3300031731 Bacteria 971
1238 Ga0307405_10664274 3300031731 Unclassified 859
1239 Ga0307405_10678864 3300031731 Bacteria 850
1240 Ga0307405_10692692 3300031731 Unclassified 843
1241 Ga0307405_10866597 3300031731 Unclassified 761
1242 Ga0307405_10954103 3300031731 Bacteria 729
1243 Ga0307405_11130437 3300031731 Bacteria 674
1244 Ga0307413_10009991 3300031824 Bacteria 4575
1245 Ga0307413_10011777 3300031824 Unclassified 4319
1246 Ga0307413_10021966 3300031824 Bacteria 3428
1247 Ga0307413_10291282 3300031824 Unclassified 1233
1248 Ga0307413_10838809 3300031824 Bacteria 776
1249 Ga0307410_10005924 3300031852 Bacteria 6535
1250 Ga0307410_10077945 3300031852 Bacteria 2318
1251 Ga0307410_10229039 3300031852 Bacteria 1434
1252 Ga0307410_10262847 3300031852 Bacteria 1346
1253 Ga0307410_10318030 3300031852 Bacteria 1234
1254 Ga0307410_10412350 3300031852 Bacteria 1094
1255 Ga0307410_10855713 3300031852 Bacteria 776
1256 Ga0307410_10904720 3300031852 Bacteria 756
1257 Ga0307410_10989503 3300031852 Unclassified 725
1258 Ga0307410_11535385 3300031852 Unclassified 587
1259 Ga0307406_10006611 3300031901 Bacteria 6408
1260 Ga0307406_10163429 3300031901 Bacteria 1603
1261 Ga0307406_11366878 3300031901 Bacteria 620
1262 Ga0307406_11511986 3300031901 Unclassified 591
1263 Ga0307407_10002222 3300031903 Bacteria 7494
1264 Ga0307407_10021163 3300031903 Bacteria 3348
1265 Ga0307407_10301660 3300031903 Bacteria 1117
1266 Ga0307407_10477930 3300031903 Bacteria 909
1267 Ga0307407_10621596 3300031903 Bacteria 806
1268 Ga0307412_10018211 3300031911 Bacteria 4221
1269 Ga0307412_10027994 3300031911 Bacteria 3521
1270 Ga0307412_10149574 3300031911 Bacteria 1721
1271 Ga0307412_10364799 3300031911 Bacteria 1164
1272 Ga0307412_12009570 3300031911 Bacteria 535
1273 Ga0307409_100003276 3300031995 Bacteria 8742
1274 Ga0307409_100125456 3300031995 Bacteria 2182
1275 Ga0307409_100234688 3300031995 Bacteria 1665
1276 Ga0307409_100239430 3300031995 Bacteria 1651
1277 Ga0307409_100371238 3300031995 Bacteria 1357
1278 Ga0307409_100432016 3300031995 Bacteria 1266
1279 Ga0307409_100474120 3300031995 Bacteria 1213
1280 Ga0307409_100596208 3300031995 Bacteria 1091
1281 Ga0307409_100702199 3300031995 Bacteria 1011
1282 Ga0307409_100949287 3300031995 Bacteria 876
1283 Ga0307416_100059432 3300032002 Bacteria 3106
1284 Ga0307416_100061514 3300032002 Bacteria 3065
1285 Ga0307416_100081188 3300032002 Bacteria 2740
1286 Ga0307416_100224715 3300032002 Bacteria 1804
1287 Ga0307416_100227799 3300032002 Unclassified 1794
1288 Ga0307416_100238602 3300032002 Bacteria 1759
1289 Ga0307416_100336044 3300032002 Unclassified 1521
1290 Ga0307416_100388795 3300032002 Bacteria 1428
1291 Ga0307416_100409248 3300032002 Unclassified 1397
1292 Ga0307416_101014057 3300032002 Unclassified 933
1293 Ga0307416_101444714 3300032002 Bacteria 793
1294 Ga0307416_101535217 3300032002 Unclassified 772
1295 Ga0307416_101570820 3300032002 Unclassified 763
1296 Ga0307416_102139434 3300032002 Unclassified 661
1297 Ga0307416_102392847 3300032002 Unclassified 628
1298 Ga0307416_102462973 3300032002 Unclassified 619
1299 Ga0307416_103417057 3300032002 Unclassified 531
1300 Ga0307416_103575410 3300032002 Unclassified 520
1301 Ga0307414_10004602 3300032004 Bacteria 7507
1302 Ga0307414_10205056 3300032004 Bacteria 1607
1303 Ga0307414_10366877 3300032004 Bacteria 1241
1304 Ga0307414_10477115 3300032004 Unclassified 1099
1305 Ga0307414_10479326 3300032004 Unclassified 1097
1306 Ga0307414_10659313 3300032004 Bacteria 944
1307 Ga0307414_11249193 3300032004 Bacteria 688
1308 Ga0307411_10001250 3300032005 Bacteria 10134
1309 Ga0307411_10032932 3300032005 Bacteria 3208
1310 Ga0307411_10273209 3300032005 Bacteria 1341
1311 Ga0307411_10391465 3300032005 Bacteria 1146
1312 Ga0307411_11699981 3300032005 Unclassified 584
1313 Ga0307411_12127510 3300032005 Bacteria 525
1314 Ga0307415_100090910 3300032126 Unclassified 2209
1315 Ga0307415_100114195 3300032126 Bacteria 2010
1316 Ga0307415_100182367 3300032126 Bacteria 1648
1317 Ga0307415_100247793 3300032126 Unclassified 1445
1318 Ga0307415_100969974 3300032126 Bacteria 788
1319 Ga0307415_101521166 3300032126 Bacteria 641
1320 Ga0307415_101942627 3300032126 Unclassified 572
1321 Ga0373950_0029035 3300034818 Unclassified 1016
1322 Ga0373938_0080018 3300034957 Unclassified 794
1323 Ga0373926_0400941 3300035083 Bacteria 542
1324 Ga0373934_0055913 3300035086 Bacteria 1569
1325 Ga0373949_0071690 3300035090 Unclassified 908
1326 Ga0373951_0055586 3300035091 Bacteria 982
1327 Ga0373951_0250978 3300035091 Unclassified 531
1328 Ga0373923_0417856 3300035111 Bacteria 647
1329 Ga0373923_0501134 3300035111 Bacteria 592
1330 Ga0373932_0004595 3300035112 Bacteria 3259
1331 Ga0373939_0010866 3300035114 Bacteria 2287
1332 Ga0373939_0224366 3300035114 Unclassified 721
1333 Ga0373941_0039098 3300035115 Bacteria 1456
1334 Ga0373941_0286619 3300035115 Unclassified 653
1335 Ga0373956_0097799 3300035119 Unclassified 1359
1336 Ga0373956_0326667 3300035119 Bacteria 731
1337 Ga0373956_0343215 3300035119 Unclassified 712
1338 Ga0373956_0599313 3300035119 Unclassified 526
1339 Ga0373960_0144395 3300035121 Unclassified 808
1340 Ga0373943_0519020 3300035170 Bacteria 697
1341 Ga0373943_0594658 3300035170 Unclassified 651
1342 Ga0373946_0588247 3300035171 Bacteria 576
1343 Ga0373955_0464168 3300035172 Unclassified 772
1344 Ga0373955_0680844 3300035172 Bacteria 631
1345 Ga0373955_0873235 3300035172 Bacteria 553
1346 Ga0373942_0354625 3300035207 Unclassified 519
1347 Ga0373962_0043749 3300035242 Bacteria 1270
1348 Ga0373924_0041482 3300035410 Unclassified 1886
1349 Ga0373924_0084401 3300035410 Bacteria 1354
1350 Ga0373931_0035621 3300035691 Bacteria 2589
1351 Ga0373931_0052877 3300035691 Bacteria 2167
1352 Ga0373931_0217261 3300035691 Unclassified 1149
1353 Ga0373931_0335073 3300035691 Bacteria 943
1354 Ga0373935_0419003 3300035692 Bacteria 964
1355 Ga0373933_0399250 3300035724 Unclassified 897
1356 Ga0373937_0025431 3300036401 Bacteria 5344
1357 Ga0373937_0498834 3300036401 Unclassified 1157
1358 Ga0373937_1501240 3300036401 Unclassified 621
1359 Ga0373937_1521642 3300036401 Bacteria 616
1360 Ga0373925_0819805 3300037068 Bacteria 767
1361 Ga0373925_0821036 3300037068 Bacteria 766
1362 Ga0395900_0878116 3300037418 Bacteria 821
1363 Ga0395898_1340306 3300037466 Bacteria 644
1364 Ga0242420_052163 3300038996 Unclassified 802
1365 Ga0439436_0074786 3300041404 Bacteria 944
1366 Ga0439439_0004932 3300041406 Bacteria 3027
1367 Ga0439453_0013175 3300041408 Bacteria 1403
1368 Ga0439461_0007768 3300041410 Unclassified 1910
1369 Ga0439461_0014950 3300041410 Bacteria 1483
1370 Ga0439461_0063965 3300041410 Bacteria 840
1371 Ga0439461_0065707 3300041410 Bacteria 832
1372 Ga0451795_1211245 3300041456 Unclassified 518
1373 Ga0451798_0567307 3300041458 Unclassified 530
1374 Ga0451800_0488747 3300041459 Unclassified 710
1375 Ga0451800_1229364 3300041459 Unclassified 505
1376 Ga0451802_0983452 3300041460 Bacteria 552
1377 Ga0451802_0983820 3300041460 Bacteria 556
1378 Ga0451802_1047813 3300041460 Bacteria 568
1379 Ga0451802_1277372 3300041460 Unclassified 540
1380 Ga0451807_2702473 3300041486 Unclassified 608
1381 Ga0451845_0469777 3300041501 Unclassified 680
1382 Ga0451849_0010536 3300041505 Unclassified 622
1383 Ga0451853_0429604 3300041512 Unclassified 744
1384 Ga0451853_0571654 3300041512 Unclassified 579
1385 Ga0451853_3505640 3300041512 Unclassified 766
1386 Ga0439431_0026650 3300041997 Bacteria 1417
1387 Ga0439431_0145949 3300041997 Unclassified 670
1388 Ga0439433_0017302 3300041999 Unclassified 1600
1389 Ga0439433_0054741 3300041999 Bacteria 944
1390 Ga0439433_0065055 3300041999 Unclassified 874
1391 Ga0439437_055614 3300042000 Unclassified 531
1392 Ga0439441_043832 3300042001 Bacteria 904
1393 Ga0439443_108067 3300042003 Unclassified 538
1394 Ga0439445_0126820 3300042004 Bacteria 735
1395 Ga0439445_0142938 3300042004 Bacteria 694
1396 Ga0439449_0246717 3300042007 Bacteria 671
1397 Ga0439449_0416214 3300042007 Bacteria 510
1398 Ga0439450_042689 3300042008 Bacteria 1057
1399 Ga0439451_133080 3300042009 Bacteria 508
1400 Ga0439455_0027924 3300042012 Bacteria 1386
1401 Ga0439455_0161761 3300042012 Bacteria 640
1402 Ga0439455_0167664 3300042012 Bacteria 630
1403 Ga0439456_108702 3300042013 Unclassified 631
1404 Ga0439457_096637 3300042014 Bacteria 686
1405 Ga0439462_0047141 3300042015 Bacteria 1155
1406 Ga0439462_0059319 3300042015 Bacteria 1034
1407 Ga0439462_0173601 3300042015 Bacteria 610
1408 Ga0439462_0260431 3300042015 Unclassified 500
1409 Ga0450920_068512 3300042122 Unclassified 721
1410 Ga0450920_144749 3300042122 Bacteria 504
1411 Ga0450894_073941 3300042131 Unclassified 525
1412 Ga0450896_080904 3300042133 Unclassified 547
1413 Ga0450910_099347 3300042147 Bacteria 522
1414 Ga0439446_0048598 3300042156 Bacteria 1263
1415 Ga0439446_0081900 3300042156 Bacteria 1000
1416 Ga0439446_0124704 3300042156 Bacteria 831
1417 Ga0439446_0273916 3300042156 Bacteria 587
1418 Ga0439446_0382644 3300042156 Unclassified 506
1419 Ga0439458_0211912 3300042157 Unclassified 532
1420 Ga0439434_0048017 3300042435 Bacteria 1320
1421 Ga0439434_0065672 3300042435 Bacteria 1138
1422 Ga0439434_0123886 3300042435 Bacteria 844
1423 Ga0439434_0266382 3300042435 Unclassified 588
1424 Ga0439435_0025603 3300042436 Bacteria 1565
1425 Ga0439435_0045608 3300042436 Bacteria 1240
1426 Ga0439435_0128033 3300042436 Unclassified 800
1427 Ga0439435_0135589 3300042436 Bacteria 781
1428 Ga0439435_0146953 3300042436 Bacteria 754
1429 Ga0439435_0367807 3300042436 Bacteria 501
1430 Ga0439444_0041154 3300042437 Bacteria 908
1431 Ga0439444_0073418 3300042437 Unclassified 736
1432 Ga0439444_0135708 3300042437 Bacteria 585
1433 Ga0439444_0170611 3300042437 Bacteria 536
1434 Ga0439459_0110878 3300042438 Unclassified 682
1435 Ga0439459_0125430 3300042438 Unclassified 651
1436 Ga0439464_0004244 3300042439 Bacteria 3658
1437 Ga0439464_0004625 3300042439 Bacteria 3525
1438 Ga0439464_0024872 3300042439 Bacteria 1657
1439 Ga0439464_0097717 3300042439 Unclassified 890
1440 Ga0439464_0120321 3300042439 Bacteria 808
1441 Ga0439460_0017095 3300042461 Unclassified 1940
1442 Ga0439460_0084401 3300042461 Bacteria 1001
1443 Ga0439460_0146311 3300042461 Bacteria 786
1444 Ga0450893_0137390 3300042532 Unclassified 520
1445 Ga0451577_0134250 3300042876 Unclassified 2221
1446 Ga0451577_0583124 3300042876 Bacteria 1015
1447 Ga0439440_0231207 3300042993 Bacteria 558
1448 Ga0453683_0512372 3300044673 Bacteria 779
1449 Ga0453683_0608827 3300044673 Bacteria 713
1450 Ga0453683_1125672 3300044673 Unclassified 524
1451 Ga0453684_0142552 3300044712 Bacteria 2859
1452 Ga0466960_0497773 3300044901 Unclassified 714
1453 Ga0451576_0025937 3300045051 Bacteria 6310
1454 Ga0451576_0046822 3300045051 Bacteria 4552
1455 Ga0451576_0053959 3300045051 Bacteria 4208
1456 Ga0451576_0063125 3300045051 Bacteria 3861
1457 Ga0451576_0239444 3300045051 Bacteria 1895
1458 Ga0451576_0810841 3300045051 Bacteria 983
1459 Ga0451576_1261760 3300045051 Bacteria 771
1460 Ga0451576_1772249 3300045051 Unclassified 639
1461 Ga0495592_0167128 3300046454 Bacteria 1509
1462 Ga0495592_0478136 3300046454 Bacteria 776
1463 Ga0495603_0130248 3300046455 Bacteria 1465
1464 Ga0495603_0158961 3300046455 Unclassified 1311
1465 Ga0495629_0120736 3300046459 Bacteria 1826
1466 Ga0495629_0140272 3300046459 Unclassified 1682
1467 Ga0495582_0613179 3300046473 Bacteria 630
1468 Ga0495639_0129813 3300046475 Bacteria 1206
1469 Ga0495662_0114404 3300046476 Bacteria 1323
1470 Ga0495585_0292895 3300046492 Unclassified 802
1471 Ga0495594_0450431 3300046499 Bacteria 732
1472 Ga0495618_0486751 3300046514 Bacteria 745
1473 Ga0495628_0128520 3300046516 Unclassified 1940
1474 Ga0495628_0640076 3300046516 Bacteria 756
1475 Ga0495630_0501505 3300046517 Unclassified 931
1476 Ga0495643_0001260 3300046522 Bacteria 24270
1477 Ga0495640_0112897 3300046533 Bacteria 1774
1478 Ga0495586_0326111 3300046535 Bacteria 881
1479 Ga0495586_0672634 3300046535 Bacteria 598
1480 Ga0495598_0087950 3300046537 Unclassified 1008
1481 Ga0495598_0113752 3300046537 Bacteria 910
1482 Ga0495609_0282182 3300046538 Unclassified 679
1483 Ga0495621_0000636 3300046539 Bacteria 8821
1484 Ga0495621_0220108 3300046539 Bacteria 768
1485 Ga0495621_0249737 3300046539 Bacteria 724
1486 Ga0495597_0074140 3300046542 Bacteria 1462
1487 Ga0495645_0027106 3300046543 Unclassified 4161
1488 Ga0495667_0295863 3300046559 Bacteria 1026
1489 Ga0495667_0491551 3300046559 Bacteria 769
1490 Ga0495656_0149170 3300046615 Bacteria 1128
1491 Ga0495656_0351256 3300046615 Unclassified 764
1492 Ga0495634_0298622 3300046642 Bacteria 974
1493 Ga0495635_0215356 3300046663 Unclassified 1300
1494 Ga0495635_0375167 3300046663 Bacteria 947
1495 Ga0495659_0018453 3300046664 Bacteria 2325
1496 Ga0495659_0023986 3300046664 Bacteria 2076
1497 Ga0495659_0060110 3300046664 Bacteria 1401
1498 Ga0495599_0107869 3300046678 Bacteria 1735
1499 Ga0495647_0075468 3300046681 Bacteria 1357
1500 Ga0495658_0130855 3300046683 Bacteria 1527
1501 Ga0495658_0503329 3300046683 Bacteria 775
1502 Ga0495613_0337369 3300046689 Unclassified 1038
1503 Ga0495613_0360306 3300046689 Bacteria 997
1504 Ga0495649_0405865 3300046694 Unclassified 684
1505 Ga0495581_0322807 3300047315 Bacteria 902
1506 Ga0495636_0066258 3300047318 Bacteria 1535
1507 Ga0495674_0506281 3300047319 Unclassified 965
1508 Ga0495676_0884280 3300047321 Bacteria 573
1509 Ga0495680_0345333 3300047322 Unclassified 1037
1510 Ga0495684_0225238 3300047471 Bacteria 1373
1511 Ga0495684_0260600 3300047471 Bacteria 1258
1512 Ga0495684_0553477 3300047471 Unclassified 783
1513 Ga0495684_0653752 3300047471 Bacteria 703
1514 Ga0495593_0512694 3300047673 Bacteria 601
1515 Ga0496100_0520517 3300048903 Bacteria 918
1516 Ga0496101_0248769 3300048904 Bacteria 1385
1517 Ga0496101_1160840 3300048904 Archaea 606
1518 Ga0496101_1279141 3300048904 Bacteria 574
1519 Ga0496102_0140567 3300048905 Unclassified 2263
1520 Ga0496102_0678002 3300048905 Unclassified 954
1521 Ga0496102_0860485 3300048905 Unclassified 829
1522 Ga0496103_0022770 3300048906 Bacteria 3774
1523 Ga0496104_0029430 3300048907 Bacteria 5095
1524 Ga0496104_0051939 3300048907 Bacteria 3871
1525 Ga0496104_0266364 3300048907 Bacteria 1626
1526 Ga0496104_0834358 3300048907 Bacteria 827
1527 Ga0496105_0208692 3300048908 Bacteria 1593
1528 Ga0496105_0234817 3300048908 Unclassified 1489
1529 Ga0496105_0462038 3300048908 Bacteria 1001
1530 Ga0496106_0149353 3300048909 Bacteria 1843
1531 Ga0496106_0172626 3300048909 Bacteria 1714
1532 Ga0496106_0207750 3300048909 Bacteria 1559
1533 Ga0496106_0646341 3300048909 Bacteria 845
1534 Ga0496107_0861191 3300048910 Unclassified 662
1535 Ga0496108_0048269 3300048911 Bacteria 3559
1536 Ga0496108_0278533 3300048911 Unclassified 1456
1537 Ga0496108_0436958 3300048911 Bacteria 1143
1538 Ga0496109_0012204 3300048912 Bacteria 7412
1539 Ga0496109_0047791 3300048912 Bacteria 3892
1540 Ga0496109_0191061 3300048912 Bacteria 1924
1541 Ga0496109_0695593 3300048912 Unclassified 954
1542 Ga0496109_0918766 3300048912 Unclassified 813
1543 Ga0496109_0946322 3300048912 Bacteria 799
1544 Ga0496109_0981085 3300048912 Bacteria 783
1545 Ga0496109_1251534 3300048912 Bacteria 678
1546 Ga0496110_0075740 3300048913 Unclassified 2990
1547 Ga0496110_0296495 3300048913 Bacteria 1473
1548 Ga0496110_0659094 3300048913 Bacteria 947
1549 Ga0496110_0876725 3300048913 Unclassified 803
1550 Ga0496110_0886173 3300048913 Bacteria 798
1551 Ga0496110_1267542 3300048913 Bacteria 646
1552 Ga0496111_0004268 3300048914 Bacteria 9006
1553 Ga0496111_0465467 3300048914 Bacteria 932
1554 Ga0496111_0831968 3300048914 Unclassified 667
1555 Ga0496112_0013855 3300048915 Bacteria 7458
1556 Ga0496112_0015556 3300048915 Bacteria 7105
1557 Ga0496112_0071968 3300048915 Bacteria 3417
1558 Ga0496112_0098364 3300048915 Bacteria 2895
1559 Ga0496113_0159497 3300048916 Bacteria 1783
1560 Ga0496113_0247084 3300048916 Unclassified 1424
1561 Ga0496114_0475289 3300048917 Bacteria 1106
1562 Ga0496114_0704493 3300048917 Bacteria 885
1563 Ga0496115_0400137 3300048918 Bacteria 1114
1564 Ga0501290_049541 3300049513 Bacteria 651
1565 Ga0501292_010393 3300049515 Bacteria 1393
1566 Ga0501298_090819 3300049521 Bacteria 684
1567 Ga0501298_152566 3300049521 Bacteria 566
1568 Ga0501299_076430 3300049522 Bacteria 736
1569 Ga0501299_078419 3300049522 Bacteria 729
1570 Ga0501031_0019692 3300049568 Bacteria 4396
1571 Ga0501031_0256475 3300049568 Bacteria 1136
1572 Ga0501031_0931695 3300049568 Bacteria 556
1573 Ga0501031_0934858 3300049568 Bacteria 555
1574 Ga0501032_0004999 3300049569 Bacteria 9916
1575 Ga0501032_0694291 3300049569 Bacteria 645
1576 Ga0501032_0786466 3300049569 Bacteria 601
1577 Ga0501032_1061582 3300049569 Unclassified 508
1578 Ga0501033_0015872 3300049570 Bacteria 5705
1579 Ga0501033_0120675 3300049570 Bacteria 1903
1580 Ga0501033_0439337 3300049570 Bacteria 907
1581 Ga0501034_0030569 3300049571 Bacteria 5474
1582 Ga0501034_0264934 3300049571 Bacteria 1660
1583 Ga0501036_0116231 3300049572 Bacteria 2259
1584 Ga0501036_0123379 3300049572 Unclassified 2188
1585 Ga0501036_0603672 3300049572 Unclassified 910
1586 Ga0501036_1204717 3300049572 Unclassified 617
1587 Ga0501037_0001127 3300049573 Bacteria 19769
1588 Ga0501037_0374079 3300049573 Bacteria 980
1589 Ga0501038_0013949 3300049574 Bacteria 7324
1590 Ga0501038_0671562 3300049574 Bacteria 778
1591 Ga0501038_1061187 3300049574 Bacteria 593
1592 Ga0501038_1205273 3300049574 Bacteria 549
1593 Ga0501039_0057734 3300049575 Bacteria 3005
1594 Ga0501039_0063695 3300049575 Bacteria 2857
1595 Ga0501039_0530095 3300049575 Bacteria 924
1596 Ga0501039_0776006 3300049575 Unclassified 748
1597 Ga0501040_0058385 3300049576 Bacteria 2650
1598 Ga0501040_0062455 3300049576 Unclassified 2563
1599 Ga0501040_0535599 3300049576 Bacteria 845
1600 Ga0501041_0166506 3300049577 Unclassified 1379
1601 Ga0501041_0178462 3300049577 Bacteria 1329
1602 Ga0501041_0310929 3300049577 Bacteria 993
1603 Ga0501041_0354744 3300049577 Unclassified 927
1604 Ga0501041_0384141 3300049577 Bacteria 889
1605 Ga0501041_0751265 3300049577 Bacteria 625
1606 Ga0501042_0016296 3300049578 Bacteria 5101
1607 Ga0501042_0119920 3300049578 Bacteria 1894
1608 Ga0501042_0129668 3300049578 Bacteria 1817
1609 Ga0501042_0197529 3300049578 Bacteria 1451
1610 Ga0501042_0427028 3300049578 Unclassified 960
1611 Ga0501042_0722006 3300049578 Unclassified 725
1612 Ga0501043_0024660 3300049579 Bacteria 4716
1613 Ga0501046_0006725 3300049580 Bacteria 10153
1614 Ga0501046_0175117 3300049580 Bacteria 1607
1615 Ga0501046_0384806 3300049580 Bacteria 1015
1616 Ga0501046_0459502 3300049580 Unclassified 915
1617 Ga0501046_0774925 3300049580 Unclassified 673
1618 Ga0501047_0427432 3300049581 Bacteria 1155
1619 Ga0501047_0822502 3300049581 Bacteria 743
1620 Ga0501048_0002548 3300049582 Bacteria 13947
1621 Ga0501048_0072087 3300049582 Bacteria 2438
1622 Ga0501048_0807840 3300049582 Bacteria 674
1623 Ga0501048_1311366 3300049582 Bacteria 520
1624 Ga0501067_0026173 3300049583 Bacteria 3232
1625 Ga0501067_0226230 3300049583 Bacteria 1041
1626 Ga0501068_0005586 3300049584 Bacteria 6886
1627 Ga0501068_0133242 3300049584 Bacteria 1555
1628 Ga0501068_0415652 3300049584 Unclassified 868
1629 Ga0501068_0582244 3300049584 Bacteria 729
1630 Ga0501068_0625175 3300049584 Unclassified 702
1631 Ga0501069_0001932 3300049585 Bacteria 10352
1632 Ga0501069_0485892 3300049585 Bacteria 736
1633 Ga0501070_0331544 3300049586 Unclassified 1237
1634 Ga0501070_0373516 3300049586 Bacteria 1155
1635 Ga0501070_0659899 3300049586 Bacteria 830
1636 Ga0501071_0006948 3300049587 Bacteria 7386
1637 Ga0501071_0041374 3300049587 Bacteria 3300
1638 Ga0501071_0113637 3300049587 Unclassified 2003
1639 Ga0501071_0205914 3300049587 Bacteria 1479
1640 Ga0501071_0328115 3300049587 Unclassified 1163
1641 Ga0501071_0356064 3300049587 Bacteria 1114
1642 Ga0501071_0501268 3300049587 Bacteria 931
1643 Ga0501071_0585157 3300049587 Bacteria 858
1644 Ga0501071_0806519 3300049587 Unclassified 724
1645 Ga0501072_0005500 3300049588 Bacteria 9642
1646 Ga0501072_0021792 3300049588 Bacteria 4969
1647 Ga0501072_0040802 3300049588 Bacteria 3645
1648 Ga0501072_0100512 3300049588 Bacteria 2299
1649 Ga0501072_0185575 3300049588 Bacteria 1659
1650 Ga0501072_0447856 3300049588 Unclassified 1023
1651 Ga0501072_0504579 3300049588 Bacteria 957
1652 Ga0501072_0633781 3300049588 Unclassified 842
1653 Ga0501072_1027742 3300049588 Bacteria 642
1654 Ga0501073_0007678 3300049589 Bacteria 8004
1655 Ga0501074_0144805 3300049590 Bacteria 1699
1656 Ga0501074_0154803 3300049590 Bacteria 1638
1657 Ga0501074_0172546 3300049590 Bacteria 1543
1658 Ga0501074_0296551 3300049590 Bacteria 1148
1659 Ga0501074_0846886 3300049590 Bacteria 644
1660 Ga0501074_1152014 3300049590 Bacteria 544
1661 Ga0501075_0017217 3300049591 Bacteria 5218
1662 Ga0501075_0122515 3300049591 Unclassified 1979
1663 Ga0501075_0157999 3300049591 Bacteria 1729
1664 Ga0501075_0201873 3300049591 Bacteria 1516
1665 Ga0501075_0289581 3300049591 Unclassified 1248
1666 Ga0501075_0374163 3300049591 Bacteria 1086
1667 Ga0501075_0429149 3300049591 Bacteria 1008
1668 Ga0501075_1451817 3300049591 Bacteria 519
1669 Ga0501076_0007927 3300049592 Bacteria 7747
1670 Ga0501076_0009234 3300049592 Bacteria 7275
1671 Ga0501076_0036616 3300049592 Bacteria 3845
1672 Ga0501076_0117349 3300049592 Bacteria 2154
1673 Ga0501076_0218362 3300049592 Bacteria 1558
1674 Ga0501076_0237452 3300049592 Bacteria 1491
1675 Ga0501076_0418406 3300049592 Bacteria 1102
1676 Ga0501076_0434789 3300049592 Unclassified 1080
1677 Ga0501076_1087847 3300049592 Bacteria 658
1678 Ga0501077_0028951 3300049593 Bacteria 3521
1679 Ga0501077_0054757 3300049593 Bacteria 2533
1680 Ga0501077_0237298 3300049593 Unclassified 1159
1681 Ga0501077_0294832 3300049593 Unclassified 1033
1682 Ga0501077_0671826 3300049593 Bacteria 666
1683 Ga0501206_028303 3300049653 Bacteria 824
1684 Ga0501206_079269 3300049653 Bacteria 568
1685 Ga0501208_133450 3300049655 Bacteria 556
1686 Ga0501208_141474 3300049655 Bacteria 542
1687 Ga0501216_074990 3300049660 Bacteria 706
1688 Ga0501217_023110 3300049661 Bacteria 1479
1689 Ga0501217_153978 3300049661 Bacteria 689
1690 Ga0501230_128058 3300049667 Unclassified 566
1691 Ga0501233_051117 3300049668 Bacteria 1001
1692 Ga0501235_182674 3300049669 Unclassified 560
1693 Ga0501249_056402 3300049679 Bacteria 907
1694 Ga0501249_096774 3300049679 Unclassified 704
1695 Ga0501251_058834 3300049681 Bacteria 628
1696 Ga0501261_079394 3300049690 Unclassified 590
1697 Ga0501221_194961 3300049704 Unclassified 560
1698 Ga0501221_225019 3300049704 Unclassified 530
1699 Ga0501225_0061387 3300049705 Bacteria 1058
1700 Ga0501225_0129918 3300049705 Bacteria 754
1701 Ga0501225_0218441 3300049705 Unclassified 613
1702 Ga0501229_032336 3300049706 Unclassified 722
1703 Ga0501079_0011724 3300049741 Bacteria 6695
1704 Ga0501079_0017863 3300049741 Bacteria 5417
1705 Ga0501079_0038698 3300049741 Bacteria 3678
1706 Ga0501079_0075715 3300049741 Bacteria 2603
1707 Ga0501079_0152089 3300049741 Bacteria 1804
1708 Ga0501079_0465854 3300049741 Unclassified 993
1709 Ga0501079_0801357 3300049741 Unclassified 742
1710 Ga0501080_0006657 3300049742 Bacteria 10396
1711 Ga0501080_0039131 3300049742 Bacteria 4426
1712 Ga0501080_0274662 3300049742 Bacteria 1533
1713 Ga0501080_0354969 3300049742 Bacteria 1323
1714 Ga0501080_1079199 3300049742 Unclassified 694
1715 Ga0501081_0037516 3300049743 Bacteria 3307
1716 Ga0501081_0286786 3300049743 Bacteria 1206
1717 Ga0501081_0773542 3300049743 Bacteria 722
1718 Ga0501081_0872487 3300049743 Bacteria 678
1719 Ga0501081_1036182 3300049743 Unclassified 620
1720 Ga0501081_1093930 3300049743 Bacteria 603
1721 Ga0501083_0250708 3300049744 Bacteria 1152
1722 Ga0501263_029782 3300049760 Unclassified 766
1723 Ga0501265_028747 3300049762 Bacteria 790
1724 Ga0501268_100077 3300049765 Bacteria 620
1725 Ga0501268_108217 3300049765 Bacteria 603
1726 Ga0501270_167889 3300049767 Unclassified 511
1727 Ga0501273_023875 3300049770 Bacteria 841
1728 Ga0501273_050627 3300049770 Unclassified 634
1729 Ga0501273_090098 3300049770 Unclassified 520
1730 Ga0501278_002751 3300049774 Bacteria 1231
1731 Ga0501283_002559 3300049779 Bacteria 2366
1732 Ga0501035_0392553 3300049822 Bacteria 1155
1733 Ga0501035_0500863 3300049822 Unclassified 1000
1734 Ga0501044_0037752 3300049823 Bacteria 5047
1735 Ga0501045_0012920 3300049824 Bacteria 5887
1736 Ga0501045_0214377 3300049824 Bacteria 1434
1737 Ga0501045_0345994 3300049824 Bacteria 1106
1738 Ga0501045_0409933 3300049824 Bacteria 1008
1739 nmdc:mga03683_452_c1 3300050489 Bacteria 11849
1740 nmdc:mga03683_488177_c1 3300050489 Bacteria 595
1741 nmdc:mga03n38_224037_c1 3300050490 Bacteria 983
1742 nmdc:mga00v17_39025_c1 3300050491 Bacteria 2842
1743 nmdc:mga00v17_4277_c1 3300050491 Bacteria 7415
1744 nmdc:mga00v17_981812_c1 3300050491 Unclassified 532
1745 nmdc:mga0yw44_112495_c1 3300050492 Bacteria 1746
1746 nmdc:mga0yw44_266254_c1 3300050492 Bacteria 1143
1747 nmdc:mga0k408_26080_c1 3300050493 Bacteria 3312
1748 nmdc:mga0k408_735706_c1 3300050493 Archaea 577
1749 nmdc:mga06z11_216672_c1 3300050494 Bacteria 1117
1750 nmdc:mga06z11_35323_c1 3300050494 Bacteria 2460
1751 nmdc:mga06z11_86569_c1 3300050494 Bacteria 1693
1752 nmdc:mga06z11_86903_c1 3300050494 Bacteria 1690
1753 nmdc:mga04h51_139610_c1 3300050495 Bacteria 918
1754 nmdc:mga04h51_54595_c1 3300050495 Bacteria 1351
1755 nmdc:mga07m45_83926_c1 3300050496 Bacteria 1821
1756 nmdc:mga05p37_11236_c1 3300050507 Bacteria 10648
1757 nmdc:mga05p37_114819_c1 3300050507 Bacteria 3310
1758 nmdc:mga05p37_133187_c1 3300050507 Bacteria 3049
1759 nmdc:mga05p37_1507651_c1 3300050507 Bacteria 669
1760 nmdc:mga05p37_1697545_c1 3300050507 Unclassified 616
1761 nmdc:mga05p37_22768_c1 3300050507 Bacteria 7600
1762 nmdc:mga05p37_27332_c1 3300050507 Bacteria 6945
1763 nmdc:mga05p37_284869_c1 3300050507 Bacteria 1969
1764 nmdc:mga05p37_2902_c1 3300050507 Bacteria 19891
1765 nmdc:mga05p37_35902_c1 3300050507 Bacteria 6082
1766 nmdc:mga05p37_468614_c1 3300050507 Unclassified 1454
1767 nmdc:mga05p37_493208_c1 3300050507 Unclassified 1408
1768 nmdc:mga05p37_4944_c1 3300050507 Bacteria 15616
1769 nmdc:mga05p37_612047_c1 3300050507 Bacteria 1227
1770 nmdc:mga09592_1040230_c1 3300050508 Bacteria 683
1771 nmdc:mga09592_122139_c1 3300050508 Bacteria 2238
1772 nmdc:mga09592_148479_c1 3300050508 Bacteria 2022
1773 nmdc:mga09592_163553_c1 3300050508 Unclassified 1923
1774 nmdc:mga09592_231053_c1 3300050508 Bacteria 1603
1775 nmdc:mga09592_343125_c1 3300050508 Unclassified 1293
1776 nmdc:mga09592_39479_c1 3300050508 Bacteria 3965
1777 nmdc:mga09592_44087_c1 3300050508 Bacteria 3753
1778 nmdc:mga09592_496001_c1 3300050508 Unclassified 1051
1779 nmdc:mga09592_50798_c1 3300050508 Bacteria 3497
1780 nmdc:mga09592_63814_c1 3300050508 Unclassified 3118
1781 nmdc:mga09592_65266_c1 3300050508 Bacteria 3083
1782 nmdc:mga09592_727698_c1 3300050508 Unclassified 843
1783 nmdc:mga09592_7497_c1 3300050508 Bacteria 8874
1784 nmdc:mga0qj67_1196400_c1 3300050509 Unclassified 591
1785 nmdc:mga0qj67_15122_c1 3300050509 Bacteria 5841
1786 nmdc:mga0qj67_19109_c1 3300050509 Bacteria 5233
1787 nmdc:mga0qj67_234750_c1 3300050509 Bacteria 1488
1788 nmdc:mga0qj67_438085_c1 3300050509 Unclassified 1053
1789 nmdc:mga0qj67_4391_c1 3300050509 Bacteria 10212
1790 nmdc:mga0qj67_45269_c1 3300050509 Bacteria 3472
1791 nmdc:mga0qj67_5816_c1 3300050509 Bacteria 9026
1792 nmdc:mga0qj67_586615_c1 3300050509 Bacteria 892
1793 nmdc:mga0qj67_8912_c1 3300050509 Bacteria 7444
1794 nmdc:mga0qj67_907673_c1 3300050509 Unclassified 694
1795 nmdc:mga0qj67_99893_c1 3300050509 Bacteria 2339
1796 nmdc:mga06r32_130743_c1 3300050510 Bacteria 2482
1797 nmdc:mga06r32_1335807_c1 3300050510 Bacteria 660
1798 nmdc:mga06r32_143512_c1 3300050510 Bacteria 2365
1799 nmdc:mga06r32_15953_c1 3300050510 Bacteria 6834
1800 nmdc:mga06r32_179600_c1 3300050510 Unclassified 2102
1801 nmdc:mga06r32_186462_c1 3300050510 Bacteria 2061
1802 nmdc:mga06r32_212762_c1 3300050510 Bacteria 1921
1803 nmdc:mga06r32_22813_c1 3300050510 Bacteria 5789
1804 nmdc:mga06r32_247392_c1 3300050510 Bacteria 1771
1805 nmdc:mga06r32_286626_c1 3300050510 Bacteria 1634
1806 nmdc:mga06r32_46488_c1 3300050510 Bacteria 4141
1807 nmdc:mga06r32_589509_c1 3300050510 Bacteria 1083
1808 nmdc:mga06r32_625364_c1 3300050510 Bacteria 1046
1809 nmdc:mga06r32_671709_c1 3300050510 Bacteria 1003
1810 nmdc:mga06r32_7339_c1 3300050510 Bacteria 9917
1811 nmdc:mga06r32_75087_c1 3300050510 Unclassified 3279
1812 nmdc:mga06r32_778904_c1 3300050510 Bacteria 918
1813 nmdc:mga06r32_826150_c1 3300050510 Unclassified 886
1814 nmdc:mga08y16_1372135_c1 3300050511 Bacteria 671
1815 nmdc:mga08y16_1421_c1 3300050511 Bacteria 24035
1816 nmdc:mga08y16_16043_c1 3300050511 Bacteria 7875
1817 nmdc:mga08y16_22405_c1 3300050511 Bacteria 6668
1818 nmdc:mga08y16_26977_c1 3300050511 Bacteria 6054
1819 nmdc:mga08y16_298163_c1 3300050511 Unclassified 1662
1820 nmdc:mga08y16_362422_c1 3300050511 Bacteria 1488
1821 nmdc:mga08y16_4008_c1 3300050511 Bacteria 15354
1822 nmdc:mga08y16_573375_c1 3300050511 Bacteria 1140
1823 nmdc:mga08y16_790720_c1 3300050511 Bacteria 942
1824 nmdc:mga08y16_810204_c1 3300050511 Bacteria 929
1825 nmdc:mga08y16_838545_c1 3300050511 Bacteria 909
1826 nmdc:mga08y16_964441_c1 3300050511 Unclassified 835
1827 nmdc:mga0n895_1036812_c1 3300050512 Unclassified 800
1828 nmdc:mga0n895_134147_c1 3300050512 Bacteria 2502
1829 nmdc:mga0n895_1630891_c1 3300050512 Bacteria 609
1830 nmdc:mga0n895_17240_c1 3300050512 Bacteria 6655
1831 nmdc:mga0n895_21135_c1 3300050512 Bacteria 6082
1832 nmdc:mga0n895_230292_c1 3300050512 Unclassified 1881
1833 nmdc:mga0n895_300669_c1 3300050512 Bacteria 1627
1834 nmdc:mga0n895_61517_c1 3300050512 Bacteria 3707
1835 nmdc:mga0n895_744010_c1 3300050512 Bacteria 974
1836 nmdc:mga0n895_883963_c1 3300050512 Bacteria 880
1837 nmdc:mga0rr50_1072245_c1 3300050513 Bacteria 686
1838 nmdc:mga0rr50_119107_c1 3300050513 Unclassified 2099
1839 nmdc:mga0rr50_211373_c1 3300050513 Bacteria 1598
1840 nmdc:mga0rr50_27802_c1 3300050513 Bacteria 3966
1841 nmdc:mga0rr50_28541_c1 3300050513 Bacteria 3923
1842 nmdc:mga0rr50_474019_c1 3300050513 Bacteria 1063
1843 nmdc:mga0rr50_49805_c1 3300050513 Bacteria 3102
1844 nmdc:mga0rr50_924602_c1 3300050513 Bacteria 744
1845 nmdc:mga08x19_1369749_c1 3300050514 Unclassified 501
1846 nmdc:mga08x19_40093_c1 3300050514 Bacteria 2980
1847 nmdc:mga0a205_13670_c1 3300050515 Bacteria 7563
1848 nmdc:mga0a205_1425727_c1 3300050515 Bacteria 540
1849 nmdc:mga0a205_1747_c1 3300050515 Bacteria 18788
1850 nmdc:mga0a205_218689_c1 3300050515 Bacteria 1791
1851 nmdc:mga0a205_35325_c1 3300050515 Bacteria 4461
1852 nmdc:mga0a205_400297_c1 3300050515 Bacteria 1237
1853 nmdc:mga0a205_475691_c1 3300050515 Bacteria 1108
1854 nmdc:mga0a205_5305_c1 3300050515 Bacteria 7720
1855 nmdc:mga0a205_77849_c2 3300050515 Bacteria 2457
1856 nmdc:mga0a205_78094_c1 3300050515 Bacteria 2621
1857 nmdc:mga0a205_88030_c1 3300050515 Bacteria 3001
1858 nmdc:mga0sz30_52699_c1 3300050516 Bacteria 1727
1859 Ga0495601_0026558 3300053077 Unclassified 3576
1860 Ga0495601_0046700 3300053077 Bacteria 2726
1861 Ga0495601_0683636 3300053077 Bacteria 655
1862 Ga0495612_0538904 3300053078 Bacteria 537
1863 Ga0495655_0165365 3300053083 Bacteria 705
1864 Ga0495619_0225593 3300053085 Bacteria 1298
1865 Ga0495619_0593098 3300053085 Unclassified 758
1866 Ga0500555_001190 3300053103 Bacteria 8504
1867 Ga0500628_111008 3300053129 Bacteria 735
1868 Ga0500628_163595 3300053129 Unclassified 628
1869 Ga0500616_0000529 3300053153 Bacteria 47940
1870 Ga0500627_0495501 3300053158 Bacteria 509
1871 Ga0500645_000293 3300053730 Bacteria 35759
1872 Ga0501084_0034752 3300054114 Bacteria 4215
1873 Ga0501084_0095716 3300054114 Bacteria 2494
1874 Ga0501084_0098812 3300054114 Unclassified 2451
1875 Ga0501084_0126087 3300054114 Bacteria 2154
1876 Ga0501084_0211315 3300054114 Bacteria 1637
1877 Ga0501084_0317402 3300054114 Bacteria 1316
1878 Ga0501084_0570793 3300054114 Bacteria 956
1879 Ga0501084_1755963 3300054114 Bacteria 518
1880 Ga0590071_000101 3300059421 Bacteria 24284
1881 Ga0590071_000336 3300059421 Bacteria 13755
1882 Ga0590071_009812 3300059421 Unclassified 2245
1883 Ga0590071_039441 3300059421 Bacteria 1135
1884 Ga0590071_069613 3300059421 Unclassified 867
1885 Ga0590074_000047 3300059423 Bacteria 11980
1886 Ga0590074_001254 3300059423 Bacteria 4027
1887 Ga0590074_061513 3300059423 Unclassified 698
1888 Ga0590075_001041 3300059424 Bacteria 7156
1889 Ga0590075_002157 3300059424 Bacteria 4732
1890 Ga0590075_040025 3300059424 Bacteria 1196
1891 Ga0590077_000084 3300059426 Bacteria 23941
1892 Ga0590077_000329 3300059426 Bacteria 13446
1893 Ga0501082_0038890 3300060353 Bacteria 4103
1894 Ga0501082_0162597 3300060353 Unclassified 1940
1895 Ga0501082_0168109 3300060353 Unclassified 1906
1896 Ga0501082_0179052 3300060353 Bacteria 1844
1897 Ga0501082_0513243 3300060353 Unclassified 1048
1898 Ga0501082_1221285 3300060353 Unclassified 657
1899 Ga0530510_0000953 3300061734 Bacteria 19095
1900 Ga0530510_0014707 3300061734 Bacteria 5524
1901 Ga0530510_0203591 3300061734 Unclassified 1471
1902 Ga0530510_0268348 3300061734 Bacteria 1273
1903 Ga0530510_0530658 3300061734 Bacteria 893
1904 Ga0530510_0779137 3300061734 Bacteria 729
1905 Ga0070674_101675223
1906 ARSoilOldRDRAFT_c020637
1907 JGI24746J21847_1006920
1908 JGI24750J21931_1024926
1909 JGI24745J21846_1023412
1910 JGI24749J21850_1076484
1911 JGI24035J26624_1024272
1912 JGI24033J26618_1003820
1913 JGI24033J26618_1028540
1914 JGI24034J26672_10117660
1915 JGI24742J22300_10085476
1916 JGI24742J22300_10116928
1917 JGI24751J29686_10077786
1918 JGI24751J29686_10121676
1919 JGI24751J29686_10137735
1920 Ga0058859_11527305
1921 Ga0058860_11945108
1922 Ga0065714_10317131
1923 Ga0065714_10372059
1924 Ga0065704_10448172
1925 Ga0065704_10864364
1926 Ga0065712_10000775
1927 Ga0065712_10012333
1928 Ga0065712_10115560
1929 Ga0065712_10168983
1930 Ga0065712_10170177
1931 Ga0065712_10201384
1932 Ga0065712_10235507
1933 Ga0065712_10377769
1934 Ga0065712_10527480
1935 Ga0065715_10001070
1936 Ga0065715_10009998
1937 Ga0065715_10029765
1938 Ga0065715_10033698
1939 Ga0065715_10126661
1940 Ga0065715_10176037
1941 Ga0065715_10215752
1942 Ga0065715_10223288
1943 Ga0065715_10363450
1944 Ga0065715_10436698
1945 Ga0065715_10656521
1946 Ga0065715_10765485
1947 Ga0065715_10870389
1948 Ga0065715_10935636
1949 Ga0065707_10098873
1950 Ga0065707_10114639
1951 Ga0065707_10141208
1952 Ga0065707_10162916
1953 Ga0065707_10187785
1954 Ga0065707_10337811
1955 Ga0065707_10528200
1956 Ga0065707_10792263
1957 Ga0070676_10005668
1958 Ga0070676_10008405
1959 Ga0070676_10014235
1960 Ga0070676_10157544
1961 Ga0070676_10311852
1962 Ga0070676_10625560
1963 Ga0070676_11076418
1964 Ga0070683_100012700
1965 Ga0070683_100028485
1966 Ga0070683_101492807
1967 Ga0070690_100001367
1968 Ga0070690_100138636
1969 Ga0070690_100199496
1970 Ga0070690_100293840
1971 Ga0070690_100463396
1972 Ga0070690_100664152
1973 Ga0070670_100001056
1974 Ga0070670_100003418
1975 Ga0070670_100011917
1976 Ga0070670_100014644
1977 Ga0070670_100026445
1978 Ga0070670_100176707
1979 Ga0070670_100260554
1980 Ga0070670_100270920
1981 Ga0070670_100551870
1982 Ga0070670_100580087
1983 Ga0070670_101144369
1984 Ga0070670_101781279
1985 Ga0070677_10001098
1986 Ga0070677_10060979
1987 Ga0068869_100012287
1988 Ga0068869_100029336
1989 Ga0068869_100052708
1990 Ga0068869_100164584
1991 Ga0068869_100337876
1992 Ga0068869_100683836
1993 Ga0068869_100772395
1994 Ga0068869_101088818
1995 Ga0070666_10004920
1996 Ga0070666_10004925
1997 Ga0070666_10105649
1998 Ga0070666_10209687
1999 Ga0070666_10373478
2000 Ga0070666_10925786
2001 Ga0070666_10967852
2002 Ga0070680_100371989
2003 Ga0070680_100534839
2004 Ga0070680_100851949
2005 Ga0068868_100026032
2006 Ga0068868_100051760
2007 Ga0068868_100063469
2008 Ga0068868_100183316
2009 Ga0068868_100361891
2010 Ga0068868_100601652
2011 Ga0068868_100613978
2012 Ga0070689_100009831
2013 Ga0070689_100012440
2014 Ga0070689_100013722
2015 Ga0070689_100261171
2016 Ga0070689_100287319
2017 Ga0070689_101851251
2018 Ga0070691_10017999
2019 Ga0070691_10109418
2020 Ga0070691_11075113
2021 Ga0070687_100002563
2022 Ga0070687_100956309
2023 Ga0070661_100035901
2024 Ga0070661_100073228
2025 Ga0070661_100500796
2026 Ga0070661_100693705
2027 Ga0070661_101258851
2028 Ga0070692_10018548
2029 Ga0070692_10591514
2030 Ga0070668_100025802
2031 Ga0070668_100077094
2032 Ga0070668_100252662
2033 Ga0070668_100411244
2034 Ga0070668_100745261
2035 Ga0070668_100912053
2036 Ga0070668_101578750
2037 Ga0070669_100003160
2038 Ga0070669_100004710
2039 Ga0070669_100007510
2040 Ga0070669_100081082
2041 Ga0070669_100125892
2042 Ga0070669_100194685
2043 Ga0070669_100209228
2044 Ga0070669_100279416
2045 Ga0070669_100305547
2046 Ga0070669_100553144
2047 Ga0070669_100916964
2048 Ga0070669_101192359
2049 Ga0070669_101283931
2050 Ga0070675_100000502
2051 Ga0070675_100003069
2052 Ga0070675_100041219
2053 Ga0070675_100048836
2054 Ga0070675_100145233
2055 Ga0070675_100185401
2056 Ga0070675_100187537
2057 Ga0070675_100199568
2058 Ga0070675_100217107
2059 Ga0070675_100246104
2060 Ga0070675_100416211
2061 Ga0070675_101319585
2062 Ga0070675_101715054
2063 Ga0070675_101844339
2064 Ga0070671_100010260
2065 Ga0070671_100024040
2066 Ga0070671_100110296
2067 Ga0070671_100118277
2068 Ga0070671_100202966
2069 Ga0070671_100466625
2070 Ga0070671_100747456
2071 Ga0070674_100001237
2072 Ga0070674_100010170
2073 Ga0070674_100018217
2074 Ga0070674_100020127
2075 Ga0070674_100058419
2076 Ga0070674_100131325
2077 Ga0070674_100176053
2078 Ga0070674_100246787
2079 Ga0070674_100413629
2080 Ga0070674_100454421
2081 Ga0070674_101494348
2082 Ga0070673_100005561
2083 Ga0070673_100046195
2084 Ga0070673_100070450
2085 Ga0070673_100105269
2086 Ga0070673_100131442
2087 Ga0070673_100506332
2088 Ga0070673_100506353
2089 Ga0070673_101220851
2090 Ga0070688_100030480
2091 Ga0070688_100061437
2092 Ga0070688_100062720
2093 Ga0070688_100087397
2094 Ga0070688_100199789
2095 Ga0070688_100236770
2096 Ga0070688_100283533
2097 Ga0070688_100703084
2098 Ga0070688_101190390
2099 Ga0070659_100211607
2100 Ga0070659_100660524
2101 Ga0070659_101703495
2102 Ga0070667_100026061
2103 Ga0070667_100296295
2104 Ga0070667_100644923
2105 Ga0070703_10018391
2106 Ga0070703_10326271
2107 Ga0070703_10516218
2108 Ga0070701_10008872
2109 Ga0070701_10013648
2110 Ga0070701_10020213
2111 Ga0070701_10033554
2112 Ga0070701_10132863
2113 Ga0070701_10196455
2114 Ga0070701_10208892
2115 Ga0070701_10289827
2116 Ga0070701_10725795
2117 Ga0070705_100003386
2118 Ga0070705_100021073
2119 Ga0070705_100038561
2120 Ga0070705_100106277
2121 Ga0070705_100112868
2122 Ga0070705_100113714
2123 Ga0070705_100291587
2124 Ga0070705_100736792
2125 Ga0070705_101305640
2126 Ga0070700_100007080
2127 Ga0070700_100012620
2128 Ga0070700_100038066
2129 Ga0070700_100057171
2130 Ga0070700_100099421
2131 Ga0070700_100213178
2132 Ga0070700_100328204
2133 Ga0070700_100432690
2134 Ga0070700_100531037
2135 Ga0070700_100578188
2136 Ga0070700_100595061
2137 Ga0070694_100013503
2138 Ga0070694_100014816
2139 Ga0070694_100134230
2140 Ga0070694_100200845
2141 Ga0070694_100533792
2142 Ga0070694_101183803
2143 Ga0070694_101804888
2144 Ga0070708_100953576
2145 Ga0070663_100043507
2146 Ga0070663_100191003
2147 Ga0070663_101100873
2148 Ga0070663_101481456
2149 Ga0070663_101720232
2150 Ga0070663_101935265
2151 Ga0070678_100019903
2152 Ga0070678_100087016
2153 Ga0070678_100154203
2154 Ga0070678_100205398
2155 Ga0070678_101012876
2156 Ga0070678_101112991
2157 Ga0070678_101483653
2158 Ga0070662_100021377
2159 Ga0070662_100171151
2160 Ga0070662_100258788
2161 Ga0070662_100388408
2162 Ga0070662_100389733
2163 Ga0070662_100415852
2164 Ga0070662_100520832
2165 Ga0070662_101597035
2166 Ga0068867_100002404
2167 Ga0068867_100098587
2168 Ga0068867_100141719
2169 Ga0068867_100174438
2170 Ga0068867_100202972
2171 Ga0068867_100295913
2172 Ga0068867_100302571
2173 Ga0068867_100389991
2174 Ga0068867_100706954
2175 Ga0068867_100756257
2176 Ga0068867_101398937
2177 Ga0068867_101534951
2178 Ga0070685_10042272
2179 Ga0070685_10093149
2180 Ga0070685_10095899
2181 Ga0070685_10177467
2182 Ga0070685_10252329
2183 Ga0070706_100077287
2184 Ga0070706_100102584
2185 Ga0070707_100044771
2186 Ga0070707_100399187
2187 Ga0070707_102162271
2188 Ga0070698_100059421
2189 Ga0070698_100129763
2190 Ga0070698_100320405
2191 Ga0070698_100469297
2192 Ga0070699_100000937
2193 Ga0070699_100005227
2194 Ga0070699_100018475
2195 Ga0070699_100037639
2196 Ga0070699_100102803
2197 Ga0070699_100553478
2198 Ga0070699_101769376
2199 Ga0070679_101623948
2200 Ga0070684_100005319
2201 Ga0070684_100572681
2202 Ga0070684_100963693
2203 Ga0070684_101411069
2204 Ga0070697_100039196
2205 Ga0070697_101161873
2206 Ga0068853_101077282
2207 Ga0068853_101574083
2208 Ga0070672_100019741
2209 Ga0070672_100028590
2210 Ga0070672_100049657
2211 Ga0070672_100082515
2212 Ga0070672_100113382
2213 Ga0070672_100129890
2214 Ga0070672_100277951
2215 Ga0070672_100296448
2216 Ga0070672_100398192
2217 Ga0070672_100814984
2218 Ga0070672_100877871
2219 Ga0070672_101309036
2220 Ga0070686_100003121
2221 Ga0070686_100011544
2222 Ga0070686_100124546
2223 Ga0070686_100283134
2224 Ga0070686_100431468
2225 Ga0070686_100499251
2226 Ga0070686_100717507
2227 Ga0070695_100000182
2228 Ga0070695_100027508
2229 Ga0070695_100071115
2230 Ga0070695_100580507
2231 Ga0070695_101604067
2232 Ga0070696_100016048
2233 Ga0070696_100016512
2234 Ga0070696_100126621
2235 Ga0070696_100145134
2236 Ga0070696_100500007
2237 Ga0070693_100012094
2238 Ga0070693_100017627
2239 Ga0070693_100969899
2240 Ga0070665_100004472
2241 Ga0070665_100039569
2242 Ga0070665_100051301
2243 Ga0070665_100718622
2244 Ga0070704_100000072
2245 Ga0070704_100001134
2246 Ga0070704_100010082
2247 Ga0070704_100012184
2248 Ga0070704_100019061
2249 Ga0070704_100070530
2250 Ga0070704_100188351
2251 Ga0070704_100253819
2252 Ga0070704_100289930
2253 Ga0070704_100401331
2254 Ga0070704_100483383
2255 Ga0070704_100593529
2256 Ga0070704_100677745
2257 Ga0068855_100439046
2258 Ga0070664_100007496
2259 Ga0070664_100009434
2260 Ga0070664_100020954
2261 Ga0070664_100073756
2262 Ga0070664_100109493
2263 Ga0070664_100190945
2264 Ga0070664_100250947
2265 Ga0070664_100356734
2266 Ga0070664_100862736
2267 Ga0070664_101043680
2268 Ga0070664_101900868
2269 Ga0068857_100024374
2270 Ga0068857_100051939
2271 Ga0068857_100081857
2272 Ga0068857_100215773
2273 Ga0068857_100355069
2274 Ga0068857_100704045
2275 Ga0068857_100830788
2276 Ga0068857_100978096
2277 Ga0068857_101927961
2278 Ga0068854_100024563
2279 Ga0068854_100077444
2280 Ga0068854_100827211
2281 Ga0068854_101130639
2282 Ga0070702_100014380
2283 Ga0070702_100026067
2284 Ga0070702_100032348
2285 Ga0070702_100119827
2286 Ga0070702_100382459
2287 Ga0068852_100566576
2288 Ga0068852_102639636
2289 Ga0068859_100005205
2290 Ga0068859_100007562
2291 Ga0068859_100007755
2292 Ga0068859_100033302
2293 Ga0068859_100316127
2294 Ga0068859_100535674
2295 Ga0068859_100596850
2296 Ga0068859_100855329
2297 Ga0068859_100950010
2298 Ga0068859_101051931
2299 Ga0068859_101235910
2300 Ga0068859_101305215
2301 Ga0068864_100011350
2302 Ga0068864_100026714
2303 Ga0068864_100028503
2304 Ga0068864_100048189
2305 Ga0068864_100166745
2306 Ga0068864_100503402
2307 Ga0068864_100708571
2308 Ga0068864_100795811
2309 Ga0068864_101382335
2310 Ga0068866_10090978
2311 Ga0068866_10167730
2312 Ga0068866_10338679
2313 Ga0068866_10341313
2314 Ga0068861_100000239
2315 Ga0068861_100014721
2316 Ga0068861_100084340
2317 Ga0068861_100129061
2318 Ga0068861_100162454
2319 Ga0068861_100274539
2320 Ga0068861_100282164
2321 Ga0068861_100397006
2322 Ga0068861_100459097
2323 Ga0068861_100483623
2324 Ga0068861_100513865
2325 Ga0068861_100610290
2326 Ga0068861_100939516
2327 Ga0068861_101055615
2328 Ga0068851_10248815
2329 Ga0068851_10573325
2330 Ga0068870_10003677
2331 Ga0068870_10006313
2332 Ga0068870_10046545
2333 Ga0068870_10101013
2334 Ga0068870_10131258
2335 Ga0068870_10185451
2336 Ga0068870_10294494
2337 Ga0068870_10430009
2338 Ga0068863_100021570
2339 Ga0068863_100047013
2340 Ga0068863_100226327
2341 Ga0068863_100247865
2342 Ga0068863_100462798
2343 Ga0068858_100012319
2344 Ga0068858_100014103
2345 Ga0068858_100045281
2346 Ga0068858_100071743
2347 Ga0068858_100216705
2348 Ga0068858_100637644
2349 Ga0068858_100638201
2350 Ga0068858_101013755
2351 Ga0068858_101955661
2352 Ga0068858_102551206
2353 Ga0068860_100003239
2354 Ga0068860_100010475
2355 Ga0068860_100138759
2356 Ga0068860_100172637
2357 Ga0068860_100404359
2358 Ga0068860_100545826
2359 Ga0068860_100770055
2360 Ga0068860_101267007
2361 Ga0068860_101346835
2362 Ga0068862_100000540
2363 Ga0068862_100004222
2364 Ga0068862_100045653
2365 Ga0068862_100074049
2366 Ga0068862_100093928
2367 Ga0068862_100142852
2368 Ga0068862_100662335
2369 Ga0068862_100722121
2370 Ga0068862_101376138
2371 Ga0081455_10206486
2372 Ga0081538_10186823
2373 Ga0075365_10009426
2374 Ga0075365_10338996
2375 Ga0075368_10004232
2376 Ga0075368_10045410
2377 Ga0075368_10168945
2378 Ga0075363_100119107
2379 Ga0075364_10013927
2380 Ga0075364_10020344
2381 Ga0075364_10088018
2382 Ga0075432_10254567
2383 Ga0070715_10786534
2384 Ga0070712_100122546
2385 Ga0075362_10003449
2386 Ga0075362_10544573
2387 Ga0075367_10016079
2388 Ga0075367_10461787
2389 Ga0075367_10648119
2390 Ga0075366_10029281
2391 Ga0075366_10046686
2392 Ga0097621_100022373
2393 Ga0097621_100050969
2394 Ga0097621_100106966
2395 Ga0097621_100164275
2396 Ga0097621_100990110
2397 Ga0097621_101344127
2398 Ga0075370_10050245
2399 Ga0068871_100007573
2400 Ga0068871_100019826
2401 Ga0068871_100242448
2402 Ga0068871_100781496
2403 Ga0068871_100792729
2404 Ga0068871_100831379
2405 Ga0068871_101726884
2406 Ga0075428_100000131
2407 Ga0075428_100002180
2408 Ga0075428_100013531
2409 Ga0075428_100023551
2410 Ga0075428_100026076
2411 Ga0075428_100027620
2412 Ga0075428_100040836
2413 Ga0075428_100076697
2414 Ga0075428_100202157
2415 Ga0075428_100463463
2416 Ga0075428_100679837
2417 Ga0075428_102035199
2418 Ga0075430_100000946
2419 Ga0075430_100003944
2420 Ga0075430_100004795
2421 Ga0075430_100007269
2422 Ga0075430_100007760
2423 Ga0075430_100008077
2424 Ga0075430_100042648
2425 Ga0075430_100174026
2426 Ga0075430_100395860
2427 Ga0075430_100640134
2428 Ga0075430_100711615
2429 Ga0075430_101201792
2430 Ga0075431_100001520
2431 Ga0075431_100014267
2432 Ga0075431_100033361
2433 Ga0075431_100033995
2434 Ga0075431_100046844
2435 Ga0075431_100091842
2436 Ga0075431_100154554
2437 Ga0075431_100162065
2438 Ga0075431_100228688
2439 Ga0075431_100356258
2440 Ga0075431_100647008
2441 Ga0075431_100647621
2442 Ga0075431_100849997
2443 Ga0075431_101895670
2444 Ga0075433_10014906
2445 Ga0075433_10061592
2446 Ga0075433_10068578
2447 Ga0075433_10082154
2448 Ga0075433_10148108
2449 Ga0075433_10158463
2450 Ga0075433_10213926
2451 Ga0075433_10249561
2452 Ga0075433_10537474
2453 Ga0075434_100008967
2454 Ga0075434_100030333
2455 Ga0075434_100031190
2456 Ga0075434_100042013
2457 Ga0075434_100043313
2458 Ga0075434_100074921
2459 Ga0075434_100099044
2460 Ga0075434_100367429
2461 Ga0075434_100971041
2462 Ga0075434_102249446
2463 Ga0075434_102307476
2464 Ga0075429_100014314
2465 Ga0075429_100016994
2466 Ga0075429_100064406
2467 Ga0075429_100069968
2468 Ga0075429_100077831
2469 Ga0075429_100140731
2470 Ga0075429_100161149
2471 Ga0075429_100177863
2472 Ga0075429_100280218
2473 Ga0075429_100292204
2474 Ga0075429_100532339
2475 Ga0068865_100005245
2476 Ga0068865_100105098
2477 Ga0068865_100107524
2478 Ga0068865_100112679
2479 Ga0068865_101061520
2480 Ga0068865_101120404
2481 Ga0068865_102159524
2482 Ga0075436_100145695
2483 Ga0075436_100749751
2484 Ga0097620_100005205
2485 Ga0097620_100007562
2486 Ga0097620_100007754
2487 Ga0097620_100033302
2488 Ga0097620_100316109
2489 Ga0097620_100535662
2490 Ga0097620_100596811
2491 Ga0097620_100855269
2492 Ga0097620_100950026
2493 Ga0097620_101051764
2494 Ga0097620_101236133
2495 Ga0097620_101305101
2496 Ga0075435_100009189
2497 Ga0075435_100012169
2498 Ga0075435_100021458
2499 Ga0075435_100027554
2500 Ga0075435_100028428
2501 Ga0075435_100137368
2502 Ga0075435_100190796
2503 Ga0075435_100247296
2504 Ga0075435_100400302
2505 Ga0075435_100538514
2506 Ga0075435_101102717
2507 Ga0105244_10513098
2508 Ga0105250_10329423
2509 Ga0105240_10786168
2510 Ga0111539_10000496
2511 Ga0111539_10003605
2512 Ga0111539_10005340
2513 Ga0111539_10012002
2514 Ga0111539_10047580
2515 Ga0111539_10096204
2516 Ga0111539_10158323
2517 Ga0111539_10212397
2518 Ga0111539_10223251
2519 Ga0111539_10350387
2520 Ga0111539_10392151
2521 Ga0111539_10453806
2522 Ga0111539_11068868
2523 Ga0111539_11382167
2524 Ga0111539_11921817
2525 Ga0111539_12139684
2526 Ga0111539_12936762
2527 Ga0105245_10012577
2528 Ga0105245_10058993
2529 Ga0105245_10489407
2530 Ga0105245_10796727
2531 Ga0105245_10876826
2532 Ga0105245_11027259
2533 Ga0105247_10010152
2534 Ga0105247_10376399
2535 Ga0105247_10667321
2536 Ga0105247_10754140
2537 Ga0105247_11066701
2538 Ga0114129_10000636
2539 Ga0114129_10005356
2540 Ga0114129_10005578
2541 Ga0114129_10023854
2542 Ga0114129_10042630
2543 Ga0114129_10061500
2544 Ga0114129_10077143
2545 Ga0114129_10129848
2546 Ga0114129_10211013
2547 Ga0114129_10269383
2548 Ga0114129_10297152
2549 Ga0114129_10305015
2550 Ga0114129_10346419
2551 Ga0114129_10358724
2552 Ga0114129_10367352
2553 Ga0114129_10583288
2554 Ga0114129_10976957
2555 Ga0114129_12103244
2556 Ga0105243_10006928
2557 Ga0105243_10016206
2558 Ga0105243_10124386
2559 Ga0105243_10221767
2560 Ga0105243_10271327
2561 Ga0105243_10338037
2562 Ga0105243_10872494
2563 Ga0105243_11113324
2564 Ga0105243_11301612
2565 Ga0105243_11792539
2566 Ga0105243_12192747
2567 Ga0105241_10258397
2568 Ga0105241_11110690
2569 Ga0105241_11175998
2570 Ga0105242_10003771
2571 Ga0105242_10079797
2572 Ga0105242_10157812
2573 Ga0105242_10163055
2574 Ga0105242_10334599
2575 Ga0105242_10525498
2576 Ga0105242_10786086
2577 Ga0105242_10807788
2578 Ga0105248_10014701
2579 Ga0105248_10031522
2580 Ga0105248_10133687
2581 Ga0105248_10150508
2582 Ga0105248_10193937
2583 Ga0105248_10206360
2584 Ga0105248_10285667
2585 Ga0105248_10322531
2586 Ga0105248_10436459
2587 Ga0105248_10480394
2588 Ga0105248_10529979
2589 Ga0105248_10583482
2590 Ga0105248_10587489
2591 Ga0105248_11044867
2592 Ga0105248_11187615
2593 Ga0105248_11417563
2594 Ga0105248_12134243
2595 Ga0105248_12545347
2596 Ga0105248_13113854
2597 Ga0105237_10076309
2598 Ga0105237_11412279
2599 Ga0105237_11750603
2600 Ga0105238_10383273
2601 Ga0105238_10677996
2602 Ga0105238_11094493
2603 Ga0105249_10001782
2604 Ga0105249_10001851
2605 Ga0105249_10010938
2606 Ga0105249_10100212
2607 Ga0105249_10126916
2608 Ga0105249_10186127
2609 Ga0105249_10429554
2610 Ga0105249_10443821
2611 Ga0105249_10509109
2612 Ga0105249_10760621
2613 Ga0105249_11189580
2614 Ga0105249_12083019
2615 Ga0105249_12899344
2616 Ga0105249_13210001
2617 Ga0105239_10306116
2618 Ga0105239_10752940
2619 Ga0105239_11493707
2620 Ga0105239_12373913
2621 Ga0105246_10067739
2622 Ga0105246_10097922
2623 Ga0105246_10233965
2624 Ga0105246_10432807
2625 Ga0105246_10812444
2626 Ga0105246_10929489
2627 Ga0105246_11287137
2628 Ga0105246_11752268
2629 Ga0105246_11808314
2630 Ga0105246_12089183
2631 Ga0105246_12188252
2632 Ga0157340_1029176
2633 Ga0157338_1032792
2634 Ga0157338_1050815
2635 Ga0157374_10021438
2636 Ga0157374_10048064
2637 Ga0157374_10066565
2638 Ga0157374_11034639
2639 Ga0157374_11362689
2640 Ga0157374_11574076
2641 Ga0157374_11683893
2642 Ga0157378_10394632
2643 Ga0157378_10650748
2644 Ga0157378_11074870
2645 Ga0157378_12351507
2646 Ga0157378_12580044
2647 Ga0163162_10004334
2648 Ga0163162_10152912
2649 Ga0163162_10182459
2650 Ga0163162_10713093
2651 Ga0157372_10955309
2652 Ga0157375_10007634
2653 Ga0157375_10073762
2654 Ga0157375_10367371
2655 Ga0157375_10391922
2656 Ga0157375_10494410
2657 Ga0157375_10497327
2658 Ga0157375_10594134
2659 Ga0157375_10781761
2660 Ga0157375_11041688
2661 Ga0157375_11113880
2662 Ga0157375_12235632
2663 Ga0163163_10000102
2664 Ga0163163_10024395
2665 Ga0163163_10036402
2666 Ga0163163_10036637
2667 Ga0163163_10053163
2668 Ga0163163_10104850
2669 Ga0163163_10151564
2670 Ga0163163_10240703
2671 Ga0163163_10486578
2672 Ga0163163_10555345
2673 Ga0163163_11009901
2674 Ga0163163_11465475
2675 Ga0163163_11751111
2676 Ga0157380_10004941
2677 Ga0157380_10076184
2678 Ga0157380_10117078
2679 Ga0157380_10146531
2680 Ga0157380_10446625
2681 Ga0157380_10630304
2682 Ga0157380_11089834
2683 Ga0157380_11358865
2684 Ga0157380_11521902
2685 Ga0157380_12580915
2686 Ga0157377_10002651
2687 Ga0157377_10030505
2688 Ga0157377_10051420
2689 Ga0157377_10054164
2690 Ga0157377_10116303
2691 Ga0157377_10149198
2692 Ga0157377_10177609
2693 Ga0157377_10217065
2694 Ga0157377_10404422
2695 Ga0157377_11335321
2696 Ga0157379_10024281
2697 Ga0157379_10046835
2698 Ga0157379_10147237
2699 Ga0157379_11368901
2700 Ga0157379_11621029
2701 Ga0157379_11936121
2702 Ga0157379_12029221
2703 Ga0157379_12212562
2704 Ga0157376_10012186
2705 Ga0157376_10019139
2706 Ga0157376_10044238
2707 Ga0157376_10090305
2708 Ga0157376_10250810
2709 Ga0157376_10453944
2710 Ga0157376_10989723
2711 Ga0157376_12007452
2712 Ga0182007_10036587
2713 Ga0163161_10049401
2714 Ga0163161_10482851
2715 Ga0163161_10538042
2716 Ga0163161_10913255
2717 Ga0207666_1046093
2718 Ga0207666_1059364
2719 Ga0207666_1082583
2720 Ga0207673_1012663
2721 Ga0207697_10000557
2722 Ga0207697_10000899
2723 Ga0207697_10110981
2724 Ga0207697_10148539
2725 Ga0207697_10250085
2726 Ga0207697_10305303
2727 Ga0207697_10512617
2728 Ga0207656_10189509
2729 Ga0207655_1219627
2730 Ga0207653_10127727
2731 Ga0207653_10319498
2732 Ga0207653_10366743
2733 Ga0207653_10367591
2734 Ga0207682_10000186
2735 Ga0207682_10014137
2736 Ga0207682_10040344
2737 Ga0207682_10060826
2738 Ga0207682_10335232
2739 Ga0207642_10017497
2740 Ga0207642_10087014
2741 Ga0207642_10172515
2742 Ga0207642_11002617
2743 Ga0207710_10725238
2744 Ga0207710_10737924
2745 Ga0207688_10000494
2746 Ga0207688_10001543
2747 Ga0207688_10018436
2748 Ga0207688_10032610
2749 Ga0207688_10108910
2750 Ga0207688_10282262
2751 Ga0207688_10669544
2752 Ga0207688_10715100
2753 Ga0207680_10057352
2754 Ga0207680_10147302
2755 Ga0207680_10194094
2756 Ga0207680_10366087
2757 Ga0207680_10584443
2758 Ga0207680_11033642
2759 Ga0207647_10134019
2760 Ga0207647_10359699
2761 Ga0207645_10002060
2762 Ga0207645_10020853
2763 Ga0207645_10066251
2764 Ga0207645_10148707
2765 Ga0207645_10191644
2766 Ga0207645_10280837
2767 Ga0207645_10296201
2768 Ga0207645_10590277
2769 Ga0207643_10003832
2770 Ga0207643_10005261
2771 Ga0207643_10009423
2772 Ga0207643_10017014
2773 Ga0207643_10020305
2774 Ga0207643_10024361
2775 Ga0207643_10069135
2776 Ga0207643_10220489
2777 Ga0207643_10298666
2778 Ga0207643_10492588
2779 Ga0207643_10881323
2780 Ga0207643_10914073
2781 Ga0207684_10138448
2782 Ga0207684_10865084
2783 Ga0207684_10867704
2784 Ga0207684_11134593
2785 Ga0207654_10226963
2786 Ga0207654_11400493
2787 Ga0207695_10521311
2788 Ga0207671_10534168
2789 Ga0207671_11142824
2790 Ga0207693_10129894
2791 Ga0207660_10193513
2792 Ga0207660_10209320
2793 Ga0207660_10896575
2794 Ga0207662_10002386
2795 Ga0207662_10005226
2796 Ga0207662_10033659
2797 Ga0207662_10049288
2798 Ga0207662_11140088
2799 Ga0207657_10314099
2800 Ga0207649_10065923
2801 Ga0207649_10144310
2802 Ga0207649_10510801
2803 Ga0207649_10580144
2804 Ga0207652_10776355
2805 Ga0207646_10044784
2806 Ga0207646_10267934
2807 Ga0207646_10411180
2808 Ga0207681_10004356
2809 Ga0207681_10026187
2810 Ga0207681_10038136
2811 Ga0207681_10074874
2812 Ga0207681_10083145
2813 Ga0207681_10087869
2814 Ga0207681_10112670
2815 Ga0207681_10174157
2816 Ga0207681_10264821
2817 Ga0207681_10309460
2818 Ga0207681_10315046
2819 Ga0207681_10658944
2820 Ga0207681_10897698
2821 Ga0207681_11006233
2822 Ga0207681_11175295
2823 Ga0207681_11856117
2824 Ga0207694_10441609
2825 Ga0207694_11073690
2826 Ga0207694_11362525
2827 Ga0207650_10011729
2828 Ga0207650_10025966
2829 Ga0207650_10043885
2830 Ga0207650_10046208
2831 Ga0207650_10047373
2832 Ga0207650_10079369
2833 Ga0207650_10089079
2834 Ga0207650_10499904
2835 Ga0207650_10709782
2836 Ga0207650_11245098
2837 Ga0207650_11435076
2838 Ga0207659_10000525
2839 Ga0207659_10001560
2840 Ga0207659_10010785
2841 Ga0207659_10015165
2842 Ga0207659_10028677
2843 Ga0207659_10090748
2844 Ga0207659_10137364
2845 Ga0207659_10170738
2846 Ga0207659_10175532
2847 Ga0207659_10183250
2848 Ga0207659_10346947
2849 Ga0207659_10395222
2850 Ga0207659_10426335
2851 Ga0207659_10464268
2852 Ga0207659_10692925
2853 Ga0207659_10790215
2854 Ga0207659_10933106
2855 Ga0207687_10020934
2856 Ga0207687_10043876
2857 Ga0207687_10216885
2858 Ga0207687_10244605
2859 Ga0207687_10361257
2860 Ga0207700_10077099
2861 Ga0207644_10013931
2862 Ga0207644_10049254
2863 Ga0207644_10078698
2864 Ga0207644_10146421
2865 Ga0207644_10163956
2866 Ga0207644_10419316
2867 Ga0207644_10618829
2868 Ga0207644_10876194
2869 Ga0207690_10426924
2870 Ga0207690_10636242
2871 Ga0207690_10700717
2872 Ga0207690_10834413
2873 Ga0207706_10002818
2874 Ga0207706_10023273
2875 Ga0207706_10070211
2876 Ga0207706_10074379
2877 Ga0207706_10089308
2878 Ga0207706_10498984
2879 Ga0207706_10615635
2880 Ga0207706_10917446
2881 Ga0207706_11121711
2882 Ga0207706_11229093
2883 Ga0207686_10022441
2884 Ga0207686_10082946
2885 Ga0207686_10260816
2886 Ga0207686_10285381
2887 Ga0207686_10735922
2888 Ga0207686_11471527
2889 Ga0207709_10098698
2890 Ga0207709_10207557
2891 Ga0207709_10618520
2892 Ga0207709_10721743
2893 Ga0207709_10730091
2894 Ga0207709_11052691
2895 Ga0207709_11523010
2896 Ga0207709_11773756
2897 Ga0207670_10006992
2898 Ga0207670_10008277
2899 Ga0207670_10013010
2900 Ga0207670_10132586
2901 Ga0207670_10260395
2902 Ga0207670_10401507
2903 Ga0207670_10912096
2904 Ga0207669_10008290
2905 Ga0207669_10011854
2906 Ga0207669_10025104
2907 Ga0207669_10107907
2908 Ga0207669_10225599
2909 Ga0207669_10234491
2910 Ga0207669_11314077
2911 Ga0207704_10124735
2912 Ga0207704_10128765
2913 Ga0207704_10822011
2914 Ga0207704_11161331
2915 Ga0207691_10000539
2916 Ga0207691_10031502
2917 Ga0207691_10033194
2918 Ga0207691_10051037
2919 Ga0207691_10057852
2920 Ga0207691_10083406
2921 Ga0207691_10098415
2922 Ga0207691_10220431
2923 Ga0207691_10291201
2924 Ga0207691_10319290
2925 Ga0207691_10630269
2926 Ga0207691_10685754
2927 Ga0207691_10724010
2928 Ga0207691_11002936
2929 Ga0207691_11393184
2930 Ga0207711_10053130
2931 Ga0207711_10069281
2932 Ga0207711_10087530
2933 Ga0207711_10133073
2934 Ga0207711_10271029
2935 Ga0207711_10334638
2936 Ga0207711_10347566
2937 Ga0207711_10496356
2938 Ga0207711_10546295
2939 Ga0207711_10552918
2940 Ga0207711_10796268
2941 Ga0207711_11051947
2942 Ga0207711_11450141
2943 Ga0207711_11904628
2944 Ga0207689_10000847
2945 Ga0207689_10017160
2946 Ga0207689_10050612
2947 Ga0207689_10074868
2948 Ga0207689_10099553
2949 Ga0207689_10136569
2950 Ga0207689_10229442
2951 Ga0207689_10236389
2952 Ga0207689_10941589
2953 Ga0207689_11178444
2954 Ga0207661_10018712
2955 Ga0207661_10068325
2956 Ga0207679_10054448
2957 Ga0207679_10057470
2958 Ga0207679_10080819
2959 Ga0207679_10102956
2960 Ga0207679_10218537
2961 Ga0207679_10233603
2962 Ga0207679_10326416
2963 Ga0207679_10383363
2964 Ga0207679_10521891
2965 Ga0207679_10850565
2966 Ga0207667_10923705
2967 Ga0207651_10039967
2968 Ga0207651_10076917
2969 Ga0207651_10219296
2970 Ga0207651_10225015
2971 Ga0207651_10550586
2972 Ga0207651_11118538
2973 Ga0207651_11715163
2974 Ga0207712_10005058
2975 Ga0207712_10005530
2976 Ga0207712_10007979
2977 Ga0207712_10165018
2978 Ga0207712_10201544
2979 Ga0207712_10281393
2980 Ga0207712_10384740
2981 Ga0207712_10459485
2982 Ga0207712_11801212
2983 Ga0207668_10071623
2984 Ga0207668_10087722
2985 Ga0207668_10097797
2986 Ga0207668_10301313
2987 Ga0207668_10526411
2988 Ga0207668_11082518
2989 Ga0207668_11191638
2990 Ga0207640_10092033
2991 Ga0207640_10180240
2992 Ga0207640_10265080
2993 Ga0207640_10356803
2994 Ga0207658_10085354
2995 Ga0207658_11657046
2996 Ga0207658_11935517
2997 Ga0207677_10007225
2998 Ga0207677_10123842
2999 Ga0207677_10136227
3000 Ga0207677_10280917
3001 Ga0207677_10588251
3002 Ga0207677_10602233
3003 Ga0207677_11588866
3004 Ga0207703_10008503
3005 Ga0207703_10037356
3006 Ga0207703_10090077
3007 Ga0207703_10191370
3008 Ga0207703_10413164
3009 Ga0207703_10416561
3010 Ga0207703_10627176
3011 Ga0207639_10420103
3012 Ga0207639_11843054
3013 Ga0207678_10053358
3014 Ga0207678_10075319
3015 Ga0207678_10223042
3016 Ga0207678_10672467
3017 Ga0207678_11116314
3018 Ga0207678_11557866
3019 Ga0207678_11623460
3020 Ga0207708_10003479
3021 Ga0207708_10008243
3022 Ga0207708_10019304
3023 Ga0207708_10019428
3024 Ga0207708_10034888
3025 Ga0207708_10093684
3026 Ga0207708_10115418
3027 Ga0207708_10209484
3028 Ga0207708_10364852
3029 Ga0207708_10425630
3030 Ga0207708_10681055
3031 Ga0207708_10949051
3032 Ga0207708_10975213
3033 Ga0207641_10169479
3034 Ga0207641_10170800
3035 Ga0207641_10322997
3036 Ga0207641_10376550
3037 Ga0207641_10709807
3038 Ga0207641_10825469
3039 Ga0207648_10004841
3040 Ga0207648_10005699
3041 Ga0207648_10012289
3042 Ga0207648_10014111
3043 Ga0207648_10088244
3044 Ga0207648_10181528
3045 Ga0207648_10228116
3046 Ga0207648_10254657
3047 Ga0207648_10299086
3048 Ga0207648_10300115
3049 Ga0207648_10714936
3050 Ga0207648_11586731
3051 Ga0207676_10013947
3052 Ga0207676_10039742
3053 Ga0207676_10100868
3054 Ga0207676_10144125
3055 Ga0207676_10400797
3056 Ga0207676_10511891
3057 Ga0207676_10729006
3058 Ga0207676_10741621
3059 Ga0207676_10798715
3060 Ga0207676_10811396
3061 Ga0207674_10015066
3062 Ga0207674_10016569
3063 Ga0207674_10192041
3064 Ga0207674_10302986
3065 Ga0207674_10417052
3066 Ga0207674_10608697
3067 Ga0207674_10857797
3068 Ga0207674_11620808
3069 Ga0207675_100000755
3070 Ga0207675_100010552
3071 Ga0207675_100031807
3072 Ga0207675_100079772
3073 Ga0207675_100140759
3074 Ga0207675_100186687
3075 Ga0207675_100253757
3076 Ga0207675_100256279
3077 Ga0207675_100947431
3078 Ga0207675_101105698
3079 Ga0207675_101408366
3080 Ga0207675_102376495
3081 Ga0207683_10014341
3082 Ga0207683_10129526
3083 Ga0207683_10176125
3084 Ga0207683_10212491
3085 Ga0207683_10257429
3086 Ga0207683_10514864
3087 Ga0207698_10037502
3088 Ga0209971_1043501
3089 Ga0209966_1080682
3090 Ga0209998_10039227
3091 Ga0209813_10050903
3092 Ga0209813_10076183
3093 Ga0209813_10101398
3094 Ga0209974_10070987
3095 Ga0209974_10092288
3096 Ga0207428_10001458
3097 Ga0207428_10006998
3098 Ga0207428_10016020
3099 Ga0207428_10017364
3100 Ga0207428_10027241
3101 Ga0207428_10046391
3102 Ga0207428_10252306
3103 Ga0207428_10564489
3104 Ga0268266_10001356
3105 Ga0268266_10027926
3106 Ga0268266_10226764
3107 Ga0268266_10818023
3108 Ga0268265_10002680
3109 Ga0268265_10011758
3110 Ga0268265_10026033
3111 Ga0268265_10057883
3112 Ga0268265_10201570
3113 Ga0268265_10281830
3114 Ga0268265_10284537
3115 Ga0268265_10393119
3116 Ga0268265_10399966
3117 Ga0268265_10972563
3118 Ga0268265_11113613
3119 Ga0268265_11639726
3120 Ga0268265_11654696
3121 Ga0268264_10011509
3122 Ga0268264_10078214
3123 Ga0268264_10118588
3124 Ga0268264_10201191
3125 Ga0268264_10311222
3126 Ga0268264_10571068
3127 Ga0307408_100002942
3128 Ga0307408_100005179
3129 Ga0307408_100019020
3130 Ga0307408_100194772
3131 Ga0307408_100240672
3132 Ga0307408_100264891
3133 Ga0307408_100287332
3134 Ga0307408_100394406
3135 Ga0307408_100435977
3136 Ga0307408_100495288
3137 Ga0307408_100895013
3138 Ga0307408_101015345
3139 Ga0307408_101213449
3140 Ga0307405_10000924
3141 Ga0307405_10504047
3142 Ga0307405_10664274
3143 Ga0307405_10678864
3144 Ga0307405_10692692
3145 Ga0307405_10866597
3146 Ga0307405_10954103
3147 Ga0307405_11130437
3148 Ga0307413_10009991
3149 Ga0307413_10011777
3150 Ga0307413_10021966
3151 Ga0307413_10291282
3152 Ga0307413_10838809
3153 Ga0307410_10005924
3154 Ga0307410_10077945
3155 Ga0307410_10229039
3156 Ga0307410_10262847
3157 Ga0307410_10318030
3158 Ga0307410_10412350
3159 Ga0307410_10855713
3160 Ga0307410_10904720
3161 Ga0307410_10989503
3162 Ga0307410_11535385
3163 Ga0307406_10006611
3164 Ga0307406_10163429
3165 Ga0307406_11366878
3166 Ga0307406_11511986
3167 Ga0307407_10002222
3168 Ga0307407_10021163
3169 Ga0307407_10301660
3170 Ga0307407_10477930
3171 Ga0307407_10621596
3172 Ga0307412_10018211
3173 Ga0307412_10027994
3174 Ga0307412_10149574
3175 Ga0307412_10364799
3176 Ga0307412_12009570
3177 Ga0307409_100003276
3178 Ga0307409_100125456
3179 Ga0307409_100234688
3180 Ga0307409_100239430
3181 Ga0307409_100371238
3182 Ga0307409_100432016
3183 Ga0307409_100474120
3184 Ga0307409_100596208
3185 Ga0307409_100702199
3186 Ga0307409_100949287
3187 Ga0307416_100059432
3188 Ga0307416_100061514
3189 Ga0307416_100081188
3190 Ga0307416_100224715
3191 Ga0307416_100227799
3192 Ga0307416_100238602
3193 Ga0307416_100336044
3194 Ga0307416_100388795
3195 Ga0307416_100409248
3196 Ga0307416_101014057
3197 Ga0307416_101444714
3198 Ga0307416_101535217
3199 Ga0307416_101570820
3200 Ga0307416_102139434
3201 Ga0307416_102392847
3202 Ga0307416_102462973
3203 Ga0307416_103417057
3204 Ga0307416_103575410
3205 Ga0307414_10004602
3206 Ga0307414_10205056
3207 Ga0307414_10366877
3208 Ga0307414_10477115
3209 Ga0307414_10479326
3210 Ga0307414_10659313
3211 Ga0307414_11249193
3212 Ga0307411_10001250
3213 Ga0307411_10032932
3214 Ga0307411_10273209
3215 Ga0307411_10391465
3216 Ga0307411_11699981
3217 Ga0307411_12127510
3218 Ga0307415_100090910
3219 Ga0307415_100114195
3220 Ga0307415_100182367
3221 Ga0307415_100247793
3222 Ga0307415_100969974
3223 Ga0307415_101521166
3224 Ga0307415_101942627
3225 Ga0373950_0029035
3226 Ga0373938_0080018
3227 Ga0373926_0400941
3228 Ga0373934_0055913
3229 Ga0373949_0071690
3230 Ga0373951_0055586
3231 Ga0373951_0250978
3232 Ga0373923_0417856
3233 Ga0373923_0501134
3234 Ga0373932_0004595
3235 Ga0373939_0010866
3236 Ga0373939_0224366
3237 Ga0373941_0039098
3238 Ga0373941_0286619
3239 Ga0373956_0097799
3240 Ga0373956_0326667
3241 Ga0373956_0343215
3242 Ga0373956_0599313
3243 Ga0373960_0144395
3244 Ga0373943_0519020
3245 Ga0373943_0594658
3246 Ga0373946_0588247
3247 Ga0373955_0464168
3248 Ga0373955_0680844
3249 Ga0373955_0873235
3250 Ga0373942_0354625
3251 Ga0373962_0043749
3252 Ga0373924_0041482
3253 Ga0373924_0084401
3254 Ga0373931_0035621
3255 Ga0373931_0052877
3256 Ga0373931_0217261
3257 Ga0373931_0335073
3258 Ga0373935_0419003
3259 Ga0373933_0399250
3260 Ga0373937_0025431
3261 Ga0373937_0498834
3262 Ga0373937_1501240
3263 Ga0373937_1521642
3264 Ga0373925_0819805
3265 Ga0373925_0821036
3266 Ga0395900_0878116
3267 Ga0395898_1340306
3268 Ga0242420_052163
3269 Ga0439436_0074786
3270 Ga0439439_0004932
3271 Ga0439453_0013175
3272 Ga0439461_0007768
3273 Ga0439461_0014950
3274 Ga0439461_0063965
3275 Ga0439461_0065707
3276 Ga0451795_1211245
3277 Ga0451798_0567307
3278 Ga0451800_0488747
3279 Ga0451800_1229364
3280 Ga0451802_0983452
3281 Ga0451802_0983820
3282 Ga0451802_1047813
3283 Ga0451802_1277372
3284 Ga0451807_2702473
3285 Ga0451845_0469777
3286 Ga0451849_0010536
3287 Ga0451853_0429604
3288 Ga0451853_0571654
3289 Ga0451853_3505640
3290 Ga0439431_0026650
3291 Ga0439431_0145949
3292 Ga0439433_0017302
3293 Ga0439433_0054741
3294 Ga0439433_0065055
3295 Ga0439437_055614
3296 Ga0439441_043832
3297 Ga0439443_108067
3298 Ga0439445_0126820
3299 Ga0439445_0142938
3300 Ga0439449_0246717
3301 Ga0439449_0416214
3302 Ga0439450_042689
3303 Ga0439451_133080
3304 Ga0439455_0027924
3305 Ga0439455_0161761
3306 Ga0439455_0167664
3307 Ga0439456_108702
3308 Ga0439457_096637
3309 Ga0439462_0047141
3310 Ga0439462_0059319
3311 Ga0439462_0173601
3312 Ga0439462_0260431
3313 Ga0450920_068512
3314 Ga0450920_144749
3315 Ga0450894_073941
3316 Ga0450896_080904
3317 Ga0450910_099347
3318 Ga0439446_0048598
3319 Ga0439446_0081900
3320 Ga0439446_0124704
3321 Ga0439446_0273916
3322 Ga0439446_0382644
3323 Ga0439458_0211912
3324 Ga0439434_0048017
3325 Ga0439434_0065672
3326 Ga0439434_0123886
3327 Ga0439434_0266382
3328 Ga0439435_0025603
3329 Ga0439435_0045608
3330 Ga0439435_0128033
3331 Ga0439435_0135589
3332 Ga0439435_0146953
3333 Ga0439435_0367807
3334 Ga0439444_0041154
3335 Ga0439444_0073418
3336 Ga0439444_0135708
3337 Ga0439444_0170611
3338 Ga0439459_0110878
3339 Ga0439459_0125430
3340 Ga0439464_0004244
3341 Ga0439464_0004625
3342 Ga0439464_0024872
3343 Ga0439464_0097717
3344 Ga0439464_0120321
3345 Ga0439460_0017095
3346 Ga0439460_0084401
3347 Ga0439460_0146311
3348 Ga0450893_0137390
3349 Ga0451577_0134250
3350 Ga0451577_0583124
3351 Ga0439440_0231207
3352 Ga0453683_0512372
3353 Ga0453683_0608827
3354 Ga0453683_1125672
3355 Ga0453684_0142552
3356 Ga0466960_0497773
3357 Ga0451576_0025937
3358 Ga0451576_0046822
3359 Ga0451576_0053959
3360 Ga0451576_0063125
3361 Ga0451576_0239444
3362 Ga0451576_0810841
3363 Ga0451576_1261760
3364 Ga0451576_1772249
3365 Ga0495592_0167128
3366 Ga0495592_0478136
3367 Ga0495603_0130248
3368 Ga0495603_0158961
3369 Ga0495629_0120736
3370 Ga0495629_0140272
3371 Ga0495582_0613179
3372 Ga0495639_0129813
3373 Ga0495662_0114404
3374 Ga0495585_0292895
3375 Ga0495594_0450431
3376 Ga0495618_0486751
3377 Ga0495628_0128520
3378 Ga0495628_0640076
3379 Ga0495630_0501505
3380 Ga0495643_0001260
3381 Ga0495640_0112897
3382 Ga0495586_0326111
3383 Ga0495586_0672634
3384 Ga0495598_0087950
3385 Ga0495598_0113752
3386 Ga0495609_0282182
3387 Ga0495621_0000636
3388 Ga0495621_0220108
3389 Ga0495621_0249737
3390 Ga0495597_0074140
3391 Ga0495645_0027106
3392 Ga0495667_0295863
3393 Ga0495667_0491551
3394 Ga0495656_0149170
3395 Ga0495656_0351256
3396 Ga0495634_0298622
3397 Ga0495635_0215356
3398 Ga0495635_0375167
3399 Ga0495659_0018453
3400 Ga0495659_0023986
3401 Ga0495659_0060110
3402 Ga0495599_0107869
3403 Ga0495647_0075468
3404 Ga0495658_0130855
3405 Ga0495658_0503329
3406 Ga0495613_0337369
3407 Ga0495613_0360306
3408 Ga0495649_0405865
3409 Ga0495581_0322807
3410 Ga0495636_0066258
3411 Ga0495674_0506281
3412 Ga0495676_0884280
3413 Ga0495680_0345333
3414 Ga0495684_0225238
3415 Ga0495684_0260600
3416 Ga0495684_0553477
3417 Ga0495684_0653752
3418 Ga0495593_0512694
3419 Ga0496100_0520517
3420 Ga0496101_0248769
3421 Ga0496101_1160840
3422 Ga0496101_1279141
3423 Ga0496102_0140567
3424 Ga0496102_0678002
3425 Ga0496102_0860485
3426 Ga0496103_0022770
3427 Ga0496104_0029430
3428 Ga0496104_0051939
3429 Ga0496104_0266364
3430 Ga0496104_0834358
3431 Ga0496105_0208692
3432 Ga0496105_0234817
3433 Ga0496105_0462038
3434 Ga0496106_0149353
3435 Ga0496106_0172626
3436 Ga0496106_0207750
3437 Ga0496106_0646341
3438 Ga0496107_0861191
3439 Ga0496108_0048269
3440 Ga0496108_0278533
3441 Ga0496108_0436958
3442 Ga0496109_0012204
3443 Ga0496109_0047791
3444 Ga0496109_0191061
3445 Ga0496109_0695593
3446 Ga0496109_0918766
3447 Ga0496109_0946322
3448 Ga0496109_0981085
3449 Ga0496109_1251534
3450 Ga0496110_0075740
3451 Ga0496110_0296495
3452 Ga0496110_0659094
3453 Ga0496110_0876725
3454 Ga0496110_0886173
3455 Ga0496110_1267542
3456 Ga0496111_0004268
3457 Ga0496111_0465467
3458 Ga0496111_0831968
3459 Ga0496112_0013855
3460 Ga0496112_0015556
3461 Ga0496112_0071968
3462 Ga0496112_0098364
3463 Ga0496113_0159497
3464 Ga0496113_0247084
3465 Ga0496114_0475289
3466 Ga0496114_0704493
3467 Ga0496115_0400137
3468 Ga0501290_049541
3469 Ga0501292_010393
3470 Ga0501298_090819
3471 Ga0501298_152566
3472 Ga0501299_076430
3473 Ga0501299_078419
3474 Ga0501031_0019692
3475 Ga0501031_0256475
3476 Ga0501031_0931695
3477 Ga0501031_0934858
3478 Ga0501032_0004999
3479 Ga0501032_0694291
3480 Ga0501032_0786466
3481 Ga0501032_1061582
3482 Ga0501033_0015872
3483 Ga0501033_0120675
3484 Ga0501033_0439337
3485 Ga0501034_0030569
3486 Ga0501034_0264934
3487 Ga0501036_0116231
3488 Ga0501036_0123379
3489 Ga0501036_0603672
3490 Ga0501036_1204717
3491 Ga0501037_0001127
3492 Ga0501037_0374079
3493 Ga0501038_0013949
3494 Ga0501038_0671562
3495 Ga0501038_1061187
3496 Ga0501038_1205273
3497 Ga0501039_0057734
3498 Ga0501039_0063695
3499 Ga0501039_0530095
3500 Ga0501039_0776006
3501 Ga0501040_0058385
3502 Ga0501040_0062455
3503 Ga0501040_0535599
3504 Ga0501041_0166506
3505 Ga0501041_0178462
3506 Ga0501041_0310929
3507 Ga0501041_0354744
3508 Ga0501041_0384141
3509 Ga0501041_0751265
3510 Ga0501042_0016296
3511 Ga0501042_0119920
3512 Ga0501042_0129668
3513 Ga0501042_0197529
3514 Ga0501042_0427028
3515 Ga0501042_0722006
3516 Ga0501043_0024660
3517 Ga0501046_0006725
3518 Ga0501046_0175117
3519 Ga0501046_0384806
3520 Ga0501046_0459502
3521 Ga0501046_0774925
3522 Ga0501047_0427432
3523 Ga0501047_0822502
3524 Ga0501048_0002548
3525 Ga0501048_0072087
3526 Ga0501048_0807840
3527 Ga0501048_1311366
3528 Ga0501067_0026173
3529 Ga0501067_0226230
3530 Ga0501068_0005586
3531 Ga0501068_0133242
3532 Ga0501068_0415652
3533 Ga0501068_0582244
3534 Ga0501068_0625175
3535 Ga0501069_0001932
3536 Ga0501069_0485892
3537 Ga0501070_0331544
3538 Ga0501070_0373516
3539 Ga0501070_0659899
3540 Ga0501071_0006948
3541 Ga0501071_0041374
3542 Ga0501071_0113637
3543 Ga0501071_0205914
3544 Ga0501071_0328115
3545 Ga0501071_0356064
3546 Ga0501071_0501268
3547 Ga0501071_0585157
3548 Ga0501071_0806519
3549 Ga0501072_0005500
3550 Ga0501072_0021792
3551 Ga0501072_0040802
3552 Ga0501072_0100512
3553 Ga0501072_0185575
3554 Ga0501072_0447856
3555 Ga0501072_0504579
3556 Ga0501072_0633781
3557 Ga0501072_1027742
3558 Ga0501073_0007678
3559 Ga0501074_0144805
3560 Ga0501074_0154803
3561 Ga0501074_0172546
3562 Ga0501074_0296551
3563 Ga0501074_0846886
3564 Ga0501074_1152014
3565 Ga0501075_0017217
3566 Ga0501075_0122515
3567 Ga0501075_0157999
3568 Ga0501075_0201873
3569 Ga0501075_0289581
3570 Ga0501075_0374163
3571 Ga0501075_0429149
3572 Ga0501075_1451817
3573 Ga0501076_0007927
3574 Ga0501076_0009234
3575 Ga0501076_0036616
3576 Ga0501076_0117349
3577 Ga0501076_0218362
3578 Ga0501076_0237452
3579 Ga0501076_0418406
3580 Ga0501076_0434789
3581 Ga0501076_1087847
3582 Ga0501077_0028951
3583 Ga0501077_0054757
3584 Ga0501077_0237298
3585 Ga0501077_0294832
3586 Ga0501077_0671826
3587 Ga0501206_028303
3588 Ga0501206_079269
3589 Ga0501208_133450
3590 Ga0501208_141474
3591 Ga0501216_074990
3592 Ga0501217_023110
3593 Ga0501217_153978
3594 Ga0501230_128058
3595 Ga0501233_051117
3596 Ga0501235_182674
3597 Ga0501249_056402
3598 Ga0501249_096774
3599 Ga0501251_058834
3600 Ga0501261_079394
3601 Ga0501221_194961
3602 Ga0501221_225019
3603 Ga0501225_0061387
3604 Ga0501225_0129918
3605 Ga0501225_0218441
3606 Ga0501229_032336
3607 Ga0501079_0011724
3608 Ga0501079_0017863
3609 Ga0501079_0038698
3610 Ga0501079_0075715
3611 Ga0501079_0152089
3612 Ga0501079_0465854
3613 Ga0501079_0801357
3614 Ga0501080_0006657
3615 Ga0501080_0039131
3616 Ga0501080_0274662
3617 Ga0501080_0354969
3618 Ga0501080_1079199
3619 Ga0501081_0037516
3620 Ga0501081_0286786
3621 Ga0501081_0773542
3622 Ga0501081_0872487
3623 Ga0501081_1036182
3624 Ga0501081_1093930
3625 Ga0501083_0250708
3626 Ga0501263_029782
3627 Ga0501265_028747
3628 Ga0501268_100077
3629 Ga0501268_108217
3630 Ga0501270_167889
3631 Ga0501273_023875
3632 Ga0501273_050627
3633 Ga0501273_090098
3634 Ga0501278_002751
3635 Ga0501283_002559
3636 Ga0501035_0392553
3637 Ga0501035_0500863
3638 Ga0501044_0037752
3639 Ga0501045_0012920
3640 Ga0501045_0214377
3641 Ga0501045_0345994
3642 Ga0501045_0409933
3643 nmdc:mga03683_452_c1
3644 nmdc:mga03683_488177_c1
3645 nmdc:mga03n38_224037_c1
3646 nmdc:mga00v17_39025_c1
3647 nmdc:mga00v17_4277_c1
3648 nmdc:mga00v17_981812_c1
3649 nmdc:mga0yw44_112495_c1
3650 nmdc:mga0yw44_266254_c1
3651 nmdc:mga0k408_26080_c1
3652 nmdc:mga0k408_735706_c1
3653 nmdc:mga06z11_216672_c1
3654 nmdc:mga06z11_35323_c1
3655 nmdc:mga06z11_86569_c1
3656 nmdc:mga06z11_86903_c1
3657 nmdc:mga04h51_139610_c1
3658 nmdc:mga04h51_54595_c1
3659 nmdc:mga07m45_83926_c1
3660 nmdc:mga05p37_11236_c1
3661 nmdc:mga05p37_114819_c1
3662 nmdc:mga05p37_133187_c1
3663 nmdc:mga05p37_1507651_c1
3664 nmdc:mga05p37_1697545_c1
3665 nmdc:mga05p37_22768_c1
3666 nmdc:mga05p37_27332_c1
3667 nmdc:mga05p37_284869_c1
3668 nmdc:mga05p37_2902_c1
3669 nmdc:mga05p37_35902_c1
3670 nmdc:mga05p37_468614_c1
3671 nmdc:mga05p37_493208_c1
3672 nmdc:mga05p37_4944_c1
3673 nmdc:mga05p37_612047_c1
3674 nmdc:mga09592_1040230_c1
3675 nmdc:mga09592_122139_c1
3676 nmdc:mga09592_148479_c1
3677 nmdc:mga09592_163553_c1
3678 nmdc:mga09592_231053_c1
3679 nmdc:mga09592_343125_c1
3680 nmdc:mga09592_39479_c1
3681 nmdc:mga09592_44087_c1
3682 nmdc:mga09592_496001_c1
3683 nmdc:mga09592_50798_c1
3684 nmdc:mga09592_63814_c1
3685 nmdc:mga09592_65266_c1
3686 nmdc:mga09592_727698_c1
3687 nmdc:mga09592_7497_c1
3688 nmdc:mga0qj67_1196400_c1
3689 nmdc:mga0qj67_15122_c1
3690 nmdc:mga0qj67_19109_c1
3691 nmdc:mga0qj67_234750_c1
3692 nmdc:mga0qj67_438085_c1
3693 nmdc:mga0qj67_4391_c1
3694 nmdc:mga0qj67_45269_c1
3695 nmdc:mga0qj67_5816_c1
3696 nmdc:mga0qj67_586615_c1
3697 nmdc:mga0qj67_8912_c1
3698 nmdc:mga0qj67_907673_c1
3699 nmdc:mga0qj67_99893_c1
3700 nmdc:mga06r32_130743_c1
3701 nmdc:mga06r32_1335807_c1
3702 nmdc:mga06r32_143512_c1
3703 nmdc:mga06r32_15953_c1
3704 nmdc:mga06r32_179600_c1
3705 nmdc:mga06r32_186462_c1
3706 nmdc:mga06r32_212762_c1
3707 nmdc:mga06r32_22813_c1
3708 nmdc:mga06r32_247392_c1
3709 nmdc:mga06r32_286626_c1
3710 nmdc:mga06r32_46488_c1
3711 nmdc:mga06r32_589509_c1
3712 nmdc:mga06r32_625364_c1
3713 nmdc:mga06r32_671709_c1
3714 nmdc:mga06r32_7339_c1
3715 nmdc:mga06r32_75087_c1
3716 nmdc:mga06r32_778904_c1
3717 nmdc:mga06r32_826150_c1
3718 nmdc:mga08y16_1372135_c1
3719 nmdc:mga08y16_1421_c1
3720 nmdc:mga08y16_16043_c1
3721 nmdc:mga08y16_22405_c1
3722 nmdc:mga08y16_26977_c1
3723 nmdc:mga08y16_298163_c1
3724 nmdc:mga08y16_362422_c1
3725 nmdc:mga08y16_4008_c1
3726 nmdc:mga08y16_573375_c1
3727 nmdc:mga08y16_790720_c1
3728 nmdc:mga08y16_810204_c1
3729 nmdc:mga08y16_838545_c1
3730 nmdc:mga08y16_964441_c1
3731 nmdc:mga0n895_1036812_c1
3732 nmdc:mga0n895_134147_c1
3733 nmdc:mga0n895_1630891_c1
3734 nmdc:mga0n895_17240_c1
3735 nmdc:mga0n895_21135_c1
3736 nmdc:mga0n895_230292_c1
3737 nmdc:mga0n895_300669_c1
3738 nmdc:mga0n895_61517_c1
3739 nmdc:mga0n895_744010_c1
3740 nmdc:mga0n895_883963_c1
3741 nmdc:mga0rr50_1072245_c1
3742 nmdc:mga0rr50_119107_c1
3743 nmdc:mga0rr50_211373_c1
3744 nmdc:mga0rr50_27802_c1
3745 nmdc:mga0rr50_28541_c1
3746 nmdc:mga0rr50_474019_c1
3747 nmdc:mga0rr50_49805_c1
3748 nmdc:mga0rr50_924602_c1
3749 nmdc:mga08x19_1369749_c1
3750 nmdc:mga08x19_40093_c1
3751 nmdc:mga0a205_13670_c1
3752 nmdc:mga0a205_1425727_c1
3753 nmdc:mga0a205_1747_c1
3754 nmdc:mga0a205_218689_c1
3755 nmdc:mga0a205_35325_c1
3756 nmdc:mga0a205_400297_c1
3757 nmdc:mga0a205_475691_c1
3758 nmdc:mga0a205_5305_c1
3759 nmdc:mga0a205_77849_c2
3760 nmdc:mga0a205_78094_c1
3761 nmdc:mga0a205_88030_c1
3762 nmdc:mga0sz30_52699_c1
3763 Ga0495601_0026558
3764 Ga0495601_0046700
3765 Ga0495601_0683636
3766 Ga0495612_0538904
3767 Ga0495655_0165365
3768 Ga0495619_0225593
3769 Ga0495619_0593098
3770 Ga0500555_001190
3771 Ga0500628_111008
3772 Ga0500628_163595
3773 Ga0500616_0000529
3774 Ga0500627_0495501
3775 Ga0500645_000293
3776 Ga0501084_0034752
3777 Ga0501084_0095716
3778 Ga0501084_0098812
3779 Ga0501084_0126087
3780 Ga0501084_0211315
3781 Ga0501084_0317402
3782 Ga0501084_0570793
3783 Ga0501084_1755963
3784 Ga0590071_000101
3785 Ga0590071_000336
3786 Ga0590071_009812
3787 Ga0590071_039441
3788 Ga0590071_069613
3789 Ga0590074_000047
3790 Ga0590074_001254
3791 Ga0590074_061513
3792 Ga0590075_001041
3793 Ga0590075_002157
3794 Ga0590075_040025
3795 Ga0590077_000084
3796 Ga0590077_000329
3797 Ga0501082_0038890
3798 Ga0501082_0162597
3799 Ga0501082_0168109
3800 Ga0501082_0179052
3801 Ga0501082_0513243
3802 Ga0501082_1221285
3803 Ga0530510_0000953
3804 Ga0530510_0014707
3805 Ga0530510_0203591
3806 Ga0530510_0268348
3807 Ga0530510_0530658
3808 Ga0530510_0779137

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

100

134

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.8145 1 109
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.7884 4 110
4ijj-assembly1.cif.gz_A structure of transcription factor dksa2 from pseudomonas aeruginosa 0.7608 4 110
4ijj-assembly3.cif.gz_C structure of transcription factor dksa2 from pseudomonas aeruginosa 0.744 4 110
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.7435 4 110
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7608 4 110 1.20.120.910
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7112 4 110 1.20.120.910
af_A0A2R8Q019_233_408_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6832 5 76 1.20.58.390
af_Q9U1I1_234_305_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.6639 78 111 2.10.110.10
af_P53709_217_324_3.90.530.10 Alpha Beta;Alpha-Beta Complex;Nucleotide Excision Repair Protein XPA (XPA-MBD); B Chain A;XPA C-terminal domain 0.6537 80 109 3.90.530.10
ID Description Score Start End GO Terms
AF-A0A535PE45-F1-model_v4 TraR/DksA family transcriptional regulator 0.8689 6 108 GO:0008270
AF-A0A0G3EFC3-F1-model_v4 General stress protein 16O 0.8663 2 108 GO:0000786
GO:0003677
GO:0006334
GO:0008270
GO:0030527
AF-A0A423LGG6-F1-model_v4 Uncharacterized protein 0.8647 3 110 GO:0008270
AF-A0A497EG63-F1-model_v4 Uncharacterized protein 0.8638 2 108 GO:0008270
AF-A0A7C5V9I4-F1-model_v4 Uncharacterized protein 0.8613 2 110 GO:0008270

Map