F496021
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1904 | 433 | 3808 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_101675223|Ga0070674_1016752231 |
| Length | 135 |
| Sequence | MLRLEFAEAMTWRPVGTAVQENVNMDQPYKDALLRKRGEILSTGGGVKPLPATMEVNSRQGDLADQASGNNEVHIQLKLKQTDAKILQAIEEALYRMEKGTYGICRDCGEPIAPARLNAIPWTRVCITCKEKQNS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 125 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 247 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 248 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 249 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 250 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 251 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 257 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 261 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 262 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 267 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 268 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 269 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 270 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 271 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 272 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 273 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 274 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 275 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 276 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 277 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 280 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 281 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 284 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 344 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 345 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 346 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 374 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 375 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 377 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 378 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 381 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 384 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 386 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 391 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 392 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 395 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 396 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 424 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 429 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 430 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 431 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 432 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.31 |
| Nodule | 0 |
| Rhizoplane | 3.05 |
| Rhizosphere | 94.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070674_101675223 | 3300005356 | Bacteria | 575 |
| 2 | ARSoilOldRDRAFT_c020637 | 3300000044 | Unclassified | 581 |
| 3 | JGI24746J21847_1006920 | 3300001977 | Bacteria | 1742 |
| 4 | JGI24750J21931_1024926 | 3300002070 | Unclassified | 855 |
| 5 | JGI24745J21846_1023412 | 3300002073 | Unclassified | 731 |
| 6 | JGI24749J21850_1076484 | 3300002076 | Unclassified | 522 |
| 7 | JGI24035J26624_1024272 | 3300002126 | Unclassified | 648 |
| 8 | JGI24033J26618_1003820 | 3300002155 | Bacteria | 1603 |
| 9 | JGI24033J26618_1028540 | 3300002155 | Unclassified | 742 |
| 10 | JGI24034J26672_10117660 | 3300002239 | Unclassified | 512 |
| 11 | JGI24742J22300_10085476 | 3300002244 | Unclassified | 599 |
| 12 | JGI24742J22300_10116928 | 3300002244 | Unclassified | 524 |
| 13 | JGI24751J29686_10077786 | 3300002459 | Bacteria | 687 |
| 14 | JGI24751J29686_10121676 | 3300002459 | Bacteria | 549 |
| 15 | JGI24751J29686_10137735 | 3300002459 | Unclassified | 516 |
| 16 | Ga0058859_11527305 | 3300004798 | Unclassified | 513 |
| 17 | Ga0058860_11945108 | 3300004801 | Bacteria | 959 |
| 18 | Ga0065714_10317131 | 3300005288 | Bacteria | 673 |
| 19 | Ga0065714_10372059 | 3300005288 | Unclassified | 615 |
| 20 | Ga0065704_10448172 | 3300005289 | Bacteria | 708 |
| 21 | Ga0065704_10864364 | 3300005289 | Unclassified | 505 |
| 22 | Ga0065712_10000775 | 3300005290 | Bacteria | 8881 |
| 23 | Ga0065712_10012333 | 3300005290 | Unclassified | 3386 |
| 24 | Ga0065712_10115560 | 3300005290 | Unclassified | 1749 |
| 25 | Ga0065712_10168983 | 3300005290 | Bacteria | 1255 |
| 26 | Ga0065712_10170177 | 3300005290 | Bacteria | 1248 |
| 27 | Ga0065712_10201384 | 3300005290 | Unclassified | 1107 |
| 28 | Ga0065712_10235507 | 3300005290 | Unclassified | 983 |
| 29 | Ga0065712_10377769 | 3300005290 | Bacteria | 755 |
| 30 | Ga0065712_10527480 | 3300005290 | Bacteria | 632 |
| 31 | Ga0065715_10001070 | 3300005293 | Bacteria | 9000 |
| 32 | Ga0065715_10009998 | 3300005293 | Bacteria | 2532 |
| 33 | Ga0065715_10029765 | 3300005293 | Bacteria | 1818 |
| 34 | Ga0065715_10033698 | 3300005293 | Bacteria | 1230 |
| 35 | Ga0065715_10126661 | 3300005293 | Bacteria | 2104 |
| 36 | Ga0065715_10176037 | 3300005293 | Bacteria | 1511 |
| 37 | Ga0065715_10215752 | 3300005293 | Unclassified | 1294 |
| 38 | Ga0065715_10223288 | 3300005293 | Bacteria | 1263 |
| 39 | Ga0065715_10363450 | 3300005293 | Bacteria | 932 |
| 40 | Ga0065715_10436698 | 3300005293 | Unclassified | 841 |
| 41 | Ga0065715_10656521 | 3300005293 | Unclassified | 675 |
| 42 | Ga0065715_10765485 | 3300005293 | Unclassified | 610 |
| 43 | Ga0065715_10870389 | 3300005293 | Bacteria | 572 |
| 44 | Ga0065715_10935636 | 3300005293 | Unclassified | 564 |
| 45 | Ga0065707_10098873 | 3300005295 | Bacteria | 3050 |
| 46 | Ga0065707_10114639 | 3300005295 | Unclassified | 2283 |
| 47 | Ga0065707_10141208 | 3300005295 | Bacteria | 1770 |
| 48 | Ga0065707_10162916 | 3300005295 | Bacteria | 1547 |
| 49 | Ga0065707_10187785 | 3300005295 | Bacteria | 1362 |
| 50 | Ga0065707_10337811 | 3300005295 | Bacteria | 938 |
| 51 | Ga0065707_10528200 | 3300005295 | Unclassified | 737 |
| 52 | Ga0065707_10792263 | 3300005295 | Unclassified | 602 |
| 53 | Ga0070676_10005668 | 3300005328 | Bacteria | 6649 |
| 54 | Ga0070676_10008405 | 3300005328 | Bacteria | 5564 |
| 55 | Ga0070676_10014235 | 3300005328 | Bacteria | 4371 |
| 56 | Ga0070676_10157544 | 3300005328 | Bacteria | 1459 |
| 57 | Ga0070676_10311852 | 3300005328 | Bacteria | 1070 |
| 58 | Ga0070676_10625560 | 3300005328 | Bacteria | 779 |
| 59 | Ga0070676_11076418 | 3300005328 | Bacteria | 607 |
| 60 | Ga0070683_100012700 | 3300005329 | Bacteria | 7325 |
| 61 | Ga0070683_100028485 | 3300005329 | Bacteria | 5049 |
| 62 | Ga0070683_101492807 | 3300005329 | Bacteria | 650 |
| 63 | Ga0070690_100001367 | 3300005330 | Bacteria | 12682 |
| 64 | Ga0070690_100138636 | 3300005330 | Bacteria | 1649 |
| 65 | Ga0070690_100199496 | 3300005330 | Bacteria | 1392 |
| 66 | Ga0070690_100293840 | 3300005330 | Bacteria | 1163 |
| 67 | Ga0070690_100463396 | 3300005330 | Bacteria | 942 |
| 68 | Ga0070690_100664152 | 3300005330 | Unclassified | 797 |
| 69 | Ga0070670_100001056 | 3300005331 | Bacteria | 21882 |
| 70 | Ga0070670_100003418 | 3300005331 | Bacteria | 13174 |
| 71 | Ga0070670_100011917 | 3300005331 | Bacteria | 7435 |
| 72 | Ga0070670_100014644 | 3300005331 | Bacteria | 6732 |
| 73 | Ga0070670_100026445 | 3300005331 | Bacteria | 4992 |
| 74 | Ga0070670_100176707 | 3300005331 | Bacteria | 1853 |
| 75 | Ga0070670_100260554 | 3300005331 | Bacteria | 1511 |
| 76 | Ga0070670_100270920 | 3300005331 | Bacteria | 1481 |
| 77 | Ga0070670_100551870 | 3300005331 | Bacteria | 1028 |
| 78 | Ga0070670_100580087 | 3300005331 | Bacteria | 1002 |
| 79 | Ga0070670_101144369 | 3300005331 | Unclassified | 710 |
| 80 | Ga0070670_101781279 | 3300005331 | Bacteria | 567 |
| 81 | Ga0070677_10001098 | 3300005333 | Bacteria | 8696 |
| 82 | Ga0070677_10060979 | 3300005333 | Unclassified | 1556 |
| 83 | Ga0068869_100012287 | 3300005334 | Bacteria | 5653 |
| 84 | Ga0068869_100029336 | 3300005334 | Bacteria | 3853 |
| 85 | Ga0068869_100052708 | 3300005334 | Bacteria | 2955 |
| 86 | Ga0068869_100164584 | 3300005334 | Bacteria | 1729 |
| 87 | Ga0068869_100337876 | 3300005334 | Bacteria | 1225 |
| 88 | Ga0068869_100683836 | 3300005334 | Bacteria | 874 |
| 89 | Ga0068869_100772395 | 3300005334 | Bacteria | 824 |
| 90 | Ga0068869_101088818 | 3300005334 | Bacteria | 699 |
| 91 | Ga0070666_10004920 | 3300005335 | Bacteria | 8167 |
| 92 | Ga0070666_10004925 | 3300005335 | Bacteria | 8165 |
| 93 | Ga0070666_10105649 | 3300005335 | Bacteria | 1945 |
| 94 | Ga0070666_10209687 | 3300005335 | Bacteria | 1372 |
| 95 | Ga0070666_10373478 | 3300005335 | Bacteria | 1023 |
| 96 | Ga0070666_10925786 | 3300005335 | Bacteria | 645 |
| 97 | Ga0070666_10967852 | 3300005335 | Unclassified | 631 |
| 98 | Ga0070680_100371989 | 3300005336 | Unclassified | 1216 |
| 99 | Ga0070680_100534839 | 3300005336 | Bacteria | 1004 |
| 100 | Ga0070680_100851949 | 3300005336 | Unclassified | 786 |
| 101 | Ga0068868_100026032 | 3300005338 | Bacteria | 4455 |
| 102 | Ga0068868_100051760 | 3300005338 | Bacteria | 3232 |
| 103 | Ga0068868_100063469 | 3300005338 | Bacteria | 2930 |
| 104 | Ga0068868_100183316 | 3300005338 | Unclassified | 1738 |
| 105 | Ga0068868_100361891 | 3300005338 | Bacteria | 1245 |
| 106 | Ga0068868_100601652 | 3300005338 | Bacteria | 974 |
| 107 | Ga0068868_100613978 | 3300005338 | Bacteria | 965 |
| 108 | Ga0070689_100009831 | 3300005340 | Bacteria | 6800 |
| 109 | Ga0070689_100012440 | 3300005340 | Bacteria | 6131 |
| 110 | Ga0070689_100013722 | 3300005340 | Bacteria | 5869 |
| 111 | Ga0070689_100261171 | 3300005340 | Bacteria | 1431 |
| 112 | Ga0070689_100287319 | 3300005340 | Bacteria | 1366 |
| 113 | Ga0070689_101851251 | 3300005340 | Bacteria | 551 |
| 114 | Ga0070691_10017999 | 3300005341 | Bacteria | 3254 |
| 115 | Ga0070691_10109418 | 3300005341 | Bacteria | 1381 |
| 116 | Ga0070691_11075113 | 3300005341 | Unclassified | 506 |
| 117 | Ga0070687_100002563 | 3300005343 | Bacteria | 6857 |
| 118 | Ga0070687_100956309 | 3300005343 | Unclassified | 618 |
| 119 | Ga0070661_100035901 | 3300005344 | Unclassified | 3603 |
| 120 | Ga0070661_100073228 | 3300005344 | Bacteria | 2522 |
| 121 | Ga0070661_100500796 | 3300005344 | Unclassified | 972 |
| 122 | Ga0070661_100693705 | 3300005344 | Bacteria | 829 |
| 123 | Ga0070661_101258851 | 3300005344 | Unclassified | 620 |
| 124 | Ga0070692_10018548 | 3300005345 | Bacteria | 3349 |
| 125 | Ga0070692_10591514 | 3300005345 | Bacteria | 733 |
| 126 | Ga0070668_100025802 | 3300005347 | Bacteria | 4458 |
| 127 | Ga0070668_100077094 | 3300005347 | Bacteria | 2605 |
| 128 | Ga0070668_100252662 | 3300005347 | Bacteria | 1464 |
| 129 | Ga0070668_100411244 | 3300005347 | Bacteria | 1157 |
| 130 | Ga0070668_100745261 | 3300005347 | Unclassified | 867 |
| 131 | Ga0070668_100912053 | 3300005347 | Bacteria | 786 |
| 132 | Ga0070668_101578750 | 3300005347 | Bacteria | 601 |
| 133 | Ga0070669_100003160 | 3300005353 | Bacteria | 11845 |
| 134 | Ga0070669_100004710 | 3300005353 | Bacteria | 9845 |
| 135 | Ga0070669_100007510 | 3300005353 | Bacteria | 7808 |
| 136 | Ga0070669_100081082 | 3300005353 | Bacteria | 2416 |
| 137 | Ga0070669_100125892 | 3300005353 | Archaea | 1960 |
| 138 | Ga0070669_100194685 | 3300005353 | Bacteria | 1592 |
| 139 | Ga0070669_100209228 | 3300005353 | Bacteria | 1538 |
| 140 | Ga0070669_100279416 | 3300005353 | Bacteria | 1337 |
| 141 | Ga0070669_100305547 | 3300005353 | Bacteria | 1281 |
| 142 | Ga0070669_100553144 | 3300005353 | Unclassified | 960 |
| 143 | Ga0070669_100916964 | 3300005353 | Bacteria | 749 |
| 144 | Ga0070669_101192359 | 3300005353 | Unclassified | 657 |
| 145 | Ga0070669_101283931 | 3300005353 | Unclassified | 634 |
| 146 | Ga0070675_100000502 | 3300005354 | Bacteria | 26891 |
| 147 | Ga0070675_100003069 | 3300005354 | Bacteria | 12614 |
| 148 | Ga0070675_100041219 | 3300005354 | Bacteria | 3771 |
| 149 | Ga0070675_100048836 | 3300005354 | Bacteria | 3471 |
| 150 | Ga0070675_100145233 | 3300005354 | Bacteria | 2031 |
| 151 | Ga0070675_100185401 | 3300005354 | Bacteria | 1801 |
| 152 | Ga0070675_100187537 | 3300005354 | Archaea | 1791 |
| 153 | Ga0070675_100199568 | 3300005354 | Bacteria | 1736 |
| 154 | Ga0070675_100217107 | 3300005354 | Bacteria | 1664 |
| 155 | Ga0070675_100246104 | 3300005354 | Bacteria | 1563 |
| 156 | Ga0070675_100416211 | 3300005354 | Bacteria | 1201 |
| 157 | Ga0070675_101319585 | 3300005354 | Bacteria | 665 |
| 158 | Ga0070675_101715054 | 3300005354 | Bacteria | 580 |
| 159 | Ga0070675_101844339 | 3300005354 | Unclassified | 558 |
| 160 | Ga0070671_100010260 | 3300005355 | Bacteria | 7519 |
| 161 | Ga0070671_100024040 | 3300005355 | Bacteria | 4987 |
| 162 | Ga0070671_100110296 | 3300005355 | Unclassified | 2311 |
| 163 | Ga0070671_100118277 | 3300005355 | Unclassified | 2229 |
| 164 | Ga0070671_100202966 | 3300005355 | Bacteria | 1681 |
| 165 | Ga0070671_100466625 | 3300005355 | Bacteria | 1084 |
| 166 | Ga0070671_100747456 | 3300005355 | Bacteria | 850 |
| 167 | Ga0070674_100001237 | 3300005356 | Bacteria | 13429 |
| 168 | Ga0070674_100010170 | 3300005356 | Bacteria | 5669 |
| 169 | Ga0070674_100018217 | 3300005356 | Bacteria | 4435 |
| 170 | Ga0070674_100020127 | 3300005356 | Bacteria | 4256 |
| 171 | Ga0070674_100058419 | 3300005356 | Bacteria | 2681 |
| 172 | Ga0070674_100131325 | 3300005356 | Bacteria | 1867 |
| 173 | Ga0070674_100176053 | 3300005356 | Bacteria | 1635 |
| 174 | Ga0070674_100246787 | 3300005356 | Bacteria | 1400 |
| 175 | Ga0070674_100413629 | 3300005356 | Bacteria | 1105 |
| 176 | Ga0070674_100454421 | 3300005356 | Bacteria | 1058 |
| 177 | Ga0070674_101494348 | 3300005356 | Bacteria | 607 |
| 178 | Ga0070673_100005561 | 3300005364 | Bacteria | 8081 |
| 179 | Ga0070673_100046195 | 3300005364 | Unclassified | 3381 |
| 180 | Ga0070673_100070450 | 3300005364 | Bacteria | 2806 |
| 181 | Ga0070673_100105269 | 3300005364 | Bacteria | 2330 |
| 182 | Ga0070673_100131442 | 3300005364 | Unclassified | 2101 |
| 183 | Ga0070673_100506332 | 3300005364 | Bacteria | 1093 |
| 184 | Ga0070673_100506353 | 3300005364 | Bacteria | 1093 |
| 185 | Ga0070673_101220851 | 3300005364 | Unclassified | 705 |
| 186 | Ga0070688_100030480 | 3300005365 | Bacteria | 3238 |
| 187 | Ga0070688_100061437 | 3300005365 | Bacteria | 2375 |
| 188 | Ga0070688_100062720 | 3300005365 | Bacteria | 2353 |
| 189 | Ga0070688_100087397 | 3300005365 | Bacteria | 2031 |
| 190 | Ga0070688_100199789 | 3300005365 | Bacteria | 1398 |
| 191 | Ga0070688_100236770 | 3300005365 | Bacteria | 1294 |
| 192 | Ga0070688_100283533 | 3300005365 | Bacteria | 1191 |
| 193 | Ga0070688_100703084 | 3300005365 | Bacteria | 783 |
| 194 | Ga0070688_101190390 | 3300005365 | Unclassified | 612 |
| 195 | Ga0070659_100211607 | 3300005366 | Bacteria | 1598 |
| 196 | Ga0070659_100660524 | 3300005366 | Unclassified | 902 |
| 197 | Ga0070659_101703495 | 3300005366 | Bacteria | 564 |
| 198 | Ga0070667_100026061 | 3300005367 | Bacteria | 4862 |
| 199 | Ga0070667_100296295 | 3300005367 | Bacteria | 1456 |
| 200 | Ga0070667_100644923 | 3300005367 | Unclassified | 977 |
| 201 | Ga0070703_10018391 | 3300005406 | Bacteria | 2020 |
| 202 | Ga0070703_10326271 | 3300005406 | Bacteria | 648 |
| 203 | Ga0070703_10516218 | 3300005406 | Bacteria | 540 |
| 204 | Ga0070701_10008872 | 3300005438 | Bacteria | 4374 |
| 205 | Ga0070701_10013648 | 3300005438 | Bacteria | 3702 |
| 206 | Ga0070701_10020213 | 3300005438 | Bacteria | 3158 |
| 207 | Ga0070701_10033554 | 3300005438 | Bacteria | 2566 |
| 208 | Ga0070701_10132863 | 3300005438 | Bacteria | 1416 |
| 209 | Ga0070701_10196455 | 3300005438 | Bacteria | 1190 |
| 210 | Ga0070701_10208892 | 3300005438 | Bacteria | 1158 |
| 211 | Ga0070701_10289827 | 3300005438 | Bacteria | 1002 |
| 212 | Ga0070701_10725795 | 3300005438 | Unclassified | 671 |
| 213 | Ga0070705_100003386 | 3300005440 | Bacteria | 7818 |
| 214 | Ga0070705_100021073 | 3300005440 | Bacteria | 3462 |
| 215 | Ga0070705_100038561 | 3300005440 | Bacteria | 2704 |
| 216 | Ga0070705_100106277 | 3300005440 | Bacteria | 1784 |
| 217 | Ga0070705_100112868 | 3300005440 | Bacteria | 1740 |
| 218 | Ga0070705_100113714 | 3300005440 | Bacteria | 1735 |
| 219 | Ga0070705_100291587 | 3300005440 | Unclassified | 1165 |
| 220 | Ga0070705_100736792 | 3300005440 | Unclassified | 778 |
| 221 | Ga0070705_101305640 | 3300005440 | Unclassified | 602 |
| 222 | Ga0070700_100007080 | 3300005441 | Bacteria | 6030 |
| 223 | Ga0070700_100012620 | 3300005441 | Bacteria | 4723 |
| 224 | Ga0070700_100038066 | 3300005441 | Bacteria | 2930 |
| 225 | Ga0070700_100057171 | 3300005441 | Unclassified | 2447 |
| 226 | Ga0070700_100099421 | 3300005441 | Bacteria | 1914 |
| 227 | Ga0070700_100213178 | 3300005441 | Bacteria | 1364 |
| 228 | Ga0070700_100328204 | 3300005441 | Unclassified | 1127 |
| 229 | Ga0070700_100432690 | 3300005441 | Bacteria | 997 |
| 230 | Ga0070700_100531037 | 3300005441 | Bacteria | 911 |
| 231 | Ga0070700_100578188 | 3300005441 | Bacteria | 877 |
| 232 | Ga0070700_100595061 | 3300005441 | Bacteria | 866 |
| 233 | Ga0070694_100013503 | 3300005444 | Bacteria | 5101 |
| 234 | Ga0070694_100014816 | 3300005444 | Bacteria | 4885 |
| 235 | Ga0070694_100134230 | 3300005444 | Bacteria | 1792 |
| 236 | Ga0070694_100200845 | 3300005444 | Bacteria | 1486 |
| 237 | Ga0070694_100533792 | 3300005444 | Bacteria | 937 |
| 238 | Ga0070694_101183803 | 3300005444 | Bacteria | 640 |
| 239 | Ga0070694_101804888 | 3300005444 | Unclassified | 521 |
| 240 | Ga0070708_100953576 | 3300005445 | Unclassified | 805 |
| 241 | Ga0070663_100043507 | 3300005455 | Bacteria | 3161 |
| 242 | Ga0070663_100191003 | 3300005455 | Bacteria | 1594 |
| 243 | Ga0070663_101100873 | 3300005455 | Bacteria | 694 |
| 244 | Ga0070663_101481456 | 3300005455 | Unclassified | 603 |
| 245 | Ga0070663_101720232 | 3300005455 | Unclassified | 561 |
| 246 | Ga0070663_101935265 | 3300005455 | Bacteria | 530 |
| 247 | Ga0070678_100019903 | 3300005456 | Unclassified | 4390 |
| 248 | Ga0070678_100087016 | 3300005456 | Unclassified | 2385 |
| 249 | Ga0070678_100154203 | 3300005456 | Unclassified | 1854 |
| 250 | Ga0070678_100205398 | 3300005456 | Unclassified | 1628 |
| 251 | Ga0070678_101012876 | 3300005456 | Bacteria | 764 |
| 252 | Ga0070678_101112991 | 3300005456 | Bacteria | 730 |
| 253 | Ga0070678_101483653 | 3300005456 | Bacteria | 635 |
| 254 | Ga0070662_100021377 | 3300005457 | Bacteria | 4417 |
| 255 | Ga0070662_100171151 | 3300005457 | Unclassified | 1706 |
| 256 | Ga0070662_100258788 | 3300005457 | Bacteria | 1402 |
| 257 | Ga0070662_100388408 | 3300005457 | Unclassified | 1150 |
| 258 | Ga0070662_100389733 | 3300005457 | Bacteria | 1148 |
| 259 | Ga0070662_100415852 | 3300005457 | Unclassified | 1112 |
| 260 | Ga0070662_100520832 | 3300005457 | Bacteria | 993 |
| 261 | Ga0070662_101597035 | 3300005457 | Bacteria | 563 |
| 262 | Ga0068867_100002404 | 3300005459 | Bacteria | 13169 |
| 263 | Ga0068867_100098587 | 3300005459 | Bacteria | 2229 |
| 264 | Ga0068867_100141719 | 3300005459 | Bacteria | 1880 |
| 265 | Ga0068867_100174438 | 3300005459 | Bacteria | 1705 |
| 266 | Ga0068867_100202972 | 3300005459 | Bacteria | 1588 |
| 267 | Ga0068867_100295913 | 3300005459 | Bacteria | 1333 |
| 268 | Ga0068867_100302571 | 3300005459 | Bacteria | 1319 |
| 269 | Ga0068867_100389991 | 3300005459 | Unclassified | 1172 |
| 270 | Ga0068867_100706954 | 3300005459 | Unclassified | 890 |
| 271 | Ga0068867_100756257 | 3300005459 | Bacteria | 863 |
| 272 | Ga0068867_101398937 | 3300005459 | Bacteria | 649 |
| 273 | Ga0068867_101534951 | 3300005459 | Bacteria | 621 |
| 274 | Ga0070685_10042272 | 3300005466 | Bacteria | 2600 |
| 275 | Ga0070685_10093149 | 3300005466 | Bacteria | 1827 |
| 276 | Ga0070685_10095899 | 3300005466 | Bacteria | 1804 |
| 277 | Ga0070685_10177467 | 3300005466 | Bacteria | 1369 |
| 278 | Ga0070685_10252329 | 3300005466 | Bacteria | 1169 |
| 279 | Ga0070706_100077287 | 3300005467 | Unclassified | 3081 |
| 280 | Ga0070706_100102584 | 3300005467 | Bacteria | 2660 |
| 281 | Ga0070707_100044771 | 3300005468 | Bacteria | 4236 |
| 282 | Ga0070707_100399187 | 3300005468 | Unclassified | 1335 |
| 283 | Ga0070707_102162271 | 3300005468 | Bacteria | 524 |
| 284 | Ga0070698_100059421 | 3300005471 | Bacteria | 3861 |
| 285 | Ga0070698_100129763 | 3300005471 | Bacteria | 2477 |
| 286 | Ga0070698_100320405 | 3300005471 | Bacteria | 1481 |
| 287 | Ga0070698_100469297 | 3300005471 | Bacteria | 1195 |
| 288 | Ga0070699_100000937 | 3300005518 | Bacteria | 27205 |
| 289 | Ga0070699_100005227 | 3300005518 | Bacteria | 11403 |
| 290 | Ga0070699_100018475 | 3300005518 | Bacteria | 5988 |
| 291 | Ga0070699_100037639 | 3300005518 | Bacteria | 4189 |
| 292 | Ga0070699_100102803 | 3300005518 | Bacteria | 2505 |
| 293 | Ga0070699_100553478 | 3300005518 | Bacteria | 1047 |
| 294 | Ga0070699_101769376 | 3300005518 | Bacteria | 566 |
| 295 | Ga0070679_101623948 | 3300005530 | Bacteria | 594 |
| 296 | Ga0070684_100005319 | 3300005535 | Bacteria | 9856 |
| 297 | Ga0070684_100572681 | 3300005535 | Bacteria | 1049 |
| 298 | Ga0070684_100963693 | 3300005535 | Bacteria | 800 |
| 299 | Ga0070684_101411069 | 3300005535 | Unclassified | 656 |
| 300 | Ga0070697_100039196 | 3300005536 | Bacteria | 3830 |
| 301 | Ga0070697_101161873 | 3300005536 | Unclassified | 688 |
| 302 | Ga0068853_101077282 | 3300005539 | Unclassified | 775 |
| 303 | Ga0068853_101574083 | 3300005539 | Bacteria | 637 |
| 304 | Ga0070672_100019741 | 3300005543 | Bacteria | 4899 |
| 305 | Ga0070672_100028590 | 3300005543 | Bacteria | 4172 |
| 306 | Ga0070672_100049657 | 3300005543 | Bacteria | 3265 |
| 307 | Ga0070672_100082515 | 3300005543 | Bacteria | 2579 |
| 308 | Ga0070672_100113382 | 3300005543 | Unclassified | 2212 |
| 309 | Ga0070672_100129890 | 3300005543 | Bacteria | 2069 |
| 310 | Ga0070672_100277951 | 3300005543 | Bacteria | 1415 |
| 311 | Ga0070672_100296448 | 3300005543 | Unclassified | 1370 |
| 312 | Ga0070672_100398192 | 3300005543 | Unclassified | 1180 |
| 313 | Ga0070672_100814984 | 3300005543 | Unclassified | 822 |
| 314 | Ga0070672_100877871 | 3300005543 | Bacteria | 791 |
| 315 | Ga0070672_101309036 | 3300005543 | Bacteria | 647 |
| 316 | Ga0070686_100003121 | 3300005544 | Bacteria | 9082 |
| 317 | Ga0070686_100011544 | 3300005544 | Bacteria | 5012 |
| 318 | Ga0070686_100124546 | 3300005544 | Bacteria | 1774 |
| 319 | Ga0070686_100283134 | 3300005544 | Bacteria | 1223 |
| 320 | Ga0070686_100431468 | 3300005544 | Unclassified | 1009 |
| 321 | Ga0070686_100499251 | 3300005544 | Bacteria | 944 |
| 322 | Ga0070686_100717507 | 3300005544 | Unclassified | 799 |
| 323 | Ga0070695_100000182 | 3300005545 | Bacteria | 30036 |
| 324 | Ga0070695_100027508 | 3300005545 | Bacteria | 3523 |
| 325 | Ga0070695_100071115 | 3300005545 | Bacteria | 2277 |
| 326 | Ga0070695_100580507 | 3300005545 | Unclassified | 877 |
| 327 | Ga0070695_101604067 | 3300005545 | Unclassified | 543 |
| 328 | Ga0070696_100016048 | 3300005546 | Bacteria | 5037 |
| 329 | Ga0070696_100016512 | 3300005546 | Bacteria | 4973 |
| 330 | Ga0070696_100126621 | 3300005546 | Unclassified | 1854 |
| 331 | Ga0070696_100145134 | 3300005546 | Bacteria | 1738 |
| 332 | Ga0070696_100500007 | 3300005546 | Bacteria | 967 |
| 333 | Ga0070693_100012094 | 3300005547 | Unclassified | 4359 |
| 334 | Ga0070693_100017627 | 3300005547 | Bacteria | 3715 |
| 335 | Ga0070693_100969899 | 3300005547 | Unclassified | 641 |
| 336 | Ga0070665_100004472 | 3300005548 | Bacteria | 14687 |
| 337 | Ga0070665_100039569 | 3300005548 | Bacteria | 4741 |
| 338 | Ga0070665_100051301 | 3300005548 | Bacteria | 4137 |
| 339 | Ga0070665_100718622 | 3300005548 | Bacteria | 1012 |
| 340 | Ga0070704_100000072 | 3300005549 | Bacteria | 33905 |
| 341 | Ga0070704_100001134 | 3300005549 | Bacteria | 13899 |
| 342 | Ga0070704_100010082 | 3300005549 | Bacteria | 5743 |
| 343 | Ga0070704_100012184 | 3300005549 | Bacteria | 5307 |
| 344 | Ga0070704_100019061 | 3300005549 | Bacteria | 4402 |
| 345 | Ga0070704_100070530 | 3300005549 | Bacteria | 2536 |
| 346 | Ga0070704_100188351 | 3300005549 | Bacteria | 1656 |
| 347 | Ga0070704_100253819 | 3300005549 | Bacteria | 1446 |
| 348 | Ga0070704_100289930 | 3300005549 | Unclassified | 1359 |
| 349 | Ga0070704_100401331 | 3300005549 | Bacteria | 1170 |
| 350 | Ga0070704_100483383 | 3300005549 | Bacteria | 1072 |
| 351 | Ga0070704_100593529 | 3300005549 | Unclassified | 973 |
| 352 | Ga0070704_100677745 | 3300005549 | Bacteria | 912 |
| 353 | Ga0068855_100439046 | 3300005563 | Bacteria | 1426 |
| 354 | Ga0070664_100007496 | 3300005564 | Bacteria | 8809 |
| 355 | Ga0070664_100009434 | 3300005564 | Bacteria | 7910 |
| 356 | Ga0070664_100020954 | 3300005564 | Bacteria | 5386 |
| 357 | Ga0070664_100073756 | 3300005564 | Bacteria | 2929 |
| 358 | Ga0070664_100109493 | 3300005564 | Bacteria | 2410 |
| 359 | Ga0070664_100190945 | 3300005564 | Unclassified | 1825 |
| 360 | Ga0070664_100250947 | 3300005564 | Unclassified | 1590 |
| 361 | Ga0070664_100356734 | 3300005564 | Bacteria | 1331 |
| 362 | Ga0070664_100862736 | 3300005564 | Unclassified | 848 |
| 363 | Ga0070664_101043680 | 3300005564 | Bacteria | 769 |
| 364 | Ga0070664_101900868 | 3300005564 | Unclassified | 565 |
| 365 | Ga0068857_100024374 | 3300005577 | Bacteria | 5325 |
| 366 | Ga0068857_100051939 | 3300005577 | Bacteria | 3638 |
| 367 | Ga0068857_100081857 | 3300005577 | Bacteria | 2883 |
| 368 | Ga0068857_100215773 | 3300005577 | Bacteria | 1751 |
| 369 | Ga0068857_100355069 | 3300005577 | Unclassified | 1358 |
| 370 | Ga0068857_100704045 | 3300005577 | Bacteria | 960 |
| 371 | Ga0068857_100830788 | 3300005577 | Bacteria | 883 |
| 372 | Ga0068857_100978096 | 3300005577 | Archaea | 814 |
| 373 | Ga0068857_101927961 | 3300005577 | Unclassified | 579 |
| 374 | Ga0068854_100024563 | 3300005578 | Bacteria | 4128 |
| 375 | Ga0068854_100077444 | 3300005578 | Bacteria | 2447 |
| 376 | Ga0068854_100827211 | 3300005578 | Unclassified | 809 |
| 377 | Ga0068854_101130639 | 3300005578 | Unclassified | 699 |
| 378 | Ga0070702_100014380 | 3300005615 | Bacteria | 4014 |
| 379 | Ga0070702_100026067 | 3300005615 | Bacteria | 3138 |
| 380 | Ga0070702_100032348 | 3300005615 | Bacteria | 2870 |
| 381 | Ga0070702_100119827 | 3300005615 | Bacteria | 1645 |
| 382 | Ga0070702_100382459 | 3300005615 | Bacteria | 1001 |
| 383 | Ga0068852_100566576 | 3300005616 | Bacteria | 1137 |
| 384 | Ga0068852_102639636 | 3300005616 | Unclassified | 522 |
| 385 | Ga0068859_100005205 | 3300005617 | Bacteria | 13216 |
| 386 | Ga0068859_100007562 | 3300005617 | Bacteria | 11037 |
| 387 | Ga0068859_100007755 | 3300005617 | Bacteria | 10898 |
| 388 | Ga0068859_100033302 | 3300005617 | Bacteria | 5175 |
| 389 | Ga0068859_100316127 | 3300005617 | Unclassified | 1655 |
| 390 | Ga0068859_100535674 | 3300005617 | Bacteria | 1266 |
| 391 | Ga0068859_100596850 | 3300005617 | Bacteria | 1197 |
| 392 | Ga0068859_100855329 | 3300005617 | Bacteria | 995 |
| 393 | Ga0068859_100950010 | 3300005617 | Unclassified | 943 |
| 394 | Ga0068859_101051931 | 3300005617 | Archaea | 895 |
| 395 | Ga0068859_101235910 | 3300005617 | Bacteria | 823 |
| 396 | Ga0068859_101305215 | 3300005617 | Bacteria | 800 |
| 397 | Ga0068864_100011350 | 3300005618 | Bacteria | 7361 |
| 398 | Ga0068864_100026714 | 3300005618 | Bacteria | 4869 |
| 399 | Ga0068864_100028503 | 3300005618 | Bacteria | 4721 |
| 400 | Ga0068864_100048189 | 3300005618 | Bacteria | 3662 |
| 401 | Ga0068864_100166745 | 3300005618 | Bacteria | 2006 |
| 402 | Ga0068864_100503402 | 3300005618 | Bacteria | 1166 |
| 403 | Ga0068864_100708571 | 3300005618 | Unclassified | 984 |
| 404 | Ga0068864_100795811 | 3300005618 | Bacteria | 929 |
| 405 | Ga0068864_101382335 | 3300005618 | Unclassified | 705 |
| 406 | Ga0068866_10090978 | 3300005718 | Bacteria | 1662 |
| 407 | Ga0068866_10167730 | 3300005718 | Bacteria | 1286 |
| 408 | Ga0068866_10338679 | 3300005718 | Unclassified | 952 |
| 409 | Ga0068866_10341313 | 3300005718 | Unclassified | 949 |
| 410 | Ga0068861_100000239 | 3300005719 | Bacteria | 30192 |
| 411 | Ga0068861_100014721 | 3300005719 | Bacteria | 5495 |
| 412 | Ga0068861_100084340 | 3300005719 | Bacteria | 2494 |
| 413 | Ga0068861_100129061 | 3300005719 | Unclassified | 2050 |
| 414 | Ga0068861_100162454 | 3300005719 | Bacteria | 1843 |
| 415 | Ga0068861_100274539 | 3300005719 | Bacteria | 1449 |
| 416 | Ga0068861_100282164 | 3300005719 | Bacteria | 1431 |
| 417 | Ga0068861_100397006 | 3300005719 | Bacteria | 1223 |
| 418 | Ga0068861_100459097 | 3300005719 | Bacteria | 1143 |
| 419 | Ga0068861_100483623 | 3300005719 | Bacteria | 1116 |
| 420 | Ga0068861_100513865 | 3300005719 | Unclassified | 1085 |
| 421 | Ga0068861_100610290 | 3300005719 | Bacteria | 1003 |
| 422 | Ga0068861_100939516 | 3300005719 | Bacteria | 821 |
| 423 | Ga0068861_101055615 | 3300005719 | Bacteria | 778 |
| 424 | Ga0068851_10248815 | 3300005834 | Bacteria | 1008 |
| 425 | Ga0068851_10573325 | 3300005834 | Unclassified | 684 |
| 426 | Ga0068870_10003677 | 3300005840 | Bacteria | 6515 |
| 427 | Ga0068870_10006313 | 3300005840 | Bacteria | 5218 |
| 428 | Ga0068870_10046545 | 3300005840 | Unclassified | 2275 |
| 429 | Ga0068870_10101013 | 3300005840 | Bacteria | 1630 |
| 430 | Ga0068870_10131258 | 3300005840 | Bacteria | 1455 |
| 431 | Ga0068870_10185451 | 3300005840 | Bacteria | 1252 |
| 432 | Ga0068870_10294494 | 3300005840 | Unclassified | 1022 |
| 433 | Ga0068870_10430009 | 3300005840 | Unclassified | 866 |
| 434 | Ga0068863_100021570 | 3300005841 | Bacteria | 6143 |
| 435 | Ga0068863_100047013 | 3300005841 | Bacteria | 4095 |
| 436 | Ga0068863_100226327 | 3300005841 | Bacteria | 1803 |
| 437 | Ga0068863_100247865 | 3300005841 | Bacteria | 1720 |
| 438 | Ga0068863_100462798 | 3300005841 | Unclassified | 1245 |
| 439 | Ga0068858_100012319 | 3300005842 | Bacteria | 8063 |
| 440 | Ga0068858_100014103 | 3300005842 | Bacteria | 7537 |
| 441 | Ga0068858_100045281 | 3300005842 | Bacteria | 4077 |
| 442 | Ga0068858_100071743 | 3300005842 | Bacteria | 3212 |
| 443 | Ga0068858_100216705 | 3300005842 | Bacteria | 1812 |
| 444 | Ga0068858_100637644 | 3300005842 | Unclassified | 1035 |
| 445 | Ga0068858_100638201 | 3300005842 | Bacteria | 1034 |
| 446 | Ga0068858_101013755 | 3300005842 | Bacteria | 814 |
| 447 | Ga0068858_101955661 | 3300005842 | Bacteria | 580 |
| 448 | Ga0068858_102551206 | 3300005842 | Unclassified | 505 |
| 449 | Ga0068860_100003239 | 3300005843 | Bacteria | 16782 |
| 450 | Ga0068860_100010475 | 3300005843 | Bacteria | 9165 |
| 451 | Ga0068860_100138759 | 3300005843 | Bacteria | 2335 |
| 452 | Ga0068860_100172637 | 3300005843 | Unclassified | 2088 |
| 453 | Ga0068860_100404359 | 3300005843 | Bacteria | 1351 |
| 454 | Ga0068860_100545826 | 3300005843 | Bacteria | 1161 |
| 455 | Ga0068860_100770055 | 3300005843 | Bacteria | 975 |
| 456 | Ga0068860_101267007 | 3300005843 | Bacteria | 758 |
| 457 | Ga0068860_101346835 | 3300005843 | Bacteria | 735 |
| 458 | Ga0068862_100000540 | 3300005844 | Bacteria | 39568 |
| 459 | Ga0068862_100004222 | 3300005844 | Bacteria | 12170 |
| 460 | Ga0068862_100045653 | 3300005844 | Bacteria | 3738 |
| 461 | Ga0068862_100074049 | 3300005844 | Bacteria | 2943 |
| 462 | Ga0068862_100093928 | 3300005844 | Bacteria | 2616 |
| 463 | Ga0068862_100142852 | 3300005844 | Bacteria | 2125 |
| 464 | Ga0068862_100662335 | 3300005844 | Unclassified | 1008 |
| 465 | Ga0068862_100722121 | 3300005844 | Bacteria | 967 |
| 466 | Ga0068862_101376138 | 3300005844 | Unclassified | 708 |
| 467 | Ga0081455_10206486 | 3300005937 | Unclassified | 1467 |
| 468 | Ga0081538_10186823 | 3300005981 | Unclassified | 877 |
| 469 | Ga0075365_10009426 | 3300006038 | Bacteria | 5612 |
| 470 | Ga0075365_10338996 | 3300006038 | Unclassified | 1059 |
| 471 | Ga0075368_10004232 | 3300006042 | Bacteria | 4846 |
| 472 | Ga0075368_10045410 | 3300006042 | Bacteria | 1736 |
| 473 | Ga0075368_10168945 | 3300006042 | Bacteria | 918 |
| 474 | Ga0075363_100119107 | 3300006048 | Bacteria | 1473 |
| 475 | Ga0075364_10013927 | 3300006051 | Bacteria | 4956 |
| 476 | Ga0075364_10020344 | 3300006051 | Bacteria | 4174 |
| 477 | Ga0075364_10088018 | 3300006051 | Unclassified | 2059 |
| 478 | Ga0075432_10254567 | 3300006058 | Unclassified | 714 |
| 479 | Ga0070715_10786534 | 3300006163 | Unclassified | 576 |
| 480 | Ga0070712_100122546 | 3300006175 | Bacteria | 1958 |
| 481 | Ga0075362_10003449 | 3300006177 | Bacteria | 5525 |
| 482 | Ga0075362_10544573 | 3300006177 | Bacteria | 596 |
| 483 | Ga0075367_10016079 | 3300006178 | Bacteria | 4080 |
| 484 | Ga0075367_10461787 | 3300006178 | Bacteria | 805 |
| 485 | Ga0075367_10648119 | 3300006178 | Archaea | 671 |
| 486 | Ga0075366_10029281 | 3300006195 | Bacteria | 3235 |
| 487 | Ga0075366_10046686 | 3300006195 | Bacteria | 2567 |
| 488 | Ga0097621_100022373 | 3300006237 | Bacteria | 4907 |
| 489 | Ga0097621_100050969 | 3300006237 | Bacteria | 3367 |
| 490 | Ga0097621_100106966 | 3300006237 | Bacteria | 2360 |
| 491 | Ga0097621_100164275 | 3300006237 | Unclassified | 1910 |
| 492 | Ga0097621_100990110 | 3300006237 | Bacteria | 786 |
| 493 | Ga0097621_101344127 | 3300006237 | Bacteria | 676 |
| 494 | Ga0075370_10050245 | 3300006353 | Bacteria | 2365 |
| 495 | Ga0068871_100007573 | 3300006358 | Bacteria | 7768 |
| 496 | Ga0068871_100019826 | 3300006358 | Bacteria | 5140 |
| 497 | Ga0068871_100242448 | 3300006358 | Bacteria | 1567 |
| 498 | Ga0068871_100781496 | 3300006358 | Bacteria | 879 |
| 499 | Ga0068871_100792729 | 3300006358 | Bacteria | 873 |
| 500 | Ga0068871_100831379 | 3300006358 | Bacteria | 853 |
| 501 | Ga0068871_101726884 | 3300006358 | Unclassified | 594 |
| 502 | Ga0075428_100000131 | 3300006844 | Bacteria | 65649 |
| 503 | Ga0075428_100002180 | 3300006844 | Bacteria | 21189 |
| 504 | Ga0075428_100013531 | 3300006844 | Bacteria | 9083 |
| 505 | Ga0075428_100023551 | 3300006844 | Bacteria | 6816 |
| 506 | Ga0075428_100026076 | 3300006844 | Bacteria | 6472 |
| 507 | Ga0075428_100027620 | 3300006844 | Bacteria | 6278 |
| 508 | Ga0075428_100040836 | 3300006844 | Bacteria | 5102 |
| 509 | Ga0075428_100076697 | 3300006844 | Unclassified | 3649 |
| 510 | Ga0075428_100202157 | 3300006844 | Bacteria | 2147 |
| 511 | Ga0075428_100463463 | 3300006844 | Bacteria | 1357 |
| 512 | Ga0075428_100679837 | 3300006844 | Bacteria | 1097 |
| 513 | Ga0075428_102035199 | 3300006844 | Unclassified | 595 |
| 514 | Ga0075430_100000946 | 3300006846 | Bacteria | 22825 |
| 515 | Ga0075430_100003944 | 3300006846 | Bacteria | 12518 |
| 516 | Ga0075430_100004795 | 3300006846 | Bacteria | 11378 |
| 517 | Ga0075430_100007269 | 3300006846 | Bacteria | 9351 |
| 518 | Ga0075430_100007760 | 3300006846 | Bacteria | 9066 |
| 519 | Ga0075430_100008077 | 3300006846 | Bacteria | 8893 |
| 520 | Ga0075430_100042648 | 3300006846 | Bacteria | 3836 |
| 521 | Ga0075430_100174026 | 3300006846 | Unclassified | 1791 |
| 522 | Ga0075430_100395860 | 3300006846 | Viruses | 1140 |
| 523 | Ga0075430_100640134 | 3300006846 | Bacteria | 877 |
| 524 | Ga0075430_100711615 | 3300006846 | Bacteria | 828 |
| 525 | Ga0075430_101201792 | 3300006846 | Bacteria | 624 |
| 526 | Ga0075431_100001520 | 3300006847 | Bacteria | 21495 |
| 527 | Ga0075431_100014267 | 3300006847 | Bacteria | 8035 |
| 528 | Ga0075431_100033361 | 3300006847 | Bacteria | 5306 |
| 529 | Ga0075431_100033995 | 3300006847 | Bacteria | 5254 |
| 530 | Ga0075431_100046844 | 3300006847 | Bacteria | 4459 |
| 531 | Ga0075431_100091842 | 3300006847 | Bacteria | 3133 |
| 532 | Ga0075431_100154554 | 3300006847 | Unclassified | 2361 |
| 533 | Ga0075431_100162065 | 3300006847 | Bacteria | 2299 |
| 534 | Ga0075431_100228688 | 3300006847 | Bacteria | 1896 |
| 535 | Ga0075431_100356258 | 3300006847 | Bacteria | 1470 |
| 536 | Ga0075431_100647008 | 3300006847 | Bacteria | 1038 |
| 537 | Ga0075431_100647621 | 3300006847 | Bacteria | 1037 |
| 538 | Ga0075431_100849997 | 3300006847 | Bacteria | 884 |
| 539 | Ga0075431_101895670 | 3300006847 | Bacteria | 552 |
| 540 | Ga0075433_10014906 | 3300006852 | Bacteria | 6362 |
| 541 | Ga0075433_10061592 | 3300006852 | Unclassified | 3287 |
| 542 | Ga0075433_10068578 | 3300006852 | Bacteria | 3114 |
| 543 | Ga0075433_10082154 | 3300006852 | Bacteria | 2841 |
| 544 | Ga0075433_10148108 | 3300006852 | Bacteria | 2087 |
| 545 | Ga0075433_10158463 | 3300006852 | Bacteria | 2014 |
| 546 | Ga0075433_10213926 | 3300006852 | Bacteria | 1713 |
| 547 | Ga0075433_10249561 | 3300006852 | Unclassified | 1575 |
| 548 | Ga0075433_10537474 | 3300006852 | Bacteria | 1028 |
| 549 | Ga0075434_100008967 | 3300006871 | Bacteria | 9316 |
| 550 | Ga0075434_100030333 | 3300006871 | Bacteria | 5324 |
| 551 | Ga0075434_100031190 | 3300006871 | Bacteria | 5254 |
| 552 | Ga0075434_100042013 | 3300006871 | Bacteria | 4532 |
| 553 | Ga0075434_100043313 | 3300006871 | Bacteria | 4464 |
| 554 | Ga0075434_100074921 | 3300006871 | Bacteria | 3378 |
| 555 | Ga0075434_100099044 | 3300006871 | Bacteria | 2920 |
| 556 | Ga0075434_100367429 | 3300006871 | Unclassified | 1460 |
| 557 | Ga0075434_100971041 | 3300006871 | Bacteria | 864 |
| 558 | Ga0075434_102249446 | 3300006871 | Bacteria | 549 |
| 559 | Ga0075434_102307476 | 3300006871 | Unclassified | 541 |
| 560 | Ga0075429_100014314 | 3300006880 | Bacteria | 6880 |
| 561 | Ga0075429_100016994 | 3300006880 | Bacteria | 6290 |
| 562 | Ga0075429_100064406 | 3300006880 | Unclassified | 3193 |
| 563 | Ga0075429_100069968 | 3300006880 | Bacteria | 3055 |
| 564 | Ga0075429_100077831 | 3300006880 | Bacteria | 2890 |
| 565 | Ga0075429_100140731 | 3300006880 | Bacteria | 2112 |
| 566 | Ga0075429_100161149 | 3300006880 | Unclassified | 1965 |
| 567 | Ga0075429_100177863 | 3300006880 | Unclassified | 1864 |
| 568 | Ga0075429_100280218 | 3300006880 | Unclassified | 1460 |
| 569 | Ga0075429_100292204 | 3300006880 | Bacteria | 1427 |
| 570 | Ga0075429_100532339 | 3300006880 | Unclassified | 1030 |
| 571 | Ga0068865_100005245 | 3300006881 | Bacteria | 7836 |
| 572 | Ga0068865_100105098 | 3300006881 | Bacteria | 2074 |
| 573 | Ga0068865_100107524 | 3300006881 | Bacteria | 2052 |
| 574 | Ga0068865_100112679 | 3300006881 | Bacteria | 2010 |
| 575 | Ga0068865_101061520 | 3300006881 | Bacteria | 712 |
| 576 | Ga0068865_101120404 | 3300006881 | Bacteria | 694 |
| 577 | Ga0068865_102159524 | 3300006881 | Bacteria | 507 |
| 578 | Ga0075436_100145695 | 3300006914 | Bacteria | 1665 |
| 579 | Ga0075436_100749751 | 3300006914 | Unclassified | 725 |
| 580 | Ga0097620_100005205 | 3300006931 | Bacteria | 13216 |
| 581 | Ga0097620_100007562 | 3300006931 | Bacteria | 11037 |
| 582 | Ga0097620_100007754 | 3300006931 | Bacteria | 10898 |
| 583 | Ga0097620_100033302 | 3300006931 | Bacteria | 5175 |
| 584 | Ga0097620_100316109 | 3300006931 | Unclassified | 1655 |
| 585 | Ga0097620_100535662 | 3300006931 | Bacteria | 1266 |
| 586 | Ga0097620_100596811 | 3300006931 | Bacteria | 1197 |
| 587 | Ga0097620_100855269 | 3300006931 | Bacteria | 995 |
| 588 | Ga0097620_100950026 | 3300006931 | Unclassified | 943 |
| 589 | Ga0097620_101051764 | 3300006931 | Archaea | 895 |
| 590 | Ga0097620_101236133 | 3300006931 | Bacteria | 823 |
| 591 | Ga0097620_101305101 | 3300006931 | Bacteria | 800 |
| 592 | Ga0075435_100009189 | 3300007076 | Bacteria | 7137 |
| 593 | Ga0075435_100012169 | 3300007076 | Bacteria | 6362 |
| 594 | Ga0075435_100021458 | 3300007076 | Bacteria | 4968 |
| 595 | Ga0075435_100027554 | 3300007076 | Bacteria | 4446 |
| 596 | Ga0075435_100028428 | 3300007076 | Bacteria | 4386 |
| 597 | Ga0075435_100137368 | 3300007076 | Bacteria | 2049 |
| 598 | Ga0075435_100190796 | 3300007076 | Bacteria | 1734 |
| 599 | Ga0075435_100247296 | 3300007076 | Bacteria | 1518 |
| 600 | Ga0075435_100400302 | 3300007076 | Bacteria | 1181 |
| 601 | Ga0075435_100538514 | 3300007076 | Unclassified | 1011 |
| 602 | Ga0075435_101102717 | 3300007076 | Bacteria | 694 |
| 603 | Ga0105244_10513098 | 3300009036 | Unclassified | 552 |
| 604 | Ga0105250_10329423 | 3300009092 | Bacteria | 665 |
| 605 | Ga0105240_10786168 | 3300009093 | Bacteria | 1032 |
| 606 | Ga0111539_10000496 | 3300009094 | Bacteria | 49999 |
| 607 | Ga0111539_10003605 | 3300009094 | Bacteria | 20407 |
| 608 | Ga0111539_10005340 | 3300009094 | Bacteria | 16620 |
| 609 | Ga0111539_10012002 | 3300009094 | Bacteria | 10862 |
| 610 | Ga0111539_10047580 | 3300009094 | Bacteria | 5126 |
| 611 | Ga0111539_10096204 | 3300009094 | Unclassified | 3478 |
| 612 | Ga0111539_10158323 | 3300009094 | Bacteria | 2649 |
| 613 | Ga0111539_10212397 | 3300009094 | Bacteria | 2254 |
| 614 | Ga0111539_10223251 | 3300009094 | Unclassified | 2194 |
| 615 | Ga0111539_10350387 | 3300009094 | Bacteria | 1718 |
| 616 | Ga0111539_10392151 | 3300009094 | Bacteria | 1617 |
| 617 | Ga0111539_10453806 | 3300009094 | Bacteria | 1493 |
| 618 | Ga0111539_11068868 | 3300009094 | Bacteria | 938 |
| 619 | Ga0111539_11382167 | 3300009094 | Unclassified | 817 |
| 620 | Ga0111539_11921817 | 3300009094 | Bacteria | 686 |
| 621 | Ga0111539_12139684 | 3300009094 | Bacteria | 649 |
| 622 | Ga0111539_12936762 | 3300009094 | Bacteria | 551 |
| 623 | Ga0105245_10012577 | 3300009098 | Bacteria | 7367 |
| 624 | Ga0105245_10058993 | 3300009098 | Bacteria | 3455 |
| 625 | Ga0105245_10489407 | 3300009098 | Bacteria | 1244 |
| 626 | Ga0105245_10796727 | 3300009098 | Bacteria | 983 |
| 627 | Ga0105245_10876826 | 3300009098 | Bacteria | 938 |
| 628 | Ga0105245_11027259 | 3300009098 | Unclassified | 869 |
| 629 | Ga0105247_10010152 | 3300009101 | Bacteria | 5705 |
| 630 | Ga0105247_10376399 | 3300009101 | Unclassified | 1005 |
| 631 | Ga0105247_10667321 | 3300009101 | Bacteria | 779 |
| 632 | Ga0105247_10754140 | 3300009101 | Bacteria | 738 |
| 633 | Ga0105247_11066701 | 3300009101 | Unclassified | 635 |
| 634 | Ga0114129_10000636 | 3300009147 | Bacteria | 43766 |
| 635 | Ga0114129_10005356 | 3300009147 | Bacteria | 18108 |
| 636 | Ga0114129_10005578 | 3300009147 | Bacteria | 17796 |
| 637 | Ga0114129_10023854 | 3300009147 | Bacteria | 8670 |
| 638 | Ga0114129_10042630 | 3300009147 | Bacteria | 6387 |
| 639 | Ga0114129_10061500 | 3300009147 | Bacteria | 5248 |
| 640 | Ga0114129_10077143 | 3300009147 | Bacteria | 4636 |
| 641 | Ga0114129_10129848 | 3300009147 | Bacteria | 3462 |
| 642 | Ga0114129_10211013 | 3300009147 | Bacteria | 2625 |
| 643 | Ga0114129_10269383 | 3300009147 | Bacteria | 2279 |
| 644 | Ga0114129_10297152 | 3300009147 | Unclassified | 2154 |
| 645 | Ga0114129_10305015 | 3300009147 | Bacteria | 2121 |
| 646 | Ga0114129_10346419 | 3300009147 | Bacteria | 1969 |
| 647 | Ga0114129_10358724 | 3300009147 | Bacteria | 1929 |
| 648 | Ga0114129_10367352 | 3300009147 | Bacteria | 1903 |
| 649 | Ga0114129_10583288 | 3300009147 | Bacteria | 1450 |
| 650 | Ga0114129_10976957 | 3300009147 | Bacteria | 1068 |
| 651 | Ga0114129_12103244 | 3300009147 | Unclassified | 681 |
| 652 | Ga0105243_10006928 | 3300009148 | Bacteria | 8735 |
| 653 | Ga0105243_10016206 | 3300009148 | Bacteria | 5639 |
| 654 | Ga0105243_10124386 | 3300009148 | Bacteria | 2179 |
| 655 | Ga0105243_10221767 | 3300009148 | Bacteria | 1672 |
| 656 | Ga0105243_10271327 | 3300009148 | Bacteria | 1523 |
| 657 | Ga0105243_10338037 | 3300009148 | Bacteria | 1378 |
| 658 | Ga0105243_10872494 | 3300009148 | Unclassified | 893 |
| 659 | Ga0105243_11113324 | 3300009148 | Bacteria | 799 |
| 660 | Ga0105243_11301612 | 3300009148 | Bacteria | 744 |
| 661 | Ga0105243_11792539 | 3300009148 | Unclassified | 645 |
| 662 | Ga0105243_12192747 | 3300009148 | Unclassified | 589 |
| 663 | Ga0105241_10258397 | 3300009174 | Bacteria | 1479 |
| 664 | Ga0105241_11110690 | 3300009174 | Unclassified | 745 |
| 665 | Ga0105241_11175998 | 3300009174 | Bacteria | 725 |
| 666 | Ga0105242_10003771 | 3300009176 | Bacteria | 11784 |
| 667 | Ga0105242_10079797 | 3300009176 | Bacteria | 2733 |
| 668 | Ga0105242_10157812 | 3300009176 | Bacteria | 1983 |
| 669 | Ga0105242_10163055 | 3300009176 | Bacteria | 1953 |
| 670 | Ga0105242_10334599 | 3300009176 | Bacteria | 1393 |
| 671 | Ga0105242_10525498 | 3300009176 | Bacteria | 1130 |
| 672 | Ga0105242_10786086 | 3300009176 | Bacteria | 941 |
| 673 | Ga0105242_10807788 | 3300009176 | Unclassified | 929 |
| 674 | Ga0105248_10014701 | 3300009177 | Bacteria | 8615 |
| 675 | Ga0105248_10031522 | 3300009177 | Bacteria | 5925 |
| 676 | Ga0105248_10133687 | 3300009177 | Bacteria | 2799 |
| 677 | Ga0105248_10150508 | 3300009177 | Bacteria | 2625 |
| 678 | Ga0105248_10193937 | 3300009177 | Bacteria | 2289 |
| 679 | Ga0105248_10206360 | 3300009177 | Bacteria | 2214 |
| 680 | Ga0105248_10285667 | 3300009177 | Unclassified | 1857 |
| 681 | Ga0105248_10322531 | 3300009177 | Bacteria | 1740 |
| 682 | Ga0105248_10436459 | 3300009177 | Bacteria | 1475 |
| 683 | Ga0105248_10480394 | 3300009177 | Bacteria | 1401 |
| 684 | Ga0105248_10529979 | 3300009177 | Bacteria | 1328 |
| 685 | Ga0105248_10583482 | 3300009177 | Bacteria | 1261 |
| 686 | Ga0105248_10587489 | 3300009177 | Bacteria | 1257 |
| 687 | Ga0105248_11044867 | 3300009177 | Unclassified | 923 |
| 688 | Ga0105248_11187615 | 3300009177 | Bacteria | 863 |
| 689 | Ga0105248_11417563 | 3300009177 | Unclassified | 786 |
| 690 | Ga0105248_12134243 | 3300009177 | Unclassified | 637 |
| 691 | Ga0105248_12545347 | 3300009177 | Bacteria | 583 |
| 692 | Ga0105248_13113854 | 3300009177 | Bacteria | 528 |
| 693 | Ga0105237_10076309 | 3300009545 | Bacteria | 3342 |
| 694 | Ga0105237_11412279 | 3300009545 | Bacteria | 702 |
| 695 | Ga0105237_11750603 | 3300009545 | Bacteria | 629 |
| 696 | Ga0105238_10383273 | 3300009551 | Bacteria | 1397 |
| 697 | Ga0105238_10677996 | 3300009551 | Bacteria | 1042 |
| 698 | Ga0105238_11094493 | 3300009551 | Unclassified | 819 |
| 699 | Ga0105249_10001782 | 3300009553 | Bacteria | 18761 |
| 700 | Ga0105249_10001851 | 3300009553 | Bacteria | 18372 |
| 701 | Ga0105249_10010938 | 3300009553 | Bacteria | 7976 |
| 702 | Ga0105249_10100212 | 3300009553 | Bacteria | 2723 |
| 703 | Ga0105249_10126916 | 3300009553 | Bacteria | 2430 |
| 704 | Ga0105249_10186127 | 3300009553 | Bacteria | 2023 |
| 705 | Ga0105249_10429554 | 3300009553 | Bacteria | 1356 |
| 706 | Ga0105249_10443821 | 3300009553 | Bacteria | 1335 |
| 707 | Ga0105249_10509109 | 3300009553 | Bacteria | 1250 |
| 708 | Ga0105249_10760621 | 3300009553 | Bacteria | 1031 |
| 709 | Ga0105249_11189580 | 3300009553 | Unclassified | 833 |
| 710 | Ga0105249_12083019 | 3300009553 | Bacteria | 640 |
| 711 | Ga0105249_12899344 | 3300009553 | Bacteria | 550 |
| 712 | Ga0105249_13210001 | 3300009553 | Bacteria | 526 |
| 713 | Ga0105239_10306116 | 3300010375 | Bacteria | 1790 |
| 714 | Ga0105239_10752940 | 3300010375 | Bacteria | 1115 |
| 715 | Ga0105239_11493707 | 3300010375 | Unclassified | 781 |
| 716 | Ga0105239_12373913 | 3300010375 | Unclassified | 617 |
| 717 | Ga0105246_10067739 | 3300011119 | Bacteria | 2502 |
| 718 | Ga0105246_10097922 | 3300011119 | Bacteria | 2130 |
| 719 | Ga0105246_10233965 | 3300011119 | Bacteria | 1448 |
| 720 | Ga0105246_10432807 | 3300011119 | Bacteria | 1101 |
| 721 | Ga0105246_10812444 | 3300011119 | Unclassified | 831 |
| 722 | Ga0105246_10929489 | 3300011119 | Bacteria | 782 |
| 723 | Ga0105246_11287137 | 3300011119 | Bacteria | 677 |
| 724 | Ga0105246_11752268 | 3300011119 | Unclassified | 592 |
| 725 | Ga0105246_11808314 | 3300011119 | Unclassified | 584 |
| 726 | Ga0105246_12089183 | 3300011119 | Bacteria | 549 |
| 727 | Ga0105246_12188252 | 3300011119 | Unclassified | 538 |
| 728 | Ga0157340_1029176 | 3300012473 | Unclassified | 507 |
| 729 | Ga0157338_1032792 | 3300012515 | Bacteria | 671 |
| 730 | Ga0157338_1050815 | 3300012515 | Bacteria | 594 |
| 731 | Ga0157374_10021438 | 3300013296 | Bacteria | 5749 |
| 732 | Ga0157374_10048064 | 3300013296 | Unclassified | 3958 |
| 733 | Ga0157374_10066565 | 3300013296 | Bacteria | 3385 |
| 734 | Ga0157374_11034639 | 3300013296 | Bacteria | 841 |
| 735 | Ga0157374_11362689 | 3300013296 | Bacteria | 732 |
| 736 | Ga0157374_11574076 | 3300013296 | Bacteria | 681 |
| 737 | Ga0157374_11683893 | 3300013296 | Bacteria | 659 |
| 738 | Ga0157378_10394632 | 3300013297 | Unclassified | 1362 |
| 739 | Ga0157378_10650748 | 3300013297 | Unclassified | 1069 |
| 740 | Ga0157378_11074870 | 3300013297 | Bacteria | 841 |
| 741 | Ga0157378_12351507 | 3300013297 | Bacteria | 585 |
| 742 | Ga0157378_12580044 | 3300013297 | Bacteria | 560 |
| 743 | Ga0163162_10004334 | 3300013306 | Bacteria | 13660 |
| 744 | Ga0163162_10152912 | 3300013306 | Bacteria | 2426 |
| 745 | Ga0163162_10182459 | 3300013306 | Bacteria | 2225 |
| 746 | Ga0163162_10713093 | 3300013306 | Bacteria | 1124 |
| 747 | Ga0157372_10955309 | 3300013307 | Unclassified | 993 |
| 748 | Ga0157375_10007634 | 3300013308 | Bacteria | 9462 |
| 749 | Ga0157375_10073762 | 3300013308 | Bacteria | 3432 |
| 750 | Ga0157375_10367371 | 3300013308 | Bacteria | 1605 |
| 751 | Ga0157375_10391922 | 3300013308 | Bacteria | 1556 |
| 752 | Ga0157375_10494410 | 3300013308 | Unclassified | 1388 |
| 753 | Ga0157375_10497327 | 3300013308 | Unclassified | 1383 |
| 754 | Ga0157375_10594134 | 3300013308 | Bacteria | 1266 |
| 755 | Ga0157375_10781761 | 3300013308 | Unclassified | 1104 |
| 756 | Ga0157375_11041688 | 3300013308 | Unclassified | 956 |
| 757 | Ga0157375_11113880 | 3300013308 | Bacteria | 924 |
| 758 | Ga0157375_12235632 | 3300013308 | Bacteria | 652 |
| 759 | Ga0163163_10000102 | 3300014325 | Bacteria | 90323 |
| 760 | Ga0163163_10024395 | 3300014325 | Bacteria | 5756 |
| 761 | Ga0163163_10036402 | 3300014325 | Bacteria | 4780 |
| 762 | Ga0163163_10036637 | 3300014325 | Bacteria | 4767 |
| 763 | Ga0163163_10053163 | 3300014325 | Bacteria | 3997 |
| 764 | Ga0163163_10104850 | 3300014325 | Bacteria | 2853 |
| 765 | Ga0163163_10151564 | 3300014325 | Unclassified | 2362 |
| 766 | Ga0163163_10240703 | 3300014325 | Bacteria | 1859 |
| 767 | Ga0163163_10486578 | 3300014325 | Bacteria | 1295 |
| 768 | Ga0163163_10555345 | 3300014325 | Unclassified | 1211 |
| 769 | Ga0163163_11009901 | 3300014325 | Bacteria | 895 |
| 770 | Ga0163163_11465475 | 3300014325 | Unclassified | 744 |
| 771 | Ga0163163_11751111 | 3300014325 | Unclassified | 682 |
| 772 | Ga0157380_10004941 | 3300014326 | Bacteria | 9294 |
| 773 | Ga0157380_10076184 | 3300014326 | Bacteria | 2729 |
| 774 | Ga0157380_10117078 | 3300014326 | Bacteria | 2250 |
| 775 | Ga0157380_10146531 | 3300014326 | Unclassified | 2035 |
| 776 | Ga0157380_10446625 | 3300014326 | Bacteria | 1241 |
| 777 | Ga0157380_10630304 | 3300014326 | Unclassified | 1066 |
| 778 | Ga0157380_11089834 | 3300014326 | Bacteria | 837 |
| 779 | Ga0157380_11358865 | 3300014326 | Bacteria | 760 |
| 780 | Ga0157380_11521902 | 3300014326 | Bacteria | 723 |
| 781 | Ga0157380_12580915 | 3300014326 | Bacteria | 574 |
| 782 | Ga0157377_10002651 | 3300014745 | Bacteria | 7940 |
| 783 | Ga0157377_10030505 | 3300014745 | Bacteria | 2921 |
| 784 | Ga0157377_10051420 | 3300014745 | Unclassified | 2324 |
| 785 | Ga0157377_10054164 | 3300014745 | Bacteria | 2270 |
| 786 | Ga0157377_10116303 | 3300014745 | Unclassified | 1615 |
| 787 | Ga0157377_10149198 | 3300014745 | Unclassified | 1444 |
| 788 | Ga0157377_10177609 | 3300014745 | Bacteria | 1336 |
| 789 | Ga0157377_10217065 | 3300014745 | Bacteria | 1222 |
| 790 | Ga0157377_10404422 | 3300014745 | Bacteria | 931 |
| 791 | Ga0157377_11335321 | 3300014745 | Bacteria | 562 |
| 792 | Ga0157379_10024281 | 3300014968 | Bacteria | 5382 |
| 793 | Ga0157379_10046835 | 3300014968 | Bacteria | 3858 |
| 794 | Ga0157379_10147237 | 3300014968 | Bacteria | 2124 |
| 795 | Ga0157379_11368901 | 3300014968 | Bacteria | 685 |
| 796 | Ga0157379_11621029 | 3300014968 | Unclassified | 632 |
| 797 | Ga0157379_11936121 | 3300014968 | Unclassified | 581 |
| 798 | Ga0157379_12029221 | 3300014968 | Unclassified | 569 |
| 799 | Ga0157379_12212562 | 3300014968 | Unclassified | 546 |
| 800 | Ga0157376_10012186 | 3300014969 | Bacteria | 6372 |
| 801 | Ga0157376_10019139 | 3300014969 | Bacteria | 5268 |
| 802 | Ga0157376_10044238 | 3300014969 | Bacteria | 3659 |
| 803 | Ga0157376_10090305 | 3300014969 | Bacteria | 2651 |
| 804 | Ga0157376_10250810 | 3300014969 | Bacteria | 1653 |
| 805 | Ga0157376_10453944 | 3300014969 | Bacteria | 1251 |
| 806 | Ga0157376_10989723 | 3300014969 | Bacteria | 863 |
| 807 | Ga0157376_12007452 | 3300014969 | Unclassified | 616 |
| 808 | Ga0182007_10036587 | 3300015262 | Bacteria | 1651 |
| 809 | Ga0163161_10049401 | 3300017792 | Unclassified | 3040 |
| 810 | Ga0163161_10482851 | 3300017792 | Bacteria | 1006 |
| 811 | Ga0163161_10538042 | 3300017792 | Unclassified | 956 |
| 812 | Ga0163161_10913255 | 3300017792 | Unclassified | 745 |
| 813 | Ga0207666_1046093 | 3300025271 | Unclassified | 686 |
| 814 | Ga0207666_1059364 | 3300025271 | Unclassified | 611 |
| 815 | Ga0207666_1082583 | 3300025271 | Unclassified | 519 |
| 816 | Ga0207673_1012663 | 3300025290 | Bacteria | 1100 |
| 817 | Ga0207697_10000557 | 3300025315 | Bacteria | 21112 |
| 818 | Ga0207697_10000899 | 3300025315 | Bacteria | 16838 |
| 819 | Ga0207697_10110981 | 3300025315 | Unclassified | 1174 |
| 820 | Ga0207697_10148539 | 3300025315 | Bacteria | 1019 |
| 821 | Ga0207697_10250085 | 3300025315 | Bacteria | 784 |
| 822 | Ga0207697_10305303 | 3300025315 | Unclassified | 706 |
| 823 | Ga0207697_10512617 | 3300025315 | Unclassified | 529 |
| 824 | Ga0207656_10189509 | 3300025321 | Bacteria | 990 |
| 825 | Ga0207655_1219627 | 3300025728 | Unclassified | 555 |
| 826 | Ga0207653_10127727 | 3300025885 | Unclassified | 920 |
| 827 | Ga0207653_10319498 | 3300025885 | Unclassified | 604 |
| 828 | Ga0207653_10366743 | 3300025885 | Bacteria | 563 |
| 829 | Ga0207653_10367591 | 3300025885 | Bacteria | 563 |
| 830 | Ga0207682_10000186 | 3300025893 | Bacteria | 28174 |
| 831 | Ga0207682_10014137 | 3300025893 | Bacteria | 3111 |
| 832 | Ga0207682_10040344 | 3300025893 | Bacteria | 1902 |
| 833 | Ga0207682_10060826 | 3300025893 | Unclassified | 1580 |
| 834 | Ga0207682_10335232 | 3300025893 | Bacteria | 711 |
| 835 | Ga0207642_10017497 | 3300025899 | Bacteria | 2728 |
| 836 | Ga0207642_10087014 | 3300025899 | Bacteria | 1533 |
| 837 | Ga0207642_10172515 | 3300025899 | Unclassified | 1171 |
| 838 | Ga0207642_11002617 | 3300025899 | Unclassified | 538 |
| 839 | Ga0207710_10725238 | 3300025900 | Bacteria | 522 |
| 840 | Ga0207710_10737924 | 3300025900 | Bacteria | 517 |
| 841 | Ga0207688_10000494 | 3300025901 | Bacteria | 18956 |
| 842 | Ga0207688_10001543 | 3300025901 | Bacteria | 12099 |
| 843 | Ga0207688_10018436 | 3300025901 | Bacteria | 3799 |
| 844 | Ga0207688_10032610 | 3300025901 | Bacteria | 2880 |
| 845 | Ga0207688_10108910 | 3300025901 | Unclassified | 1606 |
| 846 | Ga0207688_10282262 | 3300025901 | Bacteria | 1012 |
| 847 | Ga0207688_10669544 | 3300025901 | Bacteria | 656 |
| 848 | Ga0207688_10715100 | 3300025901 | Bacteria | 634 |
| 849 | Ga0207680_10057352 | 3300025903 | Bacteria | 2356 |
| 850 | Ga0207680_10147302 | 3300025903 | Bacteria | 1567 |
| 851 | Ga0207680_10194094 | 3300025903 | Bacteria | 1380 |
| 852 | Ga0207680_10366087 | 3300025903 | Unclassified | 1014 |
| 853 | Ga0207680_10584443 | 3300025903 | Bacteria | 798 |
| 854 | Ga0207680_11033642 | 3300025903 | Bacteria | 588 |
| 855 | Ga0207647_10134019 | 3300025904 | Bacteria | 1454 |
| 856 | Ga0207647_10359699 | 3300025904 | Unclassified | 824 |
| 857 | Ga0207645_10002060 | 3300025907 | Bacteria | 16108 |
| 858 | Ga0207645_10020853 | 3300025907 | Bacteria | 4281 |
| 859 | Ga0207645_10066251 | 3300025907 | Bacteria | 2309 |
| 860 | Ga0207645_10148707 | 3300025907 | Bacteria | 1528 |
| 861 | Ga0207645_10191644 | 3300025907 | Bacteria | 1344 |
| 862 | Ga0207645_10280837 | 3300025907 | Bacteria | 1106 |
| 863 | Ga0207645_10296201 | 3300025907 | Bacteria | 1076 |
| 864 | Ga0207645_10590277 | 3300025907 | Unclassified | 754 |
| 865 | Ga0207643_10003832 | 3300025908 | Bacteria | 8090 |
| 866 | Ga0207643_10005261 | 3300025908 | Bacteria | 6920 |
| 867 | Ga0207643_10009423 | 3300025908 | Bacteria | 5247 |
| 868 | Ga0207643_10017014 | 3300025908 | Bacteria | 3970 |
| 869 | Ga0207643_10020305 | 3300025908 | Bacteria | 3646 |
| 870 | Ga0207643_10024361 | 3300025908 | Bacteria | 3339 |
| 871 | Ga0207643_10069135 | 3300025908 | Unclassified | 2029 |
| 872 | Ga0207643_10220489 | 3300025908 | Bacteria | 1161 |
| 873 | Ga0207643_10298666 | 3300025908 | Bacteria | 1002 |
| 874 | Ga0207643_10492588 | 3300025908 | Bacteria | 783 |
| 875 | Ga0207643_10881323 | 3300025908 | Bacteria | 580 |
| 876 | Ga0207643_10914073 | 3300025908 | Unclassified | 569 |
| 877 | Ga0207684_10138448 | 3300025910 | Bacteria | 2091 |
| 878 | Ga0207684_10865084 | 3300025910 | Bacteria | 761 |
| 879 | Ga0207684_10867704 | 3300025910 | Bacteria | 760 |
| 880 | Ga0207684_11134593 | 3300025910 | Bacteria | 650 |
| 881 | Ga0207654_10226963 | 3300025911 | Bacteria | 1242 |
| 882 | Ga0207654_11400493 | 3300025911 | Unclassified | 510 |
| 883 | Ga0207695_10521311 | 3300025913 | Unclassified | 1070 |
| 884 | Ga0207671_10534168 | 3300025914 | Bacteria | 935 |
| 885 | Ga0207671_11142824 | 3300025914 | Bacteria | 611 |
| 886 | Ga0207693_10129894 | 3300025915 | Bacteria | 1980 |
| 887 | Ga0207660_10193513 | 3300025917 | Bacteria | 1585 |
| 888 | Ga0207660_10209320 | 3300025917 | Unclassified | 1526 |
| 889 | Ga0207660_10896575 | 3300025917 | Bacteria | 724 |
| 890 | Ga0207662_10002386 | 3300025918 | Bacteria | 9418 |
| 891 | Ga0207662_10005226 | 3300025918 | Bacteria | 6891 |
| 892 | Ga0207662_10033659 | 3300025918 | Unclassified | 2989 |
| 893 | Ga0207662_10049288 | 3300025918 | Bacteria | 2498 |
| 894 | Ga0207662_11140088 | 3300025918 | Unclassified | 554 |
| 895 | Ga0207657_10314099 | 3300025919 | Bacteria | 1240 |
| 896 | Ga0207649_10065923 | 3300025920 | Unclassified | 2294 |
| 897 | Ga0207649_10144310 | 3300025920 | Bacteria | 1632 |
| 898 | Ga0207649_10510801 | 3300025920 | Bacteria | 915 |
| 899 | Ga0207649_10580144 | 3300025920 | Bacteria | 861 |
| 900 | Ga0207652_10776355 | 3300025921 | Unclassified | 852 |
| 901 | Ga0207646_10044784 | 3300025922 | Bacteria | 3972 |
| 902 | Ga0207646_10267934 | 3300025922 | Unclassified | 1544 |
| 903 | Ga0207646_10411180 | 3300025922 | Bacteria | 1222 |
| 904 | Ga0207681_10004356 | 3300025923 | Bacteria | 8730 |
| 905 | Ga0207681_10026187 | 3300025923 | Unclassified | 3759 |
| 906 | Ga0207681_10038136 | 3300025923 | Bacteria | 3181 |
| 907 | Ga0207681_10074874 | 3300025923 | Bacteria | 2373 |
| 908 | Ga0207681_10083145 | 3300025923 | Bacteria | 2265 |
| 909 | Ga0207681_10087869 | 3300025923 | Bacteria | 2213 |
| 910 | Ga0207681_10112670 | 3300025923 | Bacteria | 1982 |
| 911 | Ga0207681_10174157 | 3300025923 | Unclassified | 1633 |
| 912 | Ga0207681_10264821 | 3300025923 | Unclassified | 1347 |
| 913 | Ga0207681_10309460 | 3300025923 | Unclassified | 1253 |
| 914 | Ga0207681_10315046 | 3300025923 | Archaea | 1242 |
| 915 | Ga0207681_10658944 | 3300025923 | Bacteria | 868 |
| 916 | Ga0207681_10897698 | 3300025923 | Bacteria | 742 |
| 917 | Ga0207681_11006233 | 3300025923 | Bacteria | 699 |
| 918 | Ga0207681_11175295 | 3300025923 | Bacteria | 644 |
| 919 | Ga0207681_11856117 | 3300025923 | Bacteria | 502 |
| 920 | Ga0207694_10441609 | 3300025924 | Bacteria | 1085 |
| 921 | Ga0207694_11073690 | 3300025924 | Unclassified | 681 |
| 922 | Ga0207694_11362525 | 3300025924 | Unclassified | 600 |
| 923 | Ga0207650_10011729 | 3300025925 | Bacteria | 6042 |
| 924 | Ga0207650_10025966 | 3300025925 | Bacteria | 4176 |
| 925 | Ga0207650_10043885 | 3300025925 | Bacteria | 3284 |
| 926 | Ga0207650_10046208 | 3300025925 | Bacteria | 3206 |
| 927 | Ga0207650_10047373 | 3300025925 | Bacteria | 3168 |
| 928 | Ga0207650_10079369 | 3300025925 | Bacteria | 2485 |
| 929 | Ga0207650_10089079 | 3300025925 | Unclassified | 2354 |
| 930 | Ga0207650_10499904 | 3300025925 | Bacteria | 1016 |
| 931 | Ga0207650_10709782 | 3300025925 | Unclassified | 850 |
| 932 | Ga0207650_11245098 | 3300025925 | Bacteria | 633 |
| 933 | Ga0207650_11435076 | 3300025925 | Unclassified | 587 |
| 934 | Ga0207659_10000525 | 3300025926 | Bacteria | 22880 |
| 935 | Ga0207659_10001560 | 3300025926 | Bacteria | 13610 |
| 936 | Ga0207659_10010785 | 3300025926 | Bacteria | 5750 |
| 937 | Ga0207659_10015165 | 3300025926 | Bacteria | 4986 |
| 938 | Ga0207659_10028677 | 3300025926 | Bacteria | 3785 |
| 939 | Ga0207659_10090748 | 3300025926 | Bacteria | 2281 |
| 940 | Ga0207659_10137364 | 3300025926 | Bacteria | 1894 |
| 941 | Ga0207659_10170738 | 3300025926 | Unclassified | 1715 |
| 942 | Ga0207659_10175532 | 3300025926 | Unclassified | 1693 |
| 943 | Ga0207659_10183250 | 3300025926 | Bacteria | 1661 |
| 944 | Ga0207659_10346947 | 3300025926 | Unclassified | 1231 |
| 945 | Ga0207659_10395222 | 3300025926 | Bacteria | 1155 |
| 946 | Ga0207659_10426335 | 3300025926 | Unclassified | 1113 |
| 947 | Ga0207659_10464268 | 3300025926 | Bacteria | 1068 |
| 948 | Ga0207659_10692925 | 3300025926 | Bacteria | 872 |
| 949 | Ga0207659_10790215 | 3300025926 | Bacteria | 815 |
| 950 | Ga0207659_10933106 | 3300025926 | Unclassified | 746 |
| 951 | Ga0207687_10020934 | 3300025927 | Bacteria | 4341 |
| 952 | Ga0207687_10043876 | 3300025927 | Bacteria | 3083 |
| 953 | Ga0207687_10216885 | 3300025927 | Unclassified | 1504 |
| 954 | Ga0207687_10244605 | 3300025927 | Bacteria | 1423 |
| 955 | Ga0207687_10361257 | 3300025927 | Bacteria | 1185 |
| 956 | Ga0207700_10077099 | 3300025928 | Unclassified | 2588 |
| 957 | Ga0207644_10013931 | 3300025931 | Bacteria | 5373 |
| 958 | Ga0207644_10049254 | 3300025931 | Bacteria | 3015 |
| 959 | Ga0207644_10078698 | 3300025931 | Bacteria | 2431 |
| 960 | Ga0207644_10146421 | 3300025931 | Bacteria | 1824 |
| 961 | Ga0207644_10163956 | 3300025931 | Bacteria | 1730 |
| 962 | Ga0207644_10419316 | 3300025931 | Bacteria | 1096 |
| 963 | Ga0207644_10618829 | 3300025931 | Bacteria | 900 |
| 964 | Ga0207644_10876194 | 3300025931 | Unclassified | 752 |
| 965 | Ga0207690_10426924 | 3300025932 | Bacteria | 1061 |
| 966 | Ga0207690_10636242 | 3300025932 | Bacteria | 873 |
| 967 | Ga0207690_10700717 | 3300025932 | Unclassified | 832 |
| 968 | Ga0207690_10834413 | 3300025932 | Bacteria | 763 |
| 969 | Ga0207706_10002818 | 3300025933 | Bacteria | 16869 |
| 970 | Ga0207706_10023273 | 3300025933 | Bacteria | 5564 |
| 971 | Ga0207706_10070211 | 3300025933 | Bacteria | 3081 |
| 972 | Ga0207706_10074379 | 3300025933 | Bacteria | 2987 |
| 973 | Ga0207706_10089308 | 3300025933 | Bacteria | 2709 |
| 974 | Ga0207706_10498984 | 3300025933 | Unclassified | 1051 |
| 975 | Ga0207706_10615635 | 3300025933 | Bacteria | 932 |
| 976 | Ga0207706_10917446 | 3300025933 | Bacteria | 739 |
| 977 | Ga0207706_11121711 | 3300025933 | Bacteria | 656 |
| 978 | Ga0207706_11229093 | 3300025933 | Bacteria | 622 |
| 979 | Ga0207686_10022441 | 3300025934 | Bacteria | 3635 |
| 980 | Ga0207686_10082946 | 3300025934 | Bacteria | 2097 |
| 981 | Ga0207686_10260816 | 3300025934 | Bacteria | 1271 |
| 982 | Ga0207686_10285381 | 3300025934 | Bacteria | 1220 |
| 983 | Ga0207686_10735922 | 3300025934 | Unclassified | 786 |
| 984 | Ga0207686_11471527 | 3300025934 | Unclassified | 561 |
| 985 | Ga0207709_10098698 | 3300025935 | Bacteria | 1926 |
| 986 | Ga0207709_10207557 | 3300025935 | Bacteria | 1403 |
| 987 | Ga0207709_10618520 | 3300025935 | Bacteria | 859 |
| 988 | Ga0207709_10721743 | 3300025935 | Bacteria | 799 |
| 989 | Ga0207709_10730091 | 3300025935 | Bacteria | 795 |
| 990 | Ga0207709_11052691 | 3300025935 | Bacteria | 667 |
| 991 | Ga0207709_11523010 | 3300025935 | Unclassified | 555 |
| 992 | Ga0207709_11773756 | 3300025935 | Unclassified | 513 |
| 993 | Ga0207670_10006992 | 3300025936 | Bacteria | 6283 |
| 994 | Ga0207670_10008277 | 3300025936 | Bacteria | 5862 |
| 995 | Ga0207670_10013010 | 3300025936 | Bacteria | 4893 |
| 996 | Ga0207670_10132586 | 3300025936 | Bacteria | 1827 |
| 997 | Ga0207670_10260395 | 3300025936 | Bacteria | 1344 |
| 998 | Ga0207670_10401507 | 3300025936 | Bacteria | 1096 |
| 999 | Ga0207670_10912096 | 3300025936 | Bacteria | 736 |
| 1000 | Ga0207669_10008290 | 3300025937 | Bacteria | 4869 |
| 1001 | Ga0207669_10011854 | 3300025937 | Bacteria | 4261 |
| 1002 | Ga0207669_10025104 | 3300025937 | Bacteria | 3214 |
| 1003 | Ga0207669_10107907 | 3300025937 | Bacteria | 1858 |
| 1004 | Ga0207669_10225599 | 3300025937 | Bacteria | 1378 |
| 1005 | Ga0207669_10234491 | 3300025937 | Bacteria | 1356 |
| 1006 | Ga0207669_11314077 | 3300025937 | Unclassified | 614 |
| 1007 | Ga0207704_10124735 | 3300025938 | Unclassified | 1770 |
| 1008 | Ga0207704_10128765 | 3300025938 | Unclassified | 1748 |
| 1009 | Ga0207704_10822011 | 3300025938 | Bacteria | 777 |
| 1010 | Ga0207704_11161331 | 3300025938 | Unclassified | 657 |
| 1011 | Ga0207691_10000539 | 3300025940 | Bacteria | 37872 |
| 1012 | Ga0207691_10031502 | 3300025940 | Bacteria | 4948 |
| 1013 | Ga0207691_10033194 | 3300025940 | Bacteria | 4805 |
| 1014 | Ga0207691_10051037 | 3300025940 | Bacteria | 3784 |
| 1015 | Ga0207691_10057852 | 3300025940 | Unclassified | 3527 |
| 1016 | Ga0207691_10083406 | 3300025940 | Bacteria | 2869 |
| 1017 | Ga0207691_10098415 | 3300025940 | Bacteria | 2613 |
| 1018 | Ga0207691_10220431 | 3300025940 | Bacteria | 1645 |
| 1019 | Ga0207691_10291201 | 3300025940 | Bacteria | 1404 |
| 1020 | Ga0207691_10319290 | 3300025940 | Bacteria | 1332 |
| 1021 | Ga0207691_10630269 | 3300025940 | Bacteria | 907 |
| 1022 | Ga0207691_10685754 | 3300025940 | Bacteria | 864 |
| 1023 | Ga0207691_10724010 | 3300025940 | Unclassified | 838 |
| 1024 | Ga0207691_11002936 | 3300025940 | Bacteria | 697 |
| 1025 | Ga0207691_11393184 | 3300025940 | Unclassified | 576 |
| 1026 | Ga0207711_10053130 | 3300025941 | Bacteria | 3475 |
| 1027 | Ga0207711_10069281 | 3300025941 | Bacteria | 3057 |
| 1028 | Ga0207711_10087530 | 3300025941 | Bacteria | 2733 |
| 1029 | Ga0207711_10133073 | 3300025941 | Bacteria | 2231 |
| 1030 | Ga0207711_10271029 | 3300025941 | Bacteria | 1562 |
| 1031 | Ga0207711_10334638 | 3300025941 | Bacteria | 1401 |
| 1032 | Ga0207711_10347566 | 3300025941 | Bacteria | 1373 |
| 1033 | Ga0207711_10496356 | 3300025941 | Bacteria | 1137 |
| 1034 | Ga0207711_10546295 | 3300025941 | Bacteria | 1081 |
| 1035 | Ga0207711_10552918 | 3300025941 | Bacteria | 1074 |
| 1036 | Ga0207711_10796268 | 3300025941 | Unclassified | 880 |
| 1037 | Ga0207711_11051947 | 3300025941 | Bacteria | 754 |
| 1038 | Ga0207711_11450141 | 3300025941 | Bacteria | 629 |
| 1039 | Ga0207711_11904628 | 3300025941 | Bacteria | 537 |
| 1040 | Ga0207689_10000847 | 3300025942 | Bacteria | 29431 |
| 1041 | Ga0207689_10017160 | 3300025942 | Bacteria | 6127 |
| 1042 | Ga0207689_10050612 | 3300025942 | Bacteria | 3425 |
| 1043 | Ga0207689_10074868 | 3300025942 | Unclassified | 2782 |
| 1044 | Ga0207689_10099553 | 3300025942 | Unclassified | 2389 |
| 1045 | Ga0207689_10136569 | 3300025942 | Bacteria | 2019 |
| 1046 | Ga0207689_10229442 | 3300025942 | Unclassified | 1534 |
| 1047 | Ga0207689_10236389 | 3300025942 | Bacteria | 1510 |
| 1048 | Ga0207689_10941589 | 3300025942 | Bacteria | 729 |
| 1049 | Ga0207689_11178444 | 3300025942 | Bacteria | 645 |
| 1050 | Ga0207661_10018712 | 3300025944 | Bacteria | 5151 |
| 1051 | Ga0207661_10068325 | 3300025944 | Unclassified | 2893 |
| 1052 | Ga0207679_10054448 | 3300025945 | Bacteria | 2945 |
| 1053 | Ga0207679_10057470 | 3300025945 | Bacteria | 2877 |
| 1054 | Ga0207679_10080819 | 3300025945 | Bacteria | 2483 |
| 1055 | Ga0207679_10102956 | 3300025945 | Bacteria | 2237 |
| 1056 | Ga0207679_10218537 | 3300025945 | Bacteria | 1602 |
| 1057 | Ga0207679_10233603 | 3300025945 | Bacteria | 1554 |
| 1058 | Ga0207679_10326416 | 3300025945 | Unclassified | 1330 |
| 1059 | Ga0207679_10383363 | 3300025945 | Unclassified | 1233 |
| 1060 | Ga0207679_10521891 | 3300025945 | Unclassified | 1062 |
| 1061 | Ga0207679_10850565 | 3300025945 | Bacteria | 833 |
| 1062 | Ga0207667_10923705 | 3300025949 | Bacteria | 863 |
| 1063 | Ga0207651_10039967 | 3300025960 | Bacteria | 3098 |
| 1064 | Ga0207651_10076917 | 3300025960 | Unclassified | 2387 |
| 1065 | Ga0207651_10219296 | 3300025960 | Bacteria | 1536 |
| 1066 | Ga0207651_10225015 | 3300025960 | Bacteria | 1519 |
| 1067 | Ga0207651_10550586 | 3300025960 | Bacteria | 1003 |
| 1068 | Ga0207651_11118538 | 3300025960 | Unclassified | 706 |
| 1069 | Ga0207651_11715163 | 3300025960 | Unclassified | 566 |
| 1070 | Ga0207712_10005058 | 3300025961 | Bacteria | 8348 |
| 1071 | Ga0207712_10005530 | 3300025961 | Bacteria | 7971 |
| 1072 | Ga0207712_10007979 | 3300025961 | Bacteria | 6691 |
| 1073 | Ga0207712_10165018 | 3300025961 | Bacteria | 1725 |
| 1074 | Ga0207712_10201544 | 3300025961 | Bacteria | 1578 |
| 1075 | Ga0207712_10281393 | 3300025961 | Bacteria | 1358 |
| 1076 | Ga0207712_10384740 | 3300025961 | Bacteria | 1175 |
| 1077 | Ga0207712_10459485 | 3300025961 | Bacteria | 1081 |
| 1078 | Ga0207712_11801212 | 3300025961 | Bacteria | 549 |
| 1079 | Ga0207668_10071623 | 3300025972 | Bacteria | 2477 |
| 1080 | Ga0207668_10087722 | 3300025972 | Bacteria | 2276 |
| 1081 | Ga0207668_10097797 | 3300025972 | Unclassified | 2173 |
| 1082 | Ga0207668_10301313 | 3300025972 | Bacteria | 1323 |
| 1083 | Ga0207668_10526411 | 3300025972 | Bacteria | 1021 |
| 1084 | Ga0207668_11082518 | 3300025972 | Unclassified | 718 |
| 1085 | Ga0207668_11191638 | 3300025972 | Bacteria | 684 |
| 1086 | Ga0207640_10092033 | 3300025981 | Bacteria | 2102 |
| 1087 | Ga0207640_10180240 | 3300025981 | Bacteria | 1583 |
| 1088 | Ga0207640_10265080 | 3300025981 | Bacteria | 1341 |
| 1089 | Ga0207640_10356803 | 3300025981 | Bacteria | 1176 |
| 1090 | Ga0207658_10085354 | 3300025986 | Bacteria | 2431 |
| 1091 | Ga0207658_11657046 | 3300025986 | Unclassified | 584 |
| 1092 | Ga0207658_11935517 | 3300025986 | Unclassified | 537 |
| 1093 | Ga0207677_10007225 | 3300026023 | Bacteria | 6122 |
| 1094 | Ga0207677_10123842 | 3300026023 | Bacteria | 1950 |
| 1095 | Ga0207677_10136227 | 3300026023 | Bacteria | 1873 |
| 1096 | Ga0207677_10280917 | 3300026023 | Bacteria | 1367 |
| 1097 | Ga0207677_10588251 | 3300026023 | Bacteria | 975 |
| 1098 | Ga0207677_10602233 | 3300026023 | Unclassified | 964 |
| 1099 | Ga0207677_11588866 | 3300026023 | Bacteria | 605 |
| 1100 | Ga0207703_10008503 | 3300026035 | Bacteria | 8108 |
| 1101 | Ga0207703_10037356 | 3300026035 | Bacteria | 3868 |
| 1102 | Ga0207703_10090077 | 3300026035 | Bacteria | 2577 |
| 1103 | Ga0207703_10191370 | 3300026035 | Bacteria | 1812 |
| 1104 | Ga0207703_10413164 | 3300026035 | Bacteria | 1254 |
| 1105 | Ga0207703_10416561 | 3300026035 | Bacteria | 1249 |
| 1106 | Ga0207703_10627176 | 3300026035 | Unclassified | 1018 |
| 1107 | Ga0207639_10420103 | 3300026041 | Bacteria | 1209 |
| 1108 | Ga0207639_11843054 | 3300026041 | Unclassified | 566 |
| 1109 | Ga0207678_10053358 | 3300026067 | Bacteria | 3483 |
| 1110 | Ga0207678_10075319 | 3300026067 | Bacteria | 2891 |
| 1111 | Ga0207678_10223042 | 3300026067 | Unclassified | 1614 |
| 1112 | Ga0207678_10672467 | 3300026067 | Bacteria | 910 |
| 1113 | Ga0207678_11116314 | 3300026067 | Unclassified | 698 |
| 1114 | Ga0207678_11557866 | 3300026067 | Bacteria | 583 |
| 1115 | Ga0207678_11623460 | 3300026067 | Bacteria | 569 |
| 1116 | Ga0207708_10003479 | 3300026075 | Bacteria | 11610 |
| 1117 | Ga0207708_10008243 | 3300026075 | Bacteria | 7718 |
| 1118 | Ga0207708_10019304 | 3300026075 | Bacteria | 5137 |
| 1119 | Ga0207708_10019428 | 3300026075 | Bacteria | 5122 |
| 1120 | Ga0207708_10034888 | 3300026075 | Bacteria | 3827 |
| 1121 | Ga0207708_10093684 | 3300026075 | Bacteria | 2318 |
| 1122 | Ga0207708_10115418 | 3300026075 | Unclassified | 2088 |
| 1123 | Ga0207708_10209484 | 3300026075 | Unclassified | 1558 |
| 1124 | Ga0207708_10364852 | 3300026075 | Bacteria | 1188 |
| 1125 | Ga0207708_10425630 | 3300026075 | Bacteria | 1102 |
| 1126 | Ga0207708_10681055 | 3300026075 | Unclassified | 878 |
| 1127 | Ga0207708_10949051 | 3300026075 | Bacteria | 746 |
| 1128 | Ga0207708_10975213 | 3300026075 | Unclassified | 736 |
| 1129 | Ga0207641_10169479 | 3300026088 | Bacteria | 1991 |
| 1130 | Ga0207641_10170800 | 3300026088 | Bacteria | 1984 |
| 1131 | Ga0207641_10322997 | 3300026088 | Bacteria | 1464 |
| 1132 | Ga0207641_10376550 | 3300026088 | Unclassified | 1358 |
| 1133 | Ga0207641_10709807 | 3300026088 | Unclassified | 991 |
| 1134 | Ga0207641_10825469 | 3300026088 | Bacteria | 918 |
| 1135 | Ga0207648_10004841 | 3300026089 | Bacteria | 13731 |
| 1136 | Ga0207648_10005699 | 3300026089 | Bacteria | 12491 |
| 1137 | Ga0207648_10012289 | 3300026089 | Bacteria | 8017 |
| 1138 | Ga0207648_10014111 | 3300026089 | Bacteria | 7390 |
| 1139 | Ga0207648_10088244 | 3300026089 | Unclassified | 2708 |
| 1140 | Ga0207648_10181528 | 3300026089 | Bacteria | 1863 |
| 1141 | Ga0207648_10228116 | 3300026089 | Bacteria | 1656 |
| 1142 | Ga0207648_10254657 | 3300026089 | Unclassified | 1565 |
| 1143 | Ga0207648_10299086 | 3300026089 | Bacteria | 1443 |
| 1144 | Ga0207648_10300115 | 3300026089 | Unclassified | 1440 |
| 1145 | Ga0207648_10714936 | 3300026089 | Unclassified | 929 |
| 1146 | Ga0207648_11586731 | 3300026089 | Unclassified | 615 |
| 1147 | Ga0207676_10013947 | 3300026095 | Bacteria | 5769 |
| 1148 | Ga0207676_10039742 | 3300026095 | Bacteria | 3601 |
| 1149 | Ga0207676_10100868 | 3300026095 | Bacteria | 2393 |
| 1150 | Ga0207676_10144125 | 3300026095 | Bacteria | 2043 |
| 1151 | Ga0207676_10400797 | 3300026095 | Bacteria | 1282 |
| 1152 | Ga0207676_10511891 | 3300026095 | Unclassified | 1141 |
| 1153 | Ga0207676_10729006 | 3300026095 | Bacteria | 962 |
| 1154 | Ga0207676_10741621 | 3300026095 | Unclassified | 954 |
| 1155 | Ga0207676_10798715 | 3300026095 | Bacteria | 920 |
| 1156 | Ga0207676_10811396 | 3300026095 | Unclassified | 913 |
| 1157 | Ga0207674_10015066 | 3300026116 | Bacteria | 8514 |
| 1158 | Ga0207674_10016569 | 3300026116 | Bacteria | 8060 |
| 1159 | Ga0207674_10192041 | 3300026116 | Bacteria | 1992 |
| 1160 | Ga0207674_10302986 | 3300026116 | Unclassified | 1547 |
| 1161 | Ga0207674_10417052 | 3300026116 | Unclassified | 1297 |
| 1162 | Ga0207674_10608697 | 3300026116 | Unclassified | 1055 |
| 1163 | Ga0207674_10857797 | 3300026116 | Bacteria | 876 |
| 1164 | Ga0207674_11620808 | 3300026116 | Bacteria | 616 |
| 1165 | Ga0207675_100000755 | 3300026118 | Bacteria | 32180 |
| 1166 | Ga0207675_100010552 | 3300026118 | Bacteria | 8654 |
| 1167 | Ga0207675_100031807 | 3300026118 | Bacteria | 4916 |
| 1168 | Ga0207675_100079772 | 3300026118 | Bacteria | 3068 |
| 1169 | Ga0207675_100140759 | 3300026118 | Bacteria | 2292 |
| 1170 | Ga0207675_100186687 | 3300026118 | Bacteria | 1987 |
| 1171 | Ga0207675_100253757 | 3300026118 | Unclassified | 1703 |
| 1172 | Ga0207675_100256279 | 3300026118 | Bacteria | 1695 |
| 1173 | Ga0207675_100947431 | 3300026118 | Bacteria | 878 |
| 1174 | Ga0207675_101105698 | 3300026118 | Unclassified | 812 |
| 1175 | Ga0207675_101408366 | 3300026118 | Archaea | 718 |
| 1176 | Ga0207675_102376495 | 3300026118 | Unclassified | 543 |
| 1177 | Ga0207683_10014341 | 3300026121 | Bacteria | 6752 |
| 1178 | Ga0207683_10129526 | 3300026121 | Unclassified | 2269 |
| 1179 | Ga0207683_10176125 | 3300026121 | Unclassified | 1938 |
| 1180 | Ga0207683_10212491 | 3300026121 | Bacteria | 1761 |
| 1181 | Ga0207683_10257429 | 3300026121 | Unclassified | 1593 |
| 1182 | Ga0207683_10514864 | 3300026121 | Bacteria | 1106 |
| 1183 | Ga0207698_10037502 | 3300026142 | Bacteria | 3571 |
| 1184 | Ga0209971_1043501 | 3300027682 | Bacteria | 1082 |
| 1185 | Ga0209966_1080682 | 3300027695 | Bacteria | 721 |
| 1186 | Ga0209998_10039227 | 3300027717 | Bacteria | 1071 |
| 1187 | Ga0209813_10050903 | 3300027866 | Bacteria | 1294 |
| 1188 | Ga0209813_10076183 | 3300027866 | Bacteria | 1100 |
| 1189 | Ga0209813_10101398 | 3300027866 | Bacteria | 980 |
| 1190 | Ga0209974_10070987 | 3300027876 | Bacteria | 1188 |
| 1191 | Ga0209974_10092288 | 3300027876 | Unclassified | 1051 |
| 1192 | Ga0207428_10001458 | 3300027907 | Bacteria | 24726 |
| 1193 | Ga0207428_10006998 | 3300027907 | Bacteria | 10330 |
| 1194 | Ga0207428_10016020 | 3300027907 | Bacteria | 6461 |
| 1195 | Ga0207428_10017364 | 3300027907 | Bacteria | 6177 |
| 1196 | Ga0207428_10027241 | 3300027907 | Bacteria | 4760 |
| 1197 | Ga0207428_10046391 | 3300027907 | Bacteria | 3495 |
| 1198 | Ga0207428_10252306 | 3300027907 | Unclassified | 1315 |
| 1199 | Ga0207428_10564489 | 3300027907 | Unclassified | 822 |
| 1200 | Ga0268266_10001356 | 3300028379 | Bacteria | 29568 |
| 1201 | Ga0268266_10027926 | 3300028379 | Bacteria | 4799 |
| 1202 | Ga0268266_10226764 | 3300028379 | Bacteria | 1719 |
| 1203 | Ga0268266_10818023 | 3300028379 | Bacteria | 900 |
| 1204 | Ga0268265_10002680 | 3300028380 | Bacteria | 13198 |
| 1205 | Ga0268265_10011758 | 3300028380 | Bacteria | 5921 |
| 1206 | Ga0268265_10026033 | 3300028380 | Bacteria | 4158 |
| 1207 | Ga0268265_10057883 | 3300028380 | Bacteria | 2957 |
| 1208 | Ga0268265_10201570 | 3300028380 | Bacteria | 1727 |
| 1209 | Ga0268265_10281830 | 3300028380 | Unclassified | 1487 |
| 1210 | Ga0268265_10284537 | 3300028380 | Bacteria | 1481 |
| 1211 | Ga0268265_10393119 | 3300028380 | Bacteria | 1279 |
| 1212 | Ga0268265_10399966 | 3300028380 | Bacteria | 1269 |
| 1213 | Ga0268265_10972563 | 3300028380 | Bacteria | 837 |
| 1214 | Ga0268265_11113613 | 3300028380 | Bacteria | 784 |
| 1215 | Ga0268265_11639726 | 3300028380 | Unclassified | 648 |
| 1216 | Ga0268265_11654696 | 3300028380 | Bacteria | 645 |
| 1217 | Ga0268264_10011509 | 3300028381 | Bacteria | 7308 |
| 1218 | Ga0268264_10078214 | 3300028381 | Bacteria | 2819 |
| 1219 | Ga0268264_10118588 | 3300028381 | Bacteria | 2329 |
| 1220 | Ga0268264_10201191 | 3300028381 | Bacteria | 1822 |
| 1221 | Ga0268264_10311222 | 3300028381 | Bacteria | 1486 |
| 1222 | Ga0268264_10571068 | 3300028381 | Unclassified | 1112 |
| 1223 | Ga0307408_100002942 | 3300031548 | Bacteria | 11800 |
| 1224 | Ga0307408_100005179 | 3300031548 | Bacteria | 8745 |
| 1225 | Ga0307408_100019020 | 3300031548 | Bacteria | 4620 |
| 1226 | Ga0307408_100194772 | 3300031548 | Bacteria | 1636 |
| 1227 | Ga0307408_100240672 | 3300031548 | Bacteria | 1487 |
| 1228 | Ga0307408_100264891 | 3300031548 | Unclassified | 1424 |
| 1229 | Ga0307408_100287332 | 3300031548 | Bacteria | 1372 |
| 1230 | Ga0307408_100394406 | 3300031548 | Bacteria | 1187 |
| 1231 | Ga0307408_100435977 | 3300031548 | Bacteria | 1133 |
| 1232 | Ga0307408_100495288 | 3300031548 | Unclassified | 1069 |
| 1233 | Ga0307408_100895013 | 3300031548 | Bacteria | 812 |
| 1234 | Ga0307408_101015345 | 3300031548 | Unclassified | 765 |
| 1235 | Ga0307408_101213449 | 3300031548 | Unclassified | 704 |
| 1236 | Ga0307405_10000924 | 3300031731 | Bacteria | 11681 |
| 1237 | Ga0307405_10504047 | 3300031731 | Bacteria | 971 |
| 1238 | Ga0307405_10664274 | 3300031731 | Unclassified | 859 |
| 1239 | Ga0307405_10678864 | 3300031731 | Bacteria | 850 |
| 1240 | Ga0307405_10692692 | 3300031731 | Unclassified | 843 |
| 1241 | Ga0307405_10866597 | 3300031731 | Unclassified | 761 |
| 1242 | Ga0307405_10954103 | 3300031731 | Bacteria | 729 |
| 1243 | Ga0307405_11130437 | 3300031731 | Bacteria | 674 |
| 1244 | Ga0307413_10009991 | 3300031824 | Bacteria | 4575 |
| 1245 | Ga0307413_10011777 | 3300031824 | Unclassified | 4319 |
| 1246 | Ga0307413_10021966 | 3300031824 | Bacteria | 3428 |
| 1247 | Ga0307413_10291282 | 3300031824 | Unclassified | 1233 |
| 1248 | Ga0307413_10838809 | 3300031824 | Bacteria | 776 |
| 1249 | Ga0307410_10005924 | 3300031852 | Bacteria | 6535 |
| 1250 | Ga0307410_10077945 | 3300031852 | Bacteria | 2318 |
| 1251 | Ga0307410_10229039 | 3300031852 | Bacteria | 1434 |
| 1252 | Ga0307410_10262847 | 3300031852 | Bacteria | 1346 |
| 1253 | Ga0307410_10318030 | 3300031852 | Bacteria | 1234 |
| 1254 | Ga0307410_10412350 | 3300031852 | Bacteria | 1094 |
| 1255 | Ga0307410_10855713 | 3300031852 | Bacteria | 776 |
| 1256 | Ga0307410_10904720 | 3300031852 | Bacteria | 756 |
| 1257 | Ga0307410_10989503 | 3300031852 | Unclassified | 725 |
| 1258 | Ga0307410_11535385 | 3300031852 | Unclassified | 587 |
| 1259 | Ga0307406_10006611 | 3300031901 | Bacteria | 6408 |
| 1260 | Ga0307406_10163429 | 3300031901 | Bacteria | 1603 |
| 1261 | Ga0307406_11366878 | 3300031901 | Bacteria | 620 |
| 1262 | Ga0307406_11511986 | 3300031901 | Unclassified | 591 |
| 1263 | Ga0307407_10002222 | 3300031903 | Bacteria | 7494 |
| 1264 | Ga0307407_10021163 | 3300031903 | Bacteria | 3348 |
| 1265 | Ga0307407_10301660 | 3300031903 | Bacteria | 1117 |
| 1266 | Ga0307407_10477930 | 3300031903 | Bacteria | 909 |
| 1267 | Ga0307407_10621596 | 3300031903 | Bacteria | 806 |
| 1268 | Ga0307412_10018211 | 3300031911 | Bacteria | 4221 |
| 1269 | Ga0307412_10027994 | 3300031911 | Bacteria | 3521 |
| 1270 | Ga0307412_10149574 | 3300031911 | Bacteria | 1721 |
| 1271 | Ga0307412_10364799 | 3300031911 | Bacteria | 1164 |
| 1272 | Ga0307412_12009570 | 3300031911 | Bacteria | 535 |
| 1273 | Ga0307409_100003276 | 3300031995 | Bacteria | 8742 |
| 1274 | Ga0307409_100125456 | 3300031995 | Bacteria | 2182 |
| 1275 | Ga0307409_100234688 | 3300031995 | Bacteria | 1665 |
| 1276 | Ga0307409_100239430 | 3300031995 | Bacteria | 1651 |
| 1277 | Ga0307409_100371238 | 3300031995 | Bacteria | 1357 |
| 1278 | Ga0307409_100432016 | 3300031995 | Bacteria | 1266 |
| 1279 | Ga0307409_100474120 | 3300031995 | Bacteria | 1213 |
| 1280 | Ga0307409_100596208 | 3300031995 | Bacteria | 1091 |
| 1281 | Ga0307409_100702199 | 3300031995 | Bacteria | 1011 |
| 1282 | Ga0307409_100949287 | 3300031995 | Bacteria | 876 |
| 1283 | Ga0307416_100059432 | 3300032002 | Bacteria | 3106 |
| 1284 | Ga0307416_100061514 | 3300032002 | Bacteria | 3065 |
| 1285 | Ga0307416_100081188 | 3300032002 | Bacteria | 2740 |
| 1286 | Ga0307416_100224715 | 3300032002 | Bacteria | 1804 |
| 1287 | Ga0307416_100227799 | 3300032002 | Unclassified | 1794 |
| 1288 | Ga0307416_100238602 | 3300032002 | Bacteria | 1759 |
| 1289 | Ga0307416_100336044 | 3300032002 | Unclassified | 1521 |
| 1290 | Ga0307416_100388795 | 3300032002 | Bacteria | 1428 |
| 1291 | Ga0307416_100409248 | 3300032002 | Unclassified | 1397 |
| 1292 | Ga0307416_101014057 | 3300032002 | Unclassified | 933 |
| 1293 | Ga0307416_101444714 | 3300032002 | Bacteria | 793 |
| 1294 | Ga0307416_101535217 | 3300032002 | Unclassified | 772 |
| 1295 | Ga0307416_101570820 | 3300032002 | Unclassified | 763 |
| 1296 | Ga0307416_102139434 | 3300032002 | Unclassified | 661 |
| 1297 | Ga0307416_102392847 | 3300032002 | Unclassified | 628 |
| 1298 | Ga0307416_102462973 | 3300032002 | Unclassified | 619 |
| 1299 | Ga0307416_103417057 | 3300032002 | Unclassified | 531 |
| 1300 | Ga0307416_103575410 | 3300032002 | Unclassified | 520 |
| 1301 | Ga0307414_10004602 | 3300032004 | Bacteria | 7507 |
| 1302 | Ga0307414_10205056 | 3300032004 | Bacteria | 1607 |
| 1303 | Ga0307414_10366877 | 3300032004 | Bacteria | 1241 |
| 1304 | Ga0307414_10477115 | 3300032004 | Unclassified | 1099 |
| 1305 | Ga0307414_10479326 | 3300032004 | Unclassified | 1097 |
| 1306 | Ga0307414_10659313 | 3300032004 | Bacteria | 944 |
| 1307 | Ga0307414_11249193 | 3300032004 | Bacteria | 688 |
| 1308 | Ga0307411_10001250 | 3300032005 | Bacteria | 10134 |
| 1309 | Ga0307411_10032932 | 3300032005 | Bacteria | 3208 |
| 1310 | Ga0307411_10273209 | 3300032005 | Bacteria | 1341 |
| 1311 | Ga0307411_10391465 | 3300032005 | Bacteria | 1146 |
| 1312 | Ga0307411_11699981 | 3300032005 | Unclassified | 584 |
| 1313 | Ga0307411_12127510 | 3300032005 | Bacteria | 525 |
| 1314 | Ga0307415_100090910 | 3300032126 | Unclassified | 2209 |
| 1315 | Ga0307415_100114195 | 3300032126 | Bacteria | 2010 |
| 1316 | Ga0307415_100182367 | 3300032126 | Bacteria | 1648 |
| 1317 | Ga0307415_100247793 | 3300032126 | Unclassified | 1445 |
| 1318 | Ga0307415_100969974 | 3300032126 | Bacteria | 788 |
| 1319 | Ga0307415_101521166 | 3300032126 | Bacteria | 641 |
| 1320 | Ga0307415_101942627 | 3300032126 | Unclassified | 572 |
| 1321 | Ga0373950_0029035 | 3300034818 | Unclassified | 1016 |
| 1322 | Ga0373938_0080018 | 3300034957 | Unclassified | 794 |
| 1323 | Ga0373926_0400941 | 3300035083 | Bacteria | 542 |
| 1324 | Ga0373934_0055913 | 3300035086 | Bacteria | 1569 |
| 1325 | Ga0373949_0071690 | 3300035090 | Unclassified | 908 |
| 1326 | Ga0373951_0055586 | 3300035091 | Bacteria | 982 |
| 1327 | Ga0373951_0250978 | 3300035091 | Unclassified | 531 |
| 1328 | Ga0373923_0417856 | 3300035111 | Bacteria | 647 |
| 1329 | Ga0373923_0501134 | 3300035111 | Bacteria | 592 |
| 1330 | Ga0373932_0004595 | 3300035112 | Bacteria | 3259 |
| 1331 | Ga0373939_0010866 | 3300035114 | Bacteria | 2287 |
| 1332 | Ga0373939_0224366 | 3300035114 | Unclassified | 721 |
| 1333 | Ga0373941_0039098 | 3300035115 | Bacteria | 1456 |
| 1334 | Ga0373941_0286619 | 3300035115 | Unclassified | 653 |
| 1335 | Ga0373956_0097799 | 3300035119 | Unclassified | 1359 |
| 1336 | Ga0373956_0326667 | 3300035119 | Bacteria | 731 |
| 1337 | Ga0373956_0343215 | 3300035119 | Unclassified | 712 |
| 1338 | Ga0373956_0599313 | 3300035119 | Unclassified | 526 |
| 1339 | Ga0373960_0144395 | 3300035121 | Unclassified | 808 |
| 1340 | Ga0373943_0519020 | 3300035170 | Bacteria | 697 |
| 1341 | Ga0373943_0594658 | 3300035170 | Unclassified | 651 |
| 1342 | Ga0373946_0588247 | 3300035171 | Bacteria | 576 |
| 1343 | Ga0373955_0464168 | 3300035172 | Unclassified | 772 |
| 1344 | Ga0373955_0680844 | 3300035172 | Bacteria | 631 |
| 1345 | Ga0373955_0873235 | 3300035172 | Bacteria | 553 |
| 1346 | Ga0373942_0354625 | 3300035207 | Unclassified | 519 |
| 1347 | Ga0373962_0043749 | 3300035242 | Bacteria | 1270 |
| 1348 | Ga0373924_0041482 | 3300035410 | Unclassified | 1886 |
| 1349 | Ga0373924_0084401 | 3300035410 | Bacteria | 1354 |
| 1350 | Ga0373931_0035621 | 3300035691 | Bacteria | 2589 |
| 1351 | Ga0373931_0052877 | 3300035691 | Bacteria | 2167 |
| 1352 | Ga0373931_0217261 | 3300035691 | Unclassified | 1149 |
| 1353 | Ga0373931_0335073 | 3300035691 | Bacteria | 943 |
| 1354 | Ga0373935_0419003 | 3300035692 | Bacteria | 964 |
| 1355 | Ga0373933_0399250 | 3300035724 | Unclassified | 897 |
| 1356 | Ga0373937_0025431 | 3300036401 | Bacteria | 5344 |
| 1357 | Ga0373937_0498834 | 3300036401 | Unclassified | 1157 |
| 1358 | Ga0373937_1501240 | 3300036401 | Unclassified | 621 |
| 1359 | Ga0373937_1521642 | 3300036401 | Bacteria | 616 |
| 1360 | Ga0373925_0819805 | 3300037068 | Bacteria | 767 |
| 1361 | Ga0373925_0821036 | 3300037068 | Bacteria | 766 |
| 1362 | Ga0395900_0878116 | 3300037418 | Bacteria | 821 |
| 1363 | Ga0395898_1340306 | 3300037466 | Bacteria | 644 |
| 1364 | Ga0242420_052163 | 3300038996 | Unclassified | 802 |
| 1365 | Ga0439436_0074786 | 3300041404 | Bacteria | 944 |
| 1366 | Ga0439439_0004932 | 3300041406 | Bacteria | 3027 |
| 1367 | Ga0439453_0013175 | 3300041408 | Bacteria | 1403 |
| 1368 | Ga0439461_0007768 | 3300041410 | Unclassified | 1910 |
| 1369 | Ga0439461_0014950 | 3300041410 | Bacteria | 1483 |
| 1370 | Ga0439461_0063965 | 3300041410 | Bacteria | 840 |
| 1371 | Ga0439461_0065707 | 3300041410 | Bacteria | 832 |
| 1372 | Ga0451795_1211245 | 3300041456 | Unclassified | 518 |
| 1373 | Ga0451798_0567307 | 3300041458 | Unclassified | 530 |
| 1374 | Ga0451800_0488747 | 3300041459 | Unclassified | 710 |
| 1375 | Ga0451800_1229364 | 3300041459 | Unclassified | 505 |
| 1376 | Ga0451802_0983452 | 3300041460 | Bacteria | 552 |
| 1377 | Ga0451802_0983820 | 3300041460 | Bacteria | 556 |
| 1378 | Ga0451802_1047813 | 3300041460 | Bacteria | 568 |
| 1379 | Ga0451802_1277372 | 3300041460 | Unclassified | 540 |
| 1380 | Ga0451807_2702473 | 3300041486 | Unclassified | 608 |
| 1381 | Ga0451845_0469777 | 3300041501 | Unclassified | 680 |
| 1382 | Ga0451849_0010536 | 3300041505 | Unclassified | 622 |
| 1383 | Ga0451853_0429604 | 3300041512 | Unclassified | 744 |
| 1384 | Ga0451853_0571654 | 3300041512 | Unclassified | 579 |
| 1385 | Ga0451853_3505640 | 3300041512 | Unclassified | 766 |
| 1386 | Ga0439431_0026650 | 3300041997 | Bacteria | 1417 |
| 1387 | Ga0439431_0145949 | 3300041997 | Unclassified | 670 |
| 1388 | Ga0439433_0017302 | 3300041999 | Unclassified | 1600 |
| 1389 | Ga0439433_0054741 | 3300041999 | Bacteria | 944 |
| 1390 | Ga0439433_0065055 | 3300041999 | Unclassified | 874 |
| 1391 | Ga0439437_055614 | 3300042000 | Unclassified | 531 |
| 1392 | Ga0439441_043832 | 3300042001 | Bacteria | 904 |
| 1393 | Ga0439443_108067 | 3300042003 | Unclassified | 538 |
| 1394 | Ga0439445_0126820 | 3300042004 | Bacteria | 735 |
| 1395 | Ga0439445_0142938 | 3300042004 | Bacteria | 694 |
| 1396 | Ga0439449_0246717 | 3300042007 | Bacteria | 671 |
| 1397 | Ga0439449_0416214 | 3300042007 | Bacteria | 510 |
| 1398 | Ga0439450_042689 | 3300042008 | Bacteria | 1057 |
| 1399 | Ga0439451_133080 | 3300042009 | Bacteria | 508 |
| 1400 | Ga0439455_0027924 | 3300042012 | Bacteria | 1386 |
| 1401 | Ga0439455_0161761 | 3300042012 | Bacteria | 640 |
| 1402 | Ga0439455_0167664 | 3300042012 | Bacteria | 630 |
| 1403 | Ga0439456_108702 | 3300042013 | Unclassified | 631 |
| 1404 | Ga0439457_096637 | 3300042014 | Bacteria | 686 |
| 1405 | Ga0439462_0047141 | 3300042015 | Bacteria | 1155 |
| 1406 | Ga0439462_0059319 | 3300042015 | Bacteria | 1034 |
| 1407 | Ga0439462_0173601 | 3300042015 | Bacteria | 610 |
| 1408 | Ga0439462_0260431 | 3300042015 | Unclassified | 500 |
| 1409 | Ga0450920_068512 | 3300042122 | Unclassified | 721 |
| 1410 | Ga0450920_144749 | 3300042122 | Bacteria | 504 |
| 1411 | Ga0450894_073941 | 3300042131 | Unclassified | 525 |
| 1412 | Ga0450896_080904 | 3300042133 | Unclassified | 547 |
| 1413 | Ga0450910_099347 | 3300042147 | Bacteria | 522 |
| 1414 | Ga0439446_0048598 | 3300042156 | Bacteria | 1263 |
| 1415 | Ga0439446_0081900 | 3300042156 | Bacteria | 1000 |
| 1416 | Ga0439446_0124704 | 3300042156 | Bacteria | 831 |
| 1417 | Ga0439446_0273916 | 3300042156 | Bacteria | 587 |
| 1418 | Ga0439446_0382644 | 3300042156 | Unclassified | 506 |
| 1419 | Ga0439458_0211912 | 3300042157 | Unclassified | 532 |
| 1420 | Ga0439434_0048017 | 3300042435 | Bacteria | 1320 |
| 1421 | Ga0439434_0065672 | 3300042435 | Bacteria | 1138 |
| 1422 | Ga0439434_0123886 | 3300042435 | Bacteria | 844 |
| 1423 | Ga0439434_0266382 | 3300042435 | Unclassified | 588 |
| 1424 | Ga0439435_0025603 | 3300042436 | Bacteria | 1565 |
| 1425 | Ga0439435_0045608 | 3300042436 | Bacteria | 1240 |
| 1426 | Ga0439435_0128033 | 3300042436 | Unclassified | 800 |
| 1427 | Ga0439435_0135589 | 3300042436 | Bacteria | 781 |
| 1428 | Ga0439435_0146953 | 3300042436 | Bacteria | 754 |
| 1429 | Ga0439435_0367807 | 3300042436 | Bacteria | 501 |
| 1430 | Ga0439444_0041154 | 3300042437 | Bacteria | 908 |
| 1431 | Ga0439444_0073418 | 3300042437 | Unclassified | 736 |
| 1432 | Ga0439444_0135708 | 3300042437 | Bacteria | 585 |
| 1433 | Ga0439444_0170611 | 3300042437 | Bacteria | 536 |
| 1434 | Ga0439459_0110878 | 3300042438 | Unclassified | 682 |
| 1435 | Ga0439459_0125430 | 3300042438 | Unclassified | 651 |
| 1436 | Ga0439464_0004244 | 3300042439 | Bacteria | 3658 |
| 1437 | Ga0439464_0004625 | 3300042439 | Bacteria | 3525 |
| 1438 | Ga0439464_0024872 | 3300042439 | Bacteria | 1657 |
| 1439 | Ga0439464_0097717 | 3300042439 | Unclassified | 890 |
| 1440 | Ga0439464_0120321 | 3300042439 | Bacteria | 808 |
| 1441 | Ga0439460_0017095 | 3300042461 | Unclassified | 1940 |
| 1442 | Ga0439460_0084401 | 3300042461 | Bacteria | 1001 |
| 1443 | Ga0439460_0146311 | 3300042461 | Bacteria | 786 |
| 1444 | Ga0450893_0137390 | 3300042532 | Unclassified | 520 |
| 1445 | Ga0451577_0134250 | 3300042876 | Unclassified | 2221 |
| 1446 | Ga0451577_0583124 | 3300042876 | Bacteria | 1015 |
| 1447 | Ga0439440_0231207 | 3300042993 | Bacteria | 558 |
| 1448 | Ga0453683_0512372 | 3300044673 | Bacteria | 779 |
| 1449 | Ga0453683_0608827 | 3300044673 | Bacteria | 713 |
| 1450 | Ga0453683_1125672 | 3300044673 | Unclassified | 524 |
| 1451 | Ga0453684_0142552 | 3300044712 | Bacteria | 2859 |
| 1452 | Ga0466960_0497773 | 3300044901 | Unclassified | 714 |
| 1453 | Ga0451576_0025937 | 3300045051 | Bacteria | 6310 |
| 1454 | Ga0451576_0046822 | 3300045051 | Bacteria | 4552 |
| 1455 | Ga0451576_0053959 | 3300045051 | Bacteria | 4208 |
| 1456 | Ga0451576_0063125 | 3300045051 | Bacteria | 3861 |
| 1457 | Ga0451576_0239444 | 3300045051 | Bacteria | 1895 |
| 1458 | Ga0451576_0810841 | 3300045051 | Bacteria | 983 |
| 1459 | Ga0451576_1261760 | 3300045051 | Bacteria | 771 |
| 1460 | Ga0451576_1772249 | 3300045051 | Unclassified | 639 |
| 1461 | Ga0495592_0167128 | 3300046454 | Bacteria | 1509 |
| 1462 | Ga0495592_0478136 | 3300046454 | Bacteria | 776 |
| 1463 | Ga0495603_0130248 | 3300046455 | Bacteria | 1465 |
| 1464 | Ga0495603_0158961 | 3300046455 | Unclassified | 1311 |
| 1465 | Ga0495629_0120736 | 3300046459 | Bacteria | 1826 |
| 1466 | Ga0495629_0140272 | 3300046459 | Unclassified | 1682 |
| 1467 | Ga0495582_0613179 | 3300046473 | Bacteria | 630 |
| 1468 | Ga0495639_0129813 | 3300046475 | Bacteria | 1206 |
| 1469 | Ga0495662_0114404 | 3300046476 | Bacteria | 1323 |
| 1470 | Ga0495585_0292895 | 3300046492 | Unclassified | 802 |
| 1471 | Ga0495594_0450431 | 3300046499 | Bacteria | 732 |
| 1472 | Ga0495618_0486751 | 3300046514 | Bacteria | 745 |
| 1473 | Ga0495628_0128520 | 3300046516 | Unclassified | 1940 |
| 1474 | Ga0495628_0640076 | 3300046516 | Bacteria | 756 |
| 1475 | Ga0495630_0501505 | 3300046517 | Unclassified | 931 |
| 1476 | Ga0495643_0001260 | 3300046522 | Bacteria | 24270 |
| 1477 | Ga0495640_0112897 | 3300046533 | Bacteria | 1774 |
| 1478 | Ga0495586_0326111 | 3300046535 | Bacteria | 881 |
| 1479 | Ga0495586_0672634 | 3300046535 | Bacteria | 598 |
| 1480 | Ga0495598_0087950 | 3300046537 | Unclassified | 1008 |
| 1481 | Ga0495598_0113752 | 3300046537 | Bacteria | 910 |
| 1482 | Ga0495609_0282182 | 3300046538 | Unclassified | 679 |
| 1483 | Ga0495621_0000636 | 3300046539 | Bacteria | 8821 |
| 1484 | Ga0495621_0220108 | 3300046539 | Bacteria | 768 |
| 1485 | Ga0495621_0249737 | 3300046539 | Bacteria | 724 |
| 1486 | Ga0495597_0074140 | 3300046542 | Bacteria | 1462 |
| 1487 | Ga0495645_0027106 | 3300046543 | Unclassified | 4161 |
| 1488 | Ga0495667_0295863 | 3300046559 | Bacteria | 1026 |
| 1489 | Ga0495667_0491551 | 3300046559 | Bacteria | 769 |
| 1490 | Ga0495656_0149170 | 3300046615 | Bacteria | 1128 |
| 1491 | Ga0495656_0351256 | 3300046615 | Unclassified | 764 |
| 1492 | Ga0495634_0298622 | 3300046642 | Bacteria | 974 |
| 1493 | Ga0495635_0215356 | 3300046663 | Unclassified | 1300 |
| 1494 | Ga0495635_0375167 | 3300046663 | Bacteria | 947 |
| 1495 | Ga0495659_0018453 | 3300046664 | Bacteria | 2325 |
| 1496 | Ga0495659_0023986 | 3300046664 | Bacteria | 2076 |
| 1497 | Ga0495659_0060110 | 3300046664 | Bacteria | 1401 |
| 1498 | Ga0495599_0107869 | 3300046678 | Bacteria | 1735 |
| 1499 | Ga0495647_0075468 | 3300046681 | Bacteria | 1357 |
| 1500 | Ga0495658_0130855 | 3300046683 | Bacteria | 1527 |
| 1501 | Ga0495658_0503329 | 3300046683 | Bacteria | 775 |
| 1502 | Ga0495613_0337369 | 3300046689 | Unclassified | 1038 |
| 1503 | Ga0495613_0360306 | 3300046689 | Bacteria | 997 |
| 1504 | Ga0495649_0405865 | 3300046694 | Unclassified | 684 |
| 1505 | Ga0495581_0322807 | 3300047315 | Bacteria | 902 |
| 1506 | Ga0495636_0066258 | 3300047318 | Bacteria | 1535 |
| 1507 | Ga0495674_0506281 | 3300047319 | Unclassified | 965 |
| 1508 | Ga0495676_0884280 | 3300047321 | Bacteria | 573 |
| 1509 | Ga0495680_0345333 | 3300047322 | Unclassified | 1037 |
| 1510 | Ga0495684_0225238 | 3300047471 | Bacteria | 1373 |
| 1511 | Ga0495684_0260600 | 3300047471 | Bacteria | 1258 |
| 1512 | Ga0495684_0553477 | 3300047471 | Unclassified | 783 |
| 1513 | Ga0495684_0653752 | 3300047471 | Bacteria | 703 |
| 1514 | Ga0495593_0512694 | 3300047673 | Bacteria | 601 |
| 1515 | Ga0496100_0520517 | 3300048903 | Bacteria | 918 |
| 1516 | Ga0496101_0248769 | 3300048904 | Bacteria | 1385 |
| 1517 | Ga0496101_1160840 | 3300048904 | Archaea | 606 |
| 1518 | Ga0496101_1279141 | 3300048904 | Bacteria | 574 |
| 1519 | Ga0496102_0140567 | 3300048905 | Unclassified | 2263 |
| 1520 | Ga0496102_0678002 | 3300048905 | Unclassified | 954 |
| 1521 | Ga0496102_0860485 | 3300048905 | Unclassified | 829 |
| 1522 | Ga0496103_0022770 | 3300048906 | Bacteria | 3774 |
| 1523 | Ga0496104_0029430 | 3300048907 | Bacteria | 5095 |
| 1524 | Ga0496104_0051939 | 3300048907 | Bacteria | 3871 |
| 1525 | Ga0496104_0266364 | 3300048907 | Bacteria | 1626 |
| 1526 | Ga0496104_0834358 | 3300048907 | Bacteria | 827 |
| 1527 | Ga0496105_0208692 | 3300048908 | Bacteria | 1593 |
| 1528 | Ga0496105_0234817 | 3300048908 | Unclassified | 1489 |
| 1529 | Ga0496105_0462038 | 3300048908 | Bacteria | 1001 |
| 1530 | Ga0496106_0149353 | 3300048909 | Bacteria | 1843 |
| 1531 | Ga0496106_0172626 | 3300048909 | Bacteria | 1714 |
| 1532 | Ga0496106_0207750 | 3300048909 | Bacteria | 1559 |
| 1533 | Ga0496106_0646341 | 3300048909 | Bacteria | 845 |
| 1534 | Ga0496107_0861191 | 3300048910 | Unclassified | 662 |
| 1535 | Ga0496108_0048269 | 3300048911 | Bacteria | 3559 |
| 1536 | Ga0496108_0278533 | 3300048911 | Unclassified | 1456 |
| 1537 | Ga0496108_0436958 | 3300048911 | Bacteria | 1143 |
| 1538 | Ga0496109_0012204 | 3300048912 | Bacteria | 7412 |
| 1539 | Ga0496109_0047791 | 3300048912 | Bacteria | 3892 |
| 1540 | Ga0496109_0191061 | 3300048912 | Bacteria | 1924 |
| 1541 | Ga0496109_0695593 | 3300048912 | Unclassified | 954 |
| 1542 | Ga0496109_0918766 | 3300048912 | Unclassified | 813 |
| 1543 | Ga0496109_0946322 | 3300048912 | Bacteria | 799 |
| 1544 | Ga0496109_0981085 | 3300048912 | Bacteria | 783 |
| 1545 | Ga0496109_1251534 | 3300048912 | Bacteria | 678 |
| 1546 | Ga0496110_0075740 | 3300048913 | Unclassified | 2990 |
| 1547 | Ga0496110_0296495 | 3300048913 | Bacteria | 1473 |
| 1548 | Ga0496110_0659094 | 3300048913 | Bacteria | 947 |
| 1549 | Ga0496110_0876725 | 3300048913 | Unclassified | 803 |
| 1550 | Ga0496110_0886173 | 3300048913 | Bacteria | 798 |
| 1551 | Ga0496110_1267542 | 3300048913 | Bacteria | 646 |
| 1552 | Ga0496111_0004268 | 3300048914 | Bacteria | 9006 |
| 1553 | Ga0496111_0465467 | 3300048914 | Bacteria | 932 |
| 1554 | Ga0496111_0831968 | 3300048914 | Unclassified | 667 |
| 1555 | Ga0496112_0013855 | 3300048915 | Bacteria | 7458 |
| 1556 | Ga0496112_0015556 | 3300048915 | Bacteria | 7105 |
| 1557 | Ga0496112_0071968 | 3300048915 | Bacteria | 3417 |
| 1558 | Ga0496112_0098364 | 3300048915 | Bacteria | 2895 |
| 1559 | Ga0496113_0159497 | 3300048916 | Bacteria | 1783 |
| 1560 | Ga0496113_0247084 | 3300048916 | Unclassified | 1424 |
| 1561 | Ga0496114_0475289 | 3300048917 | Bacteria | 1106 |
| 1562 | Ga0496114_0704493 | 3300048917 | Bacteria | 885 |
| 1563 | Ga0496115_0400137 | 3300048918 | Bacteria | 1114 |
| 1564 | Ga0501290_049541 | 3300049513 | Bacteria | 651 |
| 1565 | Ga0501292_010393 | 3300049515 | Bacteria | 1393 |
| 1566 | Ga0501298_090819 | 3300049521 | Bacteria | 684 |
| 1567 | Ga0501298_152566 | 3300049521 | Bacteria | 566 |
| 1568 | Ga0501299_076430 | 3300049522 | Bacteria | 736 |
| 1569 | Ga0501299_078419 | 3300049522 | Bacteria | 729 |
| 1570 | Ga0501031_0019692 | 3300049568 | Bacteria | 4396 |
| 1571 | Ga0501031_0256475 | 3300049568 | Bacteria | 1136 |
| 1572 | Ga0501031_0931695 | 3300049568 | Bacteria | 556 |
| 1573 | Ga0501031_0934858 | 3300049568 | Bacteria | 555 |
| 1574 | Ga0501032_0004999 | 3300049569 | Bacteria | 9916 |
| 1575 | Ga0501032_0694291 | 3300049569 | Bacteria | 645 |
| 1576 | Ga0501032_0786466 | 3300049569 | Bacteria | 601 |
| 1577 | Ga0501032_1061582 | 3300049569 | Unclassified | 508 |
| 1578 | Ga0501033_0015872 | 3300049570 | Bacteria | 5705 |
| 1579 | Ga0501033_0120675 | 3300049570 | Bacteria | 1903 |
| 1580 | Ga0501033_0439337 | 3300049570 | Bacteria | 907 |
| 1581 | Ga0501034_0030569 | 3300049571 | Bacteria | 5474 |
| 1582 | Ga0501034_0264934 | 3300049571 | Bacteria | 1660 |
| 1583 | Ga0501036_0116231 | 3300049572 | Bacteria | 2259 |
| 1584 | Ga0501036_0123379 | 3300049572 | Unclassified | 2188 |
| 1585 | Ga0501036_0603672 | 3300049572 | Unclassified | 910 |
| 1586 | Ga0501036_1204717 | 3300049572 | Unclassified | 617 |
| 1587 | Ga0501037_0001127 | 3300049573 | Bacteria | 19769 |
| 1588 | Ga0501037_0374079 | 3300049573 | Bacteria | 980 |
| 1589 | Ga0501038_0013949 | 3300049574 | Bacteria | 7324 |
| 1590 | Ga0501038_0671562 | 3300049574 | Bacteria | 778 |
| 1591 | Ga0501038_1061187 | 3300049574 | Bacteria | 593 |
| 1592 | Ga0501038_1205273 | 3300049574 | Bacteria | 549 |
| 1593 | Ga0501039_0057734 | 3300049575 | Bacteria | 3005 |
| 1594 | Ga0501039_0063695 | 3300049575 | Bacteria | 2857 |
| 1595 | Ga0501039_0530095 | 3300049575 | Bacteria | 924 |
| 1596 | Ga0501039_0776006 | 3300049575 | Unclassified | 748 |
| 1597 | Ga0501040_0058385 | 3300049576 | Bacteria | 2650 |
| 1598 | Ga0501040_0062455 | 3300049576 | Unclassified | 2563 |
| 1599 | Ga0501040_0535599 | 3300049576 | Bacteria | 845 |
| 1600 | Ga0501041_0166506 | 3300049577 | Unclassified | 1379 |
| 1601 | Ga0501041_0178462 | 3300049577 | Bacteria | 1329 |
| 1602 | Ga0501041_0310929 | 3300049577 | Bacteria | 993 |
| 1603 | Ga0501041_0354744 | 3300049577 | Unclassified | 927 |
| 1604 | Ga0501041_0384141 | 3300049577 | Bacteria | 889 |
| 1605 | Ga0501041_0751265 | 3300049577 | Bacteria | 625 |
| 1606 | Ga0501042_0016296 | 3300049578 | Bacteria | 5101 |
| 1607 | Ga0501042_0119920 | 3300049578 | Bacteria | 1894 |
| 1608 | Ga0501042_0129668 | 3300049578 | Bacteria | 1817 |
| 1609 | Ga0501042_0197529 | 3300049578 | Bacteria | 1451 |
| 1610 | Ga0501042_0427028 | 3300049578 | Unclassified | 960 |
| 1611 | Ga0501042_0722006 | 3300049578 | Unclassified | 725 |
| 1612 | Ga0501043_0024660 | 3300049579 | Bacteria | 4716 |
| 1613 | Ga0501046_0006725 | 3300049580 | Bacteria | 10153 |
| 1614 | Ga0501046_0175117 | 3300049580 | Bacteria | 1607 |
| 1615 | Ga0501046_0384806 | 3300049580 | Bacteria | 1015 |
| 1616 | Ga0501046_0459502 | 3300049580 | Unclassified | 915 |
| 1617 | Ga0501046_0774925 | 3300049580 | Unclassified | 673 |
| 1618 | Ga0501047_0427432 | 3300049581 | Bacteria | 1155 |
| 1619 | Ga0501047_0822502 | 3300049581 | Bacteria | 743 |
| 1620 | Ga0501048_0002548 | 3300049582 | Bacteria | 13947 |
| 1621 | Ga0501048_0072087 | 3300049582 | Bacteria | 2438 |
| 1622 | Ga0501048_0807840 | 3300049582 | Bacteria | 674 |
| 1623 | Ga0501048_1311366 | 3300049582 | Bacteria | 520 |
| 1624 | Ga0501067_0026173 | 3300049583 | Bacteria | 3232 |
| 1625 | Ga0501067_0226230 | 3300049583 | Bacteria | 1041 |
| 1626 | Ga0501068_0005586 | 3300049584 | Bacteria | 6886 |
| 1627 | Ga0501068_0133242 | 3300049584 | Bacteria | 1555 |
| 1628 | Ga0501068_0415652 | 3300049584 | Unclassified | 868 |
| 1629 | Ga0501068_0582244 | 3300049584 | Bacteria | 729 |
| 1630 | Ga0501068_0625175 | 3300049584 | Unclassified | 702 |
| 1631 | Ga0501069_0001932 | 3300049585 | Bacteria | 10352 |
| 1632 | Ga0501069_0485892 | 3300049585 | Bacteria | 736 |
| 1633 | Ga0501070_0331544 | 3300049586 | Unclassified | 1237 |
| 1634 | Ga0501070_0373516 | 3300049586 | Bacteria | 1155 |
| 1635 | Ga0501070_0659899 | 3300049586 | Bacteria | 830 |
| 1636 | Ga0501071_0006948 | 3300049587 | Bacteria | 7386 |
| 1637 | Ga0501071_0041374 | 3300049587 | Bacteria | 3300 |
| 1638 | Ga0501071_0113637 | 3300049587 | Unclassified | 2003 |
| 1639 | Ga0501071_0205914 | 3300049587 | Bacteria | 1479 |
| 1640 | Ga0501071_0328115 | 3300049587 | Unclassified | 1163 |
| 1641 | Ga0501071_0356064 | 3300049587 | Bacteria | 1114 |
| 1642 | Ga0501071_0501268 | 3300049587 | Bacteria | 931 |
| 1643 | Ga0501071_0585157 | 3300049587 | Bacteria | 858 |
| 1644 | Ga0501071_0806519 | 3300049587 | Unclassified | 724 |
| 1645 | Ga0501072_0005500 | 3300049588 | Bacteria | 9642 |
| 1646 | Ga0501072_0021792 | 3300049588 | Bacteria | 4969 |
| 1647 | Ga0501072_0040802 | 3300049588 | Bacteria | 3645 |
| 1648 | Ga0501072_0100512 | 3300049588 | Bacteria | 2299 |
| 1649 | Ga0501072_0185575 | 3300049588 | Bacteria | 1659 |
| 1650 | Ga0501072_0447856 | 3300049588 | Unclassified | 1023 |
| 1651 | Ga0501072_0504579 | 3300049588 | Bacteria | 957 |
| 1652 | Ga0501072_0633781 | 3300049588 | Unclassified | 842 |
| 1653 | Ga0501072_1027742 | 3300049588 | Bacteria | 642 |
| 1654 | Ga0501073_0007678 | 3300049589 | Bacteria | 8004 |
| 1655 | Ga0501074_0144805 | 3300049590 | Bacteria | 1699 |
| 1656 | Ga0501074_0154803 | 3300049590 | Bacteria | 1638 |
| 1657 | Ga0501074_0172546 | 3300049590 | Bacteria | 1543 |
| 1658 | Ga0501074_0296551 | 3300049590 | Bacteria | 1148 |
| 1659 | Ga0501074_0846886 | 3300049590 | Bacteria | 644 |
| 1660 | Ga0501074_1152014 | 3300049590 | Bacteria | 544 |
| 1661 | Ga0501075_0017217 | 3300049591 | Bacteria | 5218 |
| 1662 | Ga0501075_0122515 | 3300049591 | Unclassified | 1979 |
| 1663 | Ga0501075_0157999 | 3300049591 | Bacteria | 1729 |
| 1664 | Ga0501075_0201873 | 3300049591 | Bacteria | 1516 |
| 1665 | Ga0501075_0289581 | 3300049591 | Unclassified | 1248 |
| 1666 | Ga0501075_0374163 | 3300049591 | Bacteria | 1086 |
| 1667 | Ga0501075_0429149 | 3300049591 | Bacteria | 1008 |
| 1668 | Ga0501075_1451817 | 3300049591 | Bacteria | 519 |
| 1669 | Ga0501076_0007927 | 3300049592 | Bacteria | 7747 |
| 1670 | Ga0501076_0009234 | 3300049592 | Bacteria | 7275 |
| 1671 | Ga0501076_0036616 | 3300049592 | Bacteria | 3845 |
| 1672 | Ga0501076_0117349 | 3300049592 | Bacteria | 2154 |
| 1673 | Ga0501076_0218362 | 3300049592 | Bacteria | 1558 |
| 1674 | Ga0501076_0237452 | 3300049592 | Bacteria | 1491 |
| 1675 | Ga0501076_0418406 | 3300049592 | Bacteria | 1102 |
| 1676 | Ga0501076_0434789 | 3300049592 | Unclassified | 1080 |
| 1677 | Ga0501076_1087847 | 3300049592 | Bacteria | 658 |
| 1678 | Ga0501077_0028951 | 3300049593 | Bacteria | 3521 |
| 1679 | Ga0501077_0054757 | 3300049593 | Bacteria | 2533 |
| 1680 | Ga0501077_0237298 | 3300049593 | Unclassified | 1159 |
| 1681 | Ga0501077_0294832 | 3300049593 | Unclassified | 1033 |
| 1682 | Ga0501077_0671826 | 3300049593 | Bacteria | 666 |
| 1683 | Ga0501206_028303 | 3300049653 | Bacteria | 824 |
| 1684 | Ga0501206_079269 | 3300049653 | Bacteria | 568 |
| 1685 | Ga0501208_133450 | 3300049655 | Bacteria | 556 |
| 1686 | Ga0501208_141474 | 3300049655 | Bacteria | 542 |
| 1687 | Ga0501216_074990 | 3300049660 | Bacteria | 706 |
| 1688 | Ga0501217_023110 | 3300049661 | Bacteria | 1479 |
| 1689 | Ga0501217_153978 | 3300049661 | Bacteria | 689 |
| 1690 | Ga0501230_128058 | 3300049667 | Unclassified | 566 |
| 1691 | Ga0501233_051117 | 3300049668 | Bacteria | 1001 |
| 1692 | Ga0501235_182674 | 3300049669 | Unclassified | 560 |
| 1693 | Ga0501249_056402 | 3300049679 | Bacteria | 907 |
| 1694 | Ga0501249_096774 | 3300049679 | Unclassified | 704 |
| 1695 | Ga0501251_058834 | 3300049681 | Bacteria | 628 |
| 1696 | Ga0501261_079394 | 3300049690 | Unclassified | 590 |
| 1697 | Ga0501221_194961 | 3300049704 | Unclassified | 560 |
| 1698 | Ga0501221_225019 | 3300049704 | Unclassified | 530 |
| 1699 | Ga0501225_0061387 | 3300049705 | Bacteria | 1058 |
| 1700 | Ga0501225_0129918 | 3300049705 | Bacteria | 754 |
| 1701 | Ga0501225_0218441 | 3300049705 | Unclassified | 613 |
| 1702 | Ga0501229_032336 | 3300049706 | Unclassified | 722 |
| 1703 | Ga0501079_0011724 | 3300049741 | Bacteria | 6695 |
| 1704 | Ga0501079_0017863 | 3300049741 | Bacteria | 5417 |
| 1705 | Ga0501079_0038698 | 3300049741 | Bacteria | 3678 |
| 1706 | Ga0501079_0075715 | 3300049741 | Bacteria | 2603 |
| 1707 | Ga0501079_0152089 | 3300049741 | Bacteria | 1804 |
| 1708 | Ga0501079_0465854 | 3300049741 | Unclassified | 993 |
| 1709 | Ga0501079_0801357 | 3300049741 | Unclassified | 742 |
| 1710 | Ga0501080_0006657 | 3300049742 | Bacteria | 10396 |
| 1711 | Ga0501080_0039131 | 3300049742 | Bacteria | 4426 |
| 1712 | Ga0501080_0274662 | 3300049742 | Bacteria | 1533 |
| 1713 | Ga0501080_0354969 | 3300049742 | Bacteria | 1323 |
| 1714 | Ga0501080_1079199 | 3300049742 | Unclassified | 694 |
| 1715 | Ga0501081_0037516 | 3300049743 | Bacteria | 3307 |
| 1716 | Ga0501081_0286786 | 3300049743 | Bacteria | 1206 |
| 1717 | Ga0501081_0773542 | 3300049743 | Bacteria | 722 |
| 1718 | Ga0501081_0872487 | 3300049743 | Bacteria | 678 |
| 1719 | Ga0501081_1036182 | 3300049743 | Unclassified | 620 |
| 1720 | Ga0501081_1093930 | 3300049743 | Bacteria | 603 |
| 1721 | Ga0501083_0250708 | 3300049744 | Bacteria | 1152 |
| 1722 | Ga0501263_029782 | 3300049760 | Unclassified | 766 |
| 1723 | Ga0501265_028747 | 3300049762 | Bacteria | 790 |
| 1724 | Ga0501268_100077 | 3300049765 | Bacteria | 620 |
| 1725 | Ga0501268_108217 | 3300049765 | Bacteria | 603 |
| 1726 | Ga0501270_167889 | 3300049767 | Unclassified | 511 |
| 1727 | Ga0501273_023875 | 3300049770 | Bacteria | 841 |
| 1728 | Ga0501273_050627 | 3300049770 | Unclassified | 634 |
| 1729 | Ga0501273_090098 | 3300049770 | Unclassified | 520 |
| 1730 | Ga0501278_002751 | 3300049774 | Bacteria | 1231 |
| 1731 | Ga0501283_002559 | 3300049779 | Bacteria | 2366 |
| 1732 | Ga0501035_0392553 | 3300049822 | Bacteria | 1155 |
| 1733 | Ga0501035_0500863 | 3300049822 | Unclassified | 1000 |
| 1734 | Ga0501044_0037752 | 3300049823 | Bacteria | 5047 |
| 1735 | Ga0501045_0012920 | 3300049824 | Bacteria | 5887 |
| 1736 | Ga0501045_0214377 | 3300049824 | Bacteria | 1434 |
| 1737 | Ga0501045_0345994 | 3300049824 | Bacteria | 1106 |
| 1738 | Ga0501045_0409933 | 3300049824 | Bacteria | 1008 |
| 1739 | nmdc:mga03683_452_c1 | 3300050489 | Bacteria | 11849 |
| 1740 | nmdc:mga03683_488177_c1 | 3300050489 | Bacteria | 595 |
| 1741 | nmdc:mga03n38_224037_c1 | 3300050490 | Bacteria | 983 |
| 1742 | nmdc:mga00v17_39025_c1 | 3300050491 | Bacteria | 2842 |
| 1743 | nmdc:mga00v17_4277_c1 | 3300050491 | Bacteria | 7415 |
| 1744 | nmdc:mga00v17_981812_c1 | 3300050491 | Unclassified | 532 |
| 1745 | nmdc:mga0yw44_112495_c1 | 3300050492 | Bacteria | 1746 |
| 1746 | nmdc:mga0yw44_266254_c1 | 3300050492 | Bacteria | 1143 |
| 1747 | nmdc:mga0k408_26080_c1 | 3300050493 | Bacteria | 3312 |
| 1748 | nmdc:mga0k408_735706_c1 | 3300050493 | Archaea | 577 |
| 1749 | nmdc:mga06z11_216672_c1 | 3300050494 | Bacteria | 1117 |
| 1750 | nmdc:mga06z11_35323_c1 | 3300050494 | Bacteria | 2460 |
| 1751 | nmdc:mga06z11_86569_c1 | 3300050494 | Bacteria | 1693 |
| 1752 | nmdc:mga06z11_86903_c1 | 3300050494 | Bacteria | 1690 |
| 1753 | nmdc:mga04h51_139610_c1 | 3300050495 | Bacteria | 918 |
| 1754 | nmdc:mga04h51_54595_c1 | 3300050495 | Bacteria | 1351 |
| 1755 | nmdc:mga07m45_83926_c1 | 3300050496 | Bacteria | 1821 |
| 1756 | nmdc:mga05p37_11236_c1 | 3300050507 | Bacteria | 10648 |
| 1757 | nmdc:mga05p37_114819_c1 | 3300050507 | Bacteria | 3310 |
| 1758 | nmdc:mga05p37_133187_c1 | 3300050507 | Bacteria | 3049 |
| 1759 | nmdc:mga05p37_1507651_c1 | 3300050507 | Bacteria | 669 |
| 1760 | nmdc:mga05p37_1697545_c1 | 3300050507 | Unclassified | 616 |
| 1761 | nmdc:mga05p37_22768_c1 | 3300050507 | Bacteria | 7600 |
| 1762 | nmdc:mga05p37_27332_c1 | 3300050507 | Bacteria | 6945 |
| 1763 | nmdc:mga05p37_284869_c1 | 3300050507 | Bacteria | 1969 |
| 1764 | nmdc:mga05p37_2902_c1 | 3300050507 | Bacteria | 19891 |
| 1765 | nmdc:mga05p37_35902_c1 | 3300050507 | Bacteria | 6082 |
| 1766 | nmdc:mga05p37_468614_c1 | 3300050507 | Unclassified | 1454 |
| 1767 | nmdc:mga05p37_493208_c1 | 3300050507 | Unclassified | 1408 |
| 1768 | nmdc:mga05p37_4944_c1 | 3300050507 | Bacteria | 15616 |
| 1769 | nmdc:mga05p37_612047_c1 | 3300050507 | Bacteria | 1227 |
| 1770 | nmdc:mga09592_1040230_c1 | 3300050508 | Bacteria | 683 |
| 1771 | nmdc:mga09592_122139_c1 | 3300050508 | Bacteria | 2238 |
| 1772 | nmdc:mga09592_148479_c1 | 3300050508 | Bacteria | 2022 |
| 1773 | nmdc:mga09592_163553_c1 | 3300050508 | Unclassified | 1923 |
| 1774 | nmdc:mga09592_231053_c1 | 3300050508 | Bacteria | 1603 |
| 1775 | nmdc:mga09592_343125_c1 | 3300050508 | Unclassified | 1293 |
| 1776 | nmdc:mga09592_39479_c1 | 3300050508 | Bacteria | 3965 |
| 1777 | nmdc:mga09592_44087_c1 | 3300050508 | Bacteria | 3753 |
| 1778 | nmdc:mga09592_496001_c1 | 3300050508 | Unclassified | 1051 |
| 1779 | nmdc:mga09592_50798_c1 | 3300050508 | Bacteria | 3497 |
| 1780 | nmdc:mga09592_63814_c1 | 3300050508 | Unclassified | 3118 |
| 1781 | nmdc:mga09592_65266_c1 | 3300050508 | Bacteria | 3083 |
| 1782 | nmdc:mga09592_727698_c1 | 3300050508 | Unclassified | 843 |
| 1783 | nmdc:mga09592_7497_c1 | 3300050508 | Bacteria | 8874 |
| 1784 | nmdc:mga0qj67_1196400_c1 | 3300050509 | Unclassified | 591 |
| 1785 | nmdc:mga0qj67_15122_c1 | 3300050509 | Bacteria | 5841 |
| 1786 | nmdc:mga0qj67_19109_c1 | 3300050509 | Bacteria | 5233 |
| 1787 | nmdc:mga0qj67_234750_c1 | 3300050509 | Bacteria | 1488 |
| 1788 | nmdc:mga0qj67_438085_c1 | 3300050509 | Unclassified | 1053 |
| 1789 | nmdc:mga0qj67_4391_c1 | 3300050509 | Bacteria | 10212 |
| 1790 | nmdc:mga0qj67_45269_c1 | 3300050509 | Bacteria | 3472 |
| 1791 | nmdc:mga0qj67_5816_c1 | 3300050509 | Bacteria | 9026 |
| 1792 | nmdc:mga0qj67_586615_c1 | 3300050509 | Bacteria | 892 |
| 1793 | nmdc:mga0qj67_8912_c1 | 3300050509 | Bacteria | 7444 |
| 1794 | nmdc:mga0qj67_907673_c1 | 3300050509 | Unclassified | 694 |
| 1795 | nmdc:mga0qj67_99893_c1 | 3300050509 | Bacteria | 2339 |
| 1796 | nmdc:mga06r32_130743_c1 | 3300050510 | Bacteria | 2482 |
| 1797 | nmdc:mga06r32_1335807_c1 | 3300050510 | Bacteria | 660 |
| 1798 | nmdc:mga06r32_143512_c1 | 3300050510 | Bacteria | 2365 |
| 1799 | nmdc:mga06r32_15953_c1 | 3300050510 | Bacteria | 6834 |
| 1800 | nmdc:mga06r32_179600_c1 | 3300050510 | Unclassified | 2102 |
| 1801 | nmdc:mga06r32_186462_c1 | 3300050510 | Bacteria | 2061 |
| 1802 | nmdc:mga06r32_212762_c1 | 3300050510 | Bacteria | 1921 |
| 1803 | nmdc:mga06r32_22813_c1 | 3300050510 | Bacteria | 5789 |
| 1804 | nmdc:mga06r32_247392_c1 | 3300050510 | Bacteria | 1771 |
| 1805 | nmdc:mga06r32_286626_c1 | 3300050510 | Bacteria | 1634 |
| 1806 | nmdc:mga06r32_46488_c1 | 3300050510 | Bacteria | 4141 |
| 1807 | nmdc:mga06r32_589509_c1 | 3300050510 | Bacteria | 1083 |
| 1808 | nmdc:mga06r32_625364_c1 | 3300050510 | Bacteria | 1046 |
| 1809 | nmdc:mga06r32_671709_c1 | 3300050510 | Bacteria | 1003 |
| 1810 | nmdc:mga06r32_7339_c1 | 3300050510 | Bacteria | 9917 |
| 1811 | nmdc:mga06r32_75087_c1 | 3300050510 | Unclassified | 3279 |
| 1812 | nmdc:mga06r32_778904_c1 | 3300050510 | Bacteria | 918 |
| 1813 | nmdc:mga06r32_826150_c1 | 3300050510 | Unclassified | 886 |
| 1814 | nmdc:mga08y16_1372135_c1 | 3300050511 | Bacteria | 671 |
| 1815 | nmdc:mga08y16_1421_c1 | 3300050511 | Bacteria | 24035 |
| 1816 | nmdc:mga08y16_16043_c1 | 3300050511 | Bacteria | 7875 |
| 1817 | nmdc:mga08y16_22405_c1 | 3300050511 | Bacteria | 6668 |
| 1818 | nmdc:mga08y16_26977_c1 | 3300050511 | Bacteria | 6054 |
| 1819 | nmdc:mga08y16_298163_c1 | 3300050511 | Unclassified | 1662 |
| 1820 | nmdc:mga08y16_362422_c1 | 3300050511 | Bacteria | 1488 |
| 1821 | nmdc:mga08y16_4008_c1 | 3300050511 | Bacteria | 15354 |
| 1822 | nmdc:mga08y16_573375_c1 | 3300050511 | Bacteria | 1140 |
| 1823 | nmdc:mga08y16_790720_c1 | 3300050511 | Bacteria | 942 |
| 1824 | nmdc:mga08y16_810204_c1 | 3300050511 | Bacteria | 929 |
| 1825 | nmdc:mga08y16_838545_c1 | 3300050511 | Bacteria | 909 |
| 1826 | nmdc:mga08y16_964441_c1 | 3300050511 | Unclassified | 835 |
| 1827 | nmdc:mga0n895_1036812_c1 | 3300050512 | Unclassified | 800 |
| 1828 | nmdc:mga0n895_134147_c1 | 3300050512 | Bacteria | 2502 |
| 1829 | nmdc:mga0n895_1630891_c1 | 3300050512 | Bacteria | 609 |
| 1830 | nmdc:mga0n895_17240_c1 | 3300050512 | Bacteria | 6655 |
| 1831 | nmdc:mga0n895_21135_c1 | 3300050512 | Bacteria | 6082 |
| 1832 | nmdc:mga0n895_230292_c1 | 3300050512 | Unclassified | 1881 |
| 1833 | nmdc:mga0n895_300669_c1 | 3300050512 | Bacteria | 1627 |
| 1834 | nmdc:mga0n895_61517_c1 | 3300050512 | Bacteria | 3707 |
| 1835 | nmdc:mga0n895_744010_c1 | 3300050512 | Bacteria | 974 |
| 1836 | nmdc:mga0n895_883963_c1 | 3300050512 | Bacteria | 880 |
| 1837 | nmdc:mga0rr50_1072245_c1 | 3300050513 | Bacteria | 686 |
| 1838 | nmdc:mga0rr50_119107_c1 | 3300050513 | Unclassified | 2099 |
| 1839 | nmdc:mga0rr50_211373_c1 | 3300050513 | Bacteria | 1598 |
| 1840 | nmdc:mga0rr50_27802_c1 | 3300050513 | Bacteria | 3966 |
| 1841 | nmdc:mga0rr50_28541_c1 | 3300050513 | Bacteria | 3923 |
| 1842 | nmdc:mga0rr50_474019_c1 | 3300050513 | Bacteria | 1063 |
| 1843 | nmdc:mga0rr50_49805_c1 | 3300050513 | Bacteria | 3102 |
| 1844 | nmdc:mga0rr50_924602_c1 | 3300050513 | Bacteria | 744 |
| 1845 | nmdc:mga08x19_1369749_c1 | 3300050514 | Unclassified | 501 |
| 1846 | nmdc:mga08x19_40093_c1 | 3300050514 | Bacteria | 2980 |
| 1847 | nmdc:mga0a205_13670_c1 | 3300050515 | Bacteria | 7563 |
| 1848 | nmdc:mga0a205_1425727_c1 | 3300050515 | Bacteria | 540 |
| 1849 | nmdc:mga0a205_1747_c1 | 3300050515 | Bacteria | 18788 |
| 1850 | nmdc:mga0a205_218689_c1 | 3300050515 | Bacteria | 1791 |
| 1851 | nmdc:mga0a205_35325_c1 | 3300050515 | Bacteria | 4461 |
| 1852 | nmdc:mga0a205_400297_c1 | 3300050515 | Bacteria | 1237 |
| 1853 | nmdc:mga0a205_475691_c1 | 3300050515 | Bacteria | 1108 |
| 1854 | nmdc:mga0a205_5305_c1 | 3300050515 | Bacteria | 7720 |
| 1855 | nmdc:mga0a205_77849_c2 | 3300050515 | Bacteria | 2457 |
| 1856 | nmdc:mga0a205_78094_c1 | 3300050515 | Bacteria | 2621 |
| 1857 | nmdc:mga0a205_88030_c1 | 3300050515 | Bacteria | 3001 |
| 1858 | nmdc:mga0sz30_52699_c1 | 3300050516 | Bacteria | 1727 |
| 1859 | Ga0495601_0026558 | 3300053077 | Unclassified | 3576 |
| 1860 | Ga0495601_0046700 | 3300053077 | Bacteria | 2726 |
| 1861 | Ga0495601_0683636 | 3300053077 | Bacteria | 655 |
| 1862 | Ga0495612_0538904 | 3300053078 | Bacteria | 537 |
| 1863 | Ga0495655_0165365 | 3300053083 | Bacteria | 705 |
| 1864 | Ga0495619_0225593 | 3300053085 | Bacteria | 1298 |
| 1865 | Ga0495619_0593098 | 3300053085 | Unclassified | 758 |
| 1866 | Ga0500555_001190 | 3300053103 | Bacteria | 8504 |
| 1867 | Ga0500628_111008 | 3300053129 | Bacteria | 735 |
| 1868 | Ga0500628_163595 | 3300053129 | Unclassified | 628 |
| 1869 | Ga0500616_0000529 | 3300053153 | Bacteria | 47940 |
| 1870 | Ga0500627_0495501 | 3300053158 | Bacteria | 509 |
| 1871 | Ga0500645_000293 | 3300053730 | Bacteria | 35759 |
| 1872 | Ga0501084_0034752 | 3300054114 | Bacteria | 4215 |
| 1873 | Ga0501084_0095716 | 3300054114 | Bacteria | 2494 |
| 1874 | Ga0501084_0098812 | 3300054114 | Unclassified | 2451 |
| 1875 | Ga0501084_0126087 | 3300054114 | Bacteria | 2154 |
| 1876 | Ga0501084_0211315 | 3300054114 | Bacteria | 1637 |
| 1877 | Ga0501084_0317402 | 3300054114 | Bacteria | 1316 |
| 1878 | Ga0501084_0570793 | 3300054114 | Bacteria | 956 |
| 1879 | Ga0501084_1755963 | 3300054114 | Bacteria | 518 |
| 1880 | Ga0590071_000101 | 3300059421 | Bacteria | 24284 |
| 1881 | Ga0590071_000336 | 3300059421 | Bacteria | 13755 |
| 1882 | Ga0590071_009812 | 3300059421 | Unclassified | 2245 |
| 1883 | Ga0590071_039441 | 3300059421 | Bacteria | 1135 |
| 1884 | Ga0590071_069613 | 3300059421 | Unclassified | 867 |
| 1885 | Ga0590074_000047 | 3300059423 | Bacteria | 11980 |
| 1886 | Ga0590074_001254 | 3300059423 | Bacteria | 4027 |
| 1887 | Ga0590074_061513 | 3300059423 | Unclassified | 698 |
| 1888 | Ga0590075_001041 | 3300059424 | Bacteria | 7156 |
| 1889 | Ga0590075_002157 | 3300059424 | Bacteria | 4732 |
| 1890 | Ga0590075_040025 | 3300059424 | Bacteria | 1196 |
| 1891 | Ga0590077_000084 | 3300059426 | Bacteria | 23941 |
| 1892 | Ga0590077_000329 | 3300059426 | Bacteria | 13446 |
| 1893 | Ga0501082_0038890 | 3300060353 | Bacteria | 4103 |
| 1894 | Ga0501082_0162597 | 3300060353 | Unclassified | 1940 |
| 1895 | Ga0501082_0168109 | 3300060353 | Unclassified | 1906 |
| 1896 | Ga0501082_0179052 | 3300060353 | Bacteria | 1844 |
| 1897 | Ga0501082_0513243 | 3300060353 | Unclassified | 1048 |
| 1898 | Ga0501082_1221285 | 3300060353 | Unclassified | 657 |
| 1899 | Ga0530510_0000953 | 3300061734 | Bacteria | 19095 |
| 1900 | Ga0530510_0014707 | 3300061734 | Bacteria | 5524 |
| 1901 | Ga0530510_0203591 | 3300061734 | Unclassified | 1471 |
| 1902 | Ga0530510_0268348 | 3300061734 | Bacteria | 1273 |
| 1903 | Ga0530510_0530658 | 3300061734 | Bacteria | 893 |
| 1904 | Ga0530510_0779137 | 3300061734 | Bacteria | 729 |
| 1905 | Ga0070674_101675223 | |||
| 1906 | ARSoilOldRDRAFT_c020637 | |||
| 1907 | JGI24746J21847_1006920 | |||
| 1908 | JGI24750J21931_1024926 | |||
| 1909 | JGI24745J21846_1023412 | |||
| 1910 | JGI24749J21850_1076484 | |||
| 1911 | JGI24035J26624_1024272 | |||
| 1912 | JGI24033J26618_1003820 | |||
| 1913 | JGI24033J26618_1028540 | |||
| 1914 | JGI24034J26672_10117660 | |||
| 1915 | JGI24742J22300_10085476 | |||
| 1916 | JGI24742J22300_10116928 | |||
| 1917 | JGI24751J29686_10077786 | |||
| 1918 | JGI24751J29686_10121676 | |||
| 1919 | JGI24751J29686_10137735 | |||
| 1920 | Ga0058859_11527305 | |||
| 1921 | Ga0058860_11945108 | |||
| 1922 | Ga0065714_10317131 | |||
| 1923 | Ga0065714_10372059 | |||
| 1924 | Ga0065704_10448172 | |||
| 1925 | Ga0065704_10864364 | |||
| 1926 | Ga0065712_10000775 | |||
| 1927 | Ga0065712_10012333 | |||
| 1928 | Ga0065712_10115560 | |||
| 1929 | Ga0065712_10168983 | |||
| 1930 | Ga0065712_10170177 | |||
| 1931 | Ga0065712_10201384 | |||
| 1932 | Ga0065712_10235507 | |||
| 1933 | Ga0065712_10377769 | |||
| 1934 | Ga0065712_10527480 | |||
| 1935 | Ga0065715_10001070 | |||
| 1936 | Ga0065715_10009998 | |||
| 1937 | Ga0065715_10029765 | |||
| 1938 | Ga0065715_10033698 | |||
| 1939 | Ga0065715_10126661 | |||
| 1940 | Ga0065715_10176037 | |||
| 1941 | Ga0065715_10215752 | |||
| 1942 | Ga0065715_10223288 | |||
| 1943 | Ga0065715_10363450 | |||
| 1944 | Ga0065715_10436698 | |||
| 1945 | Ga0065715_10656521 | |||
| 1946 | Ga0065715_10765485 | |||
| 1947 | Ga0065715_10870389 | |||
| 1948 | Ga0065715_10935636 | |||
| 1949 | Ga0065707_10098873 | |||
| 1950 | Ga0065707_10114639 | |||
| 1951 | Ga0065707_10141208 | |||
| 1952 | Ga0065707_10162916 | |||
| 1953 | Ga0065707_10187785 | |||
| 1954 | Ga0065707_10337811 | |||
| 1955 | Ga0065707_10528200 | |||
| 1956 | Ga0065707_10792263 | |||
| 1957 | Ga0070676_10005668 | |||
| 1958 | Ga0070676_10008405 | |||
| 1959 | Ga0070676_10014235 | |||
| 1960 | Ga0070676_10157544 | |||
| 1961 | Ga0070676_10311852 | |||
| 1962 | Ga0070676_10625560 | |||
| 1963 | Ga0070676_11076418 | |||
| 1964 | Ga0070683_100012700 | |||
| 1965 | Ga0070683_100028485 | |||
| 1966 | Ga0070683_101492807 | |||
| 1967 | Ga0070690_100001367 | |||
| 1968 | Ga0070690_100138636 | |||
| 1969 | Ga0070690_100199496 | |||
| 1970 | Ga0070690_100293840 | |||
| 1971 | Ga0070690_100463396 | |||
| 1972 | Ga0070690_100664152 | |||
| 1973 | Ga0070670_100001056 | |||
| 1974 | Ga0070670_100003418 | |||
| 1975 | Ga0070670_100011917 | |||
| 1976 | Ga0070670_100014644 | |||
| 1977 | Ga0070670_100026445 | |||
| 1978 | Ga0070670_100176707 | |||
| 1979 | Ga0070670_100260554 | |||
| 1980 | Ga0070670_100270920 | |||
| 1981 | Ga0070670_100551870 | |||
| 1982 | Ga0070670_100580087 | |||
| 1983 | Ga0070670_101144369 | |||
| 1984 | Ga0070670_101781279 | |||
| 1985 | Ga0070677_10001098 | |||
| 1986 | Ga0070677_10060979 | |||
| 1987 | Ga0068869_100012287 | |||
| 1988 | Ga0068869_100029336 | |||
| 1989 | Ga0068869_100052708 | |||
| 1990 | Ga0068869_100164584 | |||
| 1991 | Ga0068869_100337876 | |||
| 1992 | Ga0068869_100683836 | |||
| 1993 | Ga0068869_100772395 | |||
| 1994 | Ga0068869_101088818 | |||
| 1995 | Ga0070666_10004920 | |||
| 1996 | Ga0070666_10004925 | |||
| 1997 | Ga0070666_10105649 | |||
| 1998 | Ga0070666_10209687 | |||
| 1999 | Ga0070666_10373478 | |||
| 2000 | Ga0070666_10925786 | |||
| 2001 | Ga0070666_10967852 | |||
| 2002 | Ga0070680_100371989 | |||
| 2003 | Ga0070680_100534839 | |||
| 2004 | Ga0070680_100851949 | |||
| 2005 | Ga0068868_100026032 | |||
| 2006 | Ga0068868_100051760 | |||
| 2007 | Ga0068868_100063469 | |||
| 2008 | Ga0068868_100183316 | |||
| 2009 | Ga0068868_100361891 | |||
| 2010 | Ga0068868_100601652 | |||
| 2011 | Ga0068868_100613978 | |||
| 2012 | Ga0070689_100009831 | |||
| 2013 | Ga0070689_100012440 | |||
| 2014 | Ga0070689_100013722 | |||
| 2015 | Ga0070689_100261171 | |||
| 2016 | Ga0070689_100287319 | |||
| 2017 | Ga0070689_101851251 | |||
| 2018 | Ga0070691_10017999 | |||
| 2019 | Ga0070691_10109418 | |||
| 2020 | Ga0070691_11075113 | |||
| 2021 | Ga0070687_100002563 | |||
| 2022 | Ga0070687_100956309 | |||
| 2023 | Ga0070661_100035901 | |||
| 2024 | Ga0070661_100073228 | |||
| 2025 | Ga0070661_100500796 | |||
| 2026 | Ga0070661_100693705 | |||
| 2027 | Ga0070661_101258851 | |||
| 2028 | Ga0070692_10018548 | |||
| 2029 | Ga0070692_10591514 | |||
| 2030 | Ga0070668_100025802 | |||
| 2031 | Ga0070668_100077094 | |||
| 2032 | Ga0070668_100252662 | |||
| 2033 | Ga0070668_100411244 | |||
| 2034 | Ga0070668_100745261 | |||
| 2035 | Ga0070668_100912053 | |||
| 2036 | Ga0070668_101578750 | |||
| 2037 | Ga0070669_100003160 | |||
| 2038 | Ga0070669_100004710 | |||
| 2039 | Ga0070669_100007510 | |||
| 2040 | Ga0070669_100081082 | |||
| 2041 | Ga0070669_100125892 | |||
| 2042 | Ga0070669_100194685 | |||
| 2043 | Ga0070669_100209228 | |||
| 2044 | Ga0070669_100279416 | |||
| 2045 | Ga0070669_100305547 | |||
| 2046 | Ga0070669_100553144 | |||
| 2047 | Ga0070669_100916964 | |||
| 2048 | Ga0070669_101192359 | |||
| 2049 | Ga0070669_101283931 | |||
| 2050 | Ga0070675_100000502 | |||
| 2051 | Ga0070675_100003069 | |||
| 2052 | Ga0070675_100041219 | |||
| 2053 | Ga0070675_100048836 | |||
| 2054 | Ga0070675_100145233 | |||
| 2055 | Ga0070675_100185401 | |||
| 2056 | Ga0070675_100187537 | |||
| 2057 | Ga0070675_100199568 | |||
| 2058 | Ga0070675_100217107 | |||
| 2059 | Ga0070675_100246104 | |||
| 2060 | Ga0070675_100416211 | |||
| 2061 | Ga0070675_101319585 | |||
| 2062 | Ga0070675_101715054 | |||
| 2063 | Ga0070675_101844339 | |||
| 2064 | Ga0070671_100010260 | |||
| 2065 | Ga0070671_100024040 | |||
| 2066 | Ga0070671_100110296 | |||
| 2067 | Ga0070671_100118277 | |||
| 2068 | Ga0070671_100202966 | |||
| 2069 | Ga0070671_100466625 | |||
| 2070 | Ga0070671_100747456 | |||
| 2071 | Ga0070674_100001237 | |||
| 2072 | Ga0070674_100010170 | |||
| 2073 | Ga0070674_100018217 | |||
| 2074 | Ga0070674_100020127 | |||
| 2075 | Ga0070674_100058419 | |||
| 2076 | Ga0070674_100131325 | |||
| 2077 | Ga0070674_100176053 | |||
| 2078 | Ga0070674_100246787 | |||
| 2079 | Ga0070674_100413629 | |||
| 2080 | Ga0070674_100454421 | |||
| 2081 | Ga0070674_101494348 | |||
| 2082 | Ga0070673_100005561 | |||
| 2083 | Ga0070673_100046195 | |||
| 2084 | Ga0070673_100070450 | |||
| 2085 | Ga0070673_100105269 | |||
| 2086 | Ga0070673_100131442 | |||
| 2087 | Ga0070673_100506332 | |||
| 2088 | Ga0070673_100506353 | |||
| 2089 | Ga0070673_101220851 | |||
| 2090 | Ga0070688_100030480 | |||
| 2091 | Ga0070688_100061437 | |||
| 2092 | Ga0070688_100062720 | |||
| 2093 | Ga0070688_100087397 | |||
| 2094 | Ga0070688_100199789 | |||
| 2095 | Ga0070688_100236770 | |||
| 2096 | Ga0070688_100283533 | |||
| 2097 | Ga0070688_100703084 | |||
| 2098 | Ga0070688_101190390 | |||
| 2099 | Ga0070659_100211607 | |||
| 2100 | Ga0070659_100660524 | |||
| 2101 | Ga0070659_101703495 | |||
| 2102 | Ga0070667_100026061 | |||
| 2103 | Ga0070667_100296295 | |||
| 2104 | Ga0070667_100644923 | |||
| 2105 | Ga0070703_10018391 | |||
| 2106 | Ga0070703_10326271 | |||
| 2107 | Ga0070703_10516218 | |||
| 2108 | Ga0070701_10008872 | |||
| 2109 | Ga0070701_10013648 | |||
| 2110 | Ga0070701_10020213 | |||
| 2111 | Ga0070701_10033554 | |||
| 2112 | Ga0070701_10132863 | |||
| 2113 | Ga0070701_10196455 | |||
| 2114 | Ga0070701_10208892 | |||
| 2115 | Ga0070701_10289827 | |||
| 2116 | Ga0070701_10725795 | |||
| 2117 | Ga0070705_100003386 | |||
| 2118 | Ga0070705_100021073 | |||
| 2119 | Ga0070705_100038561 | |||
| 2120 | Ga0070705_100106277 | |||
| 2121 | Ga0070705_100112868 | |||
| 2122 | Ga0070705_100113714 | |||
| 2123 | Ga0070705_100291587 | |||
| 2124 | Ga0070705_100736792 | |||
| 2125 | Ga0070705_101305640 | |||
| 2126 | Ga0070700_100007080 | |||
| 2127 | Ga0070700_100012620 | |||
| 2128 | Ga0070700_100038066 | |||
| 2129 | Ga0070700_100057171 | |||
| 2130 | Ga0070700_100099421 | |||
| 2131 | Ga0070700_100213178 | |||
| 2132 | Ga0070700_100328204 | |||
| 2133 | Ga0070700_100432690 | |||
| 2134 | Ga0070700_100531037 | |||
| 2135 | Ga0070700_100578188 | |||
| 2136 | Ga0070700_100595061 | |||
| 2137 | Ga0070694_100013503 | |||
| 2138 | Ga0070694_100014816 | |||
| 2139 | Ga0070694_100134230 | |||
| 2140 | Ga0070694_100200845 | |||
| 2141 | Ga0070694_100533792 | |||
| 2142 | Ga0070694_101183803 | |||
| 2143 | Ga0070694_101804888 | |||
| 2144 | Ga0070708_100953576 | |||
| 2145 | Ga0070663_100043507 | |||
| 2146 | Ga0070663_100191003 | |||
| 2147 | Ga0070663_101100873 | |||
| 2148 | Ga0070663_101481456 | |||
| 2149 | Ga0070663_101720232 | |||
| 2150 | Ga0070663_101935265 | |||
| 2151 | Ga0070678_100019903 | |||
| 2152 | Ga0070678_100087016 | |||
| 2153 | Ga0070678_100154203 | |||
| 2154 | Ga0070678_100205398 | |||
| 2155 | Ga0070678_101012876 | |||
| 2156 | Ga0070678_101112991 | |||
| 2157 | Ga0070678_101483653 | |||
| 2158 | Ga0070662_100021377 | |||
| 2159 | Ga0070662_100171151 | |||
| 2160 | Ga0070662_100258788 | |||
| 2161 | Ga0070662_100388408 | |||
| 2162 | Ga0070662_100389733 | |||
| 2163 | Ga0070662_100415852 | |||
| 2164 | Ga0070662_100520832 | |||
| 2165 | Ga0070662_101597035 | |||
| 2166 | Ga0068867_100002404 | |||
| 2167 | Ga0068867_100098587 | |||
| 2168 | Ga0068867_100141719 | |||
| 2169 | Ga0068867_100174438 | |||
| 2170 | Ga0068867_100202972 | |||
| 2171 | Ga0068867_100295913 | |||
| 2172 | Ga0068867_100302571 | |||
| 2173 | Ga0068867_100389991 | |||
| 2174 | Ga0068867_100706954 | |||
| 2175 | Ga0068867_100756257 | |||
| 2176 | Ga0068867_101398937 | |||
| 2177 | Ga0068867_101534951 | |||
| 2178 | Ga0070685_10042272 | |||
| 2179 | Ga0070685_10093149 | |||
| 2180 | Ga0070685_10095899 | |||
| 2181 | Ga0070685_10177467 | |||
| 2182 | Ga0070685_10252329 | |||
| 2183 | Ga0070706_100077287 | |||
| 2184 | Ga0070706_100102584 | |||
| 2185 | Ga0070707_100044771 | |||
| 2186 | Ga0070707_100399187 | |||
| 2187 | Ga0070707_102162271 | |||
| 2188 | Ga0070698_100059421 | |||
| 2189 | Ga0070698_100129763 | |||
| 2190 | Ga0070698_100320405 | |||
| 2191 | Ga0070698_100469297 | |||
| 2192 | Ga0070699_100000937 | |||
| 2193 | Ga0070699_100005227 | |||
| 2194 | Ga0070699_100018475 | |||
| 2195 | Ga0070699_100037639 | |||
| 2196 | Ga0070699_100102803 | |||
| 2197 | Ga0070699_100553478 | |||
| 2198 | Ga0070699_101769376 | |||
| 2199 | Ga0070679_101623948 | |||
| 2200 | Ga0070684_100005319 | |||
| 2201 | Ga0070684_100572681 | |||
| 2202 | Ga0070684_100963693 | |||
| 2203 | Ga0070684_101411069 | |||
| 2204 | Ga0070697_100039196 | |||
| 2205 | Ga0070697_101161873 | |||
| 2206 | Ga0068853_101077282 | |||
| 2207 | Ga0068853_101574083 | |||
| 2208 | Ga0070672_100019741 | |||
| 2209 | Ga0070672_100028590 | |||
| 2210 | Ga0070672_100049657 | |||
| 2211 | Ga0070672_100082515 | |||
| 2212 | Ga0070672_100113382 | |||
| 2213 | Ga0070672_100129890 | |||
| 2214 | Ga0070672_100277951 | |||
| 2215 | Ga0070672_100296448 | |||
| 2216 | Ga0070672_100398192 | |||
| 2217 | Ga0070672_100814984 | |||
| 2218 | Ga0070672_100877871 | |||
| 2219 | Ga0070672_101309036 | |||
| 2220 | Ga0070686_100003121 | |||
| 2221 | Ga0070686_100011544 | |||
| 2222 | Ga0070686_100124546 | |||
| 2223 | Ga0070686_100283134 | |||
| 2224 | Ga0070686_100431468 | |||
| 2225 | Ga0070686_100499251 | |||
| 2226 | Ga0070686_100717507 | |||
| 2227 | Ga0070695_100000182 | |||
| 2228 | Ga0070695_100027508 | |||
| 2229 | Ga0070695_100071115 | |||
| 2230 | Ga0070695_100580507 | |||
| 2231 | Ga0070695_101604067 | |||
| 2232 | Ga0070696_100016048 | |||
| 2233 | Ga0070696_100016512 | |||
| 2234 | Ga0070696_100126621 | |||
| 2235 | Ga0070696_100145134 | |||
| 2236 | Ga0070696_100500007 | |||
| 2237 | Ga0070693_100012094 | |||
| 2238 | Ga0070693_100017627 | |||
| 2239 | Ga0070693_100969899 | |||
| 2240 | Ga0070665_100004472 | |||
| 2241 | Ga0070665_100039569 | |||
| 2242 | Ga0070665_100051301 | |||
| 2243 | Ga0070665_100718622 | |||
| 2244 | Ga0070704_100000072 | |||
| 2245 | Ga0070704_100001134 | |||
| 2246 | Ga0070704_100010082 | |||
| 2247 | Ga0070704_100012184 | |||
| 2248 | Ga0070704_100019061 | |||
| 2249 | Ga0070704_100070530 | |||
| 2250 | Ga0070704_100188351 | |||
| 2251 | Ga0070704_100253819 | |||
| 2252 | Ga0070704_100289930 | |||
| 2253 | Ga0070704_100401331 | |||
| 2254 | Ga0070704_100483383 | |||
| 2255 | Ga0070704_100593529 | |||
| 2256 | Ga0070704_100677745 | |||
| 2257 | Ga0068855_100439046 | |||
| 2258 | Ga0070664_100007496 | |||
| 2259 | Ga0070664_100009434 | |||
| 2260 | Ga0070664_100020954 | |||
| 2261 | Ga0070664_100073756 | |||
| 2262 | Ga0070664_100109493 | |||
| 2263 | Ga0070664_100190945 | |||
| 2264 | Ga0070664_100250947 | |||
| 2265 | Ga0070664_100356734 | |||
| 2266 | Ga0070664_100862736 | |||
| 2267 | Ga0070664_101043680 | |||
| 2268 | Ga0070664_101900868 | |||
| 2269 | Ga0068857_100024374 | |||
| 2270 | Ga0068857_100051939 | |||
| 2271 | Ga0068857_100081857 | |||
| 2272 | Ga0068857_100215773 | |||
| 2273 | Ga0068857_100355069 | |||
| 2274 | Ga0068857_100704045 | |||
| 2275 | Ga0068857_100830788 | |||
| 2276 | Ga0068857_100978096 | |||
| 2277 | Ga0068857_101927961 | |||
| 2278 | Ga0068854_100024563 | |||
| 2279 | Ga0068854_100077444 | |||
| 2280 | Ga0068854_100827211 | |||
| 2281 | Ga0068854_101130639 | |||
| 2282 | Ga0070702_100014380 | |||
| 2283 | Ga0070702_100026067 | |||
| 2284 | Ga0070702_100032348 | |||
| 2285 | Ga0070702_100119827 | |||
| 2286 | Ga0070702_100382459 | |||
| 2287 | Ga0068852_100566576 | |||
| 2288 | Ga0068852_102639636 | |||
| 2289 | Ga0068859_100005205 | |||
| 2290 | Ga0068859_100007562 | |||
| 2291 | Ga0068859_100007755 | |||
| 2292 | Ga0068859_100033302 | |||
| 2293 | Ga0068859_100316127 | |||
| 2294 | Ga0068859_100535674 | |||
| 2295 | Ga0068859_100596850 | |||
| 2296 | Ga0068859_100855329 | |||
| 2297 | Ga0068859_100950010 | |||
| 2298 | Ga0068859_101051931 | |||
| 2299 | Ga0068859_101235910 | |||
| 2300 | Ga0068859_101305215 | |||
| 2301 | Ga0068864_100011350 | |||
| 2302 | Ga0068864_100026714 | |||
| 2303 | Ga0068864_100028503 | |||
| 2304 | Ga0068864_100048189 | |||
| 2305 | Ga0068864_100166745 | |||
| 2306 | Ga0068864_100503402 | |||
| 2307 | Ga0068864_100708571 | |||
| 2308 | Ga0068864_100795811 | |||
| 2309 | Ga0068864_101382335 | |||
| 2310 | Ga0068866_10090978 | |||
| 2311 | Ga0068866_10167730 | |||
| 2312 | Ga0068866_10338679 | |||
| 2313 | Ga0068866_10341313 | |||
| 2314 | Ga0068861_100000239 | |||
| 2315 | Ga0068861_100014721 | |||
| 2316 | Ga0068861_100084340 | |||
| 2317 | Ga0068861_100129061 | |||
| 2318 | Ga0068861_100162454 | |||
| 2319 | Ga0068861_100274539 | |||
| 2320 | Ga0068861_100282164 | |||
| 2321 | Ga0068861_100397006 | |||
| 2322 | Ga0068861_100459097 | |||
| 2323 | Ga0068861_100483623 | |||
| 2324 | Ga0068861_100513865 | |||
| 2325 | Ga0068861_100610290 | |||
| 2326 | Ga0068861_100939516 | |||
| 2327 | Ga0068861_101055615 | |||
| 2328 | Ga0068851_10248815 | |||
| 2329 | Ga0068851_10573325 | |||
| 2330 | Ga0068870_10003677 | |||
| 2331 | Ga0068870_10006313 | |||
| 2332 | Ga0068870_10046545 | |||
| 2333 | Ga0068870_10101013 | |||
| 2334 | Ga0068870_10131258 | |||
| 2335 | Ga0068870_10185451 | |||
| 2336 | Ga0068870_10294494 | |||
| 2337 | Ga0068870_10430009 | |||
| 2338 | Ga0068863_100021570 | |||
| 2339 | Ga0068863_100047013 | |||
| 2340 | Ga0068863_100226327 | |||
| 2341 | Ga0068863_100247865 | |||
| 2342 | Ga0068863_100462798 | |||
| 2343 | Ga0068858_100012319 | |||
| 2344 | Ga0068858_100014103 | |||
| 2345 | Ga0068858_100045281 | |||
| 2346 | Ga0068858_100071743 | |||
| 2347 | Ga0068858_100216705 | |||
| 2348 | Ga0068858_100637644 | |||
| 2349 | Ga0068858_100638201 | |||
| 2350 | Ga0068858_101013755 | |||
| 2351 | Ga0068858_101955661 | |||
| 2352 | Ga0068858_102551206 | |||
| 2353 | Ga0068860_100003239 | |||
| 2354 | Ga0068860_100010475 | |||
| 2355 | Ga0068860_100138759 | |||
| 2356 | Ga0068860_100172637 | |||
| 2357 | Ga0068860_100404359 | |||
| 2358 | Ga0068860_100545826 | |||
| 2359 | Ga0068860_100770055 | |||
| 2360 | Ga0068860_101267007 | |||
| 2361 | Ga0068860_101346835 | |||
| 2362 | Ga0068862_100000540 | |||
| 2363 | Ga0068862_100004222 | |||
| 2364 | Ga0068862_100045653 | |||
| 2365 | Ga0068862_100074049 | |||
| 2366 | Ga0068862_100093928 | |||
| 2367 | Ga0068862_100142852 | |||
| 2368 | Ga0068862_100662335 | |||
| 2369 | Ga0068862_100722121 | |||
| 2370 | Ga0068862_101376138 | |||
| 2371 | Ga0081455_10206486 | |||
| 2372 | Ga0081538_10186823 | |||
| 2373 | Ga0075365_10009426 | |||
| 2374 | Ga0075365_10338996 | |||
| 2375 | Ga0075368_10004232 | |||
| 2376 | Ga0075368_10045410 | |||
| 2377 | Ga0075368_10168945 | |||
| 2378 | Ga0075363_100119107 | |||
| 2379 | Ga0075364_10013927 | |||
| 2380 | Ga0075364_10020344 | |||
| 2381 | Ga0075364_10088018 | |||
| 2382 | Ga0075432_10254567 | |||
| 2383 | Ga0070715_10786534 | |||
| 2384 | Ga0070712_100122546 | |||
| 2385 | Ga0075362_10003449 | |||
| 2386 | Ga0075362_10544573 | |||
| 2387 | Ga0075367_10016079 | |||
| 2388 | Ga0075367_10461787 | |||
| 2389 | Ga0075367_10648119 | |||
| 2390 | Ga0075366_10029281 | |||
| 2391 | Ga0075366_10046686 | |||
| 2392 | Ga0097621_100022373 | |||
| 2393 | Ga0097621_100050969 | |||
| 2394 | Ga0097621_100106966 | |||
| 2395 | Ga0097621_100164275 | |||
| 2396 | Ga0097621_100990110 | |||
| 2397 | Ga0097621_101344127 | |||
| 2398 | Ga0075370_10050245 | |||
| 2399 | Ga0068871_100007573 | |||
| 2400 | Ga0068871_100019826 | |||
| 2401 | Ga0068871_100242448 | |||
| 2402 | Ga0068871_100781496 | |||
| 2403 | Ga0068871_100792729 | |||
| 2404 | Ga0068871_100831379 | |||
| 2405 | Ga0068871_101726884 | |||
| 2406 | Ga0075428_100000131 | |||
| 2407 | Ga0075428_100002180 | |||
| 2408 | Ga0075428_100013531 | |||
| 2409 | Ga0075428_100023551 | |||
| 2410 | Ga0075428_100026076 | |||
| 2411 | Ga0075428_100027620 | |||
| 2412 | Ga0075428_100040836 | |||
| 2413 | Ga0075428_100076697 | |||
| 2414 | Ga0075428_100202157 | |||
| 2415 | Ga0075428_100463463 | |||
| 2416 | Ga0075428_100679837 | |||
| 2417 | Ga0075428_102035199 | |||
| 2418 | Ga0075430_100000946 | |||
| 2419 | Ga0075430_100003944 | |||
| 2420 | Ga0075430_100004795 | |||
| 2421 | Ga0075430_100007269 | |||
| 2422 | Ga0075430_100007760 | |||
| 2423 | Ga0075430_100008077 | |||
| 2424 | Ga0075430_100042648 | |||
| 2425 | Ga0075430_100174026 | |||
| 2426 | Ga0075430_100395860 | |||
| 2427 | Ga0075430_100640134 | |||
| 2428 | Ga0075430_100711615 | |||
| 2429 | Ga0075430_101201792 | |||
| 2430 | Ga0075431_100001520 | |||
| 2431 | Ga0075431_100014267 | |||
| 2432 | Ga0075431_100033361 | |||
| 2433 | Ga0075431_100033995 | |||
| 2434 | Ga0075431_100046844 | |||
| 2435 | Ga0075431_100091842 | |||
| 2436 | Ga0075431_100154554 | |||
| 2437 | Ga0075431_100162065 | |||
| 2438 | Ga0075431_100228688 | |||
| 2439 | Ga0075431_100356258 | |||
| 2440 | Ga0075431_100647008 | |||
| 2441 | Ga0075431_100647621 | |||
| 2442 | Ga0075431_100849997 | |||
| 2443 | Ga0075431_101895670 | |||
| 2444 | Ga0075433_10014906 | |||
| 2445 | Ga0075433_10061592 | |||
| 2446 | Ga0075433_10068578 | |||
| 2447 | Ga0075433_10082154 | |||
| 2448 | Ga0075433_10148108 | |||
| 2449 | Ga0075433_10158463 | |||
| 2450 | Ga0075433_10213926 | |||
| 2451 | Ga0075433_10249561 | |||
| 2452 | Ga0075433_10537474 | |||
| 2453 | Ga0075434_100008967 | |||
| 2454 | Ga0075434_100030333 | |||
| 2455 | Ga0075434_100031190 | |||
| 2456 | Ga0075434_100042013 | |||
| 2457 | Ga0075434_100043313 | |||
| 2458 | Ga0075434_100074921 | |||
| 2459 | Ga0075434_100099044 | |||
| 2460 | Ga0075434_100367429 | |||
| 2461 | Ga0075434_100971041 | |||
| 2462 | Ga0075434_102249446 | |||
| 2463 | Ga0075434_102307476 | |||
| 2464 | Ga0075429_100014314 | |||
| 2465 | Ga0075429_100016994 | |||
| 2466 | Ga0075429_100064406 | |||
| 2467 | Ga0075429_100069968 | |||
| 2468 | Ga0075429_100077831 | |||
| 2469 | Ga0075429_100140731 | |||
| 2470 | Ga0075429_100161149 | |||
| 2471 | Ga0075429_100177863 | |||
| 2472 | Ga0075429_100280218 | |||
| 2473 | Ga0075429_100292204 | |||
| 2474 | Ga0075429_100532339 | |||
| 2475 | Ga0068865_100005245 | |||
| 2476 | Ga0068865_100105098 | |||
| 2477 | Ga0068865_100107524 | |||
| 2478 | Ga0068865_100112679 | |||
| 2479 | Ga0068865_101061520 | |||
| 2480 | Ga0068865_101120404 | |||
| 2481 | Ga0068865_102159524 | |||
| 2482 | Ga0075436_100145695 | |||
| 2483 | Ga0075436_100749751 | |||
| 2484 | Ga0097620_100005205 | |||
| 2485 | Ga0097620_100007562 | |||
| 2486 | Ga0097620_100007754 | |||
| 2487 | Ga0097620_100033302 | |||
| 2488 | Ga0097620_100316109 | |||
| 2489 | Ga0097620_100535662 | |||
| 2490 | Ga0097620_100596811 | |||
| 2491 | Ga0097620_100855269 | |||
| 2492 | Ga0097620_100950026 | |||
| 2493 | Ga0097620_101051764 | |||
| 2494 | Ga0097620_101236133 | |||
| 2495 | Ga0097620_101305101 | |||
| 2496 | Ga0075435_100009189 | |||
| 2497 | Ga0075435_100012169 | |||
| 2498 | Ga0075435_100021458 | |||
| 2499 | Ga0075435_100027554 | |||
| 2500 | Ga0075435_100028428 | |||
| 2501 | Ga0075435_100137368 | |||
| 2502 | Ga0075435_100190796 | |||
| 2503 | Ga0075435_100247296 | |||
| 2504 | Ga0075435_100400302 | |||
| 2505 | Ga0075435_100538514 | |||
| 2506 | Ga0075435_101102717 | |||
| 2507 | Ga0105244_10513098 | |||
| 2508 | Ga0105250_10329423 | |||
| 2509 | Ga0105240_10786168 | |||
| 2510 | Ga0111539_10000496 | |||
| 2511 | Ga0111539_10003605 | |||
| 2512 | Ga0111539_10005340 | |||
| 2513 | Ga0111539_10012002 | |||
| 2514 | Ga0111539_10047580 | |||
| 2515 | Ga0111539_10096204 | |||
| 2516 | Ga0111539_10158323 | |||
| 2517 | Ga0111539_10212397 | |||
| 2518 | Ga0111539_10223251 | |||
| 2519 | Ga0111539_10350387 | |||
| 2520 | Ga0111539_10392151 | |||
| 2521 | Ga0111539_10453806 | |||
| 2522 | Ga0111539_11068868 | |||
| 2523 | Ga0111539_11382167 | |||
| 2524 | Ga0111539_11921817 | |||
| 2525 | Ga0111539_12139684 | |||
| 2526 | Ga0111539_12936762 | |||
| 2527 | Ga0105245_10012577 | |||
| 2528 | Ga0105245_10058993 | |||
| 2529 | Ga0105245_10489407 | |||
| 2530 | Ga0105245_10796727 | |||
| 2531 | Ga0105245_10876826 | |||
| 2532 | Ga0105245_11027259 | |||
| 2533 | Ga0105247_10010152 | |||
| 2534 | Ga0105247_10376399 | |||
| 2535 | Ga0105247_10667321 | |||
| 2536 | Ga0105247_10754140 | |||
| 2537 | Ga0105247_11066701 | |||
| 2538 | Ga0114129_10000636 | |||
| 2539 | Ga0114129_10005356 | |||
| 2540 | Ga0114129_10005578 | |||
| 2541 | Ga0114129_10023854 | |||
| 2542 | Ga0114129_10042630 | |||
| 2543 | Ga0114129_10061500 | |||
| 2544 | Ga0114129_10077143 | |||
| 2545 | Ga0114129_10129848 | |||
| 2546 | Ga0114129_10211013 | |||
| 2547 | Ga0114129_10269383 | |||
| 2548 | Ga0114129_10297152 | |||
| 2549 | Ga0114129_10305015 | |||
| 2550 | Ga0114129_10346419 | |||
| 2551 | Ga0114129_10358724 | |||
| 2552 | Ga0114129_10367352 | |||
| 2553 | Ga0114129_10583288 | |||
| 2554 | Ga0114129_10976957 | |||
| 2555 | Ga0114129_12103244 | |||
| 2556 | Ga0105243_10006928 | |||
| 2557 | Ga0105243_10016206 | |||
| 2558 | Ga0105243_10124386 | |||
| 2559 | Ga0105243_10221767 | |||
| 2560 | Ga0105243_10271327 | |||
| 2561 | Ga0105243_10338037 | |||
| 2562 | Ga0105243_10872494 | |||
| 2563 | Ga0105243_11113324 | |||
| 2564 | Ga0105243_11301612 | |||
| 2565 | Ga0105243_11792539 | |||
| 2566 | Ga0105243_12192747 | |||
| 2567 | Ga0105241_10258397 | |||
| 2568 | Ga0105241_11110690 | |||
| 2569 | Ga0105241_11175998 | |||
| 2570 | Ga0105242_10003771 | |||
| 2571 | Ga0105242_10079797 | |||
| 2572 | Ga0105242_10157812 | |||
| 2573 | Ga0105242_10163055 | |||
| 2574 | Ga0105242_10334599 | |||
| 2575 | Ga0105242_10525498 | |||
| 2576 | Ga0105242_10786086 | |||
| 2577 | Ga0105242_10807788 | |||
| 2578 | Ga0105248_10014701 | |||
| 2579 | Ga0105248_10031522 | |||
| 2580 | Ga0105248_10133687 | |||
| 2581 | Ga0105248_10150508 | |||
| 2582 | Ga0105248_10193937 | |||
| 2583 | Ga0105248_10206360 | |||
| 2584 | Ga0105248_10285667 | |||
| 2585 | Ga0105248_10322531 | |||
| 2586 | Ga0105248_10436459 | |||
| 2587 | Ga0105248_10480394 | |||
| 2588 | Ga0105248_10529979 | |||
| 2589 | Ga0105248_10583482 | |||
| 2590 | Ga0105248_10587489 | |||
| 2591 | Ga0105248_11044867 | |||
| 2592 | Ga0105248_11187615 | |||
| 2593 | Ga0105248_11417563 | |||
| 2594 | Ga0105248_12134243 | |||
| 2595 | Ga0105248_12545347 | |||
| 2596 | Ga0105248_13113854 | |||
| 2597 | Ga0105237_10076309 | |||
| 2598 | Ga0105237_11412279 | |||
| 2599 | Ga0105237_11750603 | |||
| 2600 | Ga0105238_10383273 | |||
| 2601 | Ga0105238_10677996 | |||
| 2602 | Ga0105238_11094493 | |||
| 2603 | Ga0105249_10001782 | |||
| 2604 | Ga0105249_10001851 | |||
| 2605 | Ga0105249_10010938 | |||
| 2606 | Ga0105249_10100212 | |||
| 2607 | Ga0105249_10126916 | |||
| 2608 | Ga0105249_10186127 | |||
| 2609 | Ga0105249_10429554 | |||
| 2610 | Ga0105249_10443821 | |||
| 2611 | Ga0105249_10509109 | |||
| 2612 | Ga0105249_10760621 | |||
| 2613 | Ga0105249_11189580 | |||
| 2614 | Ga0105249_12083019 | |||
| 2615 | Ga0105249_12899344 | |||
| 2616 | Ga0105249_13210001 | |||
| 2617 | Ga0105239_10306116 | |||
| 2618 | Ga0105239_10752940 | |||
| 2619 | Ga0105239_11493707 | |||
| 2620 | Ga0105239_12373913 | |||
| 2621 | Ga0105246_10067739 | |||
| 2622 | Ga0105246_10097922 | |||
| 2623 | Ga0105246_10233965 | |||
| 2624 | Ga0105246_10432807 | |||
| 2625 | Ga0105246_10812444 | |||
| 2626 | Ga0105246_10929489 | |||
| 2627 | Ga0105246_11287137 | |||
| 2628 | Ga0105246_11752268 | |||
| 2629 | Ga0105246_11808314 | |||
| 2630 | Ga0105246_12089183 | |||
| 2631 | Ga0105246_12188252 | |||
| 2632 | Ga0157340_1029176 | |||
| 2633 | Ga0157338_1032792 | |||
| 2634 | Ga0157338_1050815 | |||
| 2635 | Ga0157374_10021438 | |||
| 2636 | Ga0157374_10048064 | |||
| 2637 | Ga0157374_10066565 | |||
| 2638 | Ga0157374_11034639 | |||
| 2639 | Ga0157374_11362689 | |||
| 2640 | Ga0157374_11574076 | |||
| 2641 | Ga0157374_11683893 | |||
| 2642 | Ga0157378_10394632 | |||
| 2643 | Ga0157378_10650748 | |||
| 2644 | Ga0157378_11074870 | |||
| 2645 | Ga0157378_12351507 | |||
| 2646 | Ga0157378_12580044 | |||
| 2647 | Ga0163162_10004334 | |||
| 2648 | Ga0163162_10152912 | |||
| 2649 | Ga0163162_10182459 | |||
| 2650 | Ga0163162_10713093 | |||
| 2651 | Ga0157372_10955309 | |||
| 2652 | Ga0157375_10007634 | |||
| 2653 | Ga0157375_10073762 | |||
| 2654 | Ga0157375_10367371 | |||
| 2655 | Ga0157375_10391922 | |||
| 2656 | Ga0157375_10494410 | |||
| 2657 | Ga0157375_10497327 | |||
| 2658 | Ga0157375_10594134 | |||
| 2659 | Ga0157375_10781761 | |||
| 2660 | Ga0157375_11041688 | |||
| 2661 | Ga0157375_11113880 | |||
| 2662 | Ga0157375_12235632 | |||
| 2663 | Ga0163163_10000102 | |||
| 2664 | Ga0163163_10024395 | |||
| 2665 | Ga0163163_10036402 | |||
| 2666 | Ga0163163_10036637 | |||
| 2667 | Ga0163163_10053163 | |||
| 2668 | Ga0163163_10104850 | |||
| 2669 | Ga0163163_10151564 | |||
| 2670 | Ga0163163_10240703 | |||
| 2671 | Ga0163163_10486578 | |||
| 2672 | Ga0163163_10555345 | |||
| 2673 | Ga0163163_11009901 | |||
| 2674 | Ga0163163_11465475 | |||
| 2675 | Ga0163163_11751111 | |||
| 2676 | Ga0157380_10004941 | |||
| 2677 | Ga0157380_10076184 | |||
| 2678 | Ga0157380_10117078 | |||
| 2679 | Ga0157380_10146531 | |||
| 2680 | Ga0157380_10446625 | |||
| 2681 | Ga0157380_10630304 | |||
| 2682 | Ga0157380_11089834 | |||
| 2683 | Ga0157380_11358865 | |||
| 2684 | Ga0157380_11521902 | |||
| 2685 | Ga0157380_12580915 | |||
| 2686 | Ga0157377_10002651 | |||
| 2687 | Ga0157377_10030505 | |||
| 2688 | Ga0157377_10051420 | |||
| 2689 | Ga0157377_10054164 | |||
| 2690 | Ga0157377_10116303 | |||
| 2691 | Ga0157377_10149198 | |||
| 2692 | Ga0157377_10177609 | |||
| 2693 | Ga0157377_10217065 | |||
| 2694 | Ga0157377_10404422 | |||
| 2695 | Ga0157377_11335321 | |||
| 2696 | Ga0157379_10024281 | |||
| 2697 | Ga0157379_10046835 | |||
| 2698 | Ga0157379_10147237 | |||
| 2699 | Ga0157379_11368901 | |||
| 2700 | Ga0157379_11621029 | |||
| 2701 | Ga0157379_11936121 | |||
| 2702 | Ga0157379_12029221 | |||
| 2703 | Ga0157379_12212562 | |||
| 2704 | Ga0157376_10012186 | |||
| 2705 | Ga0157376_10019139 | |||
| 2706 | Ga0157376_10044238 | |||
| 2707 | Ga0157376_10090305 | |||
| 2708 | Ga0157376_10250810 | |||
| 2709 | Ga0157376_10453944 | |||
| 2710 | Ga0157376_10989723 | |||
| 2711 | Ga0157376_12007452 | |||
| 2712 | Ga0182007_10036587 | |||
| 2713 | Ga0163161_10049401 | |||
| 2714 | Ga0163161_10482851 | |||
| 2715 | Ga0163161_10538042 | |||
| 2716 | Ga0163161_10913255 | |||
| 2717 | Ga0207666_1046093 | |||
| 2718 | Ga0207666_1059364 | |||
| 2719 | Ga0207666_1082583 | |||
| 2720 | Ga0207673_1012663 | |||
| 2721 | Ga0207697_10000557 | |||
| 2722 | Ga0207697_10000899 | |||
| 2723 | Ga0207697_10110981 | |||
| 2724 | Ga0207697_10148539 | |||
| 2725 | Ga0207697_10250085 | |||
| 2726 | Ga0207697_10305303 | |||
| 2727 | Ga0207697_10512617 | |||
| 2728 | Ga0207656_10189509 | |||
| 2729 | Ga0207655_1219627 | |||
| 2730 | Ga0207653_10127727 | |||
| 2731 | Ga0207653_10319498 | |||
| 2732 | Ga0207653_10366743 | |||
| 2733 | Ga0207653_10367591 | |||
| 2734 | Ga0207682_10000186 | |||
| 2735 | Ga0207682_10014137 | |||
| 2736 | Ga0207682_10040344 | |||
| 2737 | Ga0207682_10060826 | |||
| 2738 | Ga0207682_10335232 | |||
| 2739 | Ga0207642_10017497 | |||
| 2740 | Ga0207642_10087014 | |||
| 2741 | Ga0207642_10172515 | |||
| 2742 | Ga0207642_11002617 | |||
| 2743 | Ga0207710_10725238 | |||
| 2744 | Ga0207710_10737924 | |||
| 2745 | Ga0207688_10000494 | |||
| 2746 | Ga0207688_10001543 | |||
| 2747 | Ga0207688_10018436 | |||
| 2748 | Ga0207688_10032610 | |||
| 2749 | Ga0207688_10108910 | |||
| 2750 | Ga0207688_10282262 | |||
| 2751 | Ga0207688_10669544 | |||
| 2752 | Ga0207688_10715100 | |||
| 2753 | Ga0207680_10057352 | |||
| 2754 | Ga0207680_10147302 | |||
| 2755 | Ga0207680_10194094 | |||
| 2756 | Ga0207680_10366087 | |||
| 2757 | Ga0207680_10584443 | |||
| 2758 | Ga0207680_11033642 | |||
| 2759 | Ga0207647_10134019 | |||
| 2760 | Ga0207647_10359699 | |||
| 2761 | Ga0207645_10002060 | |||
| 2762 | Ga0207645_10020853 | |||
| 2763 | Ga0207645_10066251 | |||
| 2764 | Ga0207645_10148707 | |||
| 2765 | Ga0207645_10191644 | |||
| 2766 | Ga0207645_10280837 | |||
| 2767 | Ga0207645_10296201 | |||
| 2768 | Ga0207645_10590277 | |||
| 2769 | Ga0207643_10003832 | |||
| 2770 | Ga0207643_10005261 | |||
| 2771 | Ga0207643_10009423 | |||
| 2772 | Ga0207643_10017014 | |||
| 2773 | Ga0207643_10020305 | |||
| 2774 | Ga0207643_10024361 | |||
| 2775 | Ga0207643_10069135 | |||
| 2776 | Ga0207643_10220489 | |||
| 2777 | Ga0207643_10298666 | |||
| 2778 | Ga0207643_10492588 | |||
| 2779 | Ga0207643_10881323 | |||
| 2780 | Ga0207643_10914073 | |||
| 2781 | Ga0207684_10138448 | |||
| 2782 | Ga0207684_10865084 | |||
| 2783 | Ga0207684_10867704 | |||
| 2784 | Ga0207684_11134593 | |||
| 2785 | Ga0207654_10226963 | |||
| 2786 | Ga0207654_11400493 | |||
| 2787 | Ga0207695_10521311 | |||
| 2788 | Ga0207671_10534168 | |||
| 2789 | Ga0207671_11142824 | |||
| 2790 | Ga0207693_10129894 | |||
| 2791 | Ga0207660_10193513 | |||
| 2792 | Ga0207660_10209320 | |||
| 2793 | Ga0207660_10896575 | |||
| 2794 | Ga0207662_10002386 | |||
| 2795 | Ga0207662_10005226 | |||
| 2796 | Ga0207662_10033659 | |||
| 2797 | Ga0207662_10049288 | |||
| 2798 | Ga0207662_11140088 | |||
| 2799 | Ga0207657_10314099 | |||
| 2800 | Ga0207649_10065923 | |||
| 2801 | Ga0207649_10144310 | |||
| 2802 | Ga0207649_10510801 | |||
| 2803 | Ga0207649_10580144 | |||
| 2804 | Ga0207652_10776355 | |||
| 2805 | Ga0207646_10044784 | |||
| 2806 | Ga0207646_10267934 | |||
| 2807 | Ga0207646_10411180 | |||
| 2808 | Ga0207681_10004356 | |||
| 2809 | Ga0207681_10026187 | |||
| 2810 | Ga0207681_10038136 | |||
| 2811 | Ga0207681_10074874 | |||
| 2812 | Ga0207681_10083145 | |||
| 2813 | Ga0207681_10087869 | |||
| 2814 | Ga0207681_10112670 | |||
| 2815 | Ga0207681_10174157 | |||
| 2816 | Ga0207681_10264821 | |||
| 2817 | Ga0207681_10309460 | |||
| 2818 | Ga0207681_10315046 | |||
| 2819 | Ga0207681_10658944 | |||
| 2820 | Ga0207681_10897698 | |||
| 2821 | Ga0207681_11006233 | |||
| 2822 | Ga0207681_11175295 | |||
| 2823 | Ga0207681_11856117 | |||
| 2824 | Ga0207694_10441609 | |||
| 2825 | Ga0207694_11073690 | |||
| 2826 | Ga0207694_11362525 | |||
| 2827 | Ga0207650_10011729 | |||
| 2828 | Ga0207650_10025966 | |||
| 2829 | Ga0207650_10043885 | |||
| 2830 | Ga0207650_10046208 | |||
| 2831 | Ga0207650_10047373 | |||
| 2832 | Ga0207650_10079369 | |||
| 2833 | Ga0207650_10089079 | |||
| 2834 | Ga0207650_10499904 | |||
| 2835 | Ga0207650_10709782 | |||
| 2836 | Ga0207650_11245098 | |||
| 2837 | Ga0207650_11435076 | |||
| 2838 | Ga0207659_10000525 | |||
| 2839 | Ga0207659_10001560 | |||
| 2840 | Ga0207659_10010785 | |||
| 2841 | Ga0207659_10015165 | |||
| 2842 | Ga0207659_10028677 | |||
| 2843 | Ga0207659_10090748 | |||
| 2844 | Ga0207659_10137364 | |||
| 2845 | Ga0207659_10170738 | |||
| 2846 | Ga0207659_10175532 | |||
| 2847 | Ga0207659_10183250 | |||
| 2848 | Ga0207659_10346947 | |||
| 2849 | Ga0207659_10395222 | |||
| 2850 | Ga0207659_10426335 | |||
| 2851 | Ga0207659_10464268 | |||
| 2852 | Ga0207659_10692925 | |||
| 2853 | Ga0207659_10790215 | |||
| 2854 | Ga0207659_10933106 | |||
| 2855 | Ga0207687_10020934 | |||
| 2856 | Ga0207687_10043876 | |||
| 2857 | Ga0207687_10216885 | |||
| 2858 | Ga0207687_10244605 | |||
| 2859 | Ga0207687_10361257 | |||
| 2860 | Ga0207700_10077099 | |||
| 2861 | Ga0207644_10013931 | |||
| 2862 | Ga0207644_10049254 | |||
| 2863 | Ga0207644_10078698 | |||
| 2864 | Ga0207644_10146421 | |||
| 2865 | Ga0207644_10163956 | |||
| 2866 | Ga0207644_10419316 | |||
| 2867 | Ga0207644_10618829 | |||
| 2868 | Ga0207644_10876194 | |||
| 2869 | Ga0207690_10426924 | |||
| 2870 | Ga0207690_10636242 | |||
| 2871 | Ga0207690_10700717 | |||
| 2872 | Ga0207690_10834413 | |||
| 2873 | Ga0207706_10002818 | |||
| 2874 | Ga0207706_10023273 | |||
| 2875 | Ga0207706_10070211 | |||
| 2876 | Ga0207706_10074379 | |||
| 2877 | Ga0207706_10089308 | |||
| 2878 | Ga0207706_10498984 | |||
| 2879 | Ga0207706_10615635 | |||
| 2880 | Ga0207706_10917446 | |||
| 2881 | Ga0207706_11121711 | |||
| 2882 | Ga0207706_11229093 | |||
| 2883 | Ga0207686_10022441 | |||
| 2884 | Ga0207686_10082946 | |||
| 2885 | Ga0207686_10260816 | |||
| 2886 | Ga0207686_10285381 | |||
| 2887 | Ga0207686_10735922 | |||
| 2888 | Ga0207686_11471527 | |||
| 2889 | Ga0207709_10098698 | |||
| 2890 | Ga0207709_10207557 | |||
| 2891 | Ga0207709_10618520 | |||
| 2892 | Ga0207709_10721743 | |||
| 2893 | Ga0207709_10730091 | |||
| 2894 | Ga0207709_11052691 | |||
| 2895 | Ga0207709_11523010 | |||
| 2896 | Ga0207709_11773756 | |||
| 2897 | Ga0207670_10006992 | |||
| 2898 | Ga0207670_10008277 | |||
| 2899 | Ga0207670_10013010 | |||
| 2900 | Ga0207670_10132586 | |||
| 2901 | Ga0207670_10260395 | |||
| 2902 | Ga0207670_10401507 | |||
| 2903 | Ga0207670_10912096 | |||
| 2904 | Ga0207669_10008290 | |||
| 2905 | Ga0207669_10011854 | |||
| 2906 | Ga0207669_10025104 | |||
| 2907 | Ga0207669_10107907 | |||
| 2908 | Ga0207669_10225599 | |||
| 2909 | Ga0207669_10234491 | |||
| 2910 | Ga0207669_11314077 | |||
| 2911 | Ga0207704_10124735 | |||
| 2912 | Ga0207704_10128765 | |||
| 2913 | Ga0207704_10822011 | |||
| 2914 | Ga0207704_11161331 | |||
| 2915 | Ga0207691_10000539 | |||
| 2916 | Ga0207691_10031502 | |||
| 2917 | Ga0207691_10033194 | |||
| 2918 | Ga0207691_10051037 | |||
| 2919 | Ga0207691_10057852 | |||
| 2920 | Ga0207691_10083406 | |||
| 2921 | Ga0207691_10098415 | |||
| 2922 | Ga0207691_10220431 | |||
| 2923 | Ga0207691_10291201 | |||
| 2924 | Ga0207691_10319290 | |||
| 2925 | Ga0207691_10630269 | |||
| 2926 | Ga0207691_10685754 | |||
| 2927 | Ga0207691_10724010 | |||
| 2928 | Ga0207691_11002936 | |||
| 2929 | Ga0207691_11393184 | |||
| 2930 | Ga0207711_10053130 | |||
| 2931 | Ga0207711_10069281 | |||
| 2932 | Ga0207711_10087530 | |||
| 2933 | Ga0207711_10133073 | |||
| 2934 | Ga0207711_10271029 | |||
| 2935 | Ga0207711_10334638 | |||
| 2936 | Ga0207711_10347566 | |||
| 2937 | Ga0207711_10496356 | |||
| 2938 | Ga0207711_10546295 | |||
| 2939 | Ga0207711_10552918 | |||
| 2940 | Ga0207711_10796268 | |||
| 2941 | Ga0207711_11051947 | |||
| 2942 | Ga0207711_11450141 | |||
| 2943 | Ga0207711_11904628 | |||
| 2944 | Ga0207689_10000847 | |||
| 2945 | Ga0207689_10017160 | |||
| 2946 | Ga0207689_10050612 | |||
| 2947 | Ga0207689_10074868 | |||
| 2948 | Ga0207689_10099553 | |||
| 2949 | Ga0207689_10136569 | |||
| 2950 | Ga0207689_10229442 | |||
| 2951 | Ga0207689_10236389 | |||
| 2952 | Ga0207689_10941589 | |||
| 2953 | Ga0207689_11178444 | |||
| 2954 | Ga0207661_10018712 | |||
| 2955 | Ga0207661_10068325 | |||
| 2956 | Ga0207679_10054448 | |||
| 2957 | Ga0207679_10057470 | |||
| 2958 | Ga0207679_10080819 | |||
| 2959 | Ga0207679_10102956 | |||
| 2960 | Ga0207679_10218537 | |||
| 2961 | Ga0207679_10233603 | |||
| 2962 | Ga0207679_10326416 | |||
| 2963 | Ga0207679_10383363 | |||
| 2964 | Ga0207679_10521891 | |||
| 2965 | Ga0207679_10850565 | |||
| 2966 | Ga0207667_10923705 | |||
| 2967 | Ga0207651_10039967 | |||
| 2968 | Ga0207651_10076917 | |||
| 2969 | Ga0207651_10219296 | |||
| 2970 | Ga0207651_10225015 | |||
| 2971 | Ga0207651_10550586 | |||
| 2972 | Ga0207651_11118538 | |||
| 2973 | Ga0207651_11715163 | |||
| 2974 | Ga0207712_10005058 | |||
| 2975 | Ga0207712_10005530 | |||
| 2976 | Ga0207712_10007979 | |||
| 2977 | Ga0207712_10165018 | |||
| 2978 | Ga0207712_10201544 | |||
| 2979 | Ga0207712_10281393 | |||
| 2980 | Ga0207712_10384740 | |||
| 2981 | Ga0207712_10459485 | |||
| 2982 | Ga0207712_11801212 | |||
| 2983 | Ga0207668_10071623 | |||
| 2984 | Ga0207668_10087722 | |||
| 2985 | Ga0207668_10097797 | |||
| 2986 | Ga0207668_10301313 | |||
| 2987 | Ga0207668_10526411 | |||
| 2988 | Ga0207668_11082518 | |||
| 2989 | Ga0207668_11191638 | |||
| 2990 | Ga0207640_10092033 | |||
| 2991 | Ga0207640_10180240 | |||
| 2992 | Ga0207640_10265080 | |||
| 2993 | Ga0207640_10356803 | |||
| 2994 | Ga0207658_10085354 | |||
| 2995 | Ga0207658_11657046 | |||
| 2996 | Ga0207658_11935517 | |||
| 2997 | Ga0207677_10007225 | |||
| 2998 | Ga0207677_10123842 | |||
| 2999 | Ga0207677_10136227 | |||
| 3000 | Ga0207677_10280917 | |||
| 3001 | Ga0207677_10588251 | |||
| 3002 | Ga0207677_10602233 | |||
| 3003 | Ga0207677_11588866 | |||
| 3004 | Ga0207703_10008503 | |||
| 3005 | Ga0207703_10037356 | |||
| 3006 | Ga0207703_10090077 | |||
| 3007 | Ga0207703_10191370 | |||
| 3008 | Ga0207703_10413164 | |||
| 3009 | Ga0207703_10416561 | |||
| 3010 | Ga0207703_10627176 | |||
| 3011 | Ga0207639_10420103 | |||
| 3012 | Ga0207639_11843054 | |||
| 3013 | Ga0207678_10053358 | |||
| 3014 | Ga0207678_10075319 | |||
| 3015 | Ga0207678_10223042 | |||
| 3016 | Ga0207678_10672467 | |||
| 3017 | Ga0207678_11116314 | |||
| 3018 | Ga0207678_11557866 | |||
| 3019 | Ga0207678_11623460 | |||
| 3020 | Ga0207708_10003479 | |||
| 3021 | Ga0207708_10008243 | |||
| 3022 | Ga0207708_10019304 | |||
| 3023 | Ga0207708_10019428 | |||
| 3024 | Ga0207708_10034888 | |||
| 3025 | Ga0207708_10093684 | |||
| 3026 | Ga0207708_10115418 | |||
| 3027 | Ga0207708_10209484 | |||
| 3028 | Ga0207708_10364852 | |||
| 3029 | Ga0207708_10425630 | |||
| 3030 | Ga0207708_10681055 | |||
| 3031 | Ga0207708_10949051 | |||
| 3032 | Ga0207708_10975213 | |||
| 3033 | Ga0207641_10169479 | |||
| 3034 | Ga0207641_10170800 | |||
| 3035 | Ga0207641_10322997 | |||
| 3036 | Ga0207641_10376550 | |||
| 3037 | Ga0207641_10709807 | |||
| 3038 | Ga0207641_10825469 | |||
| 3039 | Ga0207648_10004841 | |||
| 3040 | Ga0207648_10005699 | |||
| 3041 | Ga0207648_10012289 | |||
| 3042 | Ga0207648_10014111 | |||
| 3043 | Ga0207648_10088244 | |||
| 3044 | Ga0207648_10181528 | |||
| 3045 | Ga0207648_10228116 | |||
| 3046 | Ga0207648_10254657 | |||
| 3047 | Ga0207648_10299086 | |||
| 3048 | Ga0207648_10300115 | |||
| 3049 | Ga0207648_10714936 | |||
| 3050 | Ga0207648_11586731 | |||
| 3051 | Ga0207676_10013947 | |||
| 3052 | Ga0207676_10039742 | |||
| 3053 | Ga0207676_10100868 | |||
| 3054 | Ga0207676_10144125 | |||
| 3055 | Ga0207676_10400797 | |||
| 3056 | Ga0207676_10511891 | |||
| 3057 | Ga0207676_10729006 | |||
| 3058 | Ga0207676_10741621 | |||
| 3059 | Ga0207676_10798715 | |||
| 3060 | Ga0207676_10811396 | |||
| 3061 | Ga0207674_10015066 | |||
| 3062 | Ga0207674_10016569 | |||
| 3063 | Ga0207674_10192041 | |||
| 3064 | Ga0207674_10302986 | |||
| 3065 | Ga0207674_10417052 | |||
| 3066 | Ga0207674_10608697 | |||
| 3067 | Ga0207674_10857797 | |||
| 3068 | Ga0207674_11620808 | |||
| 3069 | Ga0207675_100000755 | |||
| 3070 | Ga0207675_100010552 | |||
| 3071 | Ga0207675_100031807 | |||
| 3072 | Ga0207675_100079772 | |||
| 3073 | Ga0207675_100140759 | |||
| 3074 | Ga0207675_100186687 | |||
| 3075 | Ga0207675_100253757 | |||
| 3076 | Ga0207675_100256279 | |||
| 3077 | Ga0207675_100947431 | |||
| 3078 | Ga0207675_101105698 | |||
| 3079 | Ga0207675_101408366 | |||
| 3080 | Ga0207675_102376495 | |||
| 3081 | Ga0207683_10014341 | |||
| 3082 | Ga0207683_10129526 | |||
| 3083 | Ga0207683_10176125 | |||
| 3084 | Ga0207683_10212491 | |||
| 3085 | Ga0207683_10257429 | |||
| 3086 | Ga0207683_10514864 | |||
| 3087 | Ga0207698_10037502 | |||
| 3088 | Ga0209971_1043501 | |||
| 3089 | Ga0209966_1080682 | |||
| 3090 | Ga0209998_10039227 | |||
| 3091 | Ga0209813_10050903 | |||
| 3092 | Ga0209813_10076183 | |||
| 3093 | Ga0209813_10101398 | |||
| 3094 | Ga0209974_10070987 | |||
| 3095 | Ga0209974_10092288 | |||
| 3096 | Ga0207428_10001458 | |||
| 3097 | Ga0207428_10006998 | |||
| 3098 | Ga0207428_10016020 | |||
| 3099 | Ga0207428_10017364 | |||
| 3100 | Ga0207428_10027241 | |||
| 3101 | Ga0207428_10046391 | |||
| 3102 | Ga0207428_10252306 | |||
| 3103 | Ga0207428_10564489 | |||
| 3104 | Ga0268266_10001356 | |||
| 3105 | Ga0268266_10027926 | |||
| 3106 | Ga0268266_10226764 | |||
| 3107 | Ga0268266_10818023 | |||
| 3108 | Ga0268265_10002680 | |||
| 3109 | Ga0268265_10011758 | |||
| 3110 | Ga0268265_10026033 | |||
| 3111 | Ga0268265_10057883 | |||
| 3112 | Ga0268265_10201570 | |||
| 3113 | Ga0268265_10281830 | |||
| 3114 | Ga0268265_10284537 | |||
| 3115 | Ga0268265_10393119 | |||
| 3116 | Ga0268265_10399966 | |||
| 3117 | Ga0268265_10972563 | |||
| 3118 | Ga0268265_11113613 | |||
| 3119 | Ga0268265_11639726 | |||
| 3120 | Ga0268265_11654696 | |||
| 3121 | Ga0268264_10011509 | |||
| 3122 | Ga0268264_10078214 | |||
| 3123 | Ga0268264_10118588 | |||
| 3124 | Ga0268264_10201191 | |||
| 3125 | Ga0268264_10311222 | |||
| 3126 | Ga0268264_10571068 | |||
| 3127 | Ga0307408_100002942 | |||
| 3128 | Ga0307408_100005179 | |||
| 3129 | Ga0307408_100019020 | |||
| 3130 | Ga0307408_100194772 | |||
| 3131 | Ga0307408_100240672 | |||
| 3132 | Ga0307408_100264891 | |||
| 3133 | Ga0307408_100287332 | |||
| 3134 | Ga0307408_100394406 | |||
| 3135 | Ga0307408_100435977 | |||
| 3136 | Ga0307408_100495288 | |||
| 3137 | Ga0307408_100895013 | |||
| 3138 | Ga0307408_101015345 | |||
| 3139 | Ga0307408_101213449 | |||
| 3140 | Ga0307405_10000924 | |||
| 3141 | Ga0307405_10504047 | |||
| 3142 | Ga0307405_10664274 | |||
| 3143 | Ga0307405_10678864 | |||
| 3144 | Ga0307405_10692692 | |||
| 3145 | Ga0307405_10866597 | |||
| 3146 | Ga0307405_10954103 | |||
| 3147 | Ga0307405_11130437 | |||
| 3148 | Ga0307413_10009991 | |||
| 3149 | Ga0307413_10011777 | |||
| 3150 | Ga0307413_10021966 | |||
| 3151 | Ga0307413_10291282 | |||
| 3152 | Ga0307413_10838809 | |||
| 3153 | Ga0307410_10005924 | |||
| 3154 | Ga0307410_10077945 | |||
| 3155 | Ga0307410_10229039 | |||
| 3156 | Ga0307410_10262847 | |||
| 3157 | Ga0307410_10318030 | |||
| 3158 | Ga0307410_10412350 | |||
| 3159 | Ga0307410_10855713 | |||
| 3160 | Ga0307410_10904720 | |||
| 3161 | Ga0307410_10989503 | |||
| 3162 | Ga0307410_11535385 | |||
| 3163 | Ga0307406_10006611 | |||
| 3164 | Ga0307406_10163429 | |||
| 3165 | Ga0307406_11366878 | |||
| 3166 | Ga0307406_11511986 | |||
| 3167 | Ga0307407_10002222 | |||
| 3168 | Ga0307407_10021163 | |||
| 3169 | Ga0307407_10301660 | |||
| 3170 | Ga0307407_10477930 | |||
| 3171 | Ga0307407_10621596 | |||
| 3172 | Ga0307412_10018211 | |||
| 3173 | Ga0307412_10027994 | |||
| 3174 | Ga0307412_10149574 | |||
| 3175 | Ga0307412_10364799 | |||
| 3176 | Ga0307412_12009570 | |||
| 3177 | Ga0307409_100003276 | |||
| 3178 | Ga0307409_100125456 | |||
| 3179 | Ga0307409_100234688 | |||
| 3180 | Ga0307409_100239430 | |||
| 3181 | Ga0307409_100371238 | |||
| 3182 | Ga0307409_100432016 | |||
| 3183 | Ga0307409_100474120 | |||
| 3184 | Ga0307409_100596208 | |||
| 3185 | Ga0307409_100702199 | |||
| 3186 | Ga0307409_100949287 | |||
| 3187 | Ga0307416_100059432 | |||
| 3188 | Ga0307416_100061514 | |||
| 3189 | Ga0307416_100081188 | |||
| 3190 | Ga0307416_100224715 | |||
| 3191 | Ga0307416_100227799 | |||
| 3192 | Ga0307416_100238602 | |||
| 3193 | Ga0307416_100336044 | |||
| 3194 | Ga0307416_100388795 | |||
| 3195 | Ga0307416_100409248 | |||
| 3196 | Ga0307416_101014057 | |||
| 3197 | Ga0307416_101444714 | |||
| 3198 | Ga0307416_101535217 | |||
| 3199 | Ga0307416_101570820 | |||
| 3200 | Ga0307416_102139434 | |||
| 3201 | Ga0307416_102392847 | |||
| 3202 | Ga0307416_102462973 | |||
| 3203 | Ga0307416_103417057 | |||
| 3204 | Ga0307416_103575410 | |||
| 3205 | Ga0307414_10004602 | |||
| 3206 | Ga0307414_10205056 | |||
| 3207 | Ga0307414_10366877 | |||
| 3208 | Ga0307414_10477115 | |||
| 3209 | Ga0307414_10479326 | |||
| 3210 | Ga0307414_10659313 | |||
| 3211 | Ga0307414_11249193 | |||
| 3212 | Ga0307411_10001250 | |||
| 3213 | Ga0307411_10032932 | |||
| 3214 | Ga0307411_10273209 | |||
| 3215 | Ga0307411_10391465 | |||
| 3216 | Ga0307411_11699981 | |||
| 3217 | Ga0307411_12127510 | |||
| 3218 | Ga0307415_100090910 | |||
| 3219 | Ga0307415_100114195 | |||
| 3220 | Ga0307415_100182367 | |||
| 3221 | Ga0307415_100247793 | |||
| 3222 | Ga0307415_100969974 | |||
| 3223 | Ga0307415_101521166 | |||
| 3224 | Ga0307415_101942627 | |||
| 3225 | Ga0373950_0029035 | |||
| 3226 | Ga0373938_0080018 | |||
| 3227 | Ga0373926_0400941 | |||
| 3228 | Ga0373934_0055913 | |||
| 3229 | Ga0373949_0071690 | |||
| 3230 | Ga0373951_0055586 | |||
| 3231 | Ga0373951_0250978 | |||
| 3232 | Ga0373923_0417856 | |||
| 3233 | Ga0373923_0501134 | |||
| 3234 | Ga0373932_0004595 | |||
| 3235 | Ga0373939_0010866 | |||
| 3236 | Ga0373939_0224366 | |||
| 3237 | Ga0373941_0039098 | |||
| 3238 | Ga0373941_0286619 | |||
| 3239 | Ga0373956_0097799 | |||
| 3240 | Ga0373956_0326667 | |||
| 3241 | Ga0373956_0343215 | |||
| 3242 | Ga0373956_0599313 | |||
| 3243 | Ga0373960_0144395 | |||
| 3244 | Ga0373943_0519020 | |||
| 3245 | Ga0373943_0594658 | |||
| 3246 | Ga0373946_0588247 | |||
| 3247 | Ga0373955_0464168 | |||
| 3248 | Ga0373955_0680844 | |||
| 3249 | Ga0373955_0873235 | |||
| 3250 | Ga0373942_0354625 | |||
| 3251 | Ga0373962_0043749 | |||
| 3252 | Ga0373924_0041482 | |||
| 3253 | Ga0373924_0084401 | |||
| 3254 | Ga0373931_0035621 | |||
| 3255 | Ga0373931_0052877 | |||
| 3256 | Ga0373931_0217261 | |||
| 3257 | Ga0373931_0335073 | |||
| 3258 | Ga0373935_0419003 | |||
| 3259 | Ga0373933_0399250 | |||
| 3260 | Ga0373937_0025431 | |||
| 3261 | Ga0373937_0498834 | |||
| 3262 | Ga0373937_1501240 | |||
| 3263 | Ga0373937_1521642 | |||
| 3264 | Ga0373925_0819805 | |||
| 3265 | Ga0373925_0821036 | |||
| 3266 | Ga0395900_0878116 | |||
| 3267 | Ga0395898_1340306 | |||
| 3268 | Ga0242420_052163 | |||
| 3269 | Ga0439436_0074786 | |||
| 3270 | Ga0439439_0004932 | |||
| 3271 | Ga0439453_0013175 | |||
| 3272 | Ga0439461_0007768 | |||
| 3273 | Ga0439461_0014950 | |||
| 3274 | Ga0439461_0063965 | |||
| 3275 | Ga0439461_0065707 | |||
| 3276 | Ga0451795_1211245 | |||
| 3277 | Ga0451798_0567307 | |||
| 3278 | Ga0451800_0488747 | |||
| 3279 | Ga0451800_1229364 | |||
| 3280 | Ga0451802_0983452 | |||
| 3281 | Ga0451802_0983820 | |||
| 3282 | Ga0451802_1047813 | |||
| 3283 | Ga0451802_1277372 | |||
| 3284 | Ga0451807_2702473 | |||
| 3285 | Ga0451845_0469777 | |||
| 3286 | Ga0451849_0010536 | |||
| 3287 | Ga0451853_0429604 | |||
| 3288 | Ga0451853_0571654 | |||
| 3289 | Ga0451853_3505640 | |||
| 3290 | Ga0439431_0026650 | |||
| 3291 | Ga0439431_0145949 | |||
| 3292 | Ga0439433_0017302 | |||
| 3293 | Ga0439433_0054741 | |||
| 3294 | Ga0439433_0065055 | |||
| 3295 | Ga0439437_055614 | |||
| 3296 | Ga0439441_043832 | |||
| 3297 | Ga0439443_108067 | |||
| 3298 | Ga0439445_0126820 | |||
| 3299 | Ga0439445_0142938 | |||
| 3300 | Ga0439449_0246717 | |||
| 3301 | Ga0439449_0416214 | |||
| 3302 | Ga0439450_042689 | |||
| 3303 | Ga0439451_133080 | |||
| 3304 | Ga0439455_0027924 | |||
| 3305 | Ga0439455_0161761 | |||
| 3306 | Ga0439455_0167664 | |||
| 3307 | Ga0439456_108702 | |||
| 3308 | Ga0439457_096637 | |||
| 3309 | Ga0439462_0047141 | |||
| 3310 | Ga0439462_0059319 | |||
| 3311 | Ga0439462_0173601 | |||
| 3312 | Ga0439462_0260431 | |||
| 3313 | Ga0450920_068512 | |||
| 3314 | Ga0450920_144749 | |||
| 3315 | Ga0450894_073941 | |||
| 3316 | Ga0450896_080904 | |||
| 3317 | Ga0450910_099347 | |||
| 3318 | Ga0439446_0048598 | |||
| 3319 | Ga0439446_0081900 | |||
| 3320 | Ga0439446_0124704 | |||
| 3321 | Ga0439446_0273916 | |||
| 3322 | Ga0439446_0382644 | |||
| 3323 | Ga0439458_0211912 | |||
| 3324 | Ga0439434_0048017 | |||
| 3325 | Ga0439434_0065672 | |||
| 3326 | Ga0439434_0123886 | |||
| 3327 | Ga0439434_0266382 | |||
| 3328 | Ga0439435_0025603 | |||
| 3329 | Ga0439435_0045608 | |||
| 3330 | Ga0439435_0128033 | |||
| 3331 | Ga0439435_0135589 | |||
| 3332 | Ga0439435_0146953 | |||
| 3333 | Ga0439435_0367807 | |||
| 3334 | Ga0439444_0041154 | |||
| 3335 | Ga0439444_0073418 | |||
| 3336 | Ga0439444_0135708 | |||
| 3337 | Ga0439444_0170611 | |||
| 3338 | Ga0439459_0110878 | |||
| 3339 | Ga0439459_0125430 | |||
| 3340 | Ga0439464_0004244 | |||
| 3341 | Ga0439464_0004625 | |||
| 3342 | Ga0439464_0024872 | |||
| 3343 | Ga0439464_0097717 | |||
| 3344 | Ga0439464_0120321 | |||
| 3345 | Ga0439460_0017095 | |||
| 3346 | Ga0439460_0084401 | |||
| 3347 | Ga0439460_0146311 | |||
| 3348 | Ga0450893_0137390 | |||
| 3349 | Ga0451577_0134250 | |||
| 3350 | Ga0451577_0583124 | |||
| 3351 | Ga0439440_0231207 | |||
| 3352 | Ga0453683_0512372 | |||
| 3353 | Ga0453683_0608827 | |||
| 3354 | Ga0453683_1125672 | |||
| 3355 | Ga0453684_0142552 | |||
| 3356 | Ga0466960_0497773 | |||
| 3357 | Ga0451576_0025937 | |||
| 3358 | Ga0451576_0046822 | |||
| 3359 | Ga0451576_0053959 | |||
| 3360 | Ga0451576_0063125 | |||
| 3361 | Ga0451576_0239444 | |||
| 3362 | Ga0451576_0810841 | |||
| 3363 | Ga0451576_1261760 | |||
| 3364 | Ga0451576_1772249 | |||
| 3365 | Ga0495592_0167128 | |||
| 3366 | Ga0495592_0478136 | |||
| 3367 | Ga0495603_0130248 | |||
| 3368 | Ga0495603_0158961 | |||
| 3369 | Ga0495629_0120736 | |||
| 3370 | Ga0495629_0140272 | |||
| 3371 | Ga0495582_0613179 | |||
| 3372 | Ga0495639_0129813 | |||
| 3373 | Ga0495662_0114404 | |||
| 3374 | Ga0495585_0292895 | |||
| 3375 | Ga0495594_0450431 | |||
| 3376 | Ga0495618_0486751 | |||
| 3377 | Ga0495628_0128520 | |||
| 3378 | Ga0495628_0640076 | |||
| 3379 | Ga0495630_0501505 | |||
| 3380 | Ga0495643_0001260 | |||
| 3381 | Ga0495640_0112897 | |||
| 3382 | Ga0495586_0326111 | |||
| 3383 | Ga0495586_0672634 | |||
| 3384 | Ga0495598_0087950 | |||
| 3385 | Ga0495598_0113752 | |||
| 3386 | Ga0495609_0282182 | |||
| 3387 | Ga0495621_0000636 | |||
| 3388 | Ga0495621_0220108 | |||
| 3389 | Ga0495621_0249737 | |||
| 3390 | Ga0495597_0074140 | |||
| 3391 | Ga0495645_0027106 | |||
| 3392 | Ga0495667_0295863 | |||
| 3393 | Ga0495667_0491551 | |||
| 3394 | Ga0495656_0149170 | |||
| 3395 | Ga0495656_0351256 | |||
| 3396 | Ga0495634_0298622 | |||
| 3397 | Ga0495635_0215356 | |||
| 3398 | Ga0495635_0375167 | |||
| 3399 | Ga0495659_0018453 | |||
| 3400 | Ga0495659_0023986 | |||
| 3401 | Ga0495659_0060110 | |||
| 3402 | Ga0495599_0107869 | |||
| 3403 | Ga0495647_0075468 | |||
| 3404 | Ga0495658_0130855 | |||
| 3405 | Ga0495658_0503329 | |||
| 3406 | Ga0495613_0337369 | |||
| 3407 | Ga0495613_0360306 | |||
| 3408 | Ga0495649_0405865 | |||
| 3409 | Ga0495581_0322807 | |||
| 3410 | Ga0495636_0066258 | |||
| 3411 | Ga0495674_0506281 | |||
| 3412 | Ga0495676_0884280 | |||
| 3413 | Ga0495680_0345333 | |||
| 3414 | Ga0495684_0225238 | |||
| 3415 | Ga0495684_0260600 | |||
| 3416 | Ga0495684_0553477 | |||
| 3417 | Ga0495684_0653752 | |||
| 3418 | Ga0495593_0512694 | |||
| 3419 | Ga0496100_0520517 | |||
| 3420 | Ga0496101_0248769 | |||
| 3421 | Ga0496101_1160840 | |||
| 3422 | Ga0496101_1279141 | |||
| 3423 | Ga0496102_0140567 | |||
| 3424 | Ga0496102_0678002 | |||
| 3425 | Ga0496102_0860485 | |||
| 3426 | Ga0496103_0022770 | |||
| 3427 | Ga0496104_0029430 | |||
| 3428 | Ga0496104_0051939 | |||
| 3429 | Ga0496104_0266364 | |||
| 3430 | Ga0496104_0834358 | |||
| 3431 | Ga0496105_0208692 | |||
| 3432 | Ga0496105_0234817 | |||
| 3433 | Ga0496105_0462038 | |||
| 3434 | Ga0496106_0149353 | |||
| 3435 | Ga0496106_0172626 | |||
| 3436 | Ga0496106_0207750 | |||
| 3437 | Ga0496106_0646341 | |||
| 3438 | Ga0496107_0861191 | |||
| 3439 | Ga0496108_0048269 | |||
| 3440 | Ga0496108_0278533 | |||
| 3441 | Ga0496108_0436958 | |||
| 3442 | Ga0496109_0012204 | |||
| 3443 | Ga0496109_0047791 | |||
| 3444 | Ga0496109_0191061 | |||
| 3445 | Ga0496109_0695593 | |||
| 3446 | Ga0496109_0918766 | |||
| 3447 | Ga0496109_0946322 | |||
| 3448 | Ga0496109_0981085 | |||
| 3449 | Ga0496109_1251534 | |||
| 3450 | Ga0496110_0075740 | |||
| 3451 | Ga0496110_0296495 | |||
| 3452 | Ga0496110_0659094 | |||
| 3453 | Ga0496110_0876725 | |||
| 3454 | Ga0496110_0886173 | |||
| 3455 | Ga0496110_1267542 | |||
| 3456 | Ga0496111_0004268 | |||
| 3457 | Ga0496111_0465467 | |||
| 3458 | Ga0496111_0831968 | |||
| 3459 | Ga0496112_0013855 | |||
| 3460 | Ga0496112_0015556 | |||
| 3461 | Ga0496112_0071968 | |||
| 3462 | Ga0496112_0098364 | |||
| 3463 | Ga0496113_0159497 | |||
| 3464 | Ga0496113_0247084 | |||
| 3465 | Ga0496114_0475289 | |||
| 3466 | Ga0496114_0704493 | |||
| 3467 | Ga0496115_0400137 | |||
| 3468 | Ga0501290_049541 | |||
| 3469 | Ga0501292_010393 | |||
| 3470 | Ga0501298_090819 | |||
| 3471 | Ga0501298_152566 | |||
| 3472 | Ga0501299_076430 | |||
| 3473 | Ga0501299_078419 | |||
| 3474 | Ga0501031_0019692 | |||
| 3475 | Ga0501031_0256475 | |||
| 3476 | Ga0501031_0931695 | |||
| 3477 | Ga0501031_0934858 | |||
| 3478 | Ga0501032_0004999 | |||
| 3479 | Ga0501032_0694291 | |||
| 3480 | Ga0501032_0786466 | |||
| 3481 | Ga0501032_1061582 | |||
| 3482 | Ga0501033_0015872 | |||
| 3483 | Ga0501033_0120675 | |||
| 3484 | Ga0501033_0439337 | |||
| 3485 | Ga0501034_0030569 | |||
| 3486 | Ga0501034_0264934 | |||
| 3487 | Ga0501036_0116231 | |||
| 3488 | Ga0501036_0123379 | |||
| 3489 | Ga0501036_0603672 | |||
| 3490 | Ga0501036_1204717 | |||
| 3491 | Ga0501037_0001127 | |||
| 3492 | Ga0501037_0374079 | |||
| 3493 | Ga0501038_0013949 | |||
| 3494 | Ga0501038_0671562 | |||
| 3495 | Ga0501038_1061187 | |||
| 3496 | Ga0501038_1205273 | |||
| 3497 | Ga0501039_0057734 | |||
| 3498 | Ga0501039_0063695 | |||
| 3499 | Ga0501039_0530095 | |||
| 3500 | Ga0501039_0776006 | |||
| 3501 | Ga0501040_0058385 | |||
| 3502 | Ga0501040_0062455 | |||
| 3503 | Ga0501040_0535599 | |||
| 3504 | Ga0501041_0166506 | |||
| 3505 | Ga0501041_0178462 | |||
| 3506 | Ga0501041_0310929 | |||
| 3507 | Ga0501041_0354744 | |||
| 3508 | Ga0501041_0384141 | |||
| 3509 | Ga0501041_0751265 | |||
| 3510 | Ga0501042_0016296 | |||
| 3511 | Ga0501042_0119920 | |||
| 3512 | Ga0501042_0129668 | |||
| 3513 | Ga0501042_0197529 | |||
| 3514 | Ga0501042_0427028 | |||
| 3515 | Ga0501042_0722006 | |||
| 3516 | Ga0501043_0024660 | |||
| 3517 | Ga0501046_0006725 | |||
| 3518 | Ga0501046_0175117 | |||
| 3519 | Ga0501046_0384806 | |||
| 3520 | Ga0501046_0459502 | |||
| 3521 | Ga0501046_0774925 | |||
| 3522 | Ga0501047_0427432 | |||
| 3523 | Ga0501047_0822502 | |||
| 3524 | Ga0501048_0002548 | |||
| 3525 | Ga0501048_0072087 | |||
| 3526 | Ga0501048_0807840 | |||
| 3527 | Ga0501048_1311366 | |||
| 3528 | Ga0501067_0026173 | |||
| 3529 | Ga0501067_0226230 | |||
| 3530 | Ga0501068_0005586 | |||
| 3531 | Ga0501068_0133242 | |||
| 3532 | Ga0501068_0415652 | |||
| 3533 | Ga0501068_0582244 | |||
| 3534 | Ga0501068_0625175 | |||
| 3535 | Ga0501069_0001932 | |||
| 3536 | Ga0501069_0485892 | |||
| 3537 | Ga0501070_0331544 | |||
| 3538 | Ga0501070_0373516 | |||
| 3539 | Ga0501070_0659899 | |||
| 3540 | Ga0501071_0006948 | |||
| 3541 | Ga0501071_0041374 | |||
| 3542 | Ga0501071_0113637 | |||
| 3543 | Ga0501071_0205914 | |||
| 3544 | Ga0501071_0328115 | |||
| 3545 | Ga0501071_0356064 | |||
| 3546 | Ga0501071_0501268 | |||
| 3547 | Ga0501071_0585157 | |||
| 3548 | Ga0501071_0806519 | |||
| 3549 | Ga0501072_0005500 | |||
| 3550 | Ga0501072_0021792 | |||
| 3551 | Ga0501072_0040802 | |||
| 3552 | Ga0501072_0100512 | |||
| 3553 | Ga0501072_0185575 | |||
| 3554 | Ga0501072_0447856 | |||
| 3555 | Ga0501072_0504579 | |||
| 3556 | Ga0501072_0633781 | |||
| 3557 | Ga0501072_1027742 | |||
| 3558 | Ga0501073_0007678 | |||
| 3559 | Ga0501074_0144805 | |||
| 3560 | Ga0501074_0154803 | |||
| 3561 | Ga0501074_0172546 | |||
| 3562 | Ga0501074_0296551 | |||
| 3563 | Ga0501074_0846886 | |||
| 3564 | Ga0501074_1152014 | |||
| 3565 | Ga0501075_0017217 | |||
| 3566 | Ga0501075_0122515 | |||
| 3567 | Ga0501075_0157999 | |||
| 3568 | Ga0501075_0201873 | |||
| 3569 | Ga0501075_0289581 | |||
| 3570 | Ga0501075_0374163 | |||
| 3571 | Ga0501075_0429149 | |||
| 3572 | Ga0501075_1451817 | |||
| 3573 | Ga0501076_0007927 | |||
| 3574 | Ga0501076_0009234 | |||
| 3575 | Ga0501076_0036616 | |||
| 3576 | Ga0501076_0117349 | |||
| 3577 | Ga0501076_0218362 | |||
| 3578 | Ga0501076_0237452 | |||
| 3579 | Ga0501076_0418406 | |||
| 3580 | Ga0501076_0434789 | |||
| 3581 | Ga0501076_1087847 | |||
| 3582 | Ga0501077_0028951 | |||
| 3583 | Ga0501077_0054757 | |||
| 3584 | Ga0501077_0237298 | |||
| 3585 | Ga0501077_0294832 | |||
| 3586 | Ga0501077_0671826 | |||
| 3587 | Ga0501206_028303 | |||
| 3588 | Ga0501206_079269 | |||
| 3589 | Ga0501208_133450 | |||
| 3590 | Ga0501208_141474 | |||
| 3591 | Ga0501216_074990 | |||
| 3592 | Ga0501217_023110 | |||
| 3593 | Ga0501217_153978 | |||
| 3594 | Ga0501230_128058 | |||
| 3595 | Ga0501233_051117 | |||
| 3596 | Ga0501235_182674 | |||
| 3597 | Ga0501249_056402 | |||
| 3598 | Ga0501249_096774 | |||
| 3599 | Ga0501251_058834 | |||
| 3600 | Ga0501261_079394 | |||
| 3601 | Ga0501221_194961 | |||
| 3602 | Ga0501221_225019 | |||
| 3603 | Ga0501225_0061387 | |||
| 3604 | Ga0501225_0129918 | |||
| 3605 | Ga0501225_0218441 | |||
| 3606 | Ga0501229_032336 | |||
| 3607 | Ga0501079_0011724 | |||
| 3608 | Ga0501079_0017863 | |||
| 3609 | Ga0501079_0038698 | |||
| 3610 | Ga0501079_0075715 | |||
| 3611 | Ga0501079_0152089 | |||
| 3612 | Ga0501079_0465854 | |||
| 3613 | Ga0501079_0801357 | |||
| 3614 | Ga0501080_0006657 | |||
| 3615 | Ga0501080_0039131 | |||
| 3616 | Ga0501080_0274662 | |||
| 3617 | Ga0501080_0354969 | |||
| 3618 | Ga0501080_1079199 | |||
| 3619 | Ga0501081_0037516 | |||
| 3620 | Ga0501081_0286786 | |||
| 3621 | Ga0501081_0773542 | |||
| 3622 | Ga0501081_0872487 | |||
| 3623 | Ga0501081_1036182 | |||
| 3624 | Ga0501081_1093930 | |||
| 3625 | Ga0501083_0250708 | |||
| 3626 | Ga0501263_029782 | |||
| 3627 | Ga0501265_028747 | |||
| 3628 | Ga0501268_100077 | |||
| 3629 | Ga0501268_108217 | |||
| 3630 | Ga0501270_167889 | |||
| 3631 | Ga0501273_023875 | |||
| 3632 | Ga0501273_050627 | |||
| 3633 | Ga0501273_090098 | |||
| 3634 | Ga0501278_002751 | |||
| 3635 | Ga0501283_002559 | |||
| 3636 | Ga0501035_0392553 | |||
| 3637 | Ga0501035_0500863 | |||
| 3638 | Ga0501044_0037752 | |||
| 3639 | Ga0501045_0012920 | |||
| 3640 | Ga0501045_0214377 | |||
| 3641 | Ga0501045_0345994 | |||
| 3642 | Ga0501045_0409933 | |||
| 3643 | nmdc:mga03683_452_c1 | |||
| 3644 | nmdc:mga03683_488177_c1 | |||
| 3645 | nmdc:mga03n38_224037_c1 | |||
| 3646 | nmdc:mga00v17_39025_c1 | |||
| 3647 | nmdc:mga00v17_4277_c1 | |||
| 3648 | nmdc:mga00v17_981812_c1 | |||
| 3649 | nmdc:mga0yw44_112495_c1 | |||
| 3650 | nmdc:mga0yw44_266254_c1 | |||
| 3651 | nmdc:mga0k408_26080_c1 | |||
| 3652 | nmdc:mga0k408_735706_c1 | |||
| 3653 | nmdc:mga06z11_216672_c1 | |||
| 3654 | nmdc:mga06z11_35323_c1 | |||
| 3655 | nmdc:mga06z11_86569_c1 | |||
| 3656 | nmdc:mga06z11_86903_c1 | |||
| 3657 | nmdc:mga04h51_139610_c1 | |||
| 3658 | nmdc:mga04h51_54595_c1 | |||
| 3659 | nmdc:mga07m45_83926_c1 | |||
| 3660 | nmdc:mga05p37_11236_c1 | |||
| 3661 | nmdc:mga05p37_114819_c1 | |||
| 3662 | nmdc:mga05p37_133187_c1 | |||
| 3663 | nmdc:mga05p37_1507651_c1 | |||
| 3664 | nmdc:mga05p37_1697545_c1 | |||
| 3665 | nmdc:mga05p37_22768_c1 | |||
| 3666 | nmdc:mga05p37_27332_c1 | |||
| 3667 | nmdc:mga05p37_284869_c1 | |||
| 3668 | nmdc:mga05p37_2902_c1 | |||
| 3669 | nmdc:mga05p37_35902_c1 | |||
| 3670 | nmdc:mga05p37_468614_c1 | |||
| 3671 | nmdc:mga05p37_493208_c1 | |||
| 3672 | nmdc:mga05p37_4944_c1 | |||
| 3673 | nmdc:mga05p37_612047_c1 | |||
| 3674 | nmdc:mga09592_1040230_c1 | |||
| 3675 | nmdc:mga09592_122139_c1 | |||
| 3676 | nmdc:mga09592_148479_c1 | |||
| 3677 | nmdc:mga09592_163553_c1 | |||
| 3678 | nmdc:mga09592_231053_c1 | |||
| 3679 | nmdc:mga09592_343125_c1 | |||
| 3680 | nmdc:mga09592_39479_c1 | |||
| 3681 | nmdc:mga09592_44087_c1 | |||
| 3682 | nmdc:mga09592_496001_c1 | |||
| 3683 | nmdc:mga09592_50798_c1 | |||
| 3684 | nmdc:mga09592_63814_c1 | |||
| 3685 | nmdc:mga09592_65266_c1 | |||
| 3686 | nmdc:mga09592_727698_c1 | |||
| 3687 | nmdc:mga09592_7497_c1 | |||
| 3688 | nmdc:mga0qj67_1196400_c1 | |||
| 3689 | nmdc:mga0qj67_15122_c1 | |||
| 3690 | nmdc:mga0qj67_19109_c1 | |||
| 3691 | nmdc:mga0qj67_234750_c1 | |||
| 3692 | nmdc:mga0qj67_438085_c1 | |||
| 3693 | nmdc:mga0qj67_4391_c1 | |||
| 3694 | nmdc:mga0qj67_45269_c1 | |||
| 3695 | nmdc:mga0qj67_5816_c1 | |||
| 3696 | nmdc:mga0qj67_586615_c1 | |||
| 3697 | nmdc:mga0qj67_8912_c1 | |||
| 3698 | nmdc:mga0qj67_907673_c1 | |||
| 3699 | nmdc:mga0qj67_99893_c1 | |||
| 3700 | nmdc:mga06r32_130743_c1 | |||
| 3701 | nmdc:mga06r32_1335807_c1 | |||
| 3702 | nmdc:mga06r32_143512_c1 | |||
| 3703 | nmdc:mga06r32_15953_c1 | |||
| 3704 | nmdc:mga06r32_179600_c1 | |||
| 3705 | nmdc:mga06r32_186462_c1 | |||
| 3706 | nmdc:mga06r32_212762_c1 | |||
| 3707 | nmdc:mga06r32_22813_c1 | |||
| 3708 | nmdc:mga06r32_247392_c1 | |||
| 3709 | nmdc:mga06r32_286626_c1 | |||
| 3710 | nmdc:mga06r32_46488_c1 | |||
| 3711 | nmdc:mga06r32_589509_c1 | |||
| 3712 | nmdc:mga06r32_625364_c1 | |||
| 3713 | nmdc:mga06r32_671709_c1 | |||
| 3714 | nmdc:mga06r32_7339_c1 | |||
| 3715 | nmdc:mga06r32_75087_c1 | |||
| 3716 | nmdc:mga06r32_778904_c1 | |||
| 3717 | nmdc:mga06r32_826150_c1 | |||
| 3718 | nmdc:mga08y16_1372135_c1 | |||
| 3719 | nmdc:mga08y16_1421_c1 | |||
| 3720 | nmdc:mga08y16_16043_c1 | |||
| 3721 | nmdc:mga08y16_22405_c1 | |||
| 3722 | nmdc:mga08y16_26977_c1 | |||
| 3723 | nmdc:mga08y16_298163_c1 | |||
| 3724 | nmdc:mga08y16_362422_c1 | |||
| 3725 | nmdc:mga08y16_4008_c1 | |||
| 3726 | nmdc:mga08y16_573375_c1 | |||
| 3727 | nmdc:mga08y16_790720_c1 | |||
| 3728 | nmdc:mga08y16_810204_c1 | |||
| 3729 | nmdc:mga08y16_838545_c1 | |||
| 3730 | nmdc:mga08y16_964441_c1 | |||
| 3731 | nmdc:mga0n895_1036812_c1 | |||
| 3732 | nmdc:mga0n895_134147_c1 | |||
| 3733 | nmdc:mga0n895_1630891_c1 | |||
| 3734 | nmdc:mga0n895_17240_c1 | |||
| 3735 | nmdc:mga0n895_21135_c1 | |||
| 3736 | nmdc:mga0n895_230292_c1 | |||
| 3737 | nmdc:mga0n895_300669_c1 | |||
| 3738 | nmdc:mga0n895_61517_c1 | |||
| 3739 | nmdc:mga0n895_744010_c1 | |||
| 3740 | nmdc:mga0n895_883963_c1 | |||
| 3741 | nmdc:mga0rr50_1072245_c1 | |||
| 3742 | nmdc:mga0rr50_119107_c1 | |||
| 3743 | nmdc:mga0rr50_211373_c1 | |||
| 3744 | nmdc:mga0rr50_27802_c1 | |||
| 3745 | nmdc:mga0rr50_28541_c1 | |||
| 3746 | nmdc:mga0rr50_474019_c1 | |||
| 3747 | nmdc:mga0rr50_49805_c1 | |||
| 3748 | nmdc:mga0rr50_924602_c1 | |||
| 3749 | nmdc:mga08x19_1369749_c1 | |||
| 3750 | nmdc:mga08x19_40093_c1 | |||
| 3751 | nmdc:mga0a205_13670_c1 | |||
| 3752 | nmdc:mga0a205_1425727_c1 | |||
| 3753 | nmdc:mga0a205_1747_c1 | |||
| 3754 | nmdc:mga0a205_218689_c1 | |||
| 3755 | nmdc:mga0a205_35325_c1 | |||
| 3756 | nmdc:mga0a205_400297_c1 | |||
| 3757 | nmdc:mga0a205_475691_c1 | |||
| 3758 | nmdc:mga0a205_5305_c1 | |||
| 3759 | nmdc:mga0a205_77849_c2 | |||
| 3760 | nmdc:mga0a205_78094_c1 | |||
| 3761 | nmdc:mga0a205_88030_c1 | |||
| 3762 | nmdc:mga0sz30_52699_c1 | |||
| 3763 | Ga0495601_0026558 | |||
| 3764 | Ga0495601_0046700 | |||
| 3765 | Ga0495601_0683636 | |||
| 3766 | Ga0495612_0538904 | |||
| 3767 | Ga0495655_0165365 | |||
| 3768 | Ga0495619_0225593 | |||
| 3769 | Ga0495619_0593098 | |||
| 3770 | Ga0500555_001190 | |||
| 3771 | Ga0500628_111008 | |||
| 3772 | Ga0500628_163595 | |||
| 3773 | Ga0500616_0000529 | |||
| 3774 | Ga0500627_0495501 | |||
| 3775 | Ga0500645_000293 | |||
| 3776 | Ga0501084_0034752 | |||
| 3777 | Ga0501084_0095716 | |||
| 3778 | Ga0501084_0098812 | |||
| 3779 | Ga0501084_0126087 | |||
| 3780 | Ga0501084_0211315 | |||
| 3781 | Ga0501084_0317402 | |||
| 3782 | Ga0501084_0570793 | |||
| 3783 | Ga0501084_1755963 | |||
| 3784 | Ga0590071_000101 | |||
| 3785 | Ga0590071_000336 | |||
| 3786 | Ga0590071_009812 | |||
| 3787 | Ga0590071_039441 | |||
| 3788 | Ga0590071_069613 | |||
| 3789 | Ga0590074_000047 | |||
| 3790 | Ga0590074_001254 | |||
| 3791 | Ga0590074_061513 | |||
| 3792 | Ga0590075_001041 | |||
| 3793 | Ga0590075_002157 | |||
| 3794 | Ga0590075_040025 | |||
| 3795 | Ga0590077_000084 | |||
| 3796 | Ga0590077_000329 | |||
| 3797 | Ga0501082_0038890 | |||
| 3798 | Ga0501082_0162597 | |||
| 3799 | Ga0501082_0168109 | |||
| 3800 | Ga0501082_0179052 | |||
| 3801 | Ga0501082_0513243 | |||
| 3802 | Ga0501082_1221285 | |||
| 3803 | Ga0530510_0000953 | |||
| 3804 | Ga0530510_0014707 | |||
| 3805 | Ga0530510_0203591 | |||
| 3806 | Ga0530510_0268348 | |||
| 3807 | Ga0530510_0530658 | |||
| 3808 | Ga0530510_0779137 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.8145 | 1 | 109 |
| 7khe-assembly1.cif.gz_M | escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp | 0.7884 | 4 | 110 |
| 4ijj-assembly1.cif.gz_A | structure of transcription factor dksa2 from pseudomonas aeruginosa | 0.7608 | 4 | 110 |
| 4ijj-assembly3.cif.gz_C | structure of transcription factor dksa2 from pseudomonas aeruginosa | 0.744 | 4 | 110 |
| 7khe-assembly1.cif.gz_M | escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp | 0.7435 | 4 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.7608 | 4 | 110 | 1.20.120.910 |
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.7112 | 4 | 110 | 1.20.120.910 |
| af_A0A2R8Q019_233_408_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.6832 | 5 | 76 | 1.20.58.390 |
| af_Q9U1I1_234_305_2.10.110.10 | Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein | 0.6639 | 78 | 111 | 2.10.110.10 |
| af_P53709_217_324_3.90.530.10 | Alpha Beta;Alpha-Beta Complex;Nucleotide Excision Repair Protein XPA (XPA-MBD); B Chain A;XPA C-terminal domain | 0.6537 | 80 | 109 | 3.90.530.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535PE45-F1-model_v4 | TraR/DksA family transcriptional regulator | 0.8689 | 6 | 108 |
GO:0008270
|
| AF-A0A0G3EFC3-F1-model_v4 | General stress protein 16O | 0.8663 | 2 | 108 |
GO:0000786
GO:0003677 GO:0006334 GO:0008270 GO:0030527 |
| AF-A0A423LGG6-F1-model_v4 | Uncharacterized protein | 0.8647 | 3 | 110 |
GO:0008270
|
| AF-A0A497EG63-F1-model_v4 | Uncharacterized protein | 0.8638 | 2 | 108 |
GO:0008270
|
| AF-A0A7C5V9I4-F1-model_v4 | Uncharacterized protein | 0.8613 | 2 | 110 |
GO:0008270
|