F496017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1900 | 694 | 3800 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0156224|Ga0501037_0156224_217_987 |
| Length | 256 |
| Sequence | MLLVISPAKTLDYDTPPVTARHTQPQFLDHAQELIQQLRELSPAQIAELMHLSDKLAGLNAARFGSWHPDFTPDNAKQALLAFKGDVYTGLNAEDFSEDDFDFAQQHLSGLYGLLRPLDLMQPYRLEMGTRLANARGKDLYAFWGDRISGWLNEALAAQGDDILLNLASNEYFSSVKRKALNARIIDTEFKDLKNGQYKIISFYAKKARGLMARYVIKERLRDPEGLKDFNDQGYRYSAEHSGPDSLVFLRDEPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 91 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 92 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 93 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 171 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 172 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 173 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 174 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 177 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 201 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 202 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 203 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 204 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 205 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 206 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 207 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 208 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 212 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 213 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 214 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 215 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 218 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 221 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 222 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 223 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 224 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 225 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 228 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 229 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 230 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 231 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 232 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 233 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 240 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 246 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 344 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 345 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 346 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 347 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 361 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 378 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 379 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 382 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 383 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 384 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 385 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 386 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 387 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 388 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 389 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 390 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 391 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 392 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 393 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 394 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 395 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 396 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 397 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 398 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 399 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 400 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 401 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 402 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 403 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 404 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 405 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 406 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 407 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 408 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 409 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 410 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 411 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 412 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 413 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 414 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 415 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 416 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 417 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 418 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 419 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 420 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 421 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 422 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 423 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 424 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 425 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 426 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 427 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 428 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 429 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 430 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 431 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 432 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 433 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 434 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 435 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 436 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 437 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 438 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 439 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 440 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 441 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 442 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 443 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 444 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 445 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 446 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 447 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 448 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 449 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 450 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 451 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 452 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 453 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 454 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 455 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 456 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 457 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 458 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 459 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 460 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 461 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 462 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 463 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 464 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 465 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 466 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 467 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 468 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 469 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 470 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 471 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 472 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 473 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 474 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 475 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 476 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 477 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 478 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 479 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 480 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 481 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 482 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 483 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 484 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 485 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 486 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 487 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 488 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 489 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 490 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 491 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 492 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 493 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 494 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 495 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 496 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 497 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 498 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 499 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 500 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 501 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 502 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 503 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 504 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 505 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 506 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 507 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 508 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 509 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 510 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 511 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 512 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 513 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 514 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 515 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 516 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 517 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 518 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 519 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 520 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 521 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 522 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 523 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 524 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 525 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 526 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 527 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 528 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 529 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 530 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 531 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 532 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 533 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 534 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 535 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 536 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 537 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 538 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 539 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 540 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 541 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 542 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 543 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 544 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 545 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 546 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 547 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 548 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 549 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 550 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 551 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 552 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 553 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 554 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 555 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 556 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 557 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 558 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 559 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 560 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 561 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 562 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 563 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 564 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 565 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 566 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 567 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 568 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 569 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 570 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 571 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 572 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 573 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 574 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 575 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 576 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 577 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 578 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 579 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 580 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 581 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 582 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 583 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 584 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 585 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 586 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 587 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 588 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 589 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 590 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 591 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 592 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 593 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 594 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 595 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 596 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 597 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 598 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 599 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 600 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 601 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 602 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 603 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 604 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 605 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 606 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 607 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 608 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 609 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 610 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 611 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 612 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 613 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 614 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 615 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 616 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 617 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 618 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 619 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 620 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 621 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 622 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 623 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 624 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 625 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 626 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 627 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 628 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 629 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 630 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 631 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 632 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 633 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 634 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 635 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 636 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 637 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 638 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 639 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 640 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 641 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 642 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 643 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 644 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 645 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 646 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 647 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 648 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 649 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 650 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 651 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 652 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 653 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 654 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 655 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 656 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 657 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 658 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 659 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 660 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 661 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 662 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 663 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 664 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 665 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 666 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 667 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 668 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 669 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 670 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 671 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 672 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 673 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 674 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 675 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 676 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 677 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 678 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 679 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 680 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 681 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 682 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 683 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 684 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 685 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 686 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 687 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 688 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 689 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 690 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 691 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 692 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 693 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 694 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.42 |
| Metatranscriptomes | 0.11 |
| Isolates | 16.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0.05 |
| Endosphere | 7.63 |
| Nodule | 2.58 |
| Rhizoplane | 4.53 |
| Rhizosphere | 66.05 |
| Stem | 0 |
| Stem Tuber | 0.05 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501037_0156224 | 3300049573 | Bacteria | 1628 |
| 2 | RicEn_C2037 | 2010549000 | Bacteria | 1470 |
| 3 | MRS2a_Contig_755 | 2124908027 | Bacteria | 28110 |
| 4 | SwRhRL2b_contig_1713675 | 2162886007 | Bacteria | 5122 |
| 5 | SwRhRL2b_contig_2371853 | 2162886007 | Bacteria | 2043 |
| 6 | SwRhRL2b_contig_546740 | 2162886007 | Bacteria | 2185 |
| 7 | SwRhRL2b_contig_815985 | 2162886007 | Bacteria | 3014 |
| 8 | SwRhRL2b_contig_849631 | 2162886007 | Bacteria | 1052 |
| 9 | JGI24740J21852_10000774 | 3300001979 | Bacteria | 14020 |
| 10 | JGI25162J39368_1000101 | 3300002737 | Bacteria | 94481 |
| 11 | JGI25162J39368_1000200 | 3300002737 | Bacteria | 63130 |
| 12 | JGI25163J39215_1000001 | 3300002771 | Bacteria | 314282 |
| 13 | JGI25163J39215_1001259 | 3300002771 | Bacteria | 4609 |
| 14 | JGI25163J39215_1001987 | 3300002771 | Bacteria | 2519 |
| 15 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 16 | JGI25164J39214_1000097 | 3300002772 | Bacteria | 87008 |
| 17 | JGI25164J39214_1000162 | 3300002772 | Bacteria | 63130 |
| 18 | JGI25165J46597_1000184 | 3300003214 | Bacteria | 94481 |
| 19 | JGI25165J46597_1000294 | 3300003214 | Bacteria | 63130 |
| 20 | rootH1_10196713 | 3300003323 | Bacteria | 3035 |
| 21 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 22 | Ga0055538_1000016 | 3300003751 | Bacteria | 305460 |
| 23 | Ga0055538_1000029 | 3300003751 | Bacteria | 203858 |
| 24 | Ga0055538_1001305 | 3300003751 | Bacteria | 5047 |
| 25 | Ga0055538_1005579 | 3300003751 | Bacteria | 1292 |
| 26 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 27 | Ga0055539_1000021 | 3300003752 | Bacteria | 305460 |
| 28 | Ga0055539_1000039 | 3300003752 | Bacteria | 203858 |
| 29 | Ga0055539_1000095 | 3300003752 | Bacteria | 102639 |
| 30 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 31 | Ga0055533_1000029 | 3300003756 | Bacteria | 305460 |
| 32 | Ga0055533_1000049 | 3300003756 | Bacteria | 203858 |
| 33 | Ga0055533_1003060 | 3300003756 | Bacteria | 3537 |
| 34 | Ga0055533_1008731 | 3300003756 | Bacteria | 1255 |
| 35 | Ga0055532_1000058 | 3300003758 | Bacteria | 153303 |
| 36 | Ga0055532_1000306 | 3300003758 | Bacteria | 29851 |
| 37 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 38 | Ga0055525_1000033 | 3300003759 | Bacteria | 305460 |
| 39 | Ga0055525_1000281 | 3300003759 | Bacteria | 46722 |
| 40 | Ga0055525_1000322 | 3300003759 | Bacteria | 37351 |
| 41 | Ga0055527_1001381 | 3300003760 | Bacteria | 5172 |
| 42 | Ga0055535_1000041 | 3300003761 | Bacteria | 153303 |
| 43 | Ga0055529_1000077 | 3300003763 | Bacteria | 153303 |
| 44 | Ga0055536_1000062 | 3300003781 | Bacteria | 99169 |
| 45 | Ga0055536_1014462 | 3300003781 | Bacteria | 2769 |
| 46 | Ga0055530_10000489 | 3300003791 | Bacteria | 34449 |
| 47 | Ga0055530_10001123 | 3300003791 | Bacteria | 20903 |
| 48 | Ga0055530_10001872 | 3300003791 | Bacteria | 14468 |
| 49 | Ga0055530_10008693 | 3300003791 | Bacteria | 4022 |
| 50 | Ga0055540_1000512 | 3300003792 | Bacteria | 29296 |
| 51 | Ga0055540_1000517 | 3300003792 | Bacteria | 29219 |
| 52 | Ga0055540_1001386 | 3300003792 | Bacteria | 14468 |
| 53 | Ga0055531_10000707 | 3300003794 | Bacteria | 28425 |
| 54 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 55 | Ga0055541_1000026 | 3300003841 | Bacteria | 203858 |
| 56 | Ga0055541_1000045 | 3300003841 | Bacteria | 148620 |
| 57 | Ga0055541_1002616 | 3300003841 | Bacteria | 3537 |
| 58 | Ga0058692_1002136 | 3300003856 | Bacteria | 6817 |
| 59 | Ga0058692_1011133 | 3300003856 | Bacteria | 2190 |
| 60 | Ga0058692_1023389 | 3300003856 | Bacteria | 1257 |
| 61 | Ga0058692_1031672 | 3300003856 | Bacteria | 993 |
| 62 | Ga0065714_10004246 | 3300005288 | Bacteria | 5203 |
| 63 | Ga0065714_10008068 | 3300005288 | Bacteria | 2663 |
| 64 | Ga0065714_10021664 | 3300005288 | Bacteria | 1273 |
| 65 | Ga0065714_10158041 | 3300005288 | Bacteria | 1067 |
| 66 | Ga0065704_10000047 | 3300005289 | Bacteria | 72432 |
| 67 | Ga0065704_10007942 | 3300005289 | Bacteria | 2189 |
| 68 | Ga0065704_10009984 | 3300005289 | Bacteria | 2209 |
| 69 | Ga0065704_10034929 | 3300005289 | Bacteria | 912 |
| 70 | Ga0065704_10076354 | 3300005289 | Bacteria | 5152 |
| 71 | Ga0065704_10081280 | 3300005289 | Bacteria | 3788 |
| 72 | Ga0065704_10194578 | 3300005289 | Bacteria | 1174 |
| 73 | Ga0065712_10000745 | 3300005290 | Bacteria | 16243 |
| 74 | Ga0065712_10067926 | 3300005290 | Bacteria | 20433 |
| 75 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 76 | Ga0070670_100018557 | 3300005331 | Bacteria | 5965 |
| 77 | Ga0070666_10013660 | 3300005335 | Bacteria | 5156 |
| 78 | Ga0070682_100154681 | 3300005337 | Bacteria | 1577 |
| 79 | Ga0070660_100001483 | 3300005339 | Bacteria | 16064 |
| 80 | Ga0070661_100000301 | 3300005344 | Bacteria | 39891 |
| 81 | Ga0070661_100000333 | 3300005344 | Bacteria | 37888 |
| 82 | Ga0070661_100015613 | 3300005344 | Bacteria | 5361 |
| 83 | Ga0070668_100001689 | 3300005347 | Bacteria | 16007 |
| 84 | Ga0070669_100004323 | 3300005353 | Bacteria | 10266 |
| 85 | Ga0070669_100012110 | 3300005353 | Bacteria | 6122 |
| 86 | Ga0070671_100000023 | 3300005355 | Bacteria | 123775 |
| 87 | Ga0070667_100000018 | 3300005367 | Bacteria | 226033 |
| 88 | Ga0070663_100000025 | 3300005455 | Bacteria | 101896 |
| 89 | Ga0070662_100013363 | 3300005457 | Bacteria | 5464 |
| 90 | Ga0070662_100265268 | 3300005457 | Bacteria | 1385 |
| 91 | Ga0068853_100000548 | 3300005539 | Bacteria | 25615 |
| 92 | Ga0070665_100005073 | 3300005548 | Bacteria | 13664 |
| 93 | Ga0070665_100005453 | 3300005548 | Bacteria | 13113 |
| 94 | Ga0070665_100010581 | 3300005548 | Bacteria | 9339 |
| 95 | Ga0070665_100048104 | 3300005548 | Bacteria | 4282 |
| 96 | Ga0070665_101000163 | 3300005548 | Bacteria | 848 |
| 97 | Ga0068855_100000675 | 3300005563 | Bacteria | 41643 |
| 98 | Ga0068855_100061794 | 3300005563 | Bacteria | 4376 |
| 99 | Ga0070664_100000020 | 3300005564 | Bacteria | 119858 |
| 100 | Ga0070664_100001427 | 3300005564 | Bacteria | 19069 |
| 101 | Ga0068857_100024808 | 3300005577 | Bacteria | 5281 |
| 102 | Ga0068854_100019484 | 3300005578 | Bacteria | 4573 |
| 103 | Ga0068856_100002818 | 3300005614 | Bacteria | 17803 |
| 104 | Ga0068856_100427809 | 3300005614 | Bacteria | 1344 |
| 105 | Ga0068852_100077074 | 3300005616 | Bacteria | 2945 |
| 106 | Ga0068859_100008851 | 3300005617 | Bacteria | 10163 |
| 107 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 108 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 109 | Ga0068851_10013718 | 3300005834 | Bacteria | 3837 |
| 110 | Ga0068851_10112256 | 3300005834 | Bacteria | 1456 |
| 111 | Ga0068858_100249879 | 3300005842 | Bacteria | 1684 |
| 112 | Ga0068862_100025576 | 3300005844 | Bacteria | 4956 |
| 113 | Ga0075365_10026264 | 3300006038 | Bacteria | 3695 |
| 114 | Ga0075365_10132427 | 3300006038 | Bacteria | 1726 |
| 115 | Ga0075365_10203440 | 3300006038 | Bacteria | 1387 |
| 116 | Ga0075363_100241739 | 3300006048 | Bacteria | 1038 |
| 117 | Ga0075364_10149551 | 3300006051 | Bacteria | 1573 |
| 118 | Ga0075432_10007845 | 3300006058 | Bacteria | 3640 |
| 119 | Ga0075432_10072999 | 3300006058 | Bacteria | 1235 |
| 120 | Ga0075432_10087344 | 3300006058 | Bacteria | 1138 |
| 121 | Ga0075432_10105065 | 3300006058 | Bacteria | 1047 |
| 122 | Ga0075362_10099623 | 3300006177 | Bacteria | 1357 |
| 123 | Ga0075367_10420614 | 3300006178 | Bacteria | 846 |
| 124 | Ga0075369_10018482 | 3300006186 | Bacteria | 2839 |
| 125 | Ga0075369_10035729 | 3300006186 | Bacteria | 2113 |
| 126 | Ga0075366_10009474 | 3300006195 | Bacteria | 5436 |
| 127 | Ga0075366_10101623 | 3300006195 | Bacteria | 1725 |
| 128 | Ga0075366_10295003 | 3300006195 | Bacteria | 991 |
| 129 | Ga0075370_10051217 | 3300006353 | Bacteria | 2342 |
| 130 | Ga0075436_100284952 | 3300006914 | Bacteria | 1182 |
| 131 | Ga0097620_100008853 | 3300006931 | Bacteria | 10163 |
| 132 | Ga0099823_1000030 | 3300006944 | Bacteria | 69064 |
| 133 | Ga0099823_1042999 | 3300006944 | Bacteria | 3137 |
| 134 | Ga0079104_1000168 | 3300006946 | Bacteria | 93546 |
| 135 | Ga0079104_1000385 | 3300006946 | Bacteria | 51277 |
| 136 | Ga0079104_1000403 | 3300006946 | Bacteria | 49953 |
| 137 | Ga0079104_1002852 | 3300006946 | Bacteria | 8658 |
| 138 | Ga0079104_1006904 | 3300006946 | Bacteria | 4202 |
| 139 | Ga0079104_1012030 | 3300006946 | Bacteria | 2745 |
| 140 | Ga0079104_1012282 | 3300006946 | Bacteria | 2704 |
| 141 | Ga0079104_1016758 | 3300006946 | Bacteria | 2130 |
| 142 | Ga0079104_1017323 | 3300006946 | Bacteria | 2074 |
| 143 | Ga0079104_1018465 | 3300006946 | Bacteria | 1974 |
| 144 | Ga0105251_10000012 | 3300009011 | Bacteria | 167614 |
| 145 | Ga0105251_10002077 | 3300009011 | Bacteria | 16166 |
| 146 | Ga0105251_10002215 | 3300009011 | Bacteria | 15509 |
| 147 | Ga0105251_10002730 | 3300009011 | Bacteria | 13520 |
| 148 | Ga0105251_10005690 | 3300009011 | Bacteria | 8094 |
| 149 | Ga0105251_10009746 | 3300009011 | Bacteria | 5639 |
| 150 | Ga0105251_10009754 | 3300009011 | Bacteria | 5636 |
| 151 | Ga0105251_10011231 | 3300009011 | Bacteria | 5127 |
| 152 | Ga0105251_10011554 | 3300009011 | Bacteria | 5039 |
| 153 | Ga0105251_10011737 | 3300009011 | Bacteria | 4989 |
| 154 | Ga0105251_10014335 | 3300009011 | Bacteria | 4390 |
| 155 | Ga0105251_10014617 | 3300009011 | Bacteria | 4329 |
| 156 | Ga0105251_10017600 | 3300009011 | Bacteria | 3825 |
| 157 | Ga0105251_10021619 | 3300009011 | Bacteria | 3356 |
| 158 | Ga0105251_10024041 | 3300009011 | Bacteria | 3134 |
| 159 | Ga0105251_10032661 | 3300009011 | Bacteria | 2591 |
| 160 | Ga0105251_10039806 | 3300009011 | Bacteria | 2294 |
| 161 | Ga0105251_10053039 | 3300009011 | Bacteria | 1929 |
| 162 | Ga0105244_10000023 | 3300009036 | Bacteria | 233110 |
| 163 | Ga0105244_10001452 | 3300009036 | Bacteria | 19192 |
| 164 | Ga0105244_10001671 | 3300009036 | Bacteria | 17536 |
| 165 | Ga0105244_10002529 | 3300009036 | Bacteria | 13733 |
| 166 | Ga0105244_10003779 | 3300009036 | Bacteria | 10681 |
| 167 | Ga0105244_10005545 | 3300009036 | Bacteria | 8362 |
| 168 | Ga0105244_10005824 | 3300009036 | Bacteria | 8099 |
| 169 | Ga0105244_10007416 | 3300009036 | Bacteria | 6973 |
| 170 | Ga0105244_10009674 | 3300009036 | Bacteria | 5901 |
| 171 | Ga0105244_10018532 | 3300009036 | Bacteria | 3902 |
| 172 | Ga0105244_10018578 | 3300009036 | Bacteria | 3897 |
| 173 | Ga0105244_10019901 | 3300009036 | Bacteria | 3734 |
| 174 | Ga0105244_10023412 | 3300009036 | Bacteria | 3386 |
| 175 | Ga0105244_10030030 | 3300009036 | Bacteria | 2896 |
| 176 | Ga0105244_10030333 | 3300009036 | Bacteria | 2878 |
| 177 | Ga0105244_10036976 | 3300009036 | Bacteria | 2554 |
| 178 | Ga0105244_10042870 | 3300009036 | Bacteria | 2337 |
| 179 | Ga0105244_10042940 | 3300009036 | Bacteria | 2335 |
| 180 | Ga0105244_10054573 | 3300009036 | Bacteria | 2027 |
| 181 | Ga0105244_10067777 | 3300009036 | Bacteria | 1785 |
| 182 | Ga0105244_10067921 | 3300009036 | Bacteria | 1782 |
| 183 | Ga0105244_10112293 | 3300009036 | Bacteria | 1325 |
| 184 | Ga0105244_10153630 | 3300009036 | Bacteria | 1102 |
| 185 | Ga0105244_10160075 | 3300009036 | Bacteria | 1075 |
| 186 | Ga0105250_10001306 | 3300009092 | Bacteria | 13652 |
| 187 | Ga0105250_10001831 | 3300009092 | Bacteria | 11122 |
| 188 | Ga0105250_10003516 | 3300009092 | Bacteria | 7393 |
| 189 | Ga0105250_10004197 | 3300009092 | Bacteria | 6675 |
| 190 | Ga0105250_10009887 | 3300009092 | Bacteria | 4003 |
| 191 | Ga0105250_10011683 | 3300009092 | Bacteria | 3641 |
| 192 | Ga0105250_10013576 | 3300009092 | Bacteria | 3356 |
| 193 | Ga0105250_10013804 | 3300009092 | Bacteria | 3327 |
| 194 | Ga0105250_10018342 | 3300009092 | Bacteria | 2835 |
| 195 | Ga0105250_10030575 | 3300009092 | Bacteria | 2164 |
| 196 | Ga0105250_10034666 | 3300009092 | Bacteria | 2025 |
| 197 | Ga0105250_10038896 | 3300009092 | Bacteria | 1908 |
| 198 | Ga0105240_10076651 | 3300009093 | Bacteria | 4122 |
| 199 | Ga0105240_10128178 | 3300009093 | Bacteria | 3046 |
| 200 | Ga0105247_10000387 | 3300009101 | Bacteria | 37452 |
| 201 | Ga0105247_10000503 | 3300009101 | Bacteria | 32160 |
| 202 | Ga0105247_10010966 | 3300009101 | Bacteria | 5471 |
| 203 | Ga0105243_10000010 | 3300009148 | Bacteria | 316672 |
| 204 | Ga0105243_10000183 | 3300009148 | Bacteria | 73056 |
| 205 | Ga0105243_10000459 | 3300009148 | Bacteria | 42362 |
| 206 | Ga0105243_10003177 | 3300009148 | Bacteria | 13461 |
| 207 | Ga0105243_10014014 | 3300009148 | Bacteria | 6067 |
| 208 | Ga0105243_10022231 | 3300009148 | Bacteria | 4818 |
| 209 | Ga0105243_10030478 | 3300009148 | Bacteria | 4153 |
| 210 | Ga0105243_10046020 | 3300009148 | Bacteria | 3430 |
| 211 | Ga0105243_10051228 | 3300009148 | Bacteria | 3265 |
| 212 | Ga0105243_10087617 | 3300009148 | Bacteria | 2556 |
| 213 | Ga0105241_10000008 | 3300009174 | Bacteria | 334281 |
| 214 | Ga0105237_10002940 | 3300009545 | Bacteria | 20629 |
| 215 | Ga0105237_10028696 | 3300009545 | Bacteria | 5664 |
| 216 | Ga0105237_10067376 | 3300009545 | Bacteria | 3573 |
| 217 | Ga0105237_10460286 | 3300009545 | Bacteria | 1278 |
| 218 | Ga0105238_10001371 | 3300009551 | Bacteria | 24426 |
| 219 | Ga0105249_10001247 | 3300009553 | Bacteria | 22341 |
| 220 | Ga0105249_10031491 | 3300009553 | Bacteria | 4798 |
| 221 | Ga0105249_10052157 | 3300009553 | Bacteria | 3735 |
| 222 | Ga0105239_10029711 | 3300010375 | Bacteria | 6010 |
| 223 | Ga0105246_10001380 | 3300011119 | Bacteria | 14332 |
| 224 | Ga0105246_10024118 | 3300011119 | Bacteria | 3947 |
| 225 | Ga0105246_10058234 | 3300011119 | Bacteria | 2676 |
| 226 | Ga0105246_10064097 | 3300011119 | Bacteria | 2566 |
| 227 | Ga0105246_10101596 | 3300011119 | Bacteria | 2095 |
| 228 | Ga0105246_10117902 | 3300011119 | Bacteria | 1962 |
| 229 | Ga0157345_1000614 | 3300012498 | Bacteria | 3027 |
| 230 | Ga0157345_1000850 | 3300012498 | Bacteria | 2289 |
| 231 | Ga0157373_10001252 | 3300013100 | Bacteria | 19414 |
| 232 | Ga0157373_10001401 | 3300013100 | Bacteria | 18455 |
| 233 | Ga0157373_10003766 | 3300013100 | Bacteria | 11473 |
| 234 | Ga0157373_10008149 | 3300013100 | Bacteria | 7791 |
| 235 | Ga0157373_10011772 | 3300013100 | Bacteria | 6425 |
| 236 | Ga0157373_10017447 | 3300013100 | Bacteria | 5228 |
| 237 | Ga0157373_10018566 | 3300013100 | Bacteria | 5061 |
| 238 | Ga0157373_10020384 | 3300013100 | Bacteria | 4819 |
| 239 | Ga0157373_10028219 | 3300013100 | Bacteria | 4049 |
| 240 | Ga0157373_10035371 | 3300013100 | Bacteria | 3586 |
| 241 | Ga0157373_10043357 | 3300013100 | Bacteria | 3213 |
| 242 | Ga0157373_10043583 | 3300013100 | Bacteria | 3205 |
| 243 | Ga0157373_10053843 | 3300013100 | Bacteria | 2861 |
| 244 | Ga0157373_10104408 | 3300013100 | Bacteria | 1993 |
| 245 | Ga0157371_10000082 | 3300013102 | Bacteria | 149981 |
| 246 | Ga0157371_10000227 | 3300013102 | Bacteria | 81890 |
| 247 | Ga0157371_10000267 | 3300013102 | Bacteria | 71120 |
| 248 | Ga0157371_10001526 | 3300013102 | Bacteria | 23861 |
| 249 | Ga0157371_10002569 | 3300013102 | Bacteria | 17219 |
| 250 | Ga0157371_10003239 | 3300013102 | Bacteria | 14941 |
| 251 | Ga0157371_10004478 | 3300013102 | Bacteria | 12184 |
| 252 | Ga0157371_10020913 | 3300013102 | Bacteria | 4812 |
| 253 | Ga0157371_10023863 | 3300013102 | Bacteria | 4470 |
| 254 | Ga0157371_10050700 | 3300013102 | Bacteria | 2950 |
| 255 | Ga0157371_10054498 | 3300013102 | Bacteria | 2840 |
| 256 | Ga0157371_10100910 | 3300013102 | Bacteria | 2047 |
| 257 | Ga0157370_10000052 | 3300013104 | Bacteria | 122634 |
| 258 | Ga0157370_10000276 | 3300013104 | Bacteria | 65208 |
| 259 | Ga0157370_10000423 | 3300013104 | Bacteria | 53080 |
| 260 | Ga0157370_10004198 | 3300013104 | Bacteria | 16670 |
| 261 | Ga0157370_10041146 | 3300013104 | Bacteria | 4461 |
| 262 | Ga0157370_10052423 | 3300013104 | Bacteria | 3895 |
| 263 | Ga0157370_10095083 | 3300013104 | Bacteria | 2796 |
| 264 | Ga0157370_10113731 | 3300013104 | Bacteria | 2529 |
| 265 | Ga0157370_10144517 | 3300013104 | Bacteria | 2215 |
| 266 | Ga0157370_10212977 | 3300013104 | Bacteria | 1790 |
| 267 | Ga0157370_10803772 | 3300013104 | Bacteria | 856 |
| 268 | Ga0157369_10000183 | 3300013105 | Bacteria | 86986 |
| 269 | Ga0157369_10030052 | 3300013105 | Bacteria | 5995 |
| 270 | Ga0157369_10085606 | 3300013105 | Bacteria | 3368 |
| 271 | Ga0157369_10122993 | 3300013105 | Bacteria | 2752 |
| 272 | Ga0157369_10143426 | 3300013105 | Bacteria | 2526 |
| 273 | Ga0157369_10160005 | 3300013105 | Bacteria | 2377 |
| 274 | Ga0163162_10011360 | 3300013306 | Bacteria | 8682 |
| 275 | Ga0163162_10056413 | 3300013306 | Bacteria | 3956 |
| 276 | Ga0163162_10272367 | 3300013306 | Bacteria | 1825 |
| 277 | Ga0163162_10463514 | 3300013306 | Bacteria | 1399 |
| 278 | Ga0157372_10000122 | 3300013307 | Bacteria | 83503 |
| 279 | Ga0157372_10004149 | 3300013307 | Bacteria | 15516 |
| 280 | Ga0157372_10015434 | 3300013307 | Bacteria | 8186 |
| 281 | Ga0157372_10031809 | 3300013307 | Bacteria | 5781 |
| 282 | Ga0157372_10041575 | 3300013307 | Bacteria | 5084 |
| 283 | Ga0157372_10191917 | 3300013307 | Bacteria | 2366 |
| 284 | Ga0157372_10222969 | 3300013307 | Bacteria | 2185 |
| 285 | Ga0157372_11079318 | 3300013307 | Bacteria | 929 |
| 286 | Ga0157375_10054549 | 3300013308 | Bacteria | 3936 |
| 287 | Ga0157375_10055844 | 3300013308 | Bacteria | 3895 |
| 288 | Ga0163163_10000537 | 3300014325 | Bacteria | 33554 |
| 289 | Ga0182008_10000521 | 3300014497 | Bacteria | 28852 |
| 290 | Ga0182008_10009519 | 3300014497 | Bacteria | 5240 |
| 291 | Ga0182008_10010562 | 3300014497 | Bacteria | 4940 |
| 292 | Ga0182008_10012395 | 3300014497 | Bacteria | 4500 |
| 293 | Ga0182008_10012471 | 3300014497 | Bacteria | 4485 |
| 294 | Ga0182008_10015538 | 3300014497 | Bacteria | 3970 |
| 295 | Ga0182008_10017847 | 3300014497 | Bacteria | 3677 |
| 296 | Ga0182008_10017993 | 3300014497 | Bacteria | 3661 |
| 297 | Ga0182008_10018883 | 3300014497 | Bacteria | 3565 |
| 298 | Ga0182008_10018911 | 3300014497 | Bacteria | 3562 |
| 299 | Ga0182008_10035557 | 3300014497 | Bacteria | 2494 |
| 300 | Ga0182008_10066853 | 3300014497 | Bacteria | 1769 |
| 301 | Ga0182008_10096618 | 3300014497 | Bacteria | 1458 |
| 302 | Ga0182008_10244673 | 3300014497 | Bacteria | 924 |
| 303 | Ga0182006_1002768 | 3300015261 | Bacteria | 9377 |
| 304 | Ga0182006_1003167 | 3300015261 | Bacteria | 8599 |
| 305 | Ga0182006_1004442 | 3300015261 | Bacteria | 6919 |
| 306 | Ga0182006_1007457 | 3300015261 | Bacteria | 5004 |
| 307 | Ga0182006_1007919 | 3300015261 | Bacteria | 4836 |
| 308 | Ga0182006_1009307 | 3300015261 | Bacteria | 4408 |
| 309 | Ga0182006_1010433 | 3300015261 | Bacteria | 4132 |
| 310 | Ga0182006_1010488 | 3300015261 | Bacteria | 4117 |
| 311 | Ga0182006_1011910 | 3300015261 | Bacteria | 3809 |
| 312 | Ga0182006_1018147 | 3300015261 | Bacteria | 2977 |
| 313 | Ga0182006_1027976 | 3300015261 | Bacteria | 2297 |
| 314 | Ga0182007_10004641 | 3300015262 | Bacteria | 6202 |
| 315 | Ga0182007_10012461 | 3300015262 | Bacteria | 3269 |
| 316 | Ga0182007_10025468 | 3300015262 | Bacteria | 2061 |
| 317 | Ga0182005_1005476 | 3300015265 | Bacteria | 3962 |
| 318 | Ga0182005_1005499 | 3300015265 | Bacteria | 3951 |
| 319 | Ga0182005_1018678 | 3300015265 | Bacteria | 1916 |
| 320 | Ga0183366_1003 | 3300015679 | Bacteria | 453474 |
| 321 | Ga0183370_1003 | 3300015680 | Bacteria | 454044 |
| 322 | Ga0183369_1005 | 3300015685 | Bacteria | 453680 |
| 323 | Ga0183368_1006 | 3300015687 | Bacteria | 551576 |
| 324 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 325 | Ga0163161_10016791 | 3300017792 | Bacteria | 5117 |
| 326 | Ga0163161_10024045 | 3300017792 | Bacteria | 4301 |
| 327 | Ga0163161_10105726 | 3300017792 | Bacteria | 2100 |
| 328 | Ga0163161_10145423 | 3300017792 | Bacteria | 1798 |
| 329 | Ga0163161_10308856 | 3300017792 | Bacteria | 1247 |
| 330 | Ga0163161_10332919 | 3300017792 | Bacteria | 1203 |
| 331 | Ga0154015_1159086 | 3300020610 | Bacteria | 10595 |
| 332 | Ga0213872_10001121 | 3300021361 | Bacteria | 18331 |
| 333 | Ga0213876_10000026 | 3300021384 | Bacteria | 231892 |
| 334 | Ga0209435_100999 | 3300025206 | Bacteria | 4053 |
| 335 | Ga0209760_100063 | 3300025207 | Bacteria | 92173 |
| 336 | Ga0209760_100124 | 3300025207 | Bacteria | 51804 |
| 337 | Ga0209760_100344 | 3300025207 | Bacteria | 13462 |
| 338 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 339 | Ga0209784_100033 | 3300025224 | Bacteria | 305649 |
| 340 | Ga0209784_100045 | 3300025224 | Bacteria | 203911 |
| 341 | Ga0209784_100055 | 3300025224 | Bacteria | 177507 |
| 342 | Ga0209784_100466 | 3300025224 | Bacteria | 16871 |
| 343 | Ga0209784_100820 | 3300025224 | Bacteria | 7070 |
| 344 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 345 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 346 | Ga0209566_100037 | 3300025225 | Bacteria | 305649 |
| 347 | Ga0209566_100057 | 3300025225 | Bacteria | 203960 |
| 348 | Ga0209566_101976 | 3300025225 | Bacteria | 4390 |
| 349 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 350 | Ga0209674_100055 | 3300025226 | Bacteria | 305649 |
| 351 | Ga0209674_100080 | 3300025226 | Bacteria | 203960 |
| 352 | Ga0209674_100090 | 3300025226 | Bacteria | 175563 |
| 353 | Ga0209672_100122 | 3300025228 | Bacteria | 81984 |
| 354 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 355 | Ga0209147_100079 | 3300025229 | Bacteria | 203960 |
| 356 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 357 | Ga0209563_100056 | 3300025230 | Bacteria | 305649 |
| 358 | Ga0209563_100078 | 3300025230 | Bacteria | 203960 |
| 359 | Ga0209563_100095 | 3300025230 | Bacteria | 165592 |
| 360 | Ga0209563_100198 | 3300025230 | Bacteria | 33000 |
| 361 | Ga0209563_101685 | 3300025230 | Bacteria | 5604 |
| 362 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 363 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 364 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 365 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 366 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 367 | Ga0209437_100046 | 3300025233 | Bacteria | 405293 |
| 368 | Ga0209437_102014 | 3300025233 | Bacteria | 4158 |
| 369 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 370 | Ga0209258_100434 | 3300025242 | Bacteria | 47860 |
| 371 | Ga0207425_1027285 | 3300025245 | Bacteria | 1166 |
| 372 | Ga0207425_1028375 | 3300025245 | Bacteria | 1135 |
| 373 | Ga0209646_1000286 | 3300025246 | Bacteria | 43916 |
| 374 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 375 | Ga0209677_100034 | 3300025253 | Bacteria | 305649 |
| 376 | Ga0209677_100045 | 3300025253 | Bacteria | 203960 |
| 377 | Ga0209677_100069 | 3300025253 | Bacteria | 144999 |
| 378 | Ga0209148_1003220 | 3300025254 | Bacteria | 4663 |
| 379 | Ga0209759_1001589 | 3300025256 | Bacteria | 12303 |
| 380 | Ga0209759_1002841 | 3300025256 | Bacteria | 7305 |
| 381 | Ga0209759_1007593 | 3300025256 | Bacteria | 3470 |
| 382 | Ga0209759_1015826 | 3300025256 | Bacteria | 1930 |
| 383 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 384 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 385 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 386 | Ga0209233_1001593 | 3300025261 | Bacteria | 8872 |
| 387 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 388 | Ga0209675_1001127 | 3300025291 | Bacteria | 16296 |
| 389 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 390 | Ga0209676_1000078 | 3300025292 | Bacteria | 296293 |
| 391 | Ga0209676_1000101 | 3300025292 | Bacteria | 227976 |
| 392 | Ga0209676_1001035 | 3300025292 | Bacteria | 32260 |
| 393 | Ga0209676_1005680 | 3300025292 | Bacteria | 6417 |
| 394 | Ga0209676_1007076 | 3300025292 | Bacteria | 5372 |
| 395 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 396 | Ga0209050_1000041 | 3300025298 | Bacteria | 408004 |
| 397 | Ga0209050_1000181 | 3300025298 | Bacteria | 142533 |
| 398 | Ga0209050_1000425 | 3300025298 | Bacteria | 77756 |
| 399 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 400 | Ga0209051_1000065 | 3300025303 | Bacteria | 231445 |
| 401 | Ga0209051_1000085 | 3300025303 | Bacteria | 189973 |
| 402 | Ga0209051_1003416 | 3300025303 | Bacteria | 10424 |
| 403 | Ga0209257_1000105 | 3300025304 | Bacteria | 243729 |
| 404 | Ga0209257_1004461 | 3300025304 | Bacteria | 10836 |
| 405 | Ga0207656_10000023 | 3300025321 | Bacteria | 98957 |
| 406 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 407 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 408 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 409 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 410 | Ga0207696_1000093 | 3300025711 | Bacteria | 184278 |
| 411 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 412 | Ga0207696_1000140 | 3300025711 | Bacteria | 127393 |
| 413 | Ga0207696_1000142 | 3300025711 | Bacteria | 123519 |
| 414 | Ga0207696_1000210 | 3300025711 | Bacteria | 88330 |
| 415 | Ga0207696_1000761 | 3300025711 | Bacteria | 21277 |
| 416 | Ga0207696_1001106 | 3300025711 | Bacteria | 15723 |
| 417 | Ga0207696_1001942 | 3300025711 | Bacteria | 10508 |
| 418 | Ga0207696_1006471 | 3300025711 | Bacteria | 4718 |
| 419 | Ga0207696_1006604 | 3300025711 | Bacteria | 4651 |
| 420 | Ga0207696_1007473 | 3300025711 | Bacteria | 4270 |
| 421 | Ga0207696_1008344 | 3300025711 | Bacteria | 3976 |
| 422 | Ga0207696_1008411 | 3300025711 | Bacteria | 3949 |
| 423 | Ga0207696_1011045 | 3300025711 | Bacteria | 3276 |
| 424 | Ga0207696_1013364 | 3300025711 | Bacteria | 2864 |
| 425 | Ga0207696_1021141 | 3300025711 | Bacteria | 2087 |
| 426 | Ga0207696_1047814 | 3300025711 | Bacteria | 1232 |
| 427 | Ga0207696_1055732 | 3300025711 | Bacteria | 1121 |
| 428 | Ga0207655_1000017 | 3300025728 | Bacteria | 544403 |
| 429 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 430 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 431 | Ga0207655_1000026 | 3300025728 | Bacteria | 445528 |
| 432 | Ga0207655_1000054 | 3300025728 | Bacteria | 281894 |
| 433 | Ga0207655_1000056 | 3300025728 | Bacteria | 279166 |
| 434 | Ga0207655_1000086 | 3300025728 | Bacteria | 206068 |
| 435 | Ga0207655_1000101 | 3300025728 | Bacteria | 185883 |
| 436 | Ga0207655_1000146 | 3300025728 | Bacteria | 132221 |
| 437 | Ga0207655_1000204 | 3300025728 | Bacteria | 103596 |
| 438 | Ga0207655_1001035 | 3300025728 | Bacteria | 28075 |
| 439 | Ga0207655_1001048 | 3300025728 | Bacteria | 27691 |
| 440 | Ga0207655_1001357 | 3300025728 | Bacteria | 22968 |
| 441 | Ga0207655_1001468 | 3300025728 | Bacteria | 21769 |
| 442 | Ga0207655_1001487 | 3300025728 | Bacteria | 21477 |
| 443 | Ga0207655_1001632 | 3300025728 | Bacteria | 19908 |
| 444 | Ga0207655_1002118 | 3300025728 | Bacteria | 16607 |
| 445 | Ga0207655_1002372 | 3300025728 | Bacteria | 15380 |
| 446 | Ga0207655_1002809 | 3300025728 | Bacteria | 13501 |
| 447 | Ga0207655_1004189 | 3300025728 | Bacteria | 10348 |
| 448 | Ga0207655_1010013 | 3300025728 | Bacteria | 5809 |
| 449 | Ga0207655_1010613 | 3300025728 | Bacteria | 5570 |
| 450 | Ga0207655_1013689 | 3300025728 | Bacteria | 4638 |
| 451 | Ga0207655_1016932 | 3300025728 | Bacteria | 3958 |
| 452 | Ga0207655_1017762 | 3300025728 | Bacteria | 3820 |
| 453 | Ga0207655_1018246 | 3300025728 | Bacteria | 3737 |
| 454 | Ga0207655_1018461 | 3300025728 | Bacteria | 3695 |
| 455 | Ga0207655_1020570 | 3300025728 | Bacteria | 3384 |
| 456 | Ga0207655_1022720 | 3300025728 | Bacteria | 3133 |
| 457 | Ga0207655_1026412 | 3300025728 | Bacteria | 2789 |
| 458 | Ga0207655_1027920 | 3300025728 | Bacteria | 2674 |
| 459 | Ga0207655_1029823 | 3300025728 | Bacteria | 2547 |
| 460 | Ga0207655_1034926 | 3300025728 | Bacteria | 2254 |
| 461 | Ga0207655_1041984 | 3300025728 | Bacteria | 1953 |
| 462 | Ga0207655_1043504 | 3300025728 | Bacteria | 1898 |
| 463 | Ga0207655_1064436 | 3300025728 | Bacteria | 1397 |
| 464 | Ga0207655_1074164 | 3300025728 | Bacteria | 1253 |
| 465 | Ga0207655_1110800 | 3300025728 | Bacteria | 927 |
| 466 | Ga0207713_1000034 | 3300025735 | Bacteria | 266214 |
| 467 | Ga0207713_1000046 | 3300025735 | Bacteria | 232796 |
| 468 | Ga0207713_1000068 | 3300025735 | Bacteria | 192415 |
| 469 | Ga0207713_1000080 | 3300025735 | Bacteria | 168403 |
| 470 | Ga0207713_1000110 | 3300025735 | Bacteria | 135907 |
| 471 | Ga0207713_1000158 | 3300025735 | Bacteria | 102081 |
| 472 | Ga0207713_1000244 | 3300025735 | Bacteria | 69698 |
| 473 | Ga0207713_1000419 | 3300025735 | Bacteria | 45136 |
| 474 | Ga0207713_1001346 | 3300025735 | Bacteria | 20027 |
| 475 | Ga0207713_1001972 | 3300025735 | Bacteria | 15450 |
| 476 | Ga0207713_1001975 | 3300025735 | Bacteria | 15433 |
| 477 | Ga0207713_1002876 | 3300025735 | Bacteria | 12079 |
| 478 | Ga0207713_1002981 | 3300025735 | Bacteria | 11834 |
| 479 | Ga0207713_1003117 | 3300025735 | Bacteria | 11496 |
| 480 | Ga0207713_1003504 | 3300025735 | Bacteria | 10643 |
| 481 | Ga0207713_1004322 | 3300025735 | Bacteria | 9253 |
| 482 | Ga0207713_1004391 | 3300025735 | Bacteria | 9163 |
| 483 | Ga0207713_1004891 | 3300025735 | Bacteria | 8576 |
| 484 | Ga0207713_1004897 | 3300025735 | Bacteria | 8559 |
| 485 | Ga0207713_1005933 | 3300025735 | Bacteria | 7540 |
| 486 | Ga0207713_1006679 | 3300025735 | Bacteria | 6979 |
| 487 | Ga0207713_1007580 | 3300025735 | Bacteria | 6371 |
| 488 | Ga0207713_1009112 | 3300025735 | Bacteria | 5631 |
| 489 | Ga0207713_1010990 | 3300025735 | Bacteria | 4963 |
| 490 | Ga0207713_1013180 | 3300025735 | Bacteria | 4374 |
| 491 | Ga0207713_1015021 | 3300025735 | Bacteria | 3992 |
| 492 | Ga0207713_1016371 | 3300025735 | Bacteria | 3764 |
| 493 | Ga0207713_1016704 | 3300025735 | Bacteria | 3714 |
| 494 | Ga0207713_1019102 | 3300025735 | Bacteria | 3367 |
| 495 | Ga0207713_1024616 | 3300025735 | Bacteria | 2802 |
| 496 | Ga0207713_1025411 | 3300025735 | Bacteria | 2735 |
| 497 | Ga0207713_1026519 | 3300025735 | Bacteria | 2652 |
| 498 | Ga0207713_1029814 | 3300025735 | Bacteria | 2437 |
| 499 | Ga0207713_1060297 | 3300025735 | Bacteria | 1451 |
| 500 | Ga0207713_1063120 | 3300025735 | Bacteria | 1400 |
| 501 | Ga0207713_1072015 | 3300025735 | Bacteria | 1273 |
| 502 | Ga0207713_1100885 | 3300025735 | Bacteria | 996 |
| 503 | Ga0207710_10000005 | 3300025900 | Bacteria | 607066 |
| 504 | Ga0207710_10000015 | 3300025900 | Bacteria | 393018 |
| 505 | Ga0207710_10061552 | 3300025900 | Bacteria | 1704 |
| 506 | Ga0207680_10003192 | 3300025903 | Bacteria | 7704 |
| 507 | Ga0207654_10000009 | 3300025911 | Bacteria | 334291 |
| 508 | Ga0207695_10000409 | 3300025913 | Bacteria | 95547 |
| 509 | Ga0207695_10000464 | 3300025913 | Bacteria | 87951 |
| 510 | Ga0207695_10022418 | 3300025913 | Bacteria | 7168 |
| 511 | Ga0207695_10136306 | 3300025913 | Bacteria | 2407 |
| 512 | Ga0207695_10267066 | 3300025913 | Bacteria | 1607 |
| 513 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 514 | Ga0207671_10019908 | 3300025914 | Bacteria | 5120 |
| 515 | Ga0207657_10021762 | 3300025919 | Bacteria | 6026 |
| 516 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 517 | Ga0207649_10000065 | 3300025920 | Bacteria | 94778 |
| 518 | Ga0207649_10017509 | 3300025920 | Bacteria | 4061 |
| 519 | Ga0207681_10002007 | 3300025923 | Bacteria | 13058 |
| 520 | Ga0207681_10004476 | 3300025923 | Bacteria | 8603 |
| 521 | Ga0207694_10001679 | 3300025924 | Bacteria | 18564 |
| 522 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 523 | Ga0207650_10000183 | 3300025925 | Bacteria | 72930 |
| 524 | Ga0207650_10008433 | 3300025925 | Bacteria | 7034 |
| 525 | Ga0207644_10000027 | 3300025931 | Bacteria | 143706 |
| 526 | Ga0207690_10277642 | 3300025932 | Bacteria | 1304 |
| 527 | Ga0207706_10015738 | 3300025933 | Bacteria | 6837 |
| 528 | Ga0207706_10039228 | 3300025933 | Bacteria | 4198 |
| 529 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 530 | Ga0207709_10000067 | 3300025935 | Bacteria | 189188 |
| 531 | Ga0207709_10000396 | 3300025935 | Bacteria | 42765 |
| 532 | Ga0207709_10005426 | 3300025935 | Bacteria | 7246 |
| 533 | Ga0207709_10006784 | 3300025935 | Bacteria | 6407 |
| 534 | Ga0207709_10008031 | 3300025935 | Bacteria | 5844 |
| 535 | Ga0207709_10052375 | 3300025935 | Bacteria | 2506 |
| 536 | Ga0207709_10102522 | 3300025935 | Bacteria | 1895 |
| 537 | Ga0207711_10000845 | 3300025941 | Bacteria | 29592 |
| 538 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 539 | Ga0207679_10000028 | 3300025945 | Bacteria | 187787 |
| 540 | Ga0207679_10005708 | 3300025945 | Bacteria | 7806 |
| 541 | Ga0207667_10000073 | 3300025949 | Bacteria | 174391 |
| 542 | Ga0207667_10000076 | 3300025949 | Bacteria | 166704 |
| 543 | Ga0207667_10000147 | 3300025949 | Bacteria | 106918 |
| 544 | Ga0207667_10000166 | 3300025949 | Bacteria | 97376 |
| 545 | Ga0207712_10054644 | 3300025961 | Bacteria | 2805 |
| 546 | Ga0207712_10074311 | 3300025961 | Bacteria | 2454 |
| 547 | Ga0207668_10002127 | 3300025972 | Bacteria | 11553 |
| 548 | Ga0207640_10000078 | 3300025981 | Bacteria | 75735 |
| 549 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 550 | Ga0207639_10000547 | 3300026041 | Bacteria | 25788 |
| 551 | Ga0207678_10000136 | 3300026067 | Bacteria | 61264 |
| 552 | Ga0207702_10000149 | 3300026078 | Bacteria | 81592 |
| 553 | Ga0207641_10076332 | 3300026088 | Bacteria | 2896 |
| 554 | Ga0207641_10076333 | 3300026088 | Bacteria | 2896 |
| 555 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 556 | Ga0207674_10000009 | 3300026116 | Bacteria | 202730 |
| 557 | Ga0207674_10063507 | 3300026116 | Bacteria | 3728 |
| 558 | Ga0207674_10450750 | 3300026116 | Bacteria | 1244 |
| 559 | Ga0207698_10123753 | 3300026142 | Bacteria | 2195 |
| 560 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 561 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 562 | Ga0209281_1000054 | 3300027111 | Bacteria | 309505 |
| 563 | Ga0209281_1000058 | 3300027111 | Bacteria | 300244 |
| 564 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 565 | Ga0209281_1000120 | 3300027111 | Bacteria | 206692 |
| 566 | Ga0209281_1000223 | 3300027111 | Bacteria | 121161 |
| 567 | Ga0209281_1000648 | 3300027111 | Bacteria | 37573 |
| 568 | Ga0209281_1000822 | 3300027111 | Bacteria | 28039 |
| 569 | Ga0209281_1000854 | 3300027111 | Bacteria | 26809 |
| 570 | Ga0209281_1001003 | 3300027111 | Bacteria | 22148 |
| 571 | Ga0209281_1001185 | 3300027111 | Bacteria | 17897 |
| 572 | Ga0209281_1009430 | 3300027111 | Bacteria | 2295 |
| 573 | Ga0209281_1024966 | 3300027111 | Bacteria | 1118 |
| 574 | Ga0209973_1005686 | 3300027252 | Bacteria | 1333 |
| 575 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 576 | Ga0209389_1101587 | 3300027296 | Bacteria | 1040 |
| 577 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 578 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 579 | Ga0209371_1000030 | 3300027312 | Bacteria | 423605 |
| 580 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 581 | Ga0209371_1000054 | 3300027312 | Bacteria | 259676 |
| 582 | Ga0209371_1000111 | 3300027312 | Bacteria | 140093 |
| 583 | Ga0209371_1000123 | 3300027312 | Bacteria | 131854 |
| 584 | Ga0209371_1000197 | 3300027312 | Bacteria | 88691 |
| 585 | Ga0209371_1000264 | 3300027312 | Bacteria | 61388 |
| 586 | Ga0209371_1000495 | 3300027312 | Bacteria | 38270 |
| 587 | Ga0209371_1000544 | 3300027312 | Bacteria | 35405 |
| 588 | Ga0209371_1000563 | 3300027312 | Bacteria | 33948 |
| 589 | Ga0209371_1000655 | 3300027312 | Bacteria | 30194 |
| 590 | Ga0209371_1001916 | 3300027312 | Bacteria | 12706 |
| 591 | Ga0209371_1002190 | 3300027312 | Bacteria | 11391 |
| 592 | Ga0209371_1002345 | 3300027312 | Bacteria | 10767 |
| 593 | Ga0209371_1003937 | 3300027312 | Bacteria | 6814 |
| 594 | Ga0209371_1007145 | 3300027312 | Bacteria | 3954 |
| 595 | Ga0209371_1009009 | 3300027312 | Bacteria | 3225 |
| 596 | Ga0209371_1012021 | 3300027312 | Bacteria | 2532 |
| 597 | Ga0209984_1000531 | 3300027424 | Bacteria | 4175 |
| 598 | Ga0209999_1000664 | 3300027543 | Bacteria | 5543 |
| 599 | Ga0209982_1001053 | 3300027552 | Bacteria | 3679 |
| 600 | Ga0210002_1000988 | 3300027617 | Bacteria | 3942 |
| 601 | Ga0209983_1000183 | 3300027665 | Bacteria | 12121 |
| 602 | Ga0209971_1004691 | 3300027682 | Bacteria | 3243 |
| 603 | Ga0209974_10001803 | 3300027876 | Bacteria | 7804 |
| 604 | Ga0207428_10032458 | 3300027907 | Bacteria | 4295 |
| 605 | Ga0207428_10032996 | 3300027907 | Bacteria | 4256 |
| 606 | Ga0207428_10037197 | 3300027907 | Bacteria | 3962 |
| 607 | Ga0207428_10054198 | 3300027907 | Bacteria | 3195 |
| 608 | Ga0268266_10000290 | 3300028379 | Bacteria | 82154 |
| 609 | Ga0268266_10002297 | 3300028379 | Bacteria | 20736 |
| 610 | Ga0268266_10015754 | 3300028379 | Bacteria | 6474 |
| 611 | Ga0268266_10026046 | 3300028379 | Bacteria | 4975 |
| 612 | Ga0268266_10172067 | 3300028379 | Bacteria | 1966 |
| 613 | Ga0268266_10534908 | 3300028379 | Bacteria | 1121 |
| 614 | Ga0268265_10000856 | 3300028380 | Bacteria | 28519 |
| 615 | Ga0307517_10246300 | 3300028786 | Bacteria | 1054 |
| 616 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 617 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 618 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 619 | Ga0268256_1000025 | 3300030500 | Bacteria | 484317 |
| 620 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 621 | Ga0268256_1000095 | 3300030500 | Bacteria | 139698 |
| 622 | Ga0268256_1000147 | 3300030500 | Bacteria | 94888 |
| 623 | Ga0268256_1000150 | 3300030500 | Bacteria | 93793 |
| 624 | Ga0268256_1000426 | 3300030500 | Bacteria | 38063 |
| 625 | Ga0268256_1000462 | 3300030500 | Bacteria | 35405 |
| 626 | Ga0268256_1000488 | 3300030500 | Bacteria | 33948 |
| 627 | Ga0268256_1000560 | 3300030500 | Bacteria | 30194 |
| 628 | Ga0268256_1001337 | 3300030500 | Bacteria | 15090 |
| 629 | Ga0268256_1001950 | 3300030500 | Bacteria | 11283 |
| 630 | Ga0268256_1002082 | 3300030500 | Bacteria | 10767 |
| 631 | Ga0268256_1004727 | 3300030500 | Bacteria | 5547 |
| 632 | Ga0268256_1006244 | 3300030500 | Bacteria | 4472 |
| 633 | Ga0268256_1008572 | 3300030500 | Bacteria | 3483 |
| 634 | Ga0268256_1009489 | 3300030500 | Bacteria | 3225 |
| 635 | Ga0268256_1012535 | 3300030500 | Bacteria | 2617 |
| 636 | Ga0268256_1015669 | 3300030500 | Bacteria | 2202 |
| 637 | Ga0268256_1032480 | 3300030500 | Bacteria | 1243 |
| 638 | Ga0307511_10008822 | 3300030521 | Bacteria | 10065 |
| 639 | Ga0307511_10078177 | 3300030521 | Bacteria | 2349 |
| 640 | Ga0314311_1140123 | 3300030733 | Bacteria | 2926 |
| 641 | Ga0316179_1038930 | 3300030734 | Bacteria | 1605 |
| 642 | Ga0316179_1063794 | 3300030734 | Bacteria | 1491 |
| 643 | Ga0316178_1042939 | 3300030735 | Bacteria | 8567 |
| 644 | Ga0316181_1165376 | 3300030744 | Bacteria | 4521 |
| 645 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 646 | Ga0307408_100027803 | 3300031548 | Bacteria | 3901 |
| 647 | Ga0307408_100042393 | 3300031548 | Bacteria | 3232 |
| 648 | Ga0307408_100066951 | 3300031548 | Bacteria | 2639 |
| 649 | Ga0307408_100074200 | 3300031548 | Bacteria | 2523 |
| 650 | Ga0307408_100090278 | 3300031548 | Bacteria | 2311 |
| 651 | Ga0307408_100171090 | 3300031548 | Bacteria | 1734 |
| 652 | Ga0316575_10088156 | 3300031665 | Bacteria | 1255 |
| 653 | Ga0316579_10000983 | 3300031691 | Bacteria | 9984 |
| 654 | Ga0316576_10010811 | 3300031727 | Bacteria | 5947 |
| 655 | Ga0316576_10176831 | 3300031727 | Bacteria | 1610 |
| 656 | Ga0316576_10212105 | 3300031727 | Bacteria | 1457 |
| 657 | Ga0316578_10010544 | 3300031728 | Bacteria | 4802 |
| 658 | Ga0307405_10020488 | 3300031731 | Bacteria | 3696 |
| 659 | Ga0307405_10027086 | 3300031731 | Bacteria | 3318 |
| 660 | Ga0307405_10028691 | 3300031731 | Bacteria | 3244 |
| 661 | Ga0307405_10039569 | 3300031731 | Bacteria | 2850 |
| 662 | Ga0316577_10038935 | 3300031733 | Bacteria | 2660 |
| 663 | Ga0307413_10028925 | 3300031824 | Bacteria | 3094 |
| 664 | Ga0307413_10056805 | 3300031824 | Bacteria | 2389 |
| 665 | Ga0307406_10000214 | 3300031901 | Bacteria | 34819 |
| 666 | Ga0307406_10026044 | 3300031901 | Bacteria | 3507 |
| 667 | Ga0307406_10029392 | 3300031901 | Bacteria | 3328 |
| 668 | Ga0307406_10031353 | 3300031901 | Bacteria | 3236 |
| 669 | Ga0307407_10040421 | 3300031903 | Bacteria | 2600 |
| 670 | Ga0307412_10017149 | 3300031911 | Bacteria | 4330 |
| 671 | Ga0307412_10019213 | 3300031911 | Bacteria | 4132 |
| 672 | Ga0307412_10026364 | 3300031911 | Bacteria | 3612 |
| 673 | Ga0307412_10293159 | 3300031911 | Bacteria | 1282 |
| 674 | Ga0307412_10304819 | 3300031911 | Bacteria | 1260 |
| 675 | Ga0307409_100063336 | 3300031995 | Bacteria | 2899 |
| 676 | Ga0307409_100077387 | 3300031995 | Bacteria | 2672 |
| 677 | Ga0307416_100142353 | 3300032002 | Bacteria | 2182 |
| 678 | Ga0307414_10025040 | 3300032004 | Bacteria | 3814 |
| 679 | Ga0307414_10060311 | 3300032004 | Bacteria | 2682 |
| 680 | Ga0307414_10086911 | 3300032004 | Bacteria | 2308 |
| 681 | Ga0307414_10237716 | 3300032004 | Bacteria | 1506 |
| 682 | Ga0307414_10311378 | 3300032004 | Bacteria | 1336 |
| 683 | Ga0307414_10396485 | 3300032004 | Bacteria | 1197 |
| 684 | Ga0307411_10038323 | 3300032005 | Bacteria | 3022 |
| 685 | Ga0307411_10041586 | 3300032005 | Bacteria | 2925 |
| 686 | Ga0307411_10752877 | 3300032005 | Bacteria | 853 |
| 687 | Ga0307507_10127385 | 3300033179 | Bacteria | 2007 |
| 688 | Ga0307510_10143213 | 3300033180 | Bacteria | 2029 |
| 689 | Ga0316596_1032043 | 3300033541 | Bacteria | 1367 |
| 690 | Ga0316574_0006631 | 3300035398 | Bacteria | 6276 |
| 691 | Ga0316574_0062433 | 3300035398 | Bacteria | 2341 |
| 692 | Ga0316574_0099514 | 3300035398 | Bacteria | 1860 |
| 693 | Ga0316584_0012843 | 3300036712 | Bacteria | 5914 |
| 694 | Ga0316584_0107626 | 3300036712 | Bacteria | 2086 |
| 695 | Ga0395900_0015391 | 3300037418 | Bacteria | 7796 |
| 696 | Ga0395900_0035199 | 3300037418 | Bacteria | 5158 |
| 697 | Ga0395900_0136373 | 3300037418 | Bacteria | 2514 |
| 698 | Ga0395898_0011048 | 3300037466 | Bacteria | 9406 |
| 699 | Ga0395905_0002252 | 3300037471 | Bacteria | 21683 |
| 700 | Ga0395905_0167700 | 3300037471 | Bacteria | 2063 |
| 701 | Ga0395905_0553874 | 3300037471 | Bacteria | 1051 |
| 702 | Ga0316581_0012087 | 3300037588 | Bacteria | 2426 |
| 703 | Ga0395901_0211183 | 3300038443 | Bacteria | 2031 |
| 704 | Ga0395901_0449816 | 3300038443 | Bacteria | 1317 |
| 705 | Ga0395901_0495079 | 3300038443 | Bacteria | 1245 |
| 706 | Ga0237819_01769 | 3300038705 | Bacteria | 5078 |
| 707 | Ga0400484_03045 | 3300038725 | Bacteria | 1904 |
| 708 | Ga0400484_18184 | 3300038725 | Bacteria | 15406 |
| 709 | Ga0400484_43096 | 3300038725 | Bacteria | 21089 |
| 710 | Ga0400490_06176 | 3300038726 | Bacteria | 115887 |
| 711 | Ga0400490_24299 | 3300038726 | Bacteria | 21749 |
| 712 | Ga0400490_30332 | 3300038726 | Bacteria | 18258 |
| 713 | Ga0400490_35159 | 3300038726 | Bacteria | 9515 |
| 714 | Ga0400490_55807 | 3300038726 | Bacteria | 2599 |
| 715 | Ga0400491_03584 | 3300038727 | Bacteria | 3811 |
| 716 | Ga0400491_06675 | 3300038727 | Bacteria | 1091 |
| 717 | Ga0400491_14843 | 3300038727 | Bacteria | 2713 |
| 718 | Ga0400485_06873 | 3300038735 | Bacteria | 7773 |
| 719 | Ga0400485_08794 | 3300038735 | Bacteria | 1380 |
| 720 | Ga0400485_12958 | 3300038735 | Bacteria | 101712 |
| 721 | Ga0400488_02004 | 3300038741 | Bacteria | 3261 |
| 722 | Ga0400488_02668 | 3300038741 | Bacteria | 3679 |
| 723 | Ga0400488_12929 | 3300038741 | Bacteria | 1850 |
| 724 | Ga0400488_14412 | 3300038741 | Bacteria | 12181 |
| 725 | Ga0400488_31699 | 3300038741 | Bacteria | 3190 |
| 726 | Ga0400488_47344 | 3300038741 | Bacteria | 4732 |
| 727 | Ga0400488_58435 | 3300038741 | Bacteria | 1898 |
| 728 | Ga0400486_06238 | 3300038742 | Bacteria | 7691 |
| 729 | Ga0400486_15577 | 3300038742 | Bacteria | 1222 |
| 730 | Ga0400486_19627 | 3300038742 | Bacteria | 369894 |
| 731 | Ga0400486_20464 | 3300038742 | Bacteria | 11130 |
| 732 | Ga0400483_029125 | 3300039062 | Bacteria | 5399 |
| 733 | Ga0400483_038831 | 3300039062 | Bacteria | 5926 |
| 734 | Ga0400483_039221 | 3300039062 | Bacteria | 4263 |
| 735 | Ga0400483_072968 | 3300039062 | Bacteria | 5489 |
| 736 | Ga0400483_092221 | 3300039062 | Bacteria | 1462 |
| 737 | Ga0400483_103276 | 3300039062 | Bacteria | 1360 |
| 738 | Ga0400483_121602 | 3300039062 | Bacteria | 2799 |
| 739 | Ga0400483_139473 | 3300039062 | Bacteria | 2478 |
| 740 | Ga0400483_163413 | 3300039062 | Bacteria | 4807 |
| 741 | Ga0400483_172670 | 3300039062 | Bacteria | 11189 |
| 742 | Ga0400483_174748 | 3300039062 | Bacteria | 8804 |
| 743 | Ga0400483_175769 | 3300039062 | Bacteria | 4700 |
| 744 | Ga0400483_182091 | 3300039062 | Bacteria | 7364 |
| 745 | Ga0400483_191776 | 3300039062 | Bacteria | 12590 |
| 746 | Ga0400483_208650 | 3300039062 | Bacteria | 13788 |
| 747 | Ga0400483_218302 | 3300039062 | Bacteria | 4691 |
| 748 | Ga0400483_224284 | 3300039062 | Bacteria | 9916 |
| 749 | Ga0400483_240204 | 3300039062 | Bacteria | 6060 |
| 750 | Ga0400483_270058 | 3300039062 | Bacteria | 2317 |
| 751 | Ga0400483_291990 | 3300039062 | Bacteria | 3284 |
| 752 | Ga0400487_13538 | 3300039110 | Bacteria | 7645 |
| 753 | Ga0400487_16746 | 3300039110 | Bacteria | 54203 |
| 754 | Ga0400487_17461 | 3300039110 | Bacteria | 1360 |
| 755 | Ga0400487_23517 | 3300039110 | Bacteria | 7972 |
| 756 | Ga0400487_41541 | 3300039110 | Bacteria | 1727 |
| 757 | Ga0400487_48948 | 3300039110 | Bacteria | 55062 |
| 758 | Ga0436365_0084998 | 3300039437 | Bacteria | 507888 |
| 759 | Ga0436361_0771961 | 3300039447 | Bacteria | 14033 |
| 760 | Ga0439436_0009416 | 3300041404 | Bacteria | 2995 |
| 761 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 762 | Ga0439438_000097 | 3300041405 | Bacteria | 40098 |
| 763 | Ga0439438_000677 | 3300041405 | Bacteria | 15284 |
| 764 | Ga0439438_001150 | 3300041405 | Bacteria | 11763 |
| 765 | Ga0439438_005350 | 3300041405 | Bacteria | 4740 |
| 766 | Ga0439438_006172 | 3300041405 | Bacteria | 4271 |
| 767 | Ga0439438_006967 | 3300041405 | Bacteria | 3919 |
| 768 | Ga0439438_007127 | 3300041405 | Bacteria | 3854 |
| 769 | Ga0439438_008775 | 3300041405 | Bacteria | 3320 |
| 770 | Ga0439438_009618 | 3300041405 | Bacteria | 3118 |
| 771 | Ga0439438_009633 | 3300041405 | Bacteria | 3114 |
| 772 | Ga0439438_011342 | 3300041405 | Bacteria | 2780 |
| 773 | Ga0439438_012081 | 3300041405 | Bacteria | 2660 |
| 774 | Ga0439438_013371 | 3300041405 | Bacteria | 2479 |
| 775 | Ga0439438_029834 | 3300041405 | Bacteria | 1458 |
| 776 | Ga0439438_032844 | 3300041405 | Bacteria | 1373 |
| 777 | Ga0439438_050172 | 3300041405 | Bacteria | 1063 |
| 778 | Ga0439447_001380 | 3300041407 | Bacteria | 8889 |
| 779 | Ga0439447_001672 | 3300041407 | Bacteria | 8139 |
| 780 | Ga0439447_002380 | 3300041407 | Bacteria | 6875 |
| 781 | Ga0439447_002568 | 3300041407 | Bacteria | 6599 |
| 782 | Ga0439447_004684 | 3300041407 | Bacteria | 4663 |
| 783 | Ga0439447_008388 | 3300041407 | Bacteria | 3200 |
| 784 | Ga0439447_011298 | 3300041407 | Bacteria | 2613 |
| 785 | Ga0439447_012199 | 3300041407 | Bacteria | 2478 |
| 786 | Ga0439447_015559 | 3300041407 | Bacteria | 2108 |
| 787 | Ga0439447_033975 | 3300041407 | Bacteria | 1269 |
| 788 | Ga0439466_0000002 | 3300041411 | Bacteria | 494198 |
| 789 | Ga0439466_0000951 | 3300041411 | Bacteria | 11100 |
| 790 | Ga0439466_0002728 | 3300041411 | Bacteria | 6918 |
| 791 | Ga0439466_0005077 | 3300041411 | Bacteria | 5046 |
| 792 | Ga0439466_0005111 | 3300041411 | Bacteria | 5029 |
| 793 | Ga0439466_0014410 | 3300041411 | Bacteria | 2878 |
| 794 | Ga0439466_0017754 | 3300041411 | Bacteria | 2559 |
| 795 | Ga0439466_0021743 | 3300041411 | Bacteria | 2270 |
| 796 | Ga0439466_0026273 | 3300041411 | Bacteria | 2026 |
| 797 | Ga0439466_0042873 | 3300041411 | Bacteria | 1504 |
| 798 | Ga0439465_0006148 | 3300041413 | Bacteria | 3818 |
| 799 | Ga0439431_0003841 | 3300041997 | Bacteria | 3318 |
| 800 | Ga0439437_000031 | 3300042000 | Bacteria | 9938 |
| 801 | Ga0439445_0008797 | 3300042004 | Bacteria | 2369 |
| 802 | Ga0439432_001288 | 3300042006 | Bacteria | 9479 |
| 803 | Ga0439432_001332 | 3300042006 | Bacteria | 9354 |
| 804 | Ga0439432_002603 | 3300042006 | Bacteria | 6789 |
| 805 | Ga0439432_002793 | 3300042006 | Bacteria | 6509 |
| 806 | Ga0439432_004623 | 3300042006 | Bacteria | 5013 |
| 807 | Ga0439432_009265 | 3300042006 | Bacteria | 3437 |
| 808 | Ga0439432_010370 | 3300042006 | Bacteria | 3229 |
| 809 | Ga0439432_010526 | 3300042006 | Bacteria | 3199 |
| 810 | Ga0439432_027767 | 3300042006 | Bacteria | 1846 |
| 811 | Ga0439432_041597 | 3300042006 | Bacteria | 1455 |
| 812 | Ga0439451_000363 | 3300042009 | Bacteria | 8796 |
| 813 | Ga0439451_005039 | 3300042009 | Bacteria | 2688 |
| 814 | Ga0439451_005353 | 3300042009 | Bacteria | 2614 |
| 815 | Ga0439451_015922 | 3300042009 | Bacteria | 1516 |
| 816 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 817 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 818 | Ga0439452_000007 | 3300042010 | Bacteria | 613625 |
| 819 | Ga0439452_000056 | 3300042010 | Bacteria | 106151 |
| 820 | Ga0439452_002488 | 3300042010 | Bacteria | 6775 |
| 821 | Ga0439452_002677 | 3300042010 | Bacteria | 6459 |
| 822 | Ga0439452_002683 | 3300042010 | Bacteria | 6453 |
| 823 | Ga0439452_002723 | 3300042010 | Bacteria | 6408 |
| 824 | Ga0439452_003807 | 3300042010 | Bacteria | 5180 |
| 825 | Ga0439452_004121 | 3300042010 | Bacteria | 4938 |
| 826 | Ga0439452_007617 | 3300042010 | Bacteria | 3309 |
| 827 | Ga0439452_008798 | 3300042010 | Bacteria | 3013 |
| 828 | Ga0439452_015737 | 3300042010 | Bacteria | 2067 |
| 829 | Ga0439452_026896 | 3300042010 | Bacteria | 1448 |
| 830 | Ga0439455_0007982 | 3300042012 | Bacteria | 2257 |
| 831 | Ga0439456_000105 | 3300042013 | Bacteria | 28100 |
| 832 | Ga0439456_002230 | 3300042013 | Bacteria | 3901 |
| 833 | Ga0439456_002948 | 3300042013 | Bacteria | 3441 |
| 834 | Ga0439456_005096 | 3300042013 | Bacteria | 2669 |
| 835 | Ga0439456_007659 | 3300042013 | Bacteria | 2220 |
| 836 | Ga0439456_010631 | 3300042013 | Bacteria | 1902 |
| 837 | Ga0439463_000932 | 3300042016 | Bacteria | 8025 |
| 838 | Ga0439463_000938 | 3300042016 | Bacteria | 8002 |
| 839 | Ga0439463_002058 | 3300042016 | Bacteria | 5217 |
| 840 | Ga0439463_002320 | 3300042016 | Bacteria | 4854 |
| 841 | Ga0439463_026577 | 3300042016 | Bacteria | 1454 |
| 842 | Ga0450911_000026 | 3300042115 | Bacteria | 82955 |
| 843 | Ga0450911_001732 | 3300042115 | Bacteria | 4738 |
| 844 | Ga0450911_001842 | 3300042115 | Bacteria | 4518 |
| 845 | Ga0450920_003985 | 3300042122 | Bacteria | 2580 |
| 846 | Ga0450890_001116 | 3300042127 | Bacteria | 3889 |
| 847 | Ga0450891_002000 | 3300042129 | Bacteria | 2090 |
| 848 | Ga0450903_006951 | 3300042138 | Bacteria | 1872 |
| 849 | Ga0450904_000063 | 3300042139 | Bacteria | 23972 |
| 850 | Ga0450906_000870 | 3300042145 | Bacteria | 6645 |
| 851 | Ga0450907_000028 | 3300042146 | Bacteria | 69314 |
| 852 | Ga0450907_000284 | 3300042146 | Bacteria | 17144 |
| 853 | Ga0450907_001825 | 3300042146 | Bacteria | 4378 |
| 854 | Ga0450907_002410 | 3300042146 | Bacteria | 3573 |
| 855 | Ga0450910_000492 | 3300042147 | Bacteria | 4678 |
| 856 | Ga0450910_001473 | 3300042147 | Bacteria | 2972 |
| 857 | Ga0450910_004193 | 3300042147 | Bacteria | 1940 |
| 858 | Ga0439446_0003445 | 3300042156 | Bacteria | 3929 |
| 859 | Ga0439446_0004054 | 3300042156 | Bacteria | 3688 |
| 860 | Ga0439446_0005083 | 3300042156 | Bacteria | 3367 |
| 861 | Ga0450909_000178 | 3300042185 | Bacteria | 7099 |
| 862 | Ga0450909_002015 | 3300042185 | Bacteria | 2865 |
| 863 | Ga0439434_0004912 | 3300042435 | Bacteria | 3910 |
| 864 | Ga0439434_0006342 | 3300042435 | Bacteria | 3449 |
| 865 | Ga0439464_0002752 | 3300042439 | Bacteria | 4362 |
| 866 | Ga0439464_0003192 | 3300042439 | Bacteria | 4113 |
| 867 | Ga0439464_0005073 | 3300042439 | Bacteria | 3387 |
| 868 | Ga0439460_0001080 | 3300042461 | Bacteria | 6345 |
| 869 | Ga0439460_0001312 | 3300042461 | Bacteria | 5841 |
| 870 | Ga0439460_0002077 | 3300042461 | Bacteria | 4793 |
| 871 | Ga0450893_0001886 | 3300042532 | Bacteria | 3247 |
| 872 | Ga0450901_001007 | 3300042533 | Bacteria | 3268 |
| 873 | Ga0451577_0075485 | 3300042876 | Bacteria | 3006 |
| 874 | Ga0451577_0089912 | 3300042876 | Unclassified | 2740 |
| 875 | Ga0439440_0010617 | 3300042993 | Bacteria | 1928 |
| 876 | Ga0466969_0035488 | 3300044656 | Bacteria | 2522 |
| 877 | Ga0466972_0000005 | 3300044658 | Bacteria | 289640 |
| 878 | Ga0466981_0000014 | 3300044669 | Bacteria | 109658 |
| 879 | Ga0466978_0118475 | 3300044671 | Bacteria | 1636 |
| 880 | Ga0453683_0001671 | 3300044673 | Bacteria | 18538 |
| 881 | Ga0466965_0005749 | 3300044683 | Bacteria | 5597 |
| 882 | Ga0466965_0020226 | 3300044683 | Bacteria | 3198 |
| 883 | Ga0466961_0000442 | 3300044693 | Bacteria | 26460 |
| 884 | Ga0466964_0040296 | 3300044706 | Bacteria | 1885 |
| 885 | Ga0466964_0120551 | 3300044706 | Bacteria | 1182 |
| 886 | Ga0453684_0000170 | 3300044712 | Bacteria | 289718 |
| 887 | Ga0453684_0002648 | 3300044712 | Bacteria | 42740 |
| 888 | Ga0453684_0062534 | 3300044712 | Bacteria | 4767 |
| 889 | Ga0453684_0307997 | 3300044712 | Bacteria | 1798 |
| 890 | Ga0453684_0533060 | 3300044712 | Unclassified | 1295 |
| 891 | Ga0466971_0031454 | 3300044719 | Bacteria | 2376 |
| 892 | Ga0466968_0011936 | 3300044735 | Bacteria | 3392 |
| 893 | Ga0466968_0018253 | 3300044735 | Bacteria | 2812 |
| 894 | Ga0466970_0008396 | 3300044765 | Bacteria | 5196 |
| 895 | Ga0466957_0055193 | 3300044842 | Bacteria | 2427 |
| 896 | Ga0466959_0001576 | 3300045049 | Bacteria | 14057 |
| 897 | Ga0451576_0001328 | 3300045051 | Bacteria | 42740 |
| 898 | Ga0451576_0028821 | 3300045051 | Bacteria | 5945 |
| 899 | Ga0495617_002477 | 3300046452 | Bacteria | 7332 |
| 900 | Ga0495617_007141 | 3300046452 | Bacteria | 3892 |
| 901 | Ga0495617_007249 | 3300046452 | Bacteria | 3855 |
| 902 | Ga0495617_012971 | 3300046452 | Bacteria | 2841 |
| 903 | Ga0495617_013277 | 3300046452 | Bacteria | 2802 |
| 904 | Ga0495617_020749 | 3300046452 | Bacteria | 2220 |
| 905 | Ga0495617_057296 | 3300046452 | Bacteria | 1291 |
| 906 | Ga0495627_000047 | 3300046453 | Bacteria | 170068 |
| 907 | Ga0495627_001081 | 3300046453 | Bacteria | 17930 |
| 908 | Ga0495627_001216 | 3300046453 | Bacteria | 16129 |
| 909 | Ga0495627_020817 | 3300046453 | Bacteria | 2181 |
| 910 | Ga0495627_024153 | 3300046453 | Bacteria | 1984 |
| 911 | Ga0495603_0022354 | 3300046455 | Bacteria | 3830 |
| 912 | Ga0495603_0031673 | 3300046455 | Bacteria | 3183 |
| 913 | Ga0495603_0066303 | 3300046455 | Bacteria | 2126 |
| 914 | Ga0495590_0003315 | 3300046457 | Bacteria | 6592 |
| 915 | Ga0495590_0008408 | 3300046457 | Bacteria | 3940 |
| 916 | Ga0495590_0009203 | 3300046457 | Bacteria | 3748 |
| 917 | Ga0495590_0016441 | 3300046457 | Bacteria | 2671 |
| 918 | Ga0495591_000019 | 3300046458 | Bacteria | 223010 |
| 919 | Ga0495591_000024 | 3300046458 | Bacteria | 191134 |
| 920 | Ga0495591_000231 | 3300046458 | Bacteria | 54648 |
| 921 | Ga0495591_004731 | 3300046458 | Bacteria | 6528 |
| 922 | Ga0495591_005800 | 3300046458 | Bacteria | 5615 |
| 923 | Ga0495591_005961 | 3300046458 | Bacteria | 5506 |
| 924 | Ga0495591_006653 | 3300046458 | Bacteria | 5057 |
| 925 | Ga0495591_007443 | 3300046458 | Bacteria | 4652 |
| 926 | Ga0495591_007578 | 3300046458 | Bacteria | 4589 |
| 927 | Ga0495591_009139 | 3300046458 | Bacteria | 3966 |
| 928 | Ga0495591_010946 | 3300046458 | Bacteria | 3467 |
| 929 | Ga0495591_012377 | 3300046458 | Bacteria | 3180 |
| 930 | Ga0495591_024154 | 3300046458 | Bacteria | 1931 |
| 931 | Ga0495591_026472 | 3300046458 | Bacteria | 1801 |
| 932 | Ga0495591_043510 | 3300046458 | Bacteria | 1263 |
| 933 | Ga0495629_0091979 | 3300046459 | Bacteria | 2117 |
| 934 | Ga0495638_0010848 | 3300046460 | Bacteria | 6299 |
| 935 | Ga0495638_0023016 | 3300046460 | Bacteria | 4081 |
| 936 | Ga0495638_0035758 | 3300046460 | Bacteria | 3165 |
| 937 | Ga0495638_0055085 | 3300046460 | Bacteria | 2470 |
| 938 | Ga0495638_0055863 | 3300046460 | Bacteria | 2450 |
| 939 | Ga0495638_0073052 | 3300046460 | Bacteria | 2094 |
| 940 | Ga0495653_0015371 | 3300046463 | Bacteria | 6237 |
| 941 | Ga0495653_0018175 | 3300046463 | Bacteria | 5714 |
| 942 | Ga0495653_0039513 | 3300046463 | Bacteria | 3695 |
| 943 | Ga0495653_0060932 | 3300046463 | Bacteria | 2856 |
| 944 | Ga0495653_0135183 | 3300046463 | Bacteria | 1740 |
| 945 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 946 | Ga0495650_0000028 | 3300046471 | Bacteria | 473012 |
| 947 | Ga0495650_0000113 | 3300046471 | Bacteria | 196536 |
| 948 | Ga0495650_0001459 | 3300046471 | Bacteria | 22664 |
| 949 | Ga0495650_0009508 | 3300046471 | Bacteria | 5521 |
| 950 | Ga0495650_0010945 | 3300046471 | Bacteria | 5018 |
| 951 | Ga0495650_0016294 | 3300046471 | Bacteria | 3771 |
| 952 | Ga0495650_0019158 | 3300046471 | Bacteria | 3379 |
| 953 | Ga0495650_0020216 | 3300046471 | Bacteria | 3252 |
| 954 | Ga0495650_0021072 | 3300046471 | Bacteria | 3159 |
| 955 | Ga0495650_0035995 | 3300046471 | Bacteria | 2172 |
| 956 | Ga0495582_0167203 | 3300046473 | Bacteria | 1251 |
| 957 | Ga0495605_0000014 | 3300046474 | Bacteria | 305393 |
| 958 | Ga0495605_0000030 | 3300046474 | Bacteria | 213339 |
| 959 | Ga0495605_0000428 | 3300046474 | Bacteria | 38189 |
| 960 | Ga0495605_0001206 | 3300046474 | Bacteria | 17233 |
| 961 | Ga0495605_0006255 | 3300046474 | Bacteria | 6864 |
| 962 | Ga0495605_0008025 | 3300046474 | Bacteria | 5976 |
| 963 | Ga0495605_0014197 | 3300046474 | Bacteria | 4369 |
| 964 | Ga0495605_0018016 | 3300046474 | Bacteria | 3793 |
| 965 | Ga0495605_0026653 | 3300046474 | Bacteria | 3002 |
| 966 | Ga0495605_0042545 | 3300046474 | Bacteria | 2257 |
| 967 | Ga0495639_0000008 | 3300046475 | Bacteria | 97096 |
| 968 | Ga0495584_0003148 | 3300046491 | Bacteria | 9165 |
| 969 | Ga0495584_0003554 | 3300046491 | Bacteria | 8524 |
| 970 | Ga0495584_0008594 | 3300046491 | Bacteria | 5287 |
| 971 | Ga0495584_0008987 | 3300046491 | Bacteria | 5163 |
| 972 | Ga0495584_0010197 | 3300046491 | Bacteria | 4825 |
| 973 | Ga0495584_0014052 | 3300046491 | Bacteria | 4078 |
| 974 | Ga0495584_0014635 | 3300046491 | Bacteria | 3996 |
| 975 | Ga0495584_0015636 | 3300046491 | Bacteria | 3869 |
| 976 | Ga0495584_0018695 | 3300046491 | Bacteria | 3522 |
| 977 | Ga0495584_0044781 | 3300046491 | Bacteria | 2233 |
| 978 | Ga0495585_0004589 | 3300046492 | Bacteria | 8929 |
| 979 | Ga0495585_0010242 | 3300046492 | Bacteria | 5594 |
| 980 | Ga0495585_0020067 | 3300046492 | Bacteria | 3845 |
| 981 | Ga0495585_0024108 | 3300046492 | Bacteria | 3490 |
| 982 | Ga0495585_0037415 | 3300046492 | Bacteria | 2733 |
| 983 | Ga0495585_0046683 | 3300046492 | Bacteria | 2414 |
| 984 | Ga0495585_0176323 | 3300046492 | Bacteria | 1101 |
| 985 | Ga0495594_0011541 | 3300046499 | Bacteria | 4593 |
| 986 | Ga0495594_0014320 | 3300046499 | Bacteria | 4152 |
| 987 | Ga0495594_0017537 | 3300046499 | Bacteria | 3783 |
| 988 | Ga0495594_0029716 | 3300046499 | Bacteria | 2955 |
| 989 | Ga0495596_0004915 | 3300046500 | Bacteria | 6410 |
| 990 | Ga0495596_0035791 | 3300046500 | Bacteria | 1968 |
| 991 | Ga0495596_0051610 | 3300046500 | Bacteria | 1610 |
| 992 | Ga0495607_0000393 | 3300046501 | Bacteria | 44415 |
| 993 | Ga0495607_0001642 | 3300046501 | Bacteria | 19379 |
| 994 | Ga0495607_0003347 | 3300046501 | Bacteria | 12299 |
| 995 | Ga0495607_0006500 | 3300046501 | Bacteria | 8219 |
| 996 | Ga0495607_0007957 | 3300046501 | Bacteria | 7286 |
| 997 | Ga0495607_0012825 | 3300046501 | Bacteria | 5512 |
| 998 | Ga0495607_0016867 | 3300046501 | Bacteria | 4702 |
| 999 | Ga0495607_0020527 | 3300046501 | Bacteria | 4175 |
| 1000 | Ga0495607_0022280 | 3300046501 | Bacteria | 3980 |
| 1001 | Ga0495607_0025043 | 3300046501 | Bacteria | 3715 |
| 1002 | Ga0495607_0025376 | 3300046501 | Bacteria | 3686 |
| 1003 | Ga0495607_0026664 | 3300046501 | Bacteria | 3583 |
| 1004 | Ga0495607_0027044 | 3300046501 | Bacteria | 3552 |
| 1005 | Ga0495607_0027692 | 3300046501 | Bacteria | 3501 |
| 1006 | Ga0495607_0028841 | 3300046501 | Bacteria | 3418 |
| 1007 | Ga0495607_0033116 | 3300046501 | Bacteria | 3146 |
| 1008 | Ga0495607_0074018 | 3300046501 | Bacteria | 1892 |
| 1009 | Ga0495607_0090640 | 3300046501 | Bacteria | 1657 |
| 1010 | Ga0495583_0000066 | 3300046506 | Bacteria | 191372 |
| 1011 | Ga0495583_0004575 | 3300046506 | Bacteria | 9815 |
| 1012 | Ga0495583_0005994 | 3300046506 | Bacteria | 8064 |
| 1013 | Ga0495583_0008167 | 3300046506 | Bacteria | 6437 |
| 1014 | Ga0495583_0008202 | 3300046506 | Bacteria | 6418 |
| 1015 | Ga0495583_0009899 | 3300046506 | Bacteria | 5638 |
| 1016 | Ga0495583_0011506 | 3300046506 | Bacteria | 5074 |
| 1017 | Ga0495583_0015601 | 3300046506 | Bacteria | 4124 |
| 1018 | Ga0495583_0047542 | 3300046506 | Bacteria | 1972 |
| 1019 | Ga0495606_0000086 | 3300046507 | Bacteria | 156764 |
| 1020 | Ga0495606_0000700 | 3300046507 | Bacteria | 51952 |
| 1021 | Ga0495606_0001088 | 3300046507 | Bacteria | 38905 |
| 1022 | Ga0495606_0001652 | 3300046507 | Bacteria | 28995 |
| 1023 | Ga0495606_0003844 | 3300046507 | Bacteria | 15513 |
| 1024 | Ga0495606_0016871 | 3300046507 | Bacteria | 5546 |
| 1025 | Ga0495606_0019061 | 3300046507 | Bacteria | 5121 |
| 1026 | Ga0495606_0022787 | 3300046507 | Bacteria | 4551 |
| 1027 | Ga0495606_0025333 | 3300046507 | Bacteria | 4250 |
| 1028 | Ga0495606_0036093 | 3300046507 | Bacteria | 3371 |
| 1029 | Ga0495606_0050762 | 3300046507 | Bacteria | 2711 |
| 1030 | Ga0495606_0069986 | 3300046507 | Bacteria | 2215 |
| 1031 | Ga0495610_0015784 | 3300046512 | Bacteria | 4374 |
| 1032 | Ga0495610_0021191 | 3300046512 | Bacteria | 3579 |
| 1033 | Ga0495610_0023763 | 3300046512 | Bacteria | 3323 |
| 1034 | Ga0495610_0030726 | 3300046512 | Bacteria | 2810 |
| 1035 | Ga0495610_0036302 | 3300046512 | Bacteria | 2520 |
| 1036 | Ga0495610_0038403 | 3300046512 | Bacteria | 2430 |
| 1037 | Ga0495610_0046677 | 3300046512 | Bacteria | 2135 |
| 1038 | Ga0495610_0047555 | 3300046512 | Bacteria | 2110 |
| 1039 | Ga0495610_0061880 | 3300046512 | Bacteria | 1776 |
| 1040 | Ga0495616_0003753 | 3300046513 | Bacteria | 9693 |
| 1041 | Ga0495616_0013978 | 3300046513 | Bacteria | 4510 |
| 1042 | Ga0495616_0023885 | 3300046513 | Bacteria | 3285 |
| 1043 | Ga0495616_0034029 | 3300046513 | Bacteria | 2649 |
| 1044 | Ga0495616_0043719 | 3300046513 | Bacteria | 2275 |
| 1045 | Ga0495616_0085571 | 3300046513 | Bacteria | 1501 |
| 1046 | Ga0495620_0000100 | 3300046515 | Bacteria | 68610 |
| 1047 | Ga0495620_0000449 | 3300046515 | Bacteria | 27347 |
| 1048 | Ga0495620_0001603 | 3300046515 | Bacteria | 13396 |
| 1049 | Ga0495620_0006262 | 3300046515 | Bacteria | 6552 |
| 1050 | Ga0495620_0011773 | 3300046515 | Bacteria | 4549 |
| 1051 | Ga0495620_0016482 | 3300046515 | Bacteria | 3705 |
| 1052 | Ga0495620_0027691 | 3300046515 | Bacteria | 2648 |
| 1053 | Ga0495628_0308869 | 3300046516 | Bacteria | 1169 |
| 1054 | Ga0495630_0030101 | 3300046517 | Bacteria | 4037 |
| 1055 | Ga0495630_0063572 | 3300046517 | Bacteria | 2772 |
| 1056 | Ga0495631_0005021 | 3300046518 | Bacteria | 6967 |
| 1057 | Ga0495631_0005558 | 3300046518 | Bacteria | 6591 |
| 1058 | Ga0495631_0008676 | 3300046518 | Bacteria | 5115 |
| 1059 | Ga0495631_0011046 | 3300046518 | Bacteria | 4456 |
| 1060 | Ga0495631_0014723 | 3300046518 | Bacteria | 3768 |
| 1061 | Ga0495631_0014874 | 3300046518 | Bacteria | 3745 |
| 1062 | Ga0495631_0075669 | 3300046518 | Bacteria | 1453 |
| 1063 | Ga0495632_0002049 | 3300046519 | Bacteria | 15838 |
| 1064 | Ga0495632_0003065 | 3300046519 | Bacteria | 12154 |
| 1065 | Ga0495632_0003582 | 3300046519 | Bacteria | 10937 |
| 1066 | Ga0495632_0006252 | 3300046519 | Bacteria | 7694 |
| 1067 | Ga0495632_0010938 | 3300046519 | Bacteria | 5324 |
| 1068 | Ga0495632_0016322 | 3300046519 | Bacteria | 4133 |
| 1069 | Ga0495632_0017983 | 3300046519 | Bacteria | 3887 |
| 1070 | Ga0495632_0018548 | 3300046519 | Bacteria | 3816 |
| 1071 | Ga0495632_0020137 | 3300046519 | Bacteria | 3619 |
| 1072 | Ga0495632_0037514 | 3300046519 | Bacteria | 2458 |
| 1073 | Ga0495632_0042437 | 3300046519 | Bacteria | 2279 |
| 1074 | Ga0495632_0043242 | 3300046519 | Bacteria | 2252 |
| 1075 | Ga0495637_0000024 | 3300046520 | Bacteria | 169477 |
| 1076 | Ga0495637_0000032 | 3300046520 | Bacteria | 128687 |
| 1077 | Ga0495637_0005465 | 3300046520 | Bacteria | 6467 |
| 1078 | Ga0495637_0005782 | 3300046520 | Bacteria | 6264 |
| 1079 | Ga0495637_0012264 | 3300046520 | Bacteria | 4102 |
| 1080 | Ga0495637_0013268 | 3300046520 | Bacteria | 3915 |
| 1081 | Ga0495637_0013643 | 3300046520 | Bacteria | 3852 |
| 1082 | Ga0495637_0020555 | 3300046520 | Bacteria | 3037 |
| 1083 | Ga0495637_0022688 | 3300046520 | Bacteria | 2860 |
| 1084 | Ga0495637_0025497 | 3300046520 | Bacteria | 2663 |
| 1085 | Ga0495637_0032560 | 3300046520 | Bacteria | 2295 |
| 1086 | Ga0495637_0096235 | 3300046520 | Bacteria | 1161 |
| 1087 | Ga0495637_0109690 | 3300046520 | Bacteria | 1070 |
| 1088 | Ga0495643_0000197 | 3300046522 | Bacteria | 95489 |
| 1089 | Ga0495643_0000445 | 3300046522 | Bacteria | 53349 |
| 1090 | Ga0495643_0004884 | 3300046522 | Bacteria | 9228 |
| 1091 | Ga0495643_0012491 | 3300046522 | Bacteria | 5122 |
| 1092 | Ga0495643_0012495 | 3300046522 | Bacteria | 5122 |
| 1093 | Ga0495643_0024529 | 3300046522 | Bacteria | 3419 |
| 1094 | Ga0495643_0025790 | 3300046522 | Bacteria | 3323 |
| 1095 | Ga0495643_0057677 | 3300046522 | Bacteria | 2068 |
| 1096 | Ga0495643_0130760 | 3300046522 | Bacteria | 1260 |
| 1097 | Ga0495644_0001108 | 3300046523 | Bacteria | 11078 |
| 1098 | Ga0495644_0004868 | 3300046523 | Bacteria | 5272 |
| 1099 | Ga0495644_0005738 | 3300046523 | Bacteria | 4847 |
| 1100 | Ga0495644_0009351 | 3300046523 | Bacteria | 3780 |
| 1101 | Ga0495644_0049368 | 3300046523 | Bacteria | 1579 |
| 1102 | Ga0495648_0001813 | 3300046524 | Bacteria | 20584 |
| 1103 | Ga0495648_0007647 | 3300046524 | Bacteria | 8620 |
| 1104 | Ga0495648_0008024 | 3300046524 | Bacteria | 8364 |
| 1105 | Ga0495648_0014036 | 3300046524 | Bacteria | 5889 |
| 1106 | Ga0495648_0015997 | 3300046524 | Bacteria | 5419 |
| 1107 | Ga0495648_0022576 | 3300046524 | Bacteria | 4327 |
| 1108 | Ga0495648_0024600 | 3300046524 | Bacteria | 4095 |
| 1109 | Ga0495648_0025640 | 3300046524 | Bacteria | 3987 |
| 1110 | Ga0495648_0037592 | 3300046524 | Bacteria | 3108 |
| 1111 | Ga0495648_0039375 | 3300046524 | Bacteria | 3008 |
| 1112 | Ga0495666_0108989 | 3300046526 | Bacteria | 1301 |
| 1113 | Ga0495642_0003594 | 3300046528 | Bacteria | 6096 |
| 1114 | Ga0495642_0005515 | 3300046528 | Bacteria | 4861 |
| 1115 | Ga0495642_0005720 | 3300046528 | Bacteria | 4771 |
| 1116 | Ga0495654_0000031 | 3300046530 | Bacteria | 206800 |
| 1117 | Ga0495654_0000390 | 3300046530 | Bacteria | 37861 |
| 1118 | Ga0495654_0000899 | 3300046530 | Bacteria | 22208 |
| 1119 | Ga0495654_0002770 | 3300046530 | Bacteria | 11044 |
| 1120 | Ga0495654_0006997 | 3300046530 | Bacteria | 6353 |
| 1121 | Ga0495654_0007472 | 3300046530 | Bacteria | 6101 |
| 1122 | Ga0495654_0007591 | 3300046530 | Bacteria | 6042 |
| 1123 | Ga0495654_0012197 | 3300046530 | Bacteria | 4623 |
| 1124 | Ga0495654_0014123 | 3300046530 | Bacteria | 4257 |
| 1125 | Ga0495654_0014427 | 3300046530 | Bacteria | 4205 |
| 1126 | Ga0495654_0023508 | 3300046530 | Bacteria | 3191 |
| 1127 | Ga0495654_0026526 | 3300046530 | Bacteria | 2977 |
| 1128 | Ga0495654_0029941 | 3300046530 | Bacteria | 2773 |
| 1129 | Ga0495654_0033929 | 3300046530 | Bacteria | 2579 |
| 1130 | Ga0495654_0054890 | 3300046530 | Bacteria | 1930 |
| 1131 | Ga0495654_0091854 | 3300046530 | Bacteria | 1407 |
| 1132 | Ga0495587_0017404 | 3300046536 | Bacteria | 4466 |
| 1133 | Ga0495587_0021122 | 3300046536 | Bacteria | 4014 |
| 1134 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 1135 | Ga0495609_0000024 | 3300046538 | Bacteria | 264100 |
| 1136 | Ga0495609_0000040 | 3300046538 | Bacteria | 177058 |
| 1137 | Ga0495609_0000561 | 3300046538 | Bacteria | 29295 |
| 1138 | Ga0495609_0013914 | 3300046538 | Bacteria | 3793 |
| 1139 | Ga0495609_0013918 | 3300046538 | Bacteria | 3792 |
| 1140 | Ga0495597_0000010 | 3300046542 | Bacteria | 222418 |
| 1141 | Ga0495597_0000548 | 3300046542 | Bacteria | 31172 |
| 1142 | Ga0495597_0009030 | 3300046542 | Bacteria | 4955 |
| 1143 | Ga0495597_0009702 | 3300046542 | Bacteria | 4743 |
| 1144 | Ga0495597_0010364 | 3300046542 | Bacteria | 4558 |
| 1145 | Ga0495597_0016687 | 3300046542 | Bacteria | 3466 |
| 1146 | Ga0495597_0023906 | 3300046542 | Bacteria | 2824 |
| 1147 | Ga0495597_0026982 | 3300046542 | Bacteria | 2636 |
| 1148 | Ga0495597_0038815 | 3300046542 | Bacteria | 2133 |
| 1149 | Ga0495597_0076385 | 3300046542 | Bacteria | 1436 |
| 1150 | Ga0495597_0168391 | 3300046542 | Bacteria | 890 |
| 1151 | Ga0495622_0000476 | 3300046557 | Bacteria | 25351 |
| 1152 | Ga0495622_0001930 | 3300046557 | Bacteria | 10188 |
| 1153 | Ga0495622_0006629 | 3300046557 | Bacteria | 5366 |
| 1154 | Ga0495622_0039357 | 3300046557 | Bacteria | 2202 |
| 1155 | Ga0495622_0049270 | 3300046557 | Bacteria | 1955 |
| 1156 | Ga0495633_0000030 | 3300046558 | Bacteria | 197184 |
| 1157 | Ga0495633_0009591 | 3300046558 | Bacteria | 5335 |
| 1158 | Ga0495656_0088906 | 3300046615 | Bacteria | 1409 |
| 1159 | Ga0495656_0194236 | 3300046615 | Bacteria | 1004 |
| 1160 | Ga0495668_0010172 | 3300046616 | Bacteria | 5717 |
| 1161 | Ga0495668_0051324 | 3300046616 | Bacteria | 2283 |
| 1162 | Ga0495668_0120743 | 3300046616 | Bacteria | 1433 |
| 1163 | Ga0495634_0019095 | 3300046642 | Bacteria | 4872 |
| 1164 | Ga0495634_0045091 | 3300046642 | Bacteria | 2982 |
| 1165 | Ga0495611_0001322 | 3300046648 | Bacteria | 12589 |
| 1166 | Ga0495611_0008737 | 3300046648 | Bacteria | 4284 |
| 1167 | Ga0495611_0010746 | 3300046648 | Bacteria | 3877 |
| 1168 | Ga0495611_0015918 | 3300046648 | Bacteria | 3213 |
| 1169 | Ga0495625_0000111 | 3300046660 | Bacteria | 124977 |
| 1170 | Ga0495625_0004340 | 3300046660 | Bacteria | 13464 |
| 1171 | Ga0495625_0020146 | 3300046660 | Bacteria | 5154 |
| 1172 | Ga0495625_0020640 | 3300046660 | Bacteria | 5081 |
| 1173 | Ga0495625_0026345 | 3300046660 | Bacteria | 4394 |
| 1174 | Ga0495625_0031713 | 3300046660 | Bacteria | 3928 |
| 1175 | Ga0495625_0063707 | 3300046660 | Bacteria | 2603 |
| 1176 | Ga0495635_0020994 | 3300046663 | Bacteria | 4551 |
| 1177 | Ga0495635_0029644 | 3300046663 | Bacteria | 3805 |
| 1178 | Ga0495659_0000747 | 3300046664 | Bacteria | 11681 |
| 1179 | Ga0495661_0000015 | 3300046665 | Bacteria | 223740 |
| 1180 | Ga0495661_0000019 | 3300046665 | Bacteria | 200606 |
| 1181 | Ga0495661_0000034 | 3300046665 | Bacteria | 165606 |
| 1182 | Ga0495661_0000054 | 3300046665 | Bacteria | 138979 |
| 1183 | Ga0495661_0020788 | 3300046665 | Bacteria | 4280 |
| 1184 | Ga0495661_0040994 | 3300046665 | Bacteria | 2868 |
| 1185 | Ga0495661_0074386 | 3300046665 | Bacteria | 1977 |
| 1186 | Ga0495588_0041465 | 3300046674 | Bacteria | 2350 |
| 1187 | Ga0495588_0060090 | 3300046674 | Bacteria | 1967 |
| 1188 | Ga0495588_0153018 | 3300046674 | Bacteria | 1219 |
| 1189 | Ga0495623_0007405 | 3300046679 | Bacteria | 7126 |
| 1190 | Ga0495623_0093365 | 3300046679 | Bacteria | 1842 |
| 1191 | Ga0495646_0020274 | 3300046680 | Bacteria | 4206 |
| 1192 | Ga0495646_0071474 | 3300046680 | Bacteria | 2041 |
| 1193 | Ga0495669_0003585 | 3300046684 | Bacteria | 6402 |
| 1194 | Ga0495613_0076626 | 3300046689 | Bacteria | 2433 |
| 1195 | Ga0495624_0015757 | 3300046690 | Bacteria | 5096 |
| 1196 | Ga0495670_0012341 | 3300046691 | Bacteria | 4200 |
| 1197 | Ga0495670_0017151 | 3300046691 | Bacteria | 3562 |
| 1198 | Ga0495670_0024596 | 3300046691 | Bacteria | 2977 |
| 1199 | Ga0495671_0000904 | 3300046692 | Bacteria | 21110 |
| 1200 | Ga0495671_0001174 | 3300046692 | Bacteria | 17935 |
| 1201 | Ga0495671_0001418 | 3300046692 | Bacteria | 16112 |
| 1202 | Ga0495671_0008522 | 3300046692 | Bacteria | 5763 |
| 1203 | Ga0495671_0010463 | 3300046692 | Bacteria | 5137 |
| 1204 | Ga0495671_0011944 | 3300046692 | Bacteria | 4757 |
| 1205 | Ga0495671_0013637 | 3300046692 | Bacteria | 4393 |
| 1206 | Ga0495671_0014274 | 3300046692 | Bacteria | 4279 |
| 1207 | Ga0495671_0053465 | 3300046692 | Bacteria | 2004 |
| 1208 | Ga0495671_0058916 | 3300046692 | Bacteria | 1899 |
| 1209 | Ga0495671_0132638 | 3300046692 | Bacteria | 1214 |
| 1210 | Ga0495649_0003172 | 3300046694 | Bacteria | 11243 |
| 1211 | Ga0495649_0003193 | 3300046694 | Bacteria | 11204 |
| 1212 | Ga0495649_0004813 | 3300046694 | Bacteria | 8741 |
| 1213 | Ga0495649_0007867 | 3300046694 | Bacteria | 6450 |
| 1214 | Ga0495649_0008963 | 3300046694 | Bacteria | 5980 |
| 1215 | Ga0495649_0019668 | 3300046694 | Bacteria | 3792 |
| 1216 | Ga0495649_0021487 | 3300046694 | Bacteria | 3614 |
| 1217 | Ga0495649_0023989 | 3300046694 | Bacteria | 3404 |
| 1218 | Ga0495649_0050133 | 3300046694 | Bacteria | 2266 |
| 1219 | Ga0495649_0054604 | 3300046694 | Bacteria | 2159 |
| 1220 | Ga0495589_0000005 | 3300046794 | Bacteria | 405112 |
| 1221 | Ga0495589_0001789 | 3300046794 | Bacteria | 12227 |
| 1222 | Ga0495589_0003076 | 3300046794 | Bacteria | 9142 |
| 1223 | Ga0495589_0004916 | 3300046794 | Bacteria | 7082 |
| 1224 | Ga0495589_0007826 | 3300046794 | Bacteria | 5596 |
| 1225 | Ga0495589_0008804 | 3300046794 | Bacteria | 5250 |
| 1226 | Ga0495589_0012194 | 3300046794 | Bacteria | 4457 |
| 1227 | Ga0495589_0018117 | 3300046794 | Bacteria | 3613 |
| 1228 | Ga0495589_0030578 | 3300046794 | Bacteria | 2711 |
| 1229 | Ga0495600_0033262 | 3300046809 | Bacteria | 3347 |
| 1230 | Ga0495600_0162444 | 3300046809 | Bacteria | 1443 |
| 1231 | Ga0495660_0000013 | 3300046810 | Bacteria | 350283 |
| 1232 | Ga0495660_0000034 | 3300046810 | Bacteria | 201261 |
| 1233 | Ga0495660_0001742 | 3300046810 | Bacteria | 14498 |
| 1234 | Ga0495660_0002923 | 3300046810 | Bacteria | 10692 |
| 1235 | Ga0495660_0011326 | 3300046810 | Bacteria | 5177 |
| 1236 | Ga0495660_0025870 | 3300046810 | Bacteria | 3330 |
| 1237 | Ga0495660_0026340 | 3300046810 | Bacteria | 3297 |
| 1238 | Ga0495660_0078623 | 3300046810 | Bacteria | 1733 |
| 1239 | Ga0495660_0163558 | 3300046810 | Bacteria | 1089 |
| 1240 | Ga0495660_0177835 | 3300046810 | Bacteria | 1031 |
| 1241 | Ga0495581_0012372 | 3300047315 | Bacteria | 4943 |
| 1242 | Ga0495581_0044701 | 3300047315 | Bacteria | 2561 |
| 1243 | Ga0495604_0006556 | 3300047317 | Bacteria | 9228 |
| 1244 | Ga0495604_0074773 | 3300047317 | Bacteria | 2552 |
| 1245 | Ga0495604_0277427 | 3300047317 | Bacteria | 1133 |
| 1246 | Ga0495636_0002977 | 3300047318 | Bacteria | 6552 |
| 1247 | Ga0495636_0128680 | 3300047318 | Bacteria | 1125 |
| 1248 | Ga0495674_0031575 | 3300047319 | Bacteria | 4811 |
| 1249 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 1250 | Ga0495672_0000051 | 3300047320 | Bacteria | 237883 |
| 1251 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 1252 | Ga0495672_0005620 | 3300047320 | Bacteria | 9897 |
| 1253 | Ga0495672_0008870 | 3300047320 | Bacteria | 7356 |
| 1254 | Ga0495672_0010455 | 3300047320 | Bacteria | 6607 |
| 1255 | Ga0495672_0014368 | 3300047320 | Bacteria | 5426 |
| 1256 | Ga0495672_0015095 | 3300047320 | Bacteria | 5257 |
| 1257 | Ga0495672_0017426 | 3300047320 | Bacteria | 4805 |
| 1258 | Ga0495672_0017945 | 3300047320 | Bacteria | 4716 |
| 1259 | Ga0495672_0019267 | 3300047320 | Bacteria | 4505 |
| 1260 | Ga0495672_0023090 | 3300047320 | Bacteria | 4033 |
| 1261 | Ga0495672_0024532 | 3300047320 | Bacteria | 3882 |
| 1262 | Ga0495672_0026497 | 3300047320 | Bacteria | 3698 |
| 1263 | Ga0495672_0033233 | 3300047320 | Bacteria | 3197 |
| 1264 | Ga0495672_0045197 | 3300047320 | Bacteria | 2637 |
| 1265 | Ga0495672_0064755 | 3300047320 | Bacteria | 2091 |
| 1266 | Ga0495672_0091422 | 3300047320 | Bacteria | 1670 |
| 1267 | Ga0495672_0109630 | 3300047320 | Bacteria | 1483 |
| 1268 | Ga0495672_0189054 | 3300047320 | Bacteria | 1037 |
| 1269 | Ga0495676_0000010 | 3300047321 | Bacteria | 242637 |
| 1270 | Ga0495680_0007566 | 3300047322 | Bacteria | 9935 |
| 1271 | Ga0495680_0034742 | 3300047322 | Bacteria | 4068 |
| 1272 | Ga0495680_0040496 | 3300047322 | Bacteria | 3711 |
| 1273 | Ga0495680_0051073 | 3300047322 | Bacteria | 3230 |
| 1274 | Ga0495680_0262708 | 3300047322 | Bacteria | 1220 |
| 1275 | Ga0495683_0000265 | 3300047323 | Bacteria | 46674 |
| 1276 | Ga0495683_0004053 | 3300047323 | Bacteria | 8404 |
| 1277 | Ga0495683_0016003 | 3300047323 | Bacteria | 3896 |
| 1278 | Ga0495683_0024337 | 3300047323 | Bacteria | 3108 |
| 1279 | Ga0495683_0025802 | 3300047323 | Bacteria | 3009 |
| 1280 | Ga0495683_0076883 | 3300047323 | Bacteria | 1632 |
| 1281 | Ga0495687_007249 | 3300047443 | Bacteria | 6582 |
| 1282 | Ga0495687_010782 | 3300047443 | Bacteria | 4975 |
| 1283 | Ga0495687_026181 | 3300047443 | Bacteria | 2750 |
| 1284 | Ga0495675_0002375 | 3300047444 | Bacteria | 11244 |
| 1285 | Ga0495675_0047775 | 3300047444 | Bacteria | 2722 |
| 1286 | Ga0495679_000014 | 3300047446 | Bacteria | 292767 |
| 1287 | Ga0495679_000092 | 3300047446 | Bacteria | 82121 |
| 1288 | Ga0495679_002205 | 3300047446 | Bacteria | 10161 |
| 1289 | Ga0495679_005767 | 3300047446 | Bacteria | 5451 |
| 1290 | Ga0495679_007811 | 3300047446 | Bacteria | 4413 |
| 1291 | Ga0495679_022838 | 3300047446 | Bacteria | 2134 |
| 1292 | Ga0495685_018714 | 3300047447 | Bacteria | 2378 |
| 1293 | Ga0495673_0000047 | 3300047469 | Bacteria | 266522 |
| 1294 | Ga0495673_0000820 | 3300047469 | Bacteria | 29164 |
| 1295 | Ga0495673_0001218 | 3300047469 | Bacteria | 21382 |
| 1296 | Ga0495673_0004155 | 3300047469 | Bacteria | 9159 |
| 1297 | Ga0495673_0005956 | 3300047469 | Bacteria | 7260 |
| 1298 | Ga0495673_0014060 | 3300047469 | Bacteria | 4175 |
| 1299 | Ga0495673_0014737 | 3300047469 | Bacteria | 4055 |
| 1300 | Ga0495673_0015118 | 3300047469 | Bacteria | 3987 |
| 1301 | Ga0495673_0017028 | 3300047469 | Bacteria | 3701 |
| 1302 | Ga0495673_0027987 | 3300047469 | Bacteria | 2674 |
| 1303 | Ga0495673_0029339 | 3300047469 | Bacteria | 2597 |
| 1304 | Ga0495673_0062420 | 3300047469 | Bacteria | 1591 |
| 1305 | Ga0495681_0007066 | 3300047470 | Bacteria | 7247 |
| 1306 | Ga0495681_0007517 | 3300047470 | Bacteria | 6943 |
| 1307 | Ga0495681_0013012 | 3300047470 | Bacteria | 4856 |
| 1308 | Ga0495681_0016807 | 3300047470 | Bacteria | 4083 |
| 1309 | Ga0495681_0018996 | 3300047470 | Bacteria | 3767 |
| 1310 | Ga0495681_0021337 | 3300047470 | Bacteria | 3493 |
| 1311 | Ga0495681_0021371 | 3300047470 | Bacteria | 3490 |
| 1312 | Ga0495681_0021754 | 3300047470 | Bacteria | 3447 |
| 1313 | Ga0495681_0032848 | 3300047470 | Bacteria | 2607 |
| 1314 | Ga0495681_0085335 | 3300047470 | Bacteria | 1402 |
| 1315 | Ga0495681_0098690 | 3300047470 | Bacteria | 1280 |
| 1316 | Ga0495684_0106124 | 3300047471 | Bacteria | 2122 |
| 1317 | Ga0495686_0020480 | 3300047472 | Bacteria | 4409 |
| 1318 | Ga0495686_0029422 | 3300047472 | Bacteria | 3573 |
| 1319 | Ga0495593_0015360 | 3300047673 | Bacteria | 4340 |
| 1320 | Ga0495593_0021500 | 3300047673 | Bacteria | 3603 |
| 1321 | Ga0495593_0023582 | 3300047673 | Bacteria | 3418 |
| 1322 | Ga0495626_0000013 | 3300048091 | Bacteria | 248164 |
| 1323 | Ga0495626_0001966 | 3300048091 | Bacteria | 15231 |
| 1324 | Ga0495626_0002110 | 3300048091 | Bacteria | 14455 |
| 1325 | Ga0495626_0006395 | 3300048091 | Bacteria | 6705 |
| 1326 | Ga0495626_0007835 | 3300048091 | Bacteria | 5916 |
| 1327 | Ga0495626_0008717 | 3300048091 | Bacteria | 5525 |
| 1328 | Ga0495626_0008848 | 3300048091 | Bacteria | 5473 |
| 1329 | Ga0495626_0014640 | 3300048091 | Bacteria | 4037 |
| 1330 | Ga0496100_0149692 | 3300048903 | Bacteria | 1663 |
| 1331 | Ga0496101_0000123 | 3300048904 | Bacteria | 75836 |
| 1332 | Ga0496101_0108386 | 3300048904 | Bacteria | 2088 |
| 1333 | Ga0496101_0206250 | 3300048904 | Bacteria | 1521 |
| 1334 | Ga0496102_0004355 | 3300048905 | Bacteria | 11961 |
| 1335 | Ga0496103_0016648 | 3300048906 | Bacteria | 4389 |
| 1336 | Ga0496104_0001413 | 3300048907 | Bacteria | 20804 |
| 1337 | Ga0496104_0004669 | 3300048907 | Bacteria | 11920 |
| 1338 | Ga0496104_0028274 | 3300048907 | Bacteria | 5197 |
| 1339 | Ga0496104_0081617 | 3300048907 | Bacteria | 3084 |
| 1340 | Ga0496105_0021587 | 3300048908 | Bacteria | 5211 |
| 1341 | Ga0496105_0059543 | 3300048908 | Bacteria | 3151 |
| 1342 | Ga0496110_0053015 | 3300048913 | Bacteria | 3564 |
| 1343 | Ga0496110_0093348 | 3300048913 | Bacteria | 2694 |
| 1344 | Ga0496110_0296346 | 3300048913 | Bacteria | 1473 |
| 1345 | Ga0496113_0675539 | 3300048916 | Bacteria | 825 |
| 1346 | Ga0496114_0072729 | 3300048917 | Bacteria | 2892 |
| 1347 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 1348 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 1349 | Ga0496116_0000217 | 3300048919 | Bacteria | 108128 |
| 1350 | Ga0496116_0000528 | 3300048919 | Bacteria | 51520 |
| 1351 | Ga0496116_0004729 | 3300048919 | Bacteria | 12861 |
| 1352 | Ga0496116_0008145 | 3300048919 | Bacteria | 9155 |
| 1353 | Ga0496116_0017483 | 3300048919 | Bacteria | 5562 |
| 1354 | Ga0496116_0018565 | 3300048919 | Bacteria | 5354 |
| 1355 | Ga0496116_0036886 | 3300048919 | Bacteria | 3415 |
| 1356 | Ga0496116_0040191 | 3300048919 | Bacteria | 3223 |
| 1357 | Ga0496116_0074923 | 3300048919 | Bacteria | 2126 |
| 1358 | Ga0496116_0120366 | 3300048919 | Bacteria | 1521 |
| 1359 | Ga0496116_0155905 | 3300048919 | Bacteria | 1260 |
| 1360 | Ga0496117_0000238 | 3300048920 | Bacteria | 104303 |
| 1361 | Ga0496117_0002432 | 3300048920 | Bacteria | 23541 |
| 1362 | Ga0496117_0003210 | 3300048920 | Bacteria | 19333 |
| 1363 | Ga0496117_0007956 | 3300048920 | Bacteria | 10183 |
| 1364 | Ga0496117_0010934 | 3300048920 | Bacteria | 8180 |
| 1365 | Ga0496117_0014243 | 3300048920 | Bacteria | 6863 |
| 1366 | Ga0496117_0015593 | 3300048920 | Bacteria | 6465 |
| 1367 | Ga0496117_0016424 | 3300048920 | Bacteria | 6248 |
| 1368 | Ga0496117_0019817 | 3300048920 | Bacteria | 5510 |
| 1369 | Ga0496117_0023926 | 3300048920 | Bacteria | 4849 |
| 1370 | Ga0496117_0025131 | 3300048920 | Bacteria | 4689 |
| 1371 | Ga0496117_0027296 | 3300048920 | Bacteria | 4451 |
| 1372 | Ga0496117_0039003 | 3300048920 | Bacteria | 3511 |
| 1373 | Ga0496117_0040562 | 3300048920 | Bacteria | 3421 |
| 1374 | Ga0496117_0045051 | 3300048920 | Bacteria | 3190 |
| 1375 | Ga0496117_0050855 | 3300048920 | Bacteria | 2935 |
| 1376 | Ga0496117_0052904 | 3300048920 | Bacteria | 2857 |
| 1377 | Ga0496117_0084628 | 3300048920 | Bacteria | 2068 |
| 1378 | Ga0496117_0103914 | 3300048920 | Bacteria | 1789 |
| 1379 | Ga0496117_0111506 | 3300048920 | Bacteria | 1703 |
| 1380 | Ga0496117_0129654 | 3300048920 | Bacteria | 1531 |
| 1381 | Ga0496117_0170703 | 3300048920 | Bacteria | 1263 |
| 1382 | Ga0496118_0000959 | 3300048921 | Bacteria | 45037 |
| 1383 | Ga0496118_0001062 | 3300048921 | Bacteria | 42938 |
| 1384 | Ga0496118_0002877 | 3300048921 | Bacteria | 22448 |
| 1385 | Ga0496118_0006809 | 3300048921 | Bacteria | 12405 |
| 1386 | Ga0496118_0009111 | 3300048921 | Bacteria | 10101 |
| 1387 | Ga0496118_0010449 | 3300048921 | Bacteria | 9195 |
| 1388 | Ga0496118_0018376 | 3300048921 | Bacteria | 6311 |
| 1389 | Ga0496118_0020645 | 3300048921 | Bacteria | 5834 |
| 1390 | Ga0496118_0034122 | 3300048921 | Bacteria | 4159 |
| 1391 | Ga0496118_0034438 | 3300048921 | Bacteria | 4131 |
| 1392 | Ga0496118_0040393 | 3300048921 | Bacteria | 3710 |
| 1393 | Ga0496118_0040443 | 3300048921 | Bacteria | 3707 |
| 1394 | Ga0496118_0047495 | 3300048921 | Bacteria | 3325 |
| 1395 | Ga0496118_0061392 | 3300048921 | Bacteria | 2783 |
| 1396 | Ga0496118_0065578 | 3300048921 | Bacteria | 2656 |
| 1397 | Ga0496118_0189866 | 3300048921 | Bacteria | 1230 |
| 1398 | Ga0496119_0000026 | 3300048922 | Bacteria | 254759 |
| 1399 | Ga0496119_0000097 | 3300048922 | Bacteria | 127447 |
| 1400 | Ga0496119_0000270 | 3300048922 | Bacteria | 73810 |
| 1401 | Ga0496119_0001418 | 3300048922 | Bacteria | 29010 |
| 1402 | Ga0496119_0005618 | 3300048922 | Bacteria | 11925 |
| 1403 | Ga0496119_0005727 | 3300048922 | Bacteria | 11775 |
| 1404 | Ga0496119_0007722 | 3300048922 | Bacteria | 9614 |
| 1405 | Ga0496119_0008301 | 3300048922 | Bacteria | 9155 |
| 1406 | Ga0496119_0016128 | 3300048922 | Bacteria | 5706 |
| 1407 | Ga0496119_0036489 | 3300048922 | Bacteria | 3207 |
| 1408 | Ga0496119_0050888 | 3300048922 | Bacteria | 2549 |
| 1409 | Ga0496119_0166643 | 3300048922 | Bacteria | 1166 |
| 1410 | Ga0496120_0000344 | 3300048923 | Bacteria | 76805 |
| 1411 | Ga0496120_0000361 | 3300048923 | Bacteria | 73810 |
| 1412 | Ga0496120_0001012 | 3300048923 | Bacteria | 37715 |
| 1413 | Ga0496120_0001279 | 3300048923 | Bacteria | 31425 |
| 1414 | Ga0496120_0001280 | 3300048923 | Bacteria | 31420 |
| 1415 | Ga0496120_0002523 | 3300048923 | Bacteria | 18288 |
| 1416 | Ga0496120_0004434 | 3300048923 | Bacteria | 11774 |
| 1417 | Ga0496120_0006998 | 3300048923 | Bacteria | 8483 |
| 1418 | Ga0496120_0007521 | 3300048923 | Bacteria | 8087 |
| 1419 | Ga0496120_0009560 | 3300048923 | Bacteria | 6861 |
| 1420 | Ga0496120_0009684 | 3300048923 | Bacteria | 6799 |
| 1421 | Ga0496120_0013830 | 3300048923 | Bacteria | 5407 |
| 1422 | Ga0496120_0016493 | 3300048923 | Bacteria | 4827 |
| 1423 | Ga0496120_0045919 | 3300048923 | Bacteria | 2527 |
| 1424 | Ga0496120_0067938 | 3300048923 | Bacteria | 1967 |
| 1425 | Ga0496121_0001130 | 3300048924 | Bacteria | 46848 |
| 1426 | Ga0496121_0001808 | 3300048924 | Bacteria | 34559 |
| 1427 | Ga0496121_0004701 | 3300048924 | Bacteria | 18089 |
| 1428 | Ga0496121_0007313 | 3300048924 | Bacteria | 13353 |
| 1429 | Ga0496121_0016066 | 3300048924 | Bacteria | 7757 |
| 1430 | Ga0496121_0018682 | 3300048924 | Bacteria | 6976 |
| 1431 | Ga0496121_0022583 | 3300048924 | Bacteria | 6095 |
| 1432 | Ga0496121_0045686 | 3300048924 | Bacteria | 3760 |
| 1433 | Ga0496121_0056801 | 3300048924 | Bacteria | 3248 |
| 1434 | Ga0496121_0075323 | 3300048924 | Bacteria | 2696 |
| 1435 | Ga0496121_0086786 | 3300048924 | Bacteria | 2458 |
| 1436 | Ga0496121_0147438 | 3300048924 | Bacteria | 1736 |
| 1437 | Ga0496122_0000075 | 3300048925 | Bacteria | 219099 |
| 1438 | Ga0496122_0000125 | 3300048925 | Bacteria | 179659 |
| 1439 | Ga0496122_0000297 | 3300048925 | Bacteria | 110041 |
| 1440 | Ga0496122_0001095 | 3300048925 | Bacteria | 46975 |
| 1441 | Ga0496122_0001913 | 3300048925 | Bacteria | 31485 |
| 1442 | Ga0496122_0002193 | 3300048925 | Bacteria | 28526 |
| 1443 | Ga0496122_0008894 | 3300048925 | Bacteria | 10702 |
| 1444 | Ga0496122_0025549 | 3300048925 | Bacteria | 5126 |
| 1445 | Ga0496122_0028887 | 3300048925 | Bacteria | 4691 |
| 1446 | Ga0496122_0036451 | 3300048925 | Bacteria | 3976 |
| 1447 | Ga0496122_0042447 | 3300048925 | Bacteria | 3578 |
| 1448 | Ga0496122_0048357 | 3300048925 | Bacteria | 3272 |
| 1449 | Ga0496122_0050018 | 3300048925 | Bacteria | 3191 |
| 1450 | Ga0496122_0050616 | 3300048925 | Bacteria | 3166 |
| 1451 | Ga0496122_0056682 | 3300048925 | Bacteria | 2918 |
| 1452 | Ga0496122_0065242 | 3300048925 | Bacteria | 2641 |
| 1453 | Ga0496122_0075251 | 3300048925 | Bacteria | 2383 |
| 1454 | Ga0496122_0077679 | 3300048925 | Bacteria | 2329 |
| 1455 | Ga0496122_0078410 | 3300048925 | Bacteria | 2313 |
| 1456 | Ga0496122_0121208 | 3300048925 | Bacteria | 1686 |
| 1457 | Ga0496123_0000019 | 3300048926 | Bacteria | 400216 |
| 1458 | Ga0496123_0000092 | 3300048926 | Bacteria | 179551 |
| 1459 | Ga0496123_0000377 | 3300048926 | Bacteria | 83811 |
| 1460 | Ga0496123_0000774 | 3300048926 | Bacteria | 51762 |
| 1461 | Ga0496123_0001365 | 3300048926 | Bacteria | 34358 |
| 1462 | Ga0496123_0001657 | 3300048926 | Bacteria | 29899 |
| 1463 | Ga0496123_0003347 | 3300048926 | Bacteria | 18138 |
| 1464 | Ga0496123_0003771 | 3300048926 | Bacteria | 16612 |
| 1465 | Ga0496123_0008703 | 3300048926 | Bacteria | 9272 |
| 1466 | Ga0496123_0022363 | 3300048926 | Bacteria | 4874 |
| 1467 | Ga0496123_0028298 | 3300048926 | Bacteria | 4152 |
| 1468 | Ga0496123_0031023 | 3300048926 | Bacteria | 3899 |
| 1469 | Ga0496123_0044215 | 3300048926 | Bacteria | 3047 |
| 1470 | Ga0496123_0051898 | 3300048926 | Bacteria | 2726 |
| 1471 | Ga0496123_0058334 | 3300048926 | Bacteria | 2504 |
| 1472 | Ga0496123_0064887 | 3300048926 | Bacteria | 2324 |
| 1473 | Ga0496123_0065318 | 3300048926 | Bacteria | 2313 |
| 1474 | Ga0496123_0067104 | 3300048926 | Bacteria | 2267 |
| 1475 | Ga0496123_0071194 | 3300048926 | Bacteria | 2170 |
| 1476 | Ga0496123_0088300 | 3300048926 | Bacteria | 1852 |
| 1477 | Ga0496123_0111891 | 3300048926 | Bacteria | 1558 |
| 1478 | Ga0496124_0000051 | 3300048927 | Bacteria | 255802 |
| 1479 | Ga0496124_0000058 | 3300048927 | Bacteria | 242191 |
| 1480 | Ga0496124_0000142 | 3300048927 | Bacteria | 147311 |
| 1481 | Ga0496124_0000238 | 3300048927 | Bacteria | 106881 |
| 1482 | Ga0496124_0000965 | 3300048927 | Bacteria | 45797 |
| 1483 | Ga0496124_0006756 | 3300048927 | Bacteria | 12399 |
| 1484 | Ga0496124_0007209 | 3300048927 | Bacteria | 11878 |
| 1485 | Ga0496124_0009650 | 3300048927 | Bacteria | 9887 |
| 1486 | Ga0496124_0015821 | 3300048927 | Bacteria | 7209 |
| 1487 | Ga0496124_0016054 | 3300048927 | Bacteria | 7145 |
| 1488 | Ga0496124_0022985 | 3300048927 | Bacteria | 5703 |
| 1489 | Ga0496124_0034228 | 3300048927 | Bacteria | 4461 |
| 1490 | Ga0496124_0040053 | 3300048927 | Bacteria | 4055 |
| 1491 | Ga0496124_0054792 | 3300048927 | Bacteria | 3373 |
| 1492 | Ga0496124_0056723 | 3300048927 | Bacteria | 3302 |
| 1493 | Ga0496124_0068404 | 3300048927 | Bacteria | 2951 |
| 1494 | Ga0496124_0073613 | 3300048927 | Bacteria | 2826 |
| 1495 | Ga0496124_0092564 | 3300048927 | Bacteria | 2462 |
| 1496 | Ga0496124_0093654 | 3300048927 | Bacteria | 2444 |
| 1497 | Ga0496124_0112536 | 3300048927 | Bacteria | 2188 |
| 1498 | Ga0496124_0149901 | 3300048927 | Bacteria | 1831 |
| 1499 | Ga0496124_0166022 | 3300048927 | Bacteria | 1715 |
| 1500 | Ga0496124_0191268 | 3300048927 | Bacteria | 1566 |
| 1501 | Ga0496124_0198609 | 3300048927 | Bacteria | 1527 |
| 1502 | Ga0496125_0000032 | 3300048928 | Bacteria | 354078 |
| 1503 | Ga0496125_0000384 | 3300048928 | Bacteria | 82197 |
| 1504 | Ga0496125_0002564 | 3300048928 | Bacteria | 23406 |
| 1505 | Ga0496125_0011357 | 3300048928 | Bacteria | 8916 |
| 1506 | Ga0496125_0017828 | 3300048928 | Bacteria | 6755 |
| 1507 | Ga0496125_0018128 | 3300048928 | Bacteria | 6691 |
| 1508 | Ga0496125_0018546 | 3300048928 | Bacteria | 6608 |
| 1509 | Ga0496125_0029785 | 3300048928 | Bacteria | 4898 |
| 1510 | Ga0496125_0037717 | 3300048928 | Bacteria | 4198 |
| 1511 | Ga0496125_0040349 | 3300048928 | Bacteria | 4006 |
| 1512 | Ga0496125_0048007 | 3300048928 | Bacteria | 3564 |
| 1513 | Ga0496125_0050164 | 3300048928 | Bacteria | 3458 |
| 1514 | Ga0496125_0054932 | 3300048928 | Bacteria | 3250 |
| 1515 | Ga0496125_0055746 | 3300048928 | Bacteria | 3216 |
| 1516 | Ga0496125_0060463 | 3300048928 | Bacteria | 3044 |
| 1517 | Ga0496125_0089062 | 3300048928 | Bacteria | 2322 |
| 1518 | Ga0496125_0167249 | 3300048928 | Bacteria | 1484 |
| 1519 | Ga0496126_0000109 | 3300048929 | Bacteria | 196717 |
| 1520 | Ga0496126_0015397 | 3300048929 | Bacteria | 7693 |
| 1521 | Ga0496126_0015460 | 3300048929 | Bacteria | 7674 |
| 1522 | Ga0496126_0040308 | 3300048929 | Bacteria | 4330 |
| 1523 | Ga0496126_0064861 | 3300048929 | Bacteria | 3270 |
| 1524 | Ga0496126_0080089 | 3300048929 | Bacteria | 2890 |
| 1525 | Ga0496126_0095936 | 3300048929 | Bacteria | 2600 |
| 1526 | Ga0496126_0114406 | 3300048929 | Bacteria | 2347 |
| 1527 | Ga0496126_0121666 | 3300048929 | Bacteria | 2262 |
| 1528 | Ga0496126_0153337 | 3300048929 | Bacteria | 1973 |
| 1529 | Ga0496126_0192883 | 3300048929 | Bacteria | 1724 |
| 1530 | Ga0496126_0254358 | 3300048929 | Bacteria | 1463 |
| 1531 | Ga0496126_0325031 | 3300048929 | Bacteria | 1263 |
| 1532 | Ga0496126_0414853 | 3300048929 | Bacteria | 1089 |
| 1533 | Ga0495678_000063 | 3300049459 | Bacteria | 140183 |
| 1534 | Ga0495678_000127 | 3300049459 | Bacteria | 89660 |
| 1535 | Ga0495678_000984 | 3300049459 | Bacteria | 24399 |
| 1536 | Ga0495678_002289 | 3300049459 | Bacteria | 13278 |
| 1537 | Ga0495678_003397 | 3300049459 | Bacteria | 9897 |
| 1538 | Ga0495678_008921 | 3300049459 | Bacteria | 5014 |
| 1539 | Ga0495678_009905 | 3300049459 | Bacteria | 4672 |
| 1540 | Ga0495678_010697 | 3300049459 | Bacteria | 4437 |
| 1541 | Ga0495678_014553 | 3300049459 | Bacteria | 3653 |
| 1542 | Ga0495678_016237 | 3300049459 | Bacteria | 3408 |
| 1543 | Ga0495678_020491 | 3300049459 | Bacteria | 2926 |
| 1544 | Ga0495678_022816 | 3300049459 | Bacteria | 2731 |
| 1545 | Ga0495678_032052 | 3300049459 | Bacteria | 2184 |
| 1546 | Ga0495678_036333 | 3300049459 | Bacteria | 2010 |
| 1547 | Ga0495678_041655 | 3300049459 | Bacteria | 1835 |
| 1548 | Ga0495678_049399 | 3300049459 | Bacteria | 1635 |
| 1549 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 1550 | Ga0495682_0000134 | 3300049460 | Bacteria | 64409 |
| 1551 | Ga0495682_0000635 | 3300049460 | Bacteria | 23482 |
| 1552 | Ga0495682_0015198 | 3300049460 | Bacteria | 2917 |
| 1553 | Ga0501034_0000501 | 3300049571 | Bacteria | 63366 |
| 1554 | Ga0501034_0100596 | 3300049571 | Bacteria | 2885 |
| 1555 | Ga0501034_0140497 | 3300049571 | Bacteria | 2395 |
| 1556 | Ga0501034_0303208 | 3300049571 | Bacteria | 1534 |
| 1557 | Ga0501034_0306683 | 3300049571 | Bacteria | 1523 |
| 1558 | Ga0501037_0360361 | 3300049573 | Bacteria | 1002 |
| 1559 | Ga0501038_0008503 | 3300049574 | Bacteria | 9433 |
| 1560 | Ga0501039_0199423 | 3300049575 | Bacteria | 1574 |
| 1561 | Ga0501047_0072386 | 3300049581 | Bacteria | 3318 |
| 1562 | Ga0501222_001277 | 3300049662 | Bacteria | 3539 |
| 1563 | Ga0501227_005010 | 3300049665 | Bacteria | 2845 |
| 1564 | Ga0501241_003528 | 3300049758 | Bacteria | 2954 |
| 1565 | Ga0501035_0557365 | 3300049822 | Bacteria | 938 |
| 1566 | Ga0501226_000005 | 3300049853 | Bacteria | 271019 |
| 1567 | nmdc:mga03683_6025_c1 | 3300050489 | Bacteria | 4131 |
| 1568 | nmdc:mga00v17_5272_c1 | 3300050491 | Bacteria | 6810 |
| 1569 | nmdc:mga0yw44_29709_c1 | 3300050492 | Bacteria | 3158 |
| 1570 | nmdc:mga0k408_117807_c1 | 3300050493 | Bacteria | 1572 |
| 1571 | nmdc:mga0k408_171222_c1 | 3300050493 | Bacteria | 1294 |
| 1572 | nmdc:mga0k408_2713_c1 | 3300050493 | Bacteria | 9399 |
| 1573 | nmdc:mga07m45_6026_c1 | 3300050496 | Bacteria | 6102 |
| 1574 | nmdc:mga0sz30_20467_c1 | 3300050516 | Bacteria | 1277 |
| 1575 | Ga0500644_0021033 | 3300053088 | Bacteria | 1949 |
| 1576 | Ga0500646_0001268 | 3300053090 | Bacteria | 6760 |
| 1577 | Ga0500583_0000848 | 3300053092 | Bacteria | 8807 |
| 1578 | Ga0500650_0000427 | 3300053098 | Bacteria | 10481 |
| 1579 | Ga0500594_0067240 | 3300053118 | Bacteria | 1046 |
| 1580 | Ga0500618_001605 | 3300053125 | Bacteria | 9815 |
| 1581 | Ga0500618_002498 | 3300053125 | Bacteria | 6871 |
| 1582 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
| 1583 | Ga0500659_0014789 | 3300053135 | Bacteria | 4254 |
| 1584 | Ga0500604_0000477 | 3300053151 | Bacteria | 11053 |
| 1585 | Ga0500637_0296698 | 3300053178 | Bacteria | 883 |
| 1586 | Ga0466962_0004751 | 3300061719 | Bacteria | 6528 |
| 1587 | Ga0466962_0148562 | 3300061719 | Bacteria | 1137 |
| 1588 | 2510284792 | 2510065053 | Bacteria | 5005518 |
| 1589 | 2510295102 | 2510065055 | Bacteria | 5037935 |
| 1590 | 2510312170 | 2510065058 | Bacteria | 5005894 |
| 1591 | 2511253480 | 2511231004 | Bacteria | 6669789 |
| 1592 | 2511267416 | 2511231006 | Bacteria | 6794709 |
| 1593 | 2511270817 | 2511231007 | Bacteria | 6306603 |
| 1594 | 2511274942 | 2511231008 | Bacteria | 6624100 |
| 1595 | 2511291482 | 2511231010 | Bacteria | 6373152 |
| 1596 | 2511296193 | 2511231011 | Bacteria | 6149768 |
| 1597 | 2511300582 | 2511231012 | Bacteria | 6738011 |
| 1598 | 2511315556 | 2511231014 | Bacteria | 6462302 |
| 1599 | 2511317804 | 2511231015 | Bacteria | 6598026 |
| 1600 | 2511326900 | 2511231016 | Bacteria | 6704427 |
| 1601 | 2511332408 | 2511231017 | Bacteria | 6503007 |
| 1602 | 2511336481 | 2511231018 | Bacteria | 6436256 |
| 1603 | 2511347246 | 2511231019 | Bacteria | 6520662 |
| 1604 | 2511350510 | 2511231020 | Bacteria | 6115223 |
| 1605 | 2511357171 | 2511231021 | Bacteria | 7302637 |
| 1606 | 2511362301 | 2511231022 | Bacteria | 6719296 |
| 1607 | 2511371989 | 2511231023 | Bacteria | 6808468 |
| 1608 | 2511377686 | 2511231024 | Bacteria | 5835885 |
| 1609 | 2511381899 | 2511231025 | Bacteria | 5324661 |
| 1610 | 2511383996 | 2511231026 | Bacteria | 5225445 |
| 1611 | 2511413668 | 2511231031 | Bacteria | 6558529 |
| 1612 | 2511432761 | 2511231035 | Bacteria | 5341610 |
| 1613 | 2511826744 | 2511231156 | Bacteria | 6845832 |
| 1614 | 2512328266 | 2512047018 | Bacteria | 6663241 |
| 1615 | 2552746632 | 2551306352 | Bacteria | 3873115 |
| 1616 | 2554813779 | 2554235132 | Bacteria | 6772433 |
| 1617 | 2555245160 | 2554235231 | Bacteria | 5215788 |
| 1618 | 2555667987 | 2554235341 | Bacteria | 6867980 |
| 1619 | 2583790439 | 2582580891 | Bacteria | 6800976 |
| 1620 | 2597856212 | 2597489887 | Bacteria | 6666321 |
| 1621 | 2597862250 | 2597489888 | Bacteria | 6179543 |
| 1622 | 2597867976 | 2597489889 | Bacteria | 6297495 |
| 1623 | 2599328172 | 2599185155 | Bacteria | 5827168 |
| 1624 | 2599354987 | 2599185160 | Bacteria | 6844013 |
| 1625 | 2599361181 | 2599185161 | Bacteria | 6960462 |
| 1626 | 2599367503 | 2599185162 | Bacteria | 6957254 |
| 1627 | 2599374293 | 2599185163 | Bacteria | 6995158 |
| 1628 | 2599380093 | 2599185164 | Bacteria | 6841688 |
| 1629 | 2599386540 | 2599185165 | Bacteria | 6843250 |
| 1630 | 2599393151 | 2599185166 | Bacteria | 6959206 |
| 1631 | 2599397147 | 2599185167 | Bacteria | 6353609 |
| 1632 | 2599404918 | 2599185168 | Bacteria | 6997636 |
| 1633 | 2599449139 | 2599185179 | Bacteria | 6611171 |
| 1634 | 2599461821 | 2599185181 | Bacteria | 6844519 |
| 1635 | 2599467128 | 2599185182 | Bacteria | 6883168 |
| 1636 | 2599483531 | 2599185185 | Bacteria | 6652270 |
| 1637 | 2599491086 | 2599185186 | Bacteria | 6831633 |
| 1638 | 2599502904 | 2599185188 | Bacteria | 6164180 |
| 1639 | 2599508756 | 2599185189 | Bacteria | 5862825 |
| 1640 | 2599511117 | 2599185190 | Bacteria | 6285678 |
| 1641 | 2599519393 | 2599185191 | Bacteria | 6297582 |
| 1642 | 2599615069 | 2599185212 | Bacteria | 6765997 |
| 1643 | 2599771266 | 2599185248 | Bacteria | 6696816 |
| 1644 | 2599805438 | 2599185257 | Bacteria | 6492581 |
| 1645 | 2599879576 | 2599185288 | Bacteria | 6666191 |
| 1646 | 2599885962 | 2599185289 | Bacteria | 6778765 |
| 1647 | 2599890491 | 2599185290 | Bacteria | 6289611 |
| 1648 | 2599897676 | 2599185291 | Bacteria | 6775623 |
| 1649 | 2599930068 | 2599185300 | Bacteria | 6062622 |
| 1650 | 2599945406 | 2599185302 | Bacteria | 5954930 |
| 1651 | 2599948076 | 2599185303 | Bacteria | 6512725 |
| 1652 | 2599955678 | 2599185304 | Bacteria | 5951361 |
| 1653 | 2599961044 | 2599185305 | Bacteria | 6748700 |
| 1654 | 2599969399 | 2599185306 | Bacteria | 6637356 |
| 1655 | 2599974646 | 2599185307 | Bacteria | 6194719 |
| 1656 | 2599980733 | 2599185308 | Bacteria | 6621546 |
| 1657 | 2599985790 | 2599185309 | Bacteria | 5969593 |
| 1658 | 2599990684 | 2599185310 | Bacteria | 6014457 |
| 1659 | 2599996001 | 2599185311 | Bacteria | 6354990 |
| 1660 | 2600001930 | 2599185312 | Bacteria | 5912071 |
| 1661 | 2600005658 | 2599185313 | Bacteria | 6658188 |
| 1662 | 2600014610 | 2599185314 | Bacteria | 6621749 |
| 1663 | 2600019096 | 2599185315 | Bacteria | 6771107 |
| 1664 | 2600025573 | 2599185316 | Bacteria | 6320029 |
| 1665 | 2600027811 | 2599185317 | Bacteria | 6435722 |
| 1666 | 2600033471 | 2599185318 | Bacteria | 6961590 |
| 1667 | 2600040243 | 2599185319 | Bacteria | 6637840 |
| 1668 | 2600049389 | 2599185320 | Bacteria | 5963263 |
| 1669 | 2600055723 | 2599185321 | Bacteria | 6764560 |
| 1670 | 2600061654 | 2599185322 | Bacteria | 6763055 |
| 1671 | 2600064273 | 2599185323 | Bacteria | 6688755 |
| 1672 | 2600073513 | 2599185324 | Bacteria | 6590677 |
| 1673 | 2600077278 | 2599185325 | Bacteria | 6324919 |
| 1674 | 2600214443 | 2599185356 | Bacteria | 6843884 |
| 1675 | 2600356978 | 2600254930 | Bacteria | 6431253 |
| 1676 | 2600364141 | 2600254931 | Bacteria | 6734225 |
| 1677 | 2600443414 | 2600254954 | Bacteria | 5100516 |
| 1678 | 2601626005 | 2600255283 | Bacteria | 6061572 |
| 1679 | 2601690840 | 2600255296 | Bacteria | 5784754 |
| 1680 | 2601774852 | 2600255313 | Bacteria | 6842543 |
| 1681 | 2601800030 | 2600255318 | Bacteria | 6383414 |
| 1682 | 2602009131 | 2600255389 | Bacteria | 5275336 |
| 1683 | 2606074706 | 2603880185 | Bacteria | 6379190 |
| 1684 | 2606127569 | 2603880199 | Bacteria | 6377649 |
| 1685 | 2608381066 | 2606217733 | Bacteria | 6360972 |
| 1686 | 2621301609 | 2619619299 | Bacteria | 6649820 |
| 1687 | 2624478776 | 2623620443 | Bacteria | 6427864 |
| 1688 | 2624494174 | 2623620446 | Bacteria | 6500345 |
| 1689 | 2643843458 | 2643221565 | Bacteria | 6216018 |
| 1690 | 2643868970 | 2643221571 | Bacteria | 6228673 |
| 1691 | 2643955361 | 2643221589 | Bacteria | 6250934 |
| 1692 | 2644023713 | 2643221602 | Bacteria | 6249926 |
| 1693 | 2644030717 | 2643221603 | Bacteria | 6147767 |
| 1694 | 2644187949 | 2643221633 | Bacteria | 6733554 |
| 1695 | 2644282429 | 2643221650 | Bacteria | 7029547 |
| 1696 | 2644361808 | 2643221665 | Bacteria | 4699229 |
| 1697 | 2644623930 | 2643221713 | Bacteria | 6554480 |
| 1698 | 2649121939 | 2648501241 | Bacteria | 5312320 |
| 1699 | 2652545580 | 2651869719 | Bacteria | 6047974 |
| 1700 | 2652976501 | 2651869818 | Bacteria | 5864031 |
| 1701 | 2671089771 | 2667528170 | Bacteria | 6786960 |
| 1702 | 2671097596 | 2667528171 | Bacteria | 6900659 |
| 1703 | 2671125597 | 2667528176 | Bacteria | 6724917 |
| 1704 | 2671767826 | 2671180172 | Bacteria | 6495783 |
| 1705 | 2677897490 | 2675903420 | Bacteria | 6247433 |
| 1706 | 2678265112 | 2675903515 | Bacteria | 6580491 |
| 1707 | 2691331008 | 2690315857 | Bacteria | 4396207 |
| 1708 | 2707098367 | 2706794495 | Bacteria | 4536932 |
| 1709 | 2715750859 | 2713897148 | Bacteria | 5883533 |
| 1710 | 2715757494 | 2713897149 | Bacteria | 6506249 |
| 1711 | 2718632661 | 2718217725 | Bacteria | 5758958 |
| 1712 | 2723247138 | 2721755607 | Bacteria | 5841722 |
| 1713 | 2729145961 | 2728369097 | Bacteria | 4333476 |
| 1714 | 2738673829 | 2738541265 | Bacteria | 6594665 |
| 1715 | 2738689466 | 2738541271 | Bacteria | 5657310 |
| 1716 | 2738714612 | 2738541276 | Bacteria | 4690596 |
| 1717 | 2738752222 | 2738541282 | Bacteria | 6593925 |
| 1718 | 2738809034 | 2738541294 | Bacteria | 6925949 |
| 1719 | 2738861263 | 2738541303 | Bacteria | 6591772 |
| 1720 | 2738896394 | 2738541309 | Bacteria | 6926455 |
| 1721 | 2739196543 | 2738543004 | Bacteria | 6381073 |
| 1722 | 2739257520 | 2738543015 | Bacteria | 6750701 |
| 1723 | 2739265240 | 2738543016 | Bacteria | 5657564 |
| 1724 | 2739286852 | 2738543020 | Bacteria | 5718238 |
| 1725 | 2739292165 | 2738543021 | Bacteria | 5718241 |
| 1726 | 2739314845 | 2738543025 | Bacteria | 6600348 |
| 1727 | 2743735622 | 2740892503 | Bacteria | 6855563 |
| 1728 | 2745005568 | 2744054620 | Bacteria | 6551379 |
| 1729 | 2745160642 | 2744054655 | Bacteria | 3552603 |
| 1730 | 2765570045 | 2765235838 | Bacteria | 5445269 |
| 1731 | 2765585885 | 2765235841 | Bacteria | 6137024 |
| 1732 | 2772437198 | 2772190666 | Bacteria | 5117644 |
| 1733 | 2774120718 | 2773857670 | Bacteria | 6407454 |
| 1734 | 2774131363 | 2773857672 | Bacteria | 4993178 |
| 1735 | 2774136748 | 2773857673 | Bacteria | 6513460 |
| 1736 | 2784260498 | 2784132063 | Bacteria | 6262788 |
| 1737 | 2784313444 | 2784132072 | Bacteria | 6596533 |
| 1738 | 2794595585 | 2791355520 | Bacteria | 5948615 |
| 1739 | 2807406665 | 2806310737 | Bacteria | 5751088 |
| 1740 | 2807454997 | 2806310745 | Bacteria | 5742165 |
| 1741 | 2808855872 | 2808606361 | Bacteria | 6136259 |
| 1742 | 2808904933 | 2808606373 | Bacteria | 4423627 |
| 1743 | 2808921921 | 2808606376 | Bacteria | 6248667 |
| 1744 | 2808928804 | 2808606377 | Bacteria | 6646337 |
| 1745 | 2808935952 | 2808606378 | Bacteria | 6177535 |
| 1746 | 2808941016 | 2808606379 | Bacteria | 5022697 |
| 1747 | 2808944042 | 2808606380 | Bacteria | 6248705 |
| 1748 | 2808950925 | 2808606381 | Bacteria | 6646461 |
| 1749 | 2808956807 | 2808606382 | Bacteria | 6841132 |
| 1750 | 2808964255 | 2808606383 | Bacteria | 6138645 |
| 1751 | 2808975174 | 2808606385 | Bacteria | 6711065 |
| 1752 | 2808981666 | 2808606386 | Bacteria | 4471946 |
| 1753 | 2808991187 | 2808606388 | Bacteria | 6706662 |
| 1754 | 2808999143 | 2808606389 | Bacteria | 6138126 |
| 1755 | 2809131296 | 2808606415 | Bacteria | 4576710 |
| 1756 | 2809150918 | 2808606419 | Bacteria | 4576925 |
| 1757 | 2809215717 | 2808606445 | Bacteria | 6057339 |
| 1758 | 2812370787 | 2811994881 | Bacteria | 6298475 |
| 1759 | 2817489031 | 2816332298 | Bacteria | 6852809 |
| 1760 | 2819615414 | 2818991449 | Bacteria | 5518009 |
| 1761 | 2819658332 | 2818991456 | Bacteria | 6123676 |
| 1762 | 2819702679 | 2818991464 | Bacteria | 6907494 |
| 1763 | 2823425026 | 2823421272 | Bacteria | 5372474 |
| 1764 | 2825655993 | 2825651385 | Bacteria | 6715909 |
| 1765 | 2826583764 | 2826581358 | Bacteria | 5963467 |
| 1766 | 2834028933 | 2834028612 | Bacteria | 6354979 |
| 1767 | 2839097014 | 2839094727 | Bacteria | 5534556 |
| 1768 | 2842808057 | 2842805378 | Bacteria | 5385175 |
| 1769 | 2842821024 | 2842815866 | Bacteria | 5947510 |
| 1770 | 2842829967 | 2842826826 | Bacteria | 5974129 |
| 1771 | 2842835755 | 2842832357 | Bacteria | 5959113 |
| 1772 | 2842839054 | 2842837860 | Bacteria | 6066181 |
| 1773 | 2842847502 | 2842843487 | Bacteria | 6004777 |
| 1774 | 2842853457 | 2842849001 | Bacteria | 5924277 |
| 1775 | 2842856397 | 2842854478 | Bacteria | 6143501 |
| 1776 | 2844668497 | 2844665904 | Bacteria | 6817974 |
| 1777 | 2847089110 | 2847085930 | Bacteria | 5070450 |
| 1778 | 2852106173 | 2852103415 | Bacteria | 5193810 |
| 1779 | 2852615577 | 2852612431 | Bacteria | 6885235 |
| 1780 | 2852622804 | 2852618963 | Bacteria | 4577824 |
| 1781 | 2852662865 | 2852657418 | Bacteria | 6472974 |
| 1782 | 2852670545 | 2852667396 | Bacteria | 6885555 |
| 1783 | 2854601947 | 2854601825 | Bacteria | 4797592 |
| 1784 | 2860340680 | 2860339153 | Bacteria | 6846989 |
| 1785 | 2860868969 | 2860867994 | Bacteria | 5645326 |
| 1786 | 2876605734 | 2876601092 | Bacteria | 5114497 |
| 1787 | 2878030741 | 2878029506 | Bacteria | 6418441 |
| 1788 | 2880231654 | 2880230671 | Bacteria | 6140320 |
| 1789 | 2881716114 | 2881714928 | Bacteria | 2469486 |
| 1790 | 2887632686 | 2887630918 | Bacteria | 3239855 |
| 1791 | 2888367246 | 2888366609 | Bacteria | 5155009 |
| 1792 | 2904444683 | 2904439833 | Bacteria | 5931679 |
| 1793 | 2904507062 | 2904504865 | Bacteria | 5152820 |
| 1794 | 2904520688 | 2904518522 | Bacteria | 6068986 |
| 1795 | 2904534670 | 2904530477 | Bacteria | 5876334 |
| 1796 | 2904553039 | 2904550169 | Bacteria | 6221258 |
| 1797 | 2904584557 | 2904584206 | Bacteria | 6028872 |
| 1798 | 2904591024 | 2904589729 | Bacteria | 6113573 |
| 1799 | 2904605353 | 2904601388 | Bacteria | 5884906 |
| 1800 | 2908447717 | 2908446538 | Bacteria | 6829095 |
| 1801 | 2908673114 | 2908669403 | Bacteria | 5740494 |
| 1802 | 2912968174 | 2912963787 | Bacteria | 5646108 |
| 1803 | 2913041721 | 2913036834 | Bacteria | 6704877 |
| 1804 | 2916702829 | 2916699645 | Bacteria | 3568996 |
| 1805 | 2917071749 | 2917070673 | Bacteria | 6868303 |
| 1806 | 2917834223 | 2917832318 | Bacteria | 5346010 |
| 1807 | 2919047475 | 2919046199 | Bacteria | 5567169 |
| 1808 | 2919067309 | 2919063839 | Bacteria | 6302690 |
| 1809 | 2919080962 | 2919079590 | Bacteria | 5946433 |
| 1810 | 2919127779 | 2919125081 | Bacteria | 5385106 |
| 1811 | 2919156594 | 2919155634 | Bacteria | 4860545 |
| 1812 | 2919385791 | 2919385768 | Bacteria | 5897293 |
| 1813 | 2919458397 | 2919456309 | Bacteria | 6586567 |
| 1814 | 2919484660 | 2919481497 | Bacteria | 6907839 |
| 1815 | 2919492832 | 2919487758 | Bacteria | 5929766 |
| 1816 | 2919501743 | 2919501602 | Bacteria | 5286340 |
| 1817 | 2919534569 | 2919534386 | Bacteria | 4577686 |
| 1818 | 2919689925 | 2919688452 | Bacteria | 4595932 |
| 1819 | 2919699909 | 2919697872 | Bacteria | 6553725 |
| 1820 | 2923154630 | 2923153595 | Bacteria | 6870622 |
| 1821 | 2923512541 | 2923510766 | Bacteria | 5926163 |
| 1822 | 2923524891 | 2923519811 | Bacteria | 6298479 |
| 1823 | 2923590368 | 2923586266 | Bacteria | 6565975 |
| 1824 | 2926063416 | 2926063275 | Bacteria | 5285848 |
| 1825 | 2928132573 | 2928130867 | Bacteria | 5467269 |
| 1826 | 2929149041 | 2929144301 | Bacteria | 6622272 |
| 1827 | 2929190961 | 2929189879 | Bacteria | 5930554 |
| 1828 | 2931373538 | 2931369376 | Bacteria | 6847892 |
| 1829 | 2931391953 | 2931390751 | Bacteria | 6273349 |
| 1830 | 2931399419 | 2931396565 | Bacteria | 7251677 |
| 1831 | 2935353922 | 2935353572 | Unclassified | 6955622 |
| 1832 | 2937970756 | 2937967321 | Bacteria | 5094075 |
| 1833 | 2939637013 | 2939636861 | Bacteria | 6297853 |
| 1834 | 2939652657 | 2939651529 | Bacteria | 5895393 |
| 1835 | 2945929619 | 2945928738 | Bacteria | 6053221 |
| 1836 | 2945965869 | 2945961074 | Bacteria | 7342064 |
| 1837 | 2946011903 | 2946006987 | Bacteria | 6705746 |
| 1838 | 2946029208 | 2946027586 | Bacteria | 6049274 |
| 1839 | 2947235754 | 2947233263 | Bacteria | 6439278 |
| 1840 | 2952255420 | 2952252522 | Bacteria | 4171745 |
| 1841 | 2969305563 | 2969304461 | Bacteria | 6601805 |
| 1842 | 2974292806 | 2974289157 | Bacteria | 6080362 |
| 1843 | 2974298621 | 2974298342 | Bacteria | 4840922 |
| 1844 | 2984291400 | 2984286254 | Bacteria | 6702062 |
| 1845 | 2984500866 | 2984499530 | Bacteria | 5020881 |
| 1846 | 2984505690 | 2984504281 | Bacteria | 5262371 |
| 1847 | 2984570030 | 2984568884 | Bacteria | 3884413 |
| 1848 | 2988730640 | 2988728565 | Bacteria | 6124362 |
| 1849 | 2990200730 | 2990196909 | Bacteria | 4054280 |
| 1850 | 2998141002 | 2998139840 | Bacteria | 6073514 |
| 1851 | 3007256024 | 3007252601 | Bacteria | 4559114 |
| 1852 | 3007319905 | 3007315729 | Bacteria | 5076637 |
| 1853 | 3007400160 | 3007395558 | Bacteria | 6755444 |
| 1854 | 3007424966 | 3007419365 | Bacteria | 7026924 |
| 1855 | 3007512312 | 3007511990 | Bacteria | 6481491 |
| 1856 | 3007618704 | 3007614139 | Bacteria | 6053559 |
| 1857 | 3007624460 | 3007619802 | Bacteria | 6411688 |
| 1858 | 3007719751 | 3007718800 | Bacteria | 5971527 |
| 1859 | 3007860890 | 3007855910 | Bacteria | 5637581 |
| 1860 | 3007863775 | 3007861166 | Bacteria | 6045338 |
| 1861 | 3007867618 | 3007866637 | Bacteria | 5899198 |
| 1862 | 3007873329 | 3007872151 | Bacteria | 5268868 |
| 1863 | 637318365 | 637000220 | Bacteria | 7074893 |
| 1864 | 640487126 | 640427133 | Bacteria | 4567418 |
| 1865 | 651174998 | 651053060 | Bacteria | 4689946 |
| 1866 | 8004597851 | 8004592986 | Bacteria | 5122074 |
| 1867 | 8011353729 | 8011350971 | Bacteria | 6158957 |
| 1868 | 8015396124 | 8015394850 | Bacteria | 5064660 |
| 1869 | 8016732377 | 8016728285 | Bacteria | 5263933 |
| 1870 | 8016737263 | 8016733728 | Bacteria | 5274317 |
| 1871 | 8019502464 | 8019499862 | Bacteria | 5169538 |
| 1872 | 8019772409 | 8019769354 | Bacteria | 6924660 |
| 1873 | 8019776575 | 8019775933 | Bacteria | 6858656 |
| 1874 | 8029999757 | 8029995093 | Bacteria | 5990776 |
| 1875 | 8033233547 | 8033232454 | Bacteria | 3202805 |
| 1876 | 8034962999 | 8034962539 | Bacteria | 4884839 |
| 1877 | 8048749691 | 8048746797 | Bacteria | 3557226 |
| 1878 | 8052495524 | 8052494512 | Bacteria | 5765634 |
| 1879 | 8054290160 | 8054285046 | Bacteria | 6919322 |
| 1880 | 8054352623 | 8054347763 | Bacteria | 5901107 |
| 1881 | 8054359369 | 8054357960 | Bacteria | 2867777 |
| 1882 | 8054504546 | 8054503363 | Bacteria | 6101651 |
| 1883 | 8054933046 | 8054929484 | Bacteria | 5599761 |
| 1884 | 8055771983 | 8055770955 | Bacteria | 6827675 |
| 1885 | 8055818979 | 8055817908 | Bacteria | 6609162 |
| 1886 | 8055883748 | 8055878733 | Bacteria | 5907058 |
| 1887 | 8056117225 | 8056115690 | Bacteria | 5527654 |
| 1888 | 8056121712 | 8056120720 | Bacteria | 5758328 |
| 1889 | 8056130834 | 8056125926 | Bacteria | 6228218 |
| 1890 | 8056132864 | 8056131705 | Bacteria | 6107031 |
| 1891 | 8056138373 | 8056137416 | Bacteria | 6147080 |
| 1892 | 8056144352 | 8056143049 | Bacteria | 6307666 |
| 1893 | 8056149064 | 8056148874 | Bacteria | 6479865 |
| 1894 | 8056161134 | 8056155041 | Bacteria | 6486948 |
| 1895 | 8056161272 | 8056161164 | Bacteria | 6106669 |
| 1896 | 8056170048 | 8056166840 | Bacteria | 5820959 |
| 1897 | 8056176177 | 8056172158 | Bacteria | 6133900 |
| 1898 | 8056183447 | 8056177738 | Bacteria | 6748268 |
| 1899 | 8056569656 | 8056569372 | Bacteria | 5997322 |
| 1900 | 8057803277 | 8057798959 | Bacteria | 6713499 |
| 1901 | Ga0501037_0156224 | |||
| 1902 | RicEn_C2037 | |||
| 1903 | MRS2a_Contig_755 | |||
| 1904 | SwRhRL2b_contig_1713675 | |||
| 1905 | SwRhRL2b_contig_2371853 | |||
| 1906 | SwRhRL2b_contig_546740 | |||
| 1907 | SwRhRL2b_contig_815985 | |||
| 1908 | SwRhRL2b_contig_849631 | |||
| 1909 | JGI24740J21852_10000774 | |||
| 1910 | JGI25162J39368_1000101 | |||
| 1911 | JGI25162J39368_1000200 | |||
| 1912 | JGI25163J39215_1000001 | |||
| 1913 | JGI25163J39215_1001259 | |||
| 1914 | JGI25163J39215_1001987 | |||
| 1915 | JGI25164J39214_1000001 | |||
| 1916 | JGI25164J39214_1000097 | |||
| 1917 | JGI25164J39214_1000162 | |||
| 1918 | JGI25165J46597_1000184 | |||
| 1919 | JGI25165J46597_1000294 | |||
| 1920 | rootH1_10196713 | |||
| 1921 | Ga0055538_1000004 | |||
| 1922 | Ga0055538_1000016 | |||
| 1923 | Ga0055538_1000029 | |||
| 1924 | Ga0055538_1001305 | |||
| 1925 | Ga0055538_1005579 | |||
| 1926 | Ga0055539_1000004 | |||
| 1927 | Ga0055539_1000021 | |||
| 1928 | Ga0055539_1000039 | |||
| 1929 | Ga0055539_1000095 | |||
| 1930 | Ga0055533_1000007 | |||
| 1931 | Ga0055533_1000029 | |||
| 1932 | Ga0055533_1000049 | |||
| 1933 | Ga0055533_1003060 | |||
| 1934 | Ga0055533_1008731 | |||
| 1935 | Ga0055532_1000058 | |||
| 1936 | Ga0055532_1000306 | |||
| 1937 | Ga0055525_1000007 | |||
| 1938 | Ga0055525_1000033 | |||
| 1939 | Ga0055525_1000281 | |||
| 1940 | Ga0055525_1000322 | |||
| 1941 | Ga0055527_1001381 | |||
| 1942 | Ga0055535_1000041 | |||
| 1943 | Ga0055529_1000077 | |||
| 1944 | Ga0055536_1000062 | |||
| 1945 | Ga0055536_1014462 | |||
| 1946 | Ga0055530_10000489 | |||
| 1947 | Ga0055530_10001123 | |||
| 1948 | Ga0055530_10001872 | |||
| 1949 | Ga0055530_10008693 | |||
| 1950 | Ga0055540_1000512 | |||
| 1951 | Ga0055540_1000517 | |||
| 1952 | Ga0055540_1001386 | |||
| 1953 | Ga0055531_10000707 | |||
| 1954 | Ga0055541_1000004 | |||
| 1955 | Ga0055541_1000026 | |||
| 1956 | Ga0055541_1000045 | |||
| 1957 | Ga0055541_1002616 | |||
| 1958 | Ga0058692_1002136 | |||
| 1959 | Ga0058692_1011133 | |||
| 1960 | Ga0058692_1023389 | |||
| 1961 | Ga0058692_1031672 | |||
| 1962 | Ga0065714_10004246 | |||
| 1963 | Ga0065714_10008068 | |||
| 1964 | Ga0065714_10021664 | |||
| 1965 | Ga0065714_10158041 | |||
| 1966 | Ga0065704_10000047 | |||
| 1967 | Ga0065704_10007942 | |||
| 1968 | Ga0065704_10009984 | |||
| 1969 | Ga0065704_10034929 | |||
| 1970 | Ga0065704_10076354 | |||
| 1971 | Ga0065704_10081280 | |||
| 1972 | Ga0065704_10194578 | |||
| 1973 | Ga0065712_10000745 | |||
| 1974 | Ga0065712_10067926 | |||
| 1975 | Ga0070670_100000002 | |||
| 1976 | Ga0070670_100018557 | |||
| 1977 | Ga0070666_10013660 | |||
| 1978 | Ga0070682_100154681 | |||
| 1979 | Ga0070660_100001483 | |||
| 1980 | Ga0070661_100000301 | |||
| 1981 | Ga0070661_100000333 | |||
| 1982 | Ga0070661_100015613 | |||
| 1983 | Ga0070668_100001689 | |||
| 1984 | Ga0070669_100004323 | |||
| 1985 | Ga0070669_100012110 | |||
| 1986 | Ga0070671_100000023 | |||
| 1987 | Ga0070667_100000018 | |||
| 1988 | Ga0070663_100000025 | |||
| 1989 | Ga0070662_100013363 | |||
| 1990 | Ga0070662_100265268 | |||
| 1991 | Ga0068853_100000548 | |||
| 1992 | Ga0070665_100005073 | |||
| 1993 | Ga0070665_100005453 | |||
| 1994 | Ga0070665_100010581 | |||
| 1995 | Ga0070665_100048104 | |||
| 1996 | Ga0070665_101000163 | |||
| 1997 | Ga0068855_100000675 | |||
| 1998 | Ga0068855_100061794 | |||
| 1999 | Ga0070664_100000020 | |||
| 2000 | Ga0070664_100001427 | |||
| 2001 | Ga0068857_100024808 | |||
| 2002 | Ga0068854_100019484 | |||
| 2003 | Ga0068856_100002818 | |||
| 2004 | Ga0068856_100427809 | |||
| 2005 | Ga0068852_100077074 | |||
| 2006 | Ga0068859_100008851 | |||
| 2007 | Ga0068864_100000003 | |||
| 2008 | Ga0068851_10000006 | |||
| 2009 | Ga0068851_10013718 | |||
| 2010 | Ga0068851_10112256 | |||
| 2011 | Ga0068858_100249879 | |||
| 2012 | Ga0068862_100025576 | |||
| 2013 | Ga0075365_10026264 | |||
| 2014 | Ga0075365_10132427 | |||
| 2015 | Ga0075365_10203440 | |||
| 2016 | Ga0075363_100241739 | |||
| 2017 | Ga0075364_10149551 | |||
| 2018 | Ga0075432_10007845 | |||
| 2019 | Ga0075432_10072999 | |||
| 2020 | Ga0075432_10087344 | |||
| 2021 | Ga0075432_10105065 | |||
| 2022 | Ga0075362_10099623 | |||
| 2023 | Ga0075367_10420614 | |||
| 2024 | Ga0075369_10018482 | |||
| 2025 | Ga0075369_10035729 | |||
| 2026 | Ga0075366_10009474 | |||
| 2027 | Ga0075366_10101623 | |||
| 2028 | Ga0075366_10295003 | |||
| 2029 | Ga0075370_10051217 | |||
| 2030 | Ga0075436_100284952 | |||
| 2031 | Ga0097620_100008853 | |||
| 2032 | Ga0099823_1000030 | |||
| 2033 | Ga0099823_1042999 | |||
| 2034 | Ga0079104_1000168 | |||
| 2035 | Ga0079104_1000385 | |||
| 2036 | Ga0079104_1000403 | |||
| 2037 | Ga0079104_1002852 | |||
| 2038 | Ga0079104_1006904 | |||
| 2039 | Ga0079104_1012030 | |||
| 2040 | Ga0079104_1012282 | |||
| 2041 | Ga0079104_1016758 | |||
| 2042 | Ga0079104_1017323 | |||
| 2043 | Ga0079104_1018465 | |||
| 2044 | Ga0105251_10000012 | |||
| 2045 | Ga0105251_10002077 | |||
| 2046 | Ga0105251_10002215 | |||
| 2047 | Ga0105251_10002730 | |||
| 2048 | Ga0105251_10005690 | |||
| 2049 | Ga0105251_10009746 | |||
| 2050 | Ga0105251_10009754 | |||
| 2051 | Ga0105251_10011231 | |||
| 2052 | Ga0105251_10011554 | |||
| 2053 | Ga0105251_10011737 | |||
| 2054 | Ga0105251_10014335 | |||
| 2055 | Ga0105251_10014617 | |||
| 2056 | Ga0105251_10017600 | |||
| 2057 | Ga0105251_10021619 | |||
| 2058 | Ga0105251_10024041 | |||
| 2059 | Ga0105251_10032661 | |||
| 2060 | Ga0105251_10039806 | |||
| 2061 | Ga0105251_10053039 | |||
| 2062 | Ga0105244_10000023 | |||
| 2063 | Ga0105244_10001452 | |||
| 2064 | Ga0105244_10001671 | |||
| 2065 | Ga0105244_10002529 | |||
| 2066 | Ga0105244_10003779 | |||
| 2067 | Ga0105244_10005545 | |||
| 2068 | Ga0105244_10005824 | |||
| 2069 | Ga0105244_10007416 | |||
| 2070 | Ga0105244_10009674 | |||
| 2071 | Ga0105244_10018532 | |||
| 2072 | Ga0105244_10018578 | |||
| 2073 | Ga0105244_10019901 | |||
| 2074 | Ga0105244_10023412 | |||
| 2075 | Ga0105244_10030030 | |||
| 2076 | Ga0105244_10030333 | |||
| 2077 | Ga0105244_10036976 | |||
| 2078 | Ga0105244_10042870 | |||
| 2079 | Ga0105244_10042940 | |||
| 2080 | Ga0105244_10054573 | |||
| 2081 | Ga0105244_10067777 | |||
| 2082 | Ga0105244_10067921 | |||
| 2083 | Ga0105244_10112293 | |||
| 2084 | Ga0105244_10153630 | |||
| 2085 | Ga0105244_10160075 | |||
| 2086 | Ga0105250_10001306 | |||
| 2087 | Ga0105250_10001831 | |||
| 2088 | Ga0105250_10003516 | |||
| 2089 | Ga0105250_10004197 | |||
| 2090 | Ga0105250_10009887 | |||
| 2091 | Ga0105250_10011683 | |||
| 2092 | Ga0105250_10013576 | |||
| 2093 | Ga0105250_10013804 | |||
| 2094 | Ga0105250_10018342 | |||
| 2095 | Ga0105250_10030575 | |||
| 2096 | Ga0105250_10034666 | |||
| 2097 | Ga0105250_10038896 | |||
| 2098 | Ga0105240_10076651 | |||
| 2099 | Ga0105240_10128178 | |||
| 2100 | Ga0105247_10000387 | |||
| 2101 | Ga0105247_10000503 | |||
| 2102 | Ga0105247_10010966 | |||
| 2103 | Ga0105243_10000010 | |||
| 2104 | Ga0105243_10000183 | |||
| 2105 | Ga0105243_10000459 | |||
| 2106 | Ga0105243_10003177 | |||
| 2107 | Ga0105243_10014014 | |||
| 2108 | Ga0105243_10022231 | |||
| 2109 | Ga0105243_10030478 | |||
| 2110 | Ga0105243_10046020 | |||
| 2111 | Ga0105243_10051228 | |||
| 2112 | Ga0105243_10087617 | |||
| 2113 | Ga0105241_10000008 | |||
| 2114 | Ga0105237_10002940 | |||
| 2115 | Ga0105237_10028696 | |||
| 2116 | Ga0105237_10067376 | |||
| 2117 | Ga0105237_10460286 | |||
| 2118 | Ga0105238_10001371 | |||
| 2119 | Ga0105249_10001247 | |||
| 2120 | Ga0105249_10031491 | |||
| 2121 | Ga0105249_10052157 | |||
| 2122 | Ga0105239_10029711 | |||
| 2123 | Ga0105246_10001380 | |||
| 2124 | Ga0105246_10024118 | |||
| 2125 | Ga0105246_10058234 | |||
| 2126 | Ga0105246_10064097 | |||
| 2127 | Ga0105246_10101596 | |||
| 2128 | Ga0105246_10117902 | |||
| 2129 | Ga0157345_1000614 | |||
| 2130 | Ga0157345_1000850 | |||
| 2131 | Ga0157373_10001252 | |||
| 2132 | Ga0157373_10001401 | |||
| 2133 | Ga0157373_10003766 | |||
| 2134 | Ga0157373_10008149 | |||
| 2135 | Ga0157373_10011772 | |||
| 2136 | Ga0157373_10017447 | |||
| 2137 | Ga0157373_10018566 | |||
| 2138 | Ga0157373_10020384 | |||
| 2139 | Ga0157373_10028219 | |||
| 2140 | Ga0157373_10035371 | |||
| 2141 | Ga0157373_10043357 | |||
| 2142 | Ga0157373_10043583 | |||
| 2143 | Ga0157373_10053843 | |||
| 2144 | Ga0157373_10104408 | |||
| 2145 | Ga0157371_10000082 | |||
| 2146 | Ga0157371_10000227 | |||
| 2147 | Ga0157371_10000267 | |||
| 2148 | Ga0157371_10001526 | |||
| 2149 | Ga0157371_10002569 | |||
| 2150 | Ga0157371_10003239 | |||
| 2151 | Ga0157371_10004478 | |||
| 2152 | Ga0157371_10020913 | |||
| 2153 | Ga0157371_10023863 | |||
| 2154 | Ga0157371_10050700 | |||
| 2155 | Ga0157371_10054498 | |||
| 2156 | Ga0157371_10100910 | |||
| 2157 | Ga0157370_10000052 | |||
| 2158 | Ga0157370_10000276 | |||
| 2159 | Ga0157370_10000423 | |||
| 2160 | Ga0157370_10004198 | |||
| 2161 | Ga0157370_10041146 | |||
| 2162 | Ga0157370_10052423 | |||
| 2163 | Ga0157370_10095083 | |||
| 2164 | Ga0157370_10113731 | |||
| 2165 | Ga0157370_10144517 | |||
| 2166 | Ga0157370_10212977 | |||
| 2167 | Ga0157370_10803772 | |||
| 2168 | Ga0157369_10000183 | |||
| 2169 | Ga0157369_10030052 | |||
| 2170 | Ga0157369_10085606 | |||
| 2171 | Ga0157369_10122993 | |||
| 2172 | Ga0157369_10143426 | |||
| 2173 | Ga0157369_10160005 | |||
| 2174 | Ga0163162_10011360 | |||
| 2175 | Ga0163162_10056413 | |||
| 2176 | Ga0163162_10272367 | |||
| 2177 | Ga0163162_10463514 | |||
| 2178 | Ga0157372_10000122 | |||
| 2179 | Ga0157372_10004149 | |||
| 2180 | Ga0157372_10015434 | |||
| 2181 | Ga0157372_10031809 | |||
| 2182 | Ga0157372_10041575 | |||
| 2183 | Ga0157372_10191917 | |||
| 2184 | Ga0157372_10222969 | |||
| 2185 | Ga0157372_11079318 | |||
| 2186 | Ga0157375_10054549 | |||
| 2187 | Ga0157375_10055844 | |||
| 2188 | Ga0163163_10000537 | |||
| 2189 | Ga0182008_10000521 | |||
| 2190 | Ga0182008_10009519 | |||
| 2191 | Ga0182008_10010562 | |||
| 2192 | Ga0182008_10012395 | |||
| 2193 | Ga0182008_10012471 | |||
| 2194 | Ga0182008_10015538 | |||
| 2195 | Ga0182008_10017847 | |||
| 2196 | Ga0182008_10017993 | |||
| 2197 | Ga0182008_10018883 | |||
| 2198 | Ga0182008_10018911 | |||
| 2199 | Ga0182008_10035557 | |||
| 2200 | Ga0182008_10066853 | |||
| 2201 | Ga0182008_10096618 | |||
| 2202 | Ga0182008_10244673 | |||
| 2203 | Ga0182006_1002768 | |||
| 2204 | Ga0182006_1003167 | |||
| 2205 | Ga0182006_1004442 | |||
| 2206 | Ga0182006_1007457 | |||
| 2207 | Ga0182006_1007919 | |||
| 2208 | Ga0182006_1009307 | |||
| 2209 | Ga0182006_1010433 | |||
| 2210 | Ga0182006_1010488 | |||
| 2211 | Ga0182006_1011910 | |||
| 2212 | Ga0182006_1018147 | |||
| 2213 | Ga0182006_1027976 | |||
| 2214 | Ga0182007_10004641 | |||
| 2215 | Ga0182007_10012461 | |||
| 2216 | Ga0182007_10025468 | |||
| 2217 | Ga0182005_1005476 | |||
| 2218 | Ga0182005_1005499 | |||
| 2219 | Ga0182005_1018678 | |||
| 2220 | Ga0183366_1003 | |||
| 2221 | Ga0183370_1003 | |||
| 2222 | Ga0183369_1005 | |||
| 2223 | Ga0183368_1006 | |||
| 2224 | Ga0163161_10000002 | |||
| 2225 | Ga0163161_10016791 | |||
| 2226 | Ga0163161_10024045 | |||
| 2227 | Ga0163161_10105726 | |||
| 2228 | Ga0163161_10145423 | |||
| 2229 | Ga0163161_10308856 | |||
| 2230 | Ga0163161_10332919 | |||
| 2231 | Ga0154015_1159086 | |||
| 2232 | Ga0213872_10001121 | |||
| 2233 | Ga0213876_10000026 | |||
| 2234 | Ga0209435_100999 | |||
| 2235 | Ga0209760_100063 | |||
| 2236 | Ga0209760_100124 | |||
| 2237 | Ga0209760_100344 | |||
| 2238 | Ga0209784_100001 | |||
| 2239 | Ga0209784_100033 | |||
| 2240 | Ga0209784_100045 | |||
| 2241 | Ga0209784_100055 | |||
| 2242 | Ga0209784_100466 | |||
| 2243 | Ga0209784_100820 | |||
| 2244 | Ga0209566_100001 | |||
| 2245 | Ga0209566_100002 | |||
| 2246 | Ga0209566_100037 | |||
| 2247 | Ga0209566_100057 | |||
| 2248 | Ga0209566_101976 | |||
| 2249 | Ga0209674_100002 | |||
| 2250 | Ga0209674_100055 | |||
| 2251 | Ga0209674_100080 | |||
| 2252 | Ga0209674_100090 | |||
| 2253 | Ga0209672_100122 | |||
| 2254 | Ga0209147_100002 | |||
| 2255 | Ga0209147_100079 | |||
| 2256 | Ga0209563_100008 | |||
| 2257 | Ga0209563_100056 | |||
| 2258 | Ga0209563_100078 | |||
| 2259 | Ga0209563_100095 | |||
| 2260 | Ga0209563_100198 | |||
| 2261 | Ga0209563_101685 | |||
| 2262 | Ga0207427_100001 | |||
| 2263 | Ga0207427_100002 | |||
| 2264 | Ga0207427_100004 | |||
| 2265 | Ga0209437_100003 | |||
| 2266 | Ga0209437_100028 | |||
| 2267 | Ga0209437_100046 | |||
| 2268 | Ga0209437_102014 | |||
| 2269 | Ga0209258_100002 | |||
| 2270 | Ga0209258_100434 | |||
| 2271 | Ga0207425_1027285 | |||
| 2272 | Ga0207425_1028375 | |||
| 2273 | Ga0209646_1000286 | |||
| 2274 | Ga0209677_100004 | |||
| 2275 | Ga0209677_100034 | |||
| 2276 | Ga0209677_100045 | |||
| 2277 | Ga0209677_100069 | |||
| 2278 | Ga0209148_1003220 | |||
| 2279 | Ga0209759_1001589 | |||
| 2280 | Ga0209759_1002841 | |||
| 2281 | Ga0209759_1007593 | |||
| 2282 | Ga0209759_1015826 | |||
| 2283 | Ga0209129_1000008 | |||
| 2284 | Ga0209233_1000007 | |||
| 2285 | Ga0209233_1000008 | |||
| 2286 | Ga0209233_1001593 | |||
| 2287 | Ga0209455_1000009 | |||
| 2288 | Ga0209675_1001127 | |||
| 2289 | Ga0209676_1000056 | |||
| 2290 | Ga0209676_1000078 | |||
| 2291 | Ga0209676_1000101 | |||
| 2292 | Ga0209676_1001035 | |||
| 2293 | Ga0209676_1005680 | |||
| 2294 | Ga0209676_1007076 | |||
| 2295 | Ga0209050_1000027 | |||
| 2296 | Ga0209050_1000041 | |||
| 2297 | Ga0209050_1000181 | |||
| 2298 | Ga0209050_1000425 | |||
| 2299 | Ga0209051_1000061 | |||
| 2300 | Ga0209051_1000065 | |||
| 2301 | Ga0209051_1000085 | |||
| 2302 | Ga0209051_1003416 | |||
| 2303 | Ga0209257_1000105 | |||
| 2304 | Ga0209257_1004461 | |||
| 2305 | Ga0207656_10000023 | |||
| 2306 | Ga0207696_1000009 | |||
| 2307 | Ga0207696_1000022 | |||
| 2308 | Ga0207696_1000027 | |||
| 2309 | Ga0207696_1000032 | |||
| 2310 | Ga0207696_1000093 | |||
| 2311 | Ga0207696_1000112 | |||
| 2312 | Ga0207696_1000140 | |||
| 2313 | Ga0207696_1000142 | |||
| 2314 | Ga0207696_1000210 | |||
| 2315 | Ga0207696_1000761 | |||
| 2316 | Ga0207696_1001106 | |||
| 2317 | Ga0207696_1001942 | |||
| 2318 | Ga0207696_1006471 | |||
| 2319 | Ga0207696_1006604 | |||
| 2320 | Ga0207696_1007473 | |||
| 2321 | Ga0207696_1008344 | |||
| 2322 | Ga0207696_1008411 | |||
| 2323 | Ga0207696_1011045 | |||
| 2324 | Ga0207696_1013364 | |||
| 2325 | Ga0207696_1021141 | |||
| 2326 | Ga0207696_1047814 | |||
| 2327 | Ga0207696_1055732 | |||
| 2328 | Ga0207655_1000017 | |||
| 2329 | Ga0207655_1000021 | |||
| 2330 | Ga0207655_1000024 | |||
| 2331 | Ga0207655_1000026 | |||
| 2332 | Ga0207655_1000054 | |||
| 2333 | Ga0207655_1000056 | |||
| 2334 | Ga0207655_1000086 | |||
| 2335 | Ga0207655_1000101 | |||
| 2336 | Ga0207655_1000146 | |||
| 2337 | Ga0207655_1000204 | |||
| 2338 | Ga0207655_1001035 | |||
| 2339 | Ga0207655_1001048 | |||
| 2340 | Ga0207655_1001357 | |||
| 2341 | Ga0207655_1001468 | |||
| 2342 | Ga0207655_1001487 | |||
| 2343 | Ga0207655_1001632 | |||
| 2344 | Ga0207655_1002118 | |||
| 2345 | Ga0207655_1002372 | |||
| 2346 | Ga0207655_1002809 | |||
| 2347 | Ga0207655_1004189 | |||
| 2348 | Ga0207655_1010013 | |||
| 2349 | Ga0207655_1010613 | |||
| 2350 | Ga0207655_1013689 | |||
| 2351 | Ga0207655_1016932 | |||
| 2352 | Ga0207655_1017762 | |||
| 2353 | Ga0207655_1018246 | |||
| 2354 | Ga0207655_1018461 | |||
| 2355 | Ga0207655_1020570 | |||
| 2356 | Ga0207655_1022720 | |||
| 2357 | Ga0207655_1026412 | |||
| 2358 | Ga0207655_1027920 | |||
| 2359 | Ga0207655_1029823 | |||
| 2360 | Ga0207655_1034926 | |||
| 2361 | Ga0207655_1041984 | |||
| 2362 | Ga0207655_1043504 | |||
| 2363 | Ga0207655_1064436 | |||
| 2364 | Ga0207655_1074164 | |||
| 2365 | Ga0207655_1110800 | |||
| 2366 | Ga0207713_1000034 | |||
| 2367 | Ga0207713_1000046 | |||
| 2368 | Ga0207713_1000068 | |||
| 2369 | Ga0207713_1000080 | |||
| 2370 | Ga0207713_1000110 | |||
| 2371 | Ga0207713_1000158 | |||
| 2372 | Ga0207713_1000244 | |||
| 2373 | Ga0207713_1000419 | |||
| 2374 | Ga0207713_1001346 | |||
| 2375 | Ga0207713_1001972 | |||
| 2376 | Ga0207713_1001975 | |||
| 2377 | Ga0207713_1002876 | |||
| 2378 | Ga0207713_1002981 | |||
| 2379 | Ga0207713_1003117 | |||
| 2380 | Ga0207713_1003504 | |||
| 2381 | Ga0207713_1004322 | |||
| 2382 | Ga0207713_1004391 | |||
| 2383 | Ga0207713_1004891 | |||
| 2384 | Ga0207713_1004897 | |||
| 2385 | Ga0207713_1005933 | |||
| 2386 | Ga0207713_1006679 | |||
| 2387 | Ga0207713_1007580 | |||
| 2388 | Ga0207713_1009112 | |||
| 2389 | Ga0207713_1010990 | |||
| 2390 | Ga0207713_1013180 | |||
| 2391 | Ga0207713_1015021 | |||
| 2392 | Ga0207713_1016371 | |||
| 2393 | Ga0207713_1016704 | |||
| 2394 | Ga0207713_1019102 | |||
| 2395 | Ga0207713_1024616 | |||
| 2396 | Ga0207713_1025411 | |||
| 2397 | Ga0207713_1026519 | |||
| 2398 | Ga0207713_1029814 | |||
| 2399 | Ga0207713_1060297 | |||
| 2400 | Ga0207713_1063120 | |||
| 2401 | Ga0207713_1072015 | |||
| 2402 | Ga0207713_1100885 | |||
| 2403 | Ga0207710_10000005 | |||
| 2404 | Ga0207710_10000015 | |||
| 2405 | Ga0207710_10061552 | |||
| 2406 | Ga0207680_10003192 | |||
| 2407 | Ga0207654_10000009 | |||
| 2408 | Ga0207695_10000409 | |||
| 2409 | Ga0207695_10000464 | |||
| 2410 | Ga0207695_10022418 | |||
| 2411 | Ga0207695_10136306 | |||
| 2412 | Ga0207695_10267066 | |||
| 2413 | Ga0207671_10000019 | |||
| 2414 | Ga0207671_10019908 | |||
| 2415 | Ga0207657_10021762 | |||
| 2416 | Ga0207649_10000004 | |||
| 2417 | Ga0207649_10000065 | |||
| 2418 | Ga0207649_10017509 | |||
| 2419 | Ga0207681_10002007 | |||
| 2420 | Ga0207681_10004476 | |||
| 2421 | Ga0207694_10001679 | |||
| 2422 | Ga0207650_10000003 | |||
| 2423 | Ga0207650_10000183 | |||
| 2424 | Ga0207650_10008433 | |||
| 2425 | Ga0207644_10000027 | |||
| 2426 | Ga0207690_10277642 | |||
| 2427 | Ga0207706_10015738 | |||
| 2428 | Ga0207706_10039228 | |||
| 2429 | Ga0207709_10000001 | |||
| 2430 | Ga0207709_10000067 | |||
| 2431 | Ga0207709_10000396 | |||
| 2432 | Ga0207709_10005426 | |||
| 2433 | Ga0207709_10006784 | |||
| 2434 | Ga0207709_10008031 | |||
| 2435 | Ga0207709_10052375 | |||
| 2436 | Ga0207709_10102522 | |||
| 2437 | Ga0207711_10000845 | |||
| 2438 | Ga0207679_10000019 | |||
| 2439 | Ga0207679_10000028 | |||
| 2440 | Ga0207679_10005708 | |||
| 2441 | Ga0207667_10000073 | |||
| 2442 | Ga0207667_10000076 | |||
| 2443 | Ga0207667_10000147 | |||
| 2444 | Ga0207667_10000166 | |||
| 2445 | Ga0207712_10054644 | |||
| 2446 | Ga0207712_10074311 | |||
| 2447 | Ga0207668_10002127 | |||
| 2448 | Ga0207640_10000078 | |||
| 2449 | Ga0207658_10000004 | |||
| 2450 | Ga0207639_10000547 | |||
| 2451 | Ga0207678_10000136 | |||
| 2452 | Ga0207702_10000149 | |||
| 2453 | Ga0207641_10076332 | |||
| 2454 | Ga0207641_10076333 | |||
| 2455 | Ga0207676_10000003 | |||
| 2456 | Ga0207674_10000009 | |||
| 2457 | Ga0207674_10063507 | |||
| 2458 | Ga0207674_10450750 | |||
| 2459 | Ga0207698_10123753 | |||
| 2460 | Ga0209281_1000015 | |||
| 2461 | Ga0209281_1000049 | |||
| 2462 | Ga0209281_1000054 | |||
| 2463 | Ga0209281_1000058 | |||
| 2464 | Ga0209281_1000060 | |||
| 2465 | Ga0209281_1000120 | |||
| 2466 | Ga0209281_1000223 | |||
| 2467 | Ga0209281_1000648 | |||
| 2468 | Ga0209281_1000822 | |||
| 2469 | Ga0209281_1000854 | |||
| 2470 | Ga0209281_1001003 | |||
| 2471 | Ga0209281_1001185 | |||
| 2472 | Ga0209281_1009430 | |||
| 2473 | Ga0209281_1024966 | |||
| 2474 | Ga0209973_1005686 | |||
| 2475 | Ga0209389_1000002 | |||
| 2476 | Ga0209389_1101587 | |||
| 2477 | Ga0209371_1000008 | |||
| 2478 | Ga0209371_1000014 | |||
| 2479 | Ga0209371_1000030 | |||
| 2480 | Ga0209371_1000053 | |||
| 2481 | Ga0209371_1000054 | |||
| 2482 | Ga0209371_1000111 | |||
| 2483 | Ga0209371_1000123 | |||
| 2484 | Ga0209371_1000197 | |||
| 2485 | Ga0209371_1000264 | |||
| 2486 | Ga0209371_1000495 | |||
| 2487 | Ga0209371_1000544 | |||
| 2488 | Ga0209371_1000563 | |||
| 2489 | Ga0209371_1000655 | |||
| 2490 | Ga0209371_1001916 | |||
| 2491 | Ga0209371_1002190 | |||
| 2492 | Ga0209371_1002345 | |||
| 2493 | Ga0209371_1003937 | |||
| 2494 | Ga0209371_1007145 | |||
| 2495 | Ga0209371_1009009 | |||
| 2496 | Ga0209371_1012021 | |||
| 2497 | Ga0209984_1000531 | |||
| 2498 | Ga0209999_1000664 | |||
| 2499 | Ga0209982_1001053 | |||
| 2500 | Ga0210002_1000988 | |||
| 2501 | Ga0209983_1000183 | |||
| 2502 | Ga0209971_1004691 | |||
| 2503 | Ga0209974_10001803 | |||
| 2504 | Ga0207428_10032458 | |||
| 2505 | Ga0207428_10032996 | |||
| 2506 | Ga0207428_10037197 | |||
| 2507 | Ga0207428_10054198 | |||
| 2508 | Ga0268266_10000290 | |||
| 2509 | Ga0268266_10002297 | |||
| 2510 | Ga0268266_10015754 | |||
| 2511 | Ga0268266_10026046 | |||
| 2512 | Ga0268266_10172067 | |||
| 2513 | Ga0268266_10534908 | |||
| 2514 | Ga0268265_10000856 | |||
| 2515 | Ga0307517_10246300 | |||
| 2516 | Ga0268256_1000009 | |||
| 2517 | Ga0268256_1000012 | |||
| 2518 | Ga0268256_1000021 | |||
| 2519 | Ga0268256_1000025 | |||
| 2520 | Ga0268256_1000053 | |||
| 2521 | Ga0268256_1000095 | |||
| 2522 | Ga0268256_1000147 | |||
| 2523 | Ga0268256_1000150 | |||
| 2524 | Ga0268256_1000426 | |||
| 2525 | Ga0268256_1000462 | |||
| 2526 | Ga0268256_1000488 | |||
| 2527 | Ga0268256_1000560 | |||
| 2528 | Ga0268256_1001337 | |||
| 2529 | Ga0268256_1001950 | |||
| 2530 | Ga0268256_1002082 | |||
| 2531 | Ga0268256_1004727 | |||
| 2532 | Ga0268256_1006244 | |||
| 2533 | Ga0268256_1008572 | |||
| 2534 | Ga0268256_1009489 | |||
| 2535 | Ga0268256_1012535 | |||
| 2536 | Ga0268256_1015669 | |||
| 2537 | Ga0268256_1032480 | |||
| 2538 | Ga0307511_10008822 | |||
| 2539 | Ga0307511_10078177 | |||
| 2540 | Ga0314311_1140123 | |||
| 2541 | Ga0316179_1038930 | |||
| 2542 | Ga0316179_1063794 | |||
| 2543 | Ga0316178_1042939 | |||
| 2544 | Ga0316181_1165376 | |||
| 2545 | Ga0307408_100000020 | |||
| 2546 | Ga0307408_100027803 | |||
| 2547 | Ga0307408_100042393 | |||
| 2548 | Ga0307408_100066951 | |||
| 2549 | Ga0307408_100074200 | |||
| 2550 | Ga0307408_100090278 | |||
| 2551 | Ga0307408_100171090 | |||
| 2552 | Ga0316575_10088156 | |||
| 2553 | Ga0316579_10000983 | |||
| 2554 | Ga0316576_10010811 | |||
| 2555 | Ga0316576_10176831 | |||
| 2556 | Ga0316576_10212105 | |||
| 2557 | Ga0316578_10010544 | |||
| 2558 | Ga0307405_10020488 | |||
| 2559 | Ga0307405_10027086 | |||
| 2560 | Ga0307405_10028691 | |||
| 2561 | Ga0307405_10039569 | |||
| 2562 | Ga0316577_10038935 | |||
| 2563 | Ga0307413_10028925 | |||
| 2564 | Ga0307413_10056805 | |||
| 2565 | Ga0307406_10000214 | |||
| 2566 | Ga0307406_10026044 | |||
| 2567 | Ga0307406_10029392 | |||
| 2568 | Ga0307406_10031353 | |||
| 2569 | Ga0307407_10040421 | |||
| 2570 | Ga0307412_10017149 | |||
| 2571 | Ga0307412_10019213 | |||
| 2572 | Ga0307412_10026364 | |||
| 2573 | Ga0307412_10293159 | |||
| 2574 | Ga0307412_10304819 | |||
| 2575 | Ga0307409_100063336 | |||
| 2576 | Ga0307409_100077387 | |||
| 2577 | Ga0307416_100142353 | |||
| 2578 | Ga0307414_10025040 | |||
| 2579 | Ga0307414_10060311 | |||
| 2580 | Ga0307414_10086911 | |||
| 2581 | Ga0307414_10237716 | |||
| 2582 | Ga0307414_10311378 | |||
| 2583 | Ga0307414_10396485 | |||
| 2584 | Ga0307411_10038323 | |||
| 2585 | Ga0307411_10041586 | |||
| 2586 | Ga0307411_10752877 | |||
| 2587 | Ga0307507_10127385 | |||
| 2588 | Ga0307510_10143213 | |||
| 2589 | Ga0316596_1032043 | |||
| 2590 | Ga0316574_0006631 | |||
| 2591 | Ga0316574_0062433 | |||
| 2592 | Ga0316574_0099514 | |||
| 2593 | Ga0316584_0012843 | |||
| 2594 | Ga0316584_0107626 | |||
| 2595 | Ga0395900_0015391 | |||
| 2596 | Ga0395900_0035199 | |||
| 2597 | Ga0395900_0136373 | |||
| 2598 | Ga0395898_0011048 | |||
| 2599 | Ga0395905_0002252 | |||
| 2600 | Ga0395905_0167700 | |||
| 2601 | Ga0395905_0553874 | |||
| 2602 | Ga0316581_0012087 | |||
| 2603 | Ga0395901_0211183 | |||
| 2604 | Ga0395901_0449816 | |||
| 2605 | Ga0395901_0495079 | |||
| 2606 | Ga0237819_01769 | |||
| 2607 | Ga0400484_03045 | |||
| 2608 | Ga0400484_18184 | |||
| 2609 | Ga0400484_43096 | |||
| 2610 | Ga0400490_06176 | |||
| 2611 | Ga0400490_24299 | |||
| 2612 | Ga0400490_30332 | |||
| 2613 | Ga0400490_35159 | |||
| 2614 | Ga0400490_55807 | |||
| 2615 | Ga0400491_03584 | |||
| 2616 | Ga0400491_06675 | |||
| 2617 | Ga0400491_14843 | |||
| 2618 | Ga0400485_06873 | |||
| 2619 | Ga0400485_08794 | |||
| 2620 | Ga0400485_12958 | |||
| 2621 | Ga0400488_02004 | |||
| 2622 | Ga0400488_02668 | |||
| 2623 | Ga0400488_12929 | |||
| 2624 | Ga0400488_14412 | |||
| 2625 | Ga0400488_31699 | |||
| 2626 | Ga0400488_47344 | |||
| 2627 | Ga0400488_58435 | |||
| 2628 | Ga0400486_06238 | |||
| 2629 | Ga0400486_15577 | |||
| 2630 | Ga0400486_19627 | |||
| 2631 | Ga0400486_20464 | |||
| 2632 | Ga0400483_029125 | |||
| 2633 | Ga0400483_038831 | |||
| 2634 | Ga0400483_039221 | |||
| 2635 | Ga0400483_072968 | |||
| 2636 | Ga0400483_092221 | |||
| 2637 | Ga0400483_103276 | |||
| 2638 | Ga0400483_121602 | |||
| 2639 | Ga0400483_139473 | |||
| 2640 | Ga0400483_163413 | |||
| 2641 | Ga0400483_172670 | |||
| 2642 | Ga0400483_174748 | |||
| 2643 | Ga0400483_175769 | |||
| 2644 | Ga0400483_182091 | |||
| 2645 | Ga0400483_191776 | |||
| 2646 | Ga0400483_208650 | |||
| 2647 | Ga0400483_218302 | |||
| 2648 | Ga0400483_224284 | |||
| 2649 | Ga0400483_240204 | |||
| 2650 | Ga0400483_270058 | |||
| 2651 | Ga0400483_291990 | |||
| 2652 | Ga0400487_13538 | |||
| 2653 | Ga0400487_16746 | |||
| 2654 | Ga0400487_17461 | |||
| 2655 | Ga0400487_23517 | |||
| 2656 | Ga0400487_41541 | |||
| 2657 | Ga0400487_48948 | |||
| 2658 | Ga0436365_0084998 | |||
| 2659 | Ga0436361_0771961 | |||
| 2660 | Ga0439436_0009416 | |||
| 2661 | Ga0439438_000003 | |||
| 2662 | Ga0439438_000097 | |||
| 2663 | Ga0439438_000677 | |||
| 2664 | Ga0439438_001150 | |||
| 2665 | Ga0439438_005350 | |||
| 2666 | Ga0439438_006172 | |||
| 2667 | Ga0439438_006967 | |||
| 2668 | Ga0439438_007127 | |||
| 2669 | Ga0439438_008775 | |||
| 2670 | Ga0439438_009618 | |||
| 2671 | Ga0439438_009633 | |||
| 2672 | Ga0439438_011342 | |||
| 2673 | Ga0439438_012081 | |||
| 2674 | Ga0439438_013371 | |||
| 2675 | Ga0439438_029834 | |||
| 2676 | Ga0439438_032844 | |||
| 2677 | Ga0439438_050172 | |||
| 2678 | Ga0439447_001380 | |||
| 2679 | Ga0439447_001672 | |||
| 2680 | Ga0439447_002380 | |||
| 2681 | Ga0439447_002568 | |||
| 2682 | Ga0439447_004684 | |||
| 2683 | Ga0439447_008388 | |||
| 2684 | Ga0439447_011298 | |||
| 2685 | Ga0439447_012199 | |||
| 2686 | Ga0439447_015559 | |||
| 2687 | Ga0439447_033975 | |||
| 2688 | Ga0439466_0000002 | |||
| 2689 | Ga0439466_0000951 | |||
| 2690 | Ga0439466_0002728 | |||
| 2691 | Ga0439466_0005077 | |||
| 2692 | Ga0439466_0005111 | |||
| 2693 | Ga0439466_0014410 | |||
| 2694 | Ga0439466_0017754 | |||
| 2695 | Ga0439466_0021743 | |||
| 2696 | Ga0439466_0026273 | |||
| 2697 | Ga0439466_0042873 | |||
| 2698 | Ga0439465_0006148 | |||
| 2699 | Ga0439431_0003841 | |||
| 2700 | Ga0439437_000031 | |||
| 2701 | Ga0439445_0008797 | |||
| 2702 | Ga0439432_001288 | |||
| 2703 | Ga0439432_001332 | |||
| 2704 | Ga0439432_002603 | |||
| 2705 | Ga0439432_002793 | |||
| 2706 | Ga0439432_004623 | |||
| 2707 | Ga0439432_009265 | |||
| 2708 | Ga0439432_010370 | |||
| 2709 | Ga0439432_010526 | |||
| 2710 | Ga0439432_027767 | |||
| 2711 | Ga0439432_041597 | |||
| 2712 | Ga0439451_000363 | |||
| 2713 | Ga0439451_005039 | |||
| 2714 | Ga0439451_005353 | |||
| 2715 | Ga0439451_015922 | |||
| 2716 | Ga0439452_000004 | |||
| 2717 | Ga0439452_000005 | |||
| 2718 | Ga0439452_000007 | |||
| 2719 | Ga0439452_000056 | |||
| 2720 | Ga0439452_002488 | |||
| 2721 | Ga0439452_002677 | |||
| 2722 | Ga0439452_002683 | |||
| 2723 | Ga0439452_002723 | |||
| 2724 | Ga0439452_003807 | |||
| 2725 | Ga0439452_004121 | |||
| 2726 | Ga0439452_007617 | |||
| 2727 | Ga0439452_008798 | |||
| 2728 | Ga0439452_015737 | |||
| 2729 | Ga0439452_026896 | |||
| 2730 | Ga0439455_0007982 | |||
| 2731 | Ga0439456_000105 | |||
| 2732 | Ga0439456_002230 | |||
| 2733 | Ga0439456_002948 | |||
| 2734 | Ga0439456_005096 | |||
| 2735 | Ga0439456_007659 | |||
| 2736 | Ga0439456_010631 | |||
| 2737 | Ga0439463_000932 | |||
| 2738 | Ga0439463_000938 | |||
| 2739 | Ga0439463_002058 | |||
| 2740 | Ga0439463_002320 | |||
| 2741 | Ga0439463_026577 | |||
| 2742 | Ga0450911_000026 | |||
| 2743 | Ga0450911_001732 | |||
| 2744 | Ga0450911_001842 | |||
| 2745 | Ga0450920_003985 | |||
| 2746 | Ga0450890_001116 | |||
| 2747 | Ga0450891_002000 | |||
| 2748 | Ga0450903_006951 | |||
| 2749 | Ga0450904_000063 | |||
| 2750 | Ga0450906_000870 | |||
| 2751 | Ga0450907_000028 | |||
| 2752 | Ga0450907_000284 | |||
| 2753 | Ga0450907_001825 | |||
| 2754 | Ga0450907_002410 | |||
| 2755 | Ga0450910_000492 | |||
| 2756 | Ga0450910_001473 | |||
| 2757 | Ga0450910_004193 | |||
| 2758 | Ga0439446_0003445 | |||
| 2759 | Ga0439446_0004054 | |||
| 2760 | Ga0439446_0005083 | |||
| 2761 | Ga0450909_000178 | |||
| 2762 | Ga0450909_002015 | |||
| 2763 | Ga0439434_0004912 | |||
| 2764 | Ga0439434_0006342 | |||
| 2765 | Ga0439464_0002752 | |||
| 2766 | Ga0439464_0003192 | |||
| 2767 | Ga0439464_0005073 | |||
| 2768 | Ga0439460_0001080 | |||
| 2769 | Ga0439460_0001312 | |||
| 2770 | Ga0439460_0002077 | |||
| 2771 | Ga0450893_0001886 | |||
| 2772 | Ga0450901_001007 | |||
| 2773 | Ga0451577_0075485 | |||
| 2774 | Ga0451577_0089912 | |||
| 2775 | Ga0439440_0010617 | |||
| 2776 | Ga0466969_0035488 | |||
| 2777 | Ga0466972_0000005 | |||
| 2778 | Ga0466981_0000014 | |||
| 2779 | Ga0466978_0118475 | |||
| 2780 | Ga0453683_0001671 | |||
| 2781 | Ga0466965_0005749 | |||
| 2782 | Ga0466965_0020226 | |||
| 2783 | Ga0466961_0000442 | |||
| 2784 | Ga0466964_0040296 | |||
| 2785 | Ga0466964_0120551 | |||
| 2786 | Ga0453684_0000170 | |||
| 2787 | Ga0453684_0002648 | |||
| 2788 | Ga0453684_0062534 | |||
| 2789 | Ga0453684_0307997 | |||
| 2790 | Ga0453684_0533060 | |||
| 2791 | Ga0466971_0031454 | |||
| 2792 | Ga0466968_0011936 | |||
| 2793 | Ga0466968_0018253 | |||
| 2794 | Ga0466970_0008396 | |||
| 2795 | Ga0466957_0055193 | |||
| 2796 | Ga0466959_0001576 | |||
| 2797 | Ga0451576_0001328 | |||
| 2798 | Ga0451576_0028821 | |||
| 2799 | Ga0495617_002477 | |||
| 2800 | Ga0495617_007141 | |||
| 2801 | Ga0495617_007249 | |||
| 2802 | Ga0495617_012971 | |||
| 2803 | Ga0495617_013277 | |||
| 2804 | Ga0495617_020749 | |||
| 2805 | Ga0495617_057296 | |||
| 2806 | Ga0495627_000047 | |||
| 2807 | Ga0495627_001081 | |||
| 2808 | Ga0495627_001216 | |||
| 2809 | Ga0495627_020817 | |||
| 2810 | Ga0495627_024153 | |||
| 2811 | Ga0495603_0022354 | |||
| 2812 | Ga0495603_0031673 | |||
| 2813 | Ga0495603_0066303 | |||
| 2814 | Ga0495590_0003315 | |||
| 2815 | Ga0495590_0008408 | |||
| 2816 | Ga0495590_0009203 | |||
| 2817 | Ga0495590_0016441 | |||
| 2818 | Ga0495591_000019 | |||
| 2819 | Ga0495591_000024 | |||
| 2820 | Ga0495591_000231 | |||
| 2821 | Ga0495591_004731 | |||
| 2822 | Ga0495591_005800 | |||
| 2823 | Ga0495591_005961 | |||
| 2824 | Ga0495591_006653 | |||
| 2825 | Ga0495591_007443 | |||
| 2826 | Ga0495591_007578 | |||
| 2827 | Ga0495591_009139 | |||
| 2828 | Ga0495591_010946 | |||
| 2829 | Ga0495591_012377 | |||
| 2830 | Ga0495591_024154 | |||
| 2831 | Ga0495591_026472 | |||
| 2832 | Ga0495591_043510 | |||
| 2833 | Ga0495629_0091979 | |||
| 2834 | Ga0495638_0010848 | |||
| 2835 | Ga0495638_0023016 | |||
| 2836 | Ga0495638_0035758 | |||
| 2837 | Ga0495638_0055085 | |||
| 2838 | Ga0495638_0055863 | |||
| 2839 | Ga0495638_0073052 | |||
| 2840 | Ga0495653_0015371 | |||
| 2841 | Ga0495653_0018175 | |||
| 2842 | Ga0495653_0039513 | |||
| 2843 | Ga0495653_0060932 | |||
| 2844 | Ga0495653_0135183 | |||
| 2845 | Ga0495650_0000004 | |||
| 2846 | Ga0495650_0000028 | |||
| 2847 | Ga0495650_0000113 | |||
| 2848 | Ga0495650_0001459 | |||
| 2849 | Ga0495650_0009508 | |||
| 2850 | Ga0495650_0010945 | |||
| 2851 | Ga0495650_0016294 | |||
| 2852 | Ga0495650_0019158 | |||
| 2853 | Ga0495650_0020216 | |||
| 2854 | Ga0495650_0021072 | |||
| 2855 | Ga0495650_0035995 | |||
| 2856 | Ga0495582_0167203 | |||
| 2857 | Ga0495605_0000014 | |||
| 2858 | Ga0495605_0000030 | |||
| 2859 | Ga0495605_0000428 | |||
| 2860 | Ga0495605_0001206 | |||
| 2861 | Ga0495605_0006255 | |||
| 2862 | Ga0495605_0008025 | |||
| 2863 | Ga0495605_0014197 | |||
| 2864 | Ga0495605_0018016 | |||
| 2865 | Ga0495605_0026653 | |||
| 2866 | Ga0495605_0042545 | |||
| 2867 | Ga0495639_0000008 | |||
| 2868 | Ga0495584_0003148 | |||
| 2869 | Ga0495584_0003554 | |||
| 2870 | Ga0495584_0008594 | |||
| 2871 | Ga0495584_0008987 | |||
| 2872 | Ga0495584_0010197 | |||
| 2873 | Ga0495584_0014052 | |||
| 2874 | Ga0495584_0014635 | |||
| 2875 | Ga0495584_0015636 | |||
| 2876 | Ga0495584_0018695 | |||
| 2877 | Ga0495584_0044781 | |||
| 2878 | Ga0495585_0004589 | |||
| 2879 | Ga0495585_0010242 | |||
| 2880 | Ga0495585_0020067 | |||
| 2881 | Ga0495585_0024108 | |||
| 2882 | Ga0495585_0037415 | |||
| 2883 | Ga0495585_0046683 | |||
| 2884 | Ga0495585_0176323 | |||
| 2885 | Ga0495594_0011541 | |||
| 2886 | Ga0495594_0014320 | |||
| 2887 | Ga0495594_0017537 | |||
| 2888 | Ga0495594_0029716 | |||
| 2889 | Ga0495596_0004915 | |||
| 2890 | Ga0495596_0035791 | |||
| 2891 | Ga0495596_0051610 | |||
| 2892 | Ga0495607_0000393 | |||
| 2893 | Ga0495607_0001642 | |||
| 2894 | Ga0495607_0003347 | |||
| 2895 | Ga0495607_0006500 | |||
| 2896 | Ga0495607_0007957 | |||
| 2897 | Ga0495607_0012825 | |||
| 2898 | Ga0495607_0016867 | |||
| 2899 | Ga0495607_0020527 | |||
| 2900 | Ga0495607_0022280 | |||
| 2901 | Ga0495607_0025043 | |||
| 2902 | Ga0495607_0025376 | |||
| 2903 | Ga0495607_0026664 | |||
| 2904 | Ga0495607_0027044 | |||
| 2905 | Ga0495607_0027692 | |||
| 2906 | Ga0495607_0028841 | |||
| 2907 | Ga0495607_0033116 | |||
| 2908 | Ga0495607_0074018 | |||
| 2909 | Ga0495607_0090640 | |||
| 2910 | Ga0495583_0000066 | |||
| 2911 | Ga0495583_0004575 | |||
| 2912 | Ga0495583_0005994 | |||
| 2913 | Ga0495583_0008167 | |||
| 2914 | Ga0495583_0008202 | |||
| 2915 | Ga0495583_0009899 | |||
| 2916 | Ga0495583_0011506 | |||
| 2917 | Ga0495583_0015601 | |||
| 2918 | Ga0495583_0047542 | |||
| 2919 | Ga0495606_0000086 | |||
| 2920 | Ga0495606_0000700 | |||
| 2921 | Ga0495606_0001088 | |||
| 2922 | Ga0495606_0001652 | |||
| 2923 | Ga0495606_0003844 | |||
| 2924 | Ga0495606_0016871 | |||
| 2925 | Ga0495606_0019061 | |||
| 2926 | Ga0495606_0022787 | |||
| 2927 | Ga0495606_0025333 | |||
| 2928 | Ga0495606_0036093 | |||
| 2929 | Ga0495606_0050762 | |||
| 2930 | Ga0495606_0069986 | |||
| 2931 | Ga0495610_0015784 | |||
| 2932 | Ga0495610_0021191 | |||
| 2933 | Ga0495610_0023763 | |||
| 2934 | Ga0495610_0030726 | |||
| 2935 | Ga0495610_0036302 | |||
| 2936 | Ga0495610_0038403 | |||
| 2937 | Ga0495610_0046677 | |||
| 2938 | Ga0495610_0047555 | |||
| 2939 | Ga0495610_0061880 | |||
| 2940 | Ga0495616_0003753 | |||
| 2941 | Ga0495616_0013978 | |||
| 2942 | Ga0495616_0023885 | |||
| 2943 | Ga0495616_0034029 | |||
| 2944 | Ga0495616_0043719 | |||
| 2945 | Ga0495616_0085571 | |||
| 2946 | Ga0495620_0000100 | |||
| 2947 | Ga0495620_0000449 | |||
| 2948 | Ga0495620_0001603 | |||
| 2949 | Ga0495620_0006262 | |||
| 2950 | Ga0495620_0011773 | |||
| 2951 | Ga0495620_0016482 | |||
| 2952 | Ga0495620_0027691 | |||
| 2953 | Ga0495628_0308869 | |||
| 2954 | Ga0495630_0030101 | |||
| 2955 | Ga0495630_0063572 | |||
| 2956 | Ga0495631_0005021 | |||
| 2957 | Ga0495631_0005558 | |||
| 2958 | Ga0495631_0008676 | |||
| 2959 | Ga0495631_0011046 | |||
| 2960 | Ga0495631_0014723 | |||
| 2961 | Ga0495631_0014874 | |||
| 2962 | Ga0495631_0075669 | |||
| 2963 | Ga0495632_0002049 | |||
| 2964 | Ga0495632_0003065 | |||
| 2965 | Ga0495632_0003582 | |||
| 2966 | Ga0495632_0006252 | |||
| 2967 | Ga0495632_0010938 | |||
| 2968 | Ga0495632_0016322 | |||
| 2969 | Ga0495632_0017983 | |||
| 2970 | Ga0495632_0018548 | |||
| 2971 | Ga0495632_0020137 | |||
| 2972 | Ga0495632_0037514 | |||
| 2973 | Ga0495632_0042437 | |||
| 2974 | Ga0495632_0043242 | |||
| 2975 | Ga0495637_0000024 | |||
| 2976 | Ga0495637_0000032 | |||
| 2977 | Ga0495637_0005465 | |||
| 2978 | Ga0495637_0005782 | |||
| 2979 | Ga0495637_0012264 | |||
| 2980 | Ga0495637_0013268 | |||
| 2981 | Ga0495637_0013643 | |||
| 2982 | Ga0495637_0020555 | |||
| 2983 | Ga0495637_0022688 | |||
| 2984 | Ga0495637_0025497 | |||
| 2985 | Ga0495637_0032560 | |||
| 2986 | Ga0495637_0096235 | |||
| 2987 | Ga0495637_0109690 | |||
| 2988 | Ga0495643_0000197 | |||
| 2989 | Ga0495643_0000445 | |||
| 2990 | Ga0495643_0004884 | |||
| 2991 | Ga0495643_0012491 | |||
| 2992 | Ga0495643_0012495 | |||
| 2993 | Ga0495643_0024529 | |||
| 2994 | Ga0495643_0025790 | |||
| 2995 | Ga0495643_0057677 | |||
| 2996 | Ga0495643_0130760 | |||
| 2997 | Ga0495644_0001108 | |||
| 2998 | Ga0495644_0004868 | |||
| 2999 | Ga0495644_0005738 | |||
| 3000 | Ga0495644_0009351 | |||
| 3001 | Ga0495644_0049368 | |||
| 3002 | Ga0495648_0001813 | |||
| 3003 | Ga0495648_0007647 | |||
| 3004 | Ga0495648_0008024 | |||
| 3005 | Ga0495648_0014036 | |||
| 3006 | Ga0495648_0015997 | |||
| 3007 | Ga0495648_0022576 | |||
| 3008 | Ga0495648_0024600 | |||
| 3009 | Ga0495648_0025640 | |||
| 3010 | Ga0495648_0037592 | |||
| 3011 | Ga0495648_0039375 | |||
| 3012 | Ga0495666_0108989 | |||
| 3013 | Ga0495642_0003594 | |||
| 3014 | Ga0495642_0005515 | |||
| 3015 | Ga0495642_0005720 | |||
| 3016 | Ga0495654_0000031 | |||
| 3017 | Ga0495654_0000390 | |||
| 3018 | Ga0495654_0000899 | |||
| 3019 | Ga0495654_0002770 | |||
| 3020 | Ga0495654_0006997 | |||
| 3021 | Ga0495654_0007472 | |||
| 3022 | Ga0495654_0007591 | |||
| 3023 | Ga0495654_0012197 | |||
| 3024 | Ga0495654_0014123 | |||
| 3025 | Ga0495654_0014427 | |||
| 3026 | Ga0495654_0023508 | |||
| 3027 | Ga0495654_0026526 | |||
| 3028 | Ga0495654_0029941 | |||
| 3029 | Ga0495654_0033929 | |||
| 3030 | Ga0495654_0054890 | |||
| 3031 | Ga0495654_0091854 | |||
| 3032 | Ga0495587_0017404 | |||
| 3033 | Ga0495587_0021122 | |||
| 3034 | Ga0495609_0000006 | |||
| 3035 | Ga0495609_0000024 | |||
| 3036 | Ga0495609_0000040 | |||
| 3037 | Ga0495609_0000561 | |||
| 3038 | Ga0495609_0013914 | |||
| 3039 | Ga0495609_0013918 | |||
| 3040 | Ga0495597_0000010 | |||
| 3041 | Ga0495597_0000548 | |||
| 3042 | Ga0495597_0009030 | |||
| 3043 | Ga0495597_0009702 | |||
| 3044 | Ga0495597_0010364 | |||
| 3045 | Ga0495597_0016687 | |||
| 3046 | Ga0495597_0023906 | |||
| 3047 | Ga0495597_0026982 | |||
| 3048 | Ga0495597_0038815 | |||
| 3049 | Ga0495597_0076385 | |||
| 3050 | Ga0495597_0168391 | |||
| 3051 | Ga0495622_0000476 | |||
| 3052 | Ga0495622_0001930 | |||
| 3053 | Ga0495622_0006629 | |||
| 3054 | Ga0495622_0039357 | |||
| 3055 | Ga0495622_0049270 | |||
| 3056 | Ga0495633_0000030 | |||
| 3057 | Ga0495633_0009591 | |||
| 3058 | Ga0495656_0088906 | |||
| 3059 | Ga0495656_0194236 | |||
| 3060 | Ga0495668_0010172 | |||
| 3061 | Ga0495668_0051324 | |||
| 3062 | Ga0495668_0120743 | |||
| 3063 | Ga0495634_0019095 | |||
| 3064 | Ga0495634_0045091 | |||
| 3065 | Ga0495611_0001322 | |||
| 3066 | Ga0495611_0008737 | |||
| 3067 | Ga0495611_0010746 | |||
| 3068 | Ga0495611_0015918 | |||
| 3069 | Ga0495625_0000111 | |||
| 3070 | Ga0495625_0004340 | |||
| 3071 | Ga0495625_0020146 | |||
| 3072 | Ga0495625_0020640 | |||
| 3073 | Ga0495625_0026345 | |||
| 3074 | Ga0495625_0031713 | |||
| 3075 | Ga0495625_0063707 | |||
| 3076 | Ga0495635_0020994 | |||
| 3077 | Ga0495635_0029644 | |||
| 3078 | Ga0495659_0000747 | |||
| 3079 | Ga0495661_0000015 | |||
| 3080 | Ga0495661_0000019 | |||
| 3081 | Ga0495661_0000034 | |||
| 3082 | Ga0495661_0000054 | |||
| 3083 | Ga0495661_0020788 | |||
| 3084 | Ga0495661_0040994 | |||
| 3085 | Ga0495661_0074386 | |||
| 3086 | Ga0495588_0041465 | |||
| 3087 | Ga0495588_0060090 | |||
| 3088 | Ga0495588_0153018 | |||
| 3089 | Ga0495623_0007405 | |||
| 3090 | Ga0495623_0093365 | |||
| 3091 | Ga0495646_0020274 | |||
| 3092 | Ga0495646_0071474 | |||
| 3093 | Ga0495669_0003585 | |||
| 3094 | Ga0495613_0076626 | |||
| 3095 | Ga0495624_0015757 | |||
| 3096 | Ga0495670_0012341 | |||
| 3097 | Ga0495670_0017151 | |||
| 3098 | Ga0495670_0024596 | |||
| 3099 | Ga0495671_0000904 | |||
| 3100 | Ga0495671_0001174 | |||
| 3101 | Ga0495671_0001418 | |||
| 3102 | Ga0495671_0008522 | |||
| 3103 | Ga0495671_0010463 | |||
| 3104 | Ga0495671_0011944 | |||
| 3105 | Ga0495671_0013637 | |||
| 3106 | Ga0495671_0014274 | |||
| 3107 | Ga0495671_0053465 | |||
| 3108 | Ga0495671_0058916 | |||
| 3109 | Ga0495671_0132638 | |||
| 3110 | Ga0495649_0003172 | |||
| 3111 | Ga0495649_0003193 | |||
| 3112 | Ga0495649_0004813 | |||
| 3113 | Ga0495649_0007867 | |||
| 3114 | Ga0495649_0008963 | |||
| 3115 | Ga0495649_0019668 | |||
| 3116 | Ga0495649_0021487 | |||
| 3117 | Ga0495649_0023989 | |||
| 3118 | Ga0495649_0050133 | |||
| 3119 | Ga0495649_0054604 | |||
| 3120 | Ga0495589_0000005 | |||
| 3121 | Ga0495589_0001789 | |||
| 3122 | Ga0495589_0003076 | |||
| 3123 | Ga0495589_0004916 | |||
| 3124 | Ga0495589_0007826 | |||
| 3125 | Ga0495589_0008804 | |||
| 3126 | Ga0495589_0012194 | |||
| 3127 | Ga0495589_0018117 | |||
| 3128 | Ga0495589_0030578 | |||
| 3129 | Ga0495600_0033262 | |||
| 3130 | Ga0495600_0162444 | |||
| 3131 | Ga0495660_0000013 | |||
| 3132 | Ga0495660_0000034 | |||
| 3133 | Ga0495660_0001742 | |||
| 3134 | Ga0495660_0002923 | |||
| 3135 | Ga0495660_0011326 | |||
| 3136 | Ga0495660_0025870 | |||
| 3137 | Ga0495660_0026340 | |||
| 3138 | Ga0495660_0078623 | |||
| 3139 | Ga0495660_0163558 | |||
| 3140 | Ga0495660_0177835 | |||
| 3141 | Ga0495581_0012372 | |||
| 3142 | Ga0495581_0044701 | |||
| 3143 | Ga0495604_0006556 | |||
| 3144 | Ga0495604_0074773 | |||
| 3145 | Ga0495604_0277427 | |||
| 3146 | Ga0495636_0002977 | |||
| 3147 | Ga0495636_0128680 | |||
| 3148 | Ga0495674_0031575 | |||
| 3149 | Ga0495672_0000029 | |||
| 3150 | Ga0495672_0000051 | |||
| 3151 | Ga0495672_0000054 | |||
| 3152 | Ga0495672_0005620 | |||
| 3153 | Ga0495672_0008870 | |||
| 3154 | Ga0495672_0010455 | |||
| 3155 | Ga0495672_0014368 | |||
| 3156 | Ga0495672_0015095 | |||
| 3157 | Ga0495672_0017426 | |||
| 3158 | Ga0495672_0017945 | |||
| 3159 | Ga0495672_0019267 | |||
| 3160 | Ga0495672_0023090 | |||
| 3161 | Ga0495672_0024532 | |||
| 3162 | Ga0495672_0026497 | |||
| 3163 | Ga0495672_0033233 | |||
| 3164 | Ga0495672_0045197 | |||
| 3165 | Ga0495672_0064755 | |||
| 3166 | Ga0495672_0091422 | |||
| 3167 | Ga0495672_0109630 | |||
| 3168 | Ga0495672_0189054 | |||
| 3169 | Ga0495676_0000010 | |||
| 3170 | Ga0495680_0007566 | |||
| 3171 | Ga0495680_0034742 | |||
| 3172 | Ga0495680_0040496 | |||
| 3173 | Ga0495680_0051073 | |||
| 3174 | Ga0495680_0262708 | |||
| 3175 | Ga0495683_0000265 | |||
| 3176 | Ga0495683_0004053 | |||
| 3177 | Ga0495683_0016003 | |||
| 3178 | Ga0495683_0024337 | |||
| 3179 | Ga0495683_0025802 | |||
| 3180 | Ga0495683_0076883 | |||
| 3181 | Ga0495687_007249 | |||
| 3182 | Ga0495687_010782 | |||
| 3183 | Ga0495687_026181 | |||
| 3184 | Ga0495675_0002375 | |||
| 3185 | Ga0495675_0047775 | |||
| 3186 | Ga0495679_000014 | |||
| 3187 | Ga0495679_000092 | |||
| 3188 | Ga0495679_002205 | |||
| 3189 | Ga0495679_005767 | |||
| 3190 | Ga0495679_007811 | |||
| 3191 | Ga0495679_022838 | |||
| 3192 | Ga0495685_018714 | |||
| 3193 | Ga0495673_0000047 | |||
| 3194 | Ga0495673_0000820 | |||
| 3195 | Ga0495673_0001218 | |||
| 3196 | Ga0495673_0004155 | |||
| 3197 | Ga0495673_0005956 | |||
| 3198 | Ga0495673_0014060 | |||
| 3199 | Ga0495673_0014737 | |||
| 3200 | Ga0495673_0015118 | |||
| 3201 | Ga0495673_0017028 | |||
| 3202 | Ga0495673_0027987 | |||
| 3203 | Ga0495673_0029339 | |||
| 3204 | Ga0495673_0062420 | |||
| 3205 | Ga0495681_0007066 | |||
| 3206 | Ga0495681_0007517 | |||
| 3207 | Ga0495681_0013012 | |||
| 3208 | Ga0495681_0016807 | |||
| 3209 | Ga0495681_0018996 | |||
| 3210 | Ga0495681_0021337 | |||
| 3211 | Ga0495681_0021371 | |||
| 3212 | Ga0495681_0021754 | |||
| 3213 | Ga0495681_0032848 | |||
| 3214 | Ga0495681_0085335 | |||
| 3215 | Ga0495681_0098690 | |||
| 3216 | Ga0495684_0106124 | |||
| 3217 | Ga0495686_0020480 | |||
| 3218 | Ga0495686_0029422 | |||
| 3219 | Ga0495593_0015360 | |||
| 3220 | Ga0495593_0021500 | |||
| 3221 | Ga0495593_0023582 | |||
| 3222 | Ga0495626_0000013 | |||
| 3223 | Ga0495626_0001966 | |||
| 3224 | Ga0495626_0002110 | |||
| 3225 | Ga0495626_0006395 | |||
| 3226 | Ga0495626_0007835 | |||
| 3227 | Ga0495626_0008717 | |||
| 3228 | Ga0495626_0008848 | |||
| 3229 | Ga0495626_0014640 | |||
| 3230 | Ga0496100_0149692 | |||
| 3231 | Ga0496101_0000123 | |||
| 3232 | Ga0496101_0108386 | |||
| 3233 | Ga0496101_0206250 | |||
| 3234 | Ga0496102_0004355 | |||
| 3235 | Ga0496103_0016648 | |||
| 3236 | Ga0496104_0001413 | |||
| 3237 | Ga0496104_0004669 | |||
| 3238 | Ga0496104_0028274 | |||
| 3239 | Ga0496104_0081617 | |||
| 3240 | Ga0496105_0021587 | |||
| 3241 | Ga0496105_0059543 | |||
| 3242 | Ga0496110_0053015 | |||
| 3243 | Ga0496110_0093348 | |||
| 3244 | Ga0496110_0296346 | |||
| 3245 | Ga0496113_0675539 | |||
| 3246 | Ga0496114_0072729 | |||
| 3247 | Ga0496116_0000015 | |||
| 3248 | Ga0496116_0000016 | |||
| 3249 | Ga0496116_0000217 | |||
| 3250 | Ga0496116_0000528 | |||
| 3251 | Ga0496116_0004729 | |||
| 3252 | Ga0496116_0008145 | |||
| 3253 | Ga0496116_0017483 | |||
| 3254 | Ga0496116_0018565 | |||
| 3255 | Ga0496116_0036886 | |||
| 3256 | Ga0496116_0040191 | |||
| 3257 | Ga0496116_0074923 | |||
| 3258 | Ga0496116_0120366 | |||
| 3259 | Ga0496116_0155905 | |||
| 3260 | Ga0496117_0000238 | |||
| 3261 | Ga0496117_0002432 | |||
| 3262 | Ga0496117_0003210 | |||
| 3263 | Ga0496117_0007956 | |||
| 3264 | Ga0496117_0010934 | |||
| 3265 | Ga0496117_0014243 | |||
| 3266 | Ga0496117_0015593 | |||
| 3267 | Ga0496117_0016424 | |||
| 3268 | Ga0496117_0019817 | |||
| 3269 | Ga0496117_0023926 | |||
| 3270 | Ga0496117_0025131 | |||
| 3271 | Ga0496117_0027296 | |||
| 3272 | Ga0496117_0039003 | |||
| 3273 | Ga0496117_0040562 | |||
| 3274 | Ga0496117_0045051 | |||
| 3275 | Ga0496117_0050855 | |||
| 3276 | Ga0496117_0052904 | |||
| 3277 | Ga0496117_0084628 | |||
| 3278 | Ga0496117_0103914 | |||
| 3279 | Ga0496117_0111506 | |||
| 3280 | Ga0496117_0129654 | |||
| 3281 | Ga0496117_0170703 | |||
| 3282 | Ga0496118_0000959 | |||
| 3283 | Ga0496118_0001062 | |||
| 3284 | Ga0496118_0002877 | |||
| 3285 | Ga0496118_0006809 | |||
| 3286 | Ga0496118_0009111 | |||
| 3287 | Ga0496118_0010449 | |||
| 3288 | Ga0496118_0018376 | |||
| 3289 | Ga0496118_0020645 | |||
| 3290 | Ga0496118_0034122 | |||
| 3291 | Ga0496118_0034438 | |||
| 3292 | Ga0496118_0040393 | |||
| 3293 | Ga0496118_0040443 | |||
| 3294 | Ga0496118_0047495 | |||
| 3295 | Ga0496118_0061392 | |||
| 3296 | Ga0496118_0065578 | |||
| 3297 | Ga0496118_0189866 | |||
| 3298 | Ga0496119_0000026 | |||
| 3299 | Ga0496119_0000097 | |||
| 3300 | Ga0496119_0000270 | |||
| 3301 | Ga0496119_0001418 | |||
| 3302 | Ga0496119_0005618 | |||
| 3303 | Ga0496119_0005727 | |||
| 3304 | Ga0496119_0007722 | |||
| 3305 | Ga0496119_0008301 | |||
| 3306 | Ga0496119_0016128 | |||
| 3307 | Ga0496119_0036489 | |||
| 3308 | Ga0496119_0050888 | |||
| 3309 | Ga0496119_0166643 | |||
| 3310 | Ga0496120_0000344 | |||
| 3311 | Ga0496120_0000361 | |||
| 3312 | Ga0496120_0001012 | |||
| 3313 | Ga0496120_0001279 | |||
| 3314 | Ga0496120_0001280 | |||
| 3315 | Ga0496120_0002523 | |||
| 3316 | Ga0496120_0004434 | |||
| 3317 | Ga0496120_0006998 | |||
| 3318 | Ga0496120_0007521 | |||
| 3319 | Ga0496120_0009560 | |||
| 3320 | Ga0496120_0009684 | |||
| 3321 | Ga0496120_0013830 | |||
| 3322 | Ga0496120_0016493 | |||
| 3323 | Ga0496120_0045919 | |||
| 3324 | Ga0496120_0067938 | |||
| 3325 | Ga0496121_0001130 | |||
| 3326 | Ga0496121_0001808 | |||
| 3327 | Ga0496121_0004701 | |||
| 3328 | Ga0496121_0007313 | |||
| 3329 | Ga0496121_0016066 | |||
| 3330 | Ga0496121_0018682 | |||
| 3331 | Ga0496121_0022583 | |||
| 3332 | Ga0496121_0045686 | |||
| 3333 | Ga0496121_0056801 | |||
| 3334 | Ga0496121_0075323 | |||
| 3335 | Ga0496121_0086786 | |||
| 3336 | Ga0496121_0147438 | |||
| 3337 | Ga0496122_0000075 | |||
| 3338 | Ga0496122_0000125 | |||
| 3339 | Ga0496122_0000297 | |||
| 3340 | Ga0496122_0001095 | |||
| 3341 | Ga0496122_0001913 | |||
| 3342 | Ga0496122_0002193 | |||
| 3343 | Ga0496122_0008894 | |||
| 3344 | Ga0496122_0025549 | |||
| 3345 | Ga0496122_0028887 | |||
| 3346 | Ga0496122_0036451 | |||
| 3347 | Ga0496122_0042447 | |||
| 3348 | Ga0496122_0048357 | |||
| 3349 | Ga0496122_0050018 | |||
| 3350 | Ga0496122_0050616 | |||
| 3351 | Ga0496122_0056682 | |||
| 3352 | Ga0496122_0065242 | |||
| 3353 | Ga0496122_0075251 | |||
| 3354 | Ga0496122_0077679 | |||
| 3355 | Ga0496122_0078410 | |||
| 3356 | Ga0496122_0121208 | |||
| 3357 | Ga0496123_0000019 | |||
| 3358 | Ga0496123_0000092 | |||
| 3359 | Ga0496123_0000377 | |||
| 3360 | Ga0496123_0000774 | |||
| 3361 | Ga0496123_0001365 | |||
| 3362 | Ga0496123_0001657 | |||
| 3363 | Ga0496123_0003347 | |||
| 3364 | Ga0496123_0003771 | |||
| 3365 | Ga0496123_0008703 | |||
| 3366 | Ga0496123_0022363 | |||
| 3367 | Ga0496123_0028298 | |||
| 3368 | Ga0496123_0031023 | |||
| 3369 | Ga0496123_0044215 | |||
| 3370 | Ga0496123_0051898 | |||
| 3371 | Ga0496123_0058334 | |||
| 3372 | Ga0496123_0064887 | |||
| 3373 | Ga0496123_0065318 | |||
| 3374 | Ga0496123_0067104 | |||
| 3375 | Ga0496123_0071194 | |||
| 3376 | Ga0496123_0088300 | |||
| 3377 | Ga0496123_0111891 | |||
| 3378 | Ga0496124_0000051 | |||
| 3379 | Ga0496124_0000058 | |||
| 3380 | Ga0496124_0000142 | |||
| 3381 | Ga0496124_0000238 | |||
| 3382 | Ga0496124_0000965 | |||
| 3383 | Ga0496124_0006756 | |||
| 3384 | Ga0496124_0007209 | |||
| 3385 | Ga0496124_0009650 | |||
| 3386 | Ga0496124_0015821 | |||
| 3387 | Ga0496124_0016054 | |||
| 3388 | Ga0496124_0022985 | |||
| 3389 | Ga0496124_0034228 | |||
| 3390 | Ga0496124_0040053 | |||
| 3391 | Ga0496124_0054792 | |||
| 3392 | Ga0496124_0056723 | |||
| 3393 | Ga0496124_0068404 | |||
| 3394 | Ga0496124_0073613 | |||
| 3395 | Ga0496124_0092564 | |||
| 3396 | Ga0496124_0093654 | |||
| 3397 | Ga0496124_0112536 | |||
| 3398 | Ga0496124_0149901 | |||
| 3399 | Ga0496124_0166022 | |||
| 3400 | Ga0496124_0191268 | |||
| 3401 | Ga0496124_0198609 | |||
| 3402 | Ga0496125_0000032 | |||
| 3403 | Ga0496125_0000384 | |||
| 3404 | Ga0496125_0002564 | |||
| 3405 | Ga0496125_0011357 | |||
| 3406 | Ga0496125_0017828 | |||
| 3407 | Ga0496125_0018128 | |||
| 3408 | Ga0496125_0018546 | |||
| 3409 | Ga0496125_0029785 | |||
| 3410 | Ga0496125_0037717 | |||
| 3411 | Ga0496125_0040349 | |||
| 3412 | Ga0496125_0048007 | |||
| 3413 | Ga0496125_0050164 | |||
| 3414 | Ga0496125_0054932 | |||
| 3415 | Ga0496125_0055746 | |||
| 3416 | Ga0496125_0060463 | |||
| 3417 | Ga0496125_0089062 | |||
| 3418 | Ga0496125_0167249 | |||
| 3419 | Ga0496126_0000109 | |||
| 3420 | Ga0496126_0015397 | |||
| 3421 | Ga0496126_0015460 | |||
| 3422 | Ga0496126_0040308 | |||
| 3423 | Ga0496126_0064861 | |||
| 3424 | Ga0496126_0080089 | |||
| 3425 | Ga0496126_0095936 | |||
| 3426 | Ga0496126_0114406 | |||
| 3427 | Ga0496126_0121666 | |||
| 3428 | Ga0496126_0153337 | |||
| 3429 | Ga0496126_0192883 | |||
| 3430 | Ga0496126_0254358 | |||
| 3431 | Ga0496126_0325031 | |||
| 3432 | Ga0496126_0414853 | |||
| 3433 | Ga0495678_000063 | |||
| 3434 | Ga0495678_000127 | |||
| 3435 | Ga0495678_000984 | |||
| 3436 | Ga0495678_002289 | |||
| 3437 | Ga0495678_003397 | |||
| 3438 | Ga0495678_008921 | |||
| 3439 | Ga0495678_009905 | |||
| 3440 | Ga0495678_010697 | |||
| 3441 | Ga0495678_014553 | |||
| 3442 | Ga0495678_016237 | |||
| 3443 | Ga0495678_020491 | |||
| 3444 | Ga0495678_022816 | |||
| 3445 | Ga0495678_032052 | |||
| 3446 | Ga0495678_036333 | |||
| 3447 | Ga0495678_041655 | |||
| 3448 | Ga0495678_049399 | |||
| 3449 | Ga0495682_0000003 | |||
| 3450 | Ga0495682_0000134 | |||
| 3451 | Ga0495682_0000635 | |||
| 3452 | Ga0495682_0015198 | |||
| 3453 | Ga0501034_0000501 | |||
| 3454 | Ga0501034_0100596 | |||
| 3455 | Ga0501034_0140497 | |||
| 3456 | Ga0501034_0303208 | |||
| 3457 | Ga0501034_0306683 | |||
| 3458 | Ga0501037_0360361 | |||
| 3459 | Ga0501038_0008503 | |||
| 3460 | Ga0501039_0199423 | |||
| 3461 | Ga0501047_0072386 | |||
| 3462 | Ga0501222_001277 | |||
| 3463 | Ga0501227_005010 | |||
| 3464 | Ga0501241_003528 | |||
| 3465 | Ga0501035_0557365 | |||
| 3466 | Ga0501226_000005 | |||
| 3467 | nmdc:mga03683_6025_c1 | |||
| 3468 | nmdc:mga00v17_5272_c1 | |||
| 3469 | nmdc:mga0yw44_29709_c1 | |||
| 3470 | nmdc:mga0k408_117807_c1 | |||
| 3471 | nmdc:mga0k408_171222_c1 | |||
| 3472 | nmdc:mga0k408_2713_c1 | |||
| 3473 | nmdc:mga07m45_6026_c1 | |||
| 3474 | nmdc:mga0sz30_20467_c1 | |||
| 3475 | Ga0500644_0021033 | |||
| 3476 | Ga0500646_0001268 | |||
| 3477 | Ga0500583_0000848 | |||
| 3478 | Ga0500650_0000427 | |||
| 3479 | Ga0500594_0067240 | |||
| 3480 | Ga0500618_001605 | |||
| 3481 | Ga0500618_002498 | |||
| 3482 | Ga0500621_000006 | |||
| 3483 | Ga0500659_0014789 | |||
| 3484 | Ga0500604_0000477 | |||
| 3485 | Ga0500637_0296698 | |||
| 3486 | Ga0466962_0004751 | |||
| 3487 | Ga0466962_0148562 | |||
| 3488 | 2510284792 | |||
| 3489 | 2510295102 | |||
| 3490 | 2510312170 | |||
| 3491 | 2511253480 | |||
| 3492 | 2511267416 | |||
| 3493 | 2511270817 | |||
| 3494 | 2511274942 | |||
| 3495 | 2511291482 | |||
| 3496 | 2511296193 | |||
| 3497 | 2511300582 | |||
| 3498 | 2511315556 | |||
| 3499 | 2511317804 | |||
| 3500 | 2511326900 | |||
| 3501 | 2511332408 | |||
| 3502 | 2511336481 | |||
| 3503 | 2511347246 | |||
| 3504 | 2511350510 | |||
| 3505 | 2511357171 | |||
| 3506 | 2511362301 | |||
| 3507 | 2511371989 | |||
| 3508 | 2511377686 | |||
| 3509 | 2511381899 | |||
| 3510 | 2511383996 | |||
| 3511 | 2511413668 | |||
| 3512 | 2511432761 | |||
| 3513 | 2511826744 | |||
| 3514 | 2512328266 | |||
| 3515 | 2552746632 | |||
| 3516 | 2554813779 | |||
| 3517 | 2555245160 | |||
| 3518 | 2555667987 | |||
| 3519 | 2583790439 | |||
| 3520 | 2597856212 | |||
| 3521 | 2597862250 | |||
| 3522 | 2597867976 | |||
| 3523 | 2599328172 | |||
| 3524 | 2599354987 | |||
| 3525 | 2599361181 | |||
| 3526 | 2599367503 | |||
| 3527 | 2599374293 | |||
| 3528 | 2599380093 | |||
| 3529 | 2599386540 | |||
| 3530 | 2599393151 | |||
| 3531 | 2599397147 | |||
| 3532 | 2599404918 | |||
| 3533 | 2599449139 | |||
| 3534 | 2599461821 | |||
| 3535 | 2599467128 | |||
| 3536 | 2599483531 | |||
| 3537 | 2599491086 | |||
| 3538 | 2599502904 | |||
| 3539 | 2599508756 | |||
| 3540 | 2599511117 | |||
| 3541 | 2599519393 | |||
| 3542 | 2599615069 | |||
| 3543 | 2599771266 | |||
| 3544 | 2599805438 | |||
| 3545 | 2599879576 | |||
| 3546 | 2599885962 | |||
| 3547 | 2599890491 | |||
| 3548 | 2599897676 | |||
| 3549 | 2599930068 | |||
| 3550 | 2599945406 | |||
| 3551 | 2599948076 | |||
| 3552 | 2599955678 | |||
| 3553 | 2599961044 | |||
| 3554 | 2599969399 | |||
| 3555 | 2599974646 | |||
| 3556 | 2599980733 | |||
| 3557 | 2599985790 | |||
| 3558 | 2599990684 | |||
| 3559 | 2599996001 | |||
| 3560 | 2600001930 | |||
| 3561 | 2600005658 | |||
| 3562 | 2600014610 | |||
| 3563 | 2600019096 | |||
| 3564 | 2600025573 | |||
| 3565 | 2600027811 | |||
| 3566 | 2600033471 | |||
| 3567 | 2600040243 | |||
| 3568 | 2600049389 | |||
| 3569 | 2600055723 | |||
| 3570 | 2600061654 | |||
| 3571 | 2600064273 | |||
| 3572 | 2600073513 | |||
| 3573 | 2600077278 | |||
| 3574 | 2600214443 | |||
| 3575 | 2600356978 | |||
| 3576 | 2600364141 | |||
| 3577 | 2600443414 | |||
| 3578 | 2601626005 | |||
| 3579 | 2601690840 | |||
| 3580 | 2601774852 | |||
| 3581 | 2601800030 | |||
| 3582 | 2602009131 | |||
| 3583 | 2606074706 | |||
| 3584 | 2606127569 | |||
| 3585 | 2608381066 | |||
| 3586 | 2621301609 | |||
| 3587 | 2624478776 | |||
| 3588 | 2624494174 | |||
| 3589 | 2643843458 | |||
| 3590 | 2643868970 | |||
| 3591 | 2643955361 | |||
| 3592 | 2644023713 | |||
| 3593 | 2644030717 | |||
| 3594 | 2644187949 | |||
| 3595 | 2644282429 | |||
| 3596 | 2644361808 | |||
| 3597 | 2644623930 | |||
| 3598 | 2649121939 | |||
| 3599 | 2652545580 | |||
| 3600 | 2652976501 | |||
| 3601 | 2671089771 | |||
| 3602 | 2671097596 | |||
| 3603 | 2671125597 | |||
| 3604 | 2671767826 | |||
| 3605 | 2677897490 | |||
| 3606 | 2678265112 | |||
| 3607 | 2691331008 | |||
| 3608 | 2707098367 | |||
| 3609 | 2715750859 | |||
| 3610 | 2715757494 | |||
| 3611 | 2718632661 | |||
| 3612 | 2723247138 | |||
| 3613 | 2729145961 | |||
| 3614 | 2738673829 | |||
| 3615 | 2738689466 | |||
| 3616 | 2738714612 | |||
| 3617 | 2738752222 | |||
| 3618 | 2738809034 | |||
| 3619 | 2738861263 | |||
| 3620 | 2738896394 | |||
| 3621 | 2739196543 | |||
| 3622 | 2739257520 | |||
| 3623 | 2739265240 | |||
| 3624 | 2739286852 | |||
| 3625 | 2739292165 | |||
| 3626 | 2739314845 | |||
| 3627 | 2743735622 | |||
| 3628 | 2745005568 | |||
| 3629 | 2745160642 | |||
| 3630 | 2765570045 | |||
| 3631 | 2765585885 | |||
| 3632 | 2772437198 | |||
| 3633 | 2774120718 | |||
| 3634 | 2774131363 | |||
| 3635 | 2774136748 | |||
| 3636 | 2784260498 | |||
| 3637 | 2784313444 | |||
| 3638 | 2794595585 | |||
| 3639 | 2807406665 | |||
| 3640 | 2807454997 | |||
| 3641 | 2808855872 | |||
| 3642 | 2808904933 | |||
| 3643 | 2808921921 | |||
| 3644 | 2808928804 | |||
| 3645 | 2808935952 | |||
| 3646 | 2808941016 | |||
| 3647 | 2808944042 | |||
| 3648 | 2808950925 | |||
| 3649 | 2808956807 | |||
| 3650 | 2808964255 | |||
| 3651 | 2808975174 | |||
| 3652 | 2808981666 | |||
| 3653 | 2808991187 | |||
| 3654 | 2808999143 | |||
| 3655 | 2809131296 | |||
| 3656 | 2809150918 | |||
| 3657 | 2809215717 | |||
| 3658 | 2812370787 | |||
| 3659 | 2817489031 | |||
| 3660 | 2819615414 | |||
| 3661 | 2819658332 | |||
| 3662 | 2819702679 | |||
| 3663 | 2823425026 | |||
| 3664 | 2825655993 | |||
| 3665 | 2826583764 | |||
| 3666 | 2834028933 | |||
| 3667 | 2839097014 | |||
| 3668 | 2842808057 | |||
| 3669 | 2842821024 | |||
| 3670 | 2842829967 | |||
| 3671 | 2842835755 | |||
| 3672 | 2842839054 | |||
| 3673 | 2842847502 | |||
| 3674 | 2842853457 | |||
| 3675 | 2842856397 | |||
| 3676 | 2844668497 | |||
| 3677 | 2847089110 | |||
| 3678 | 2852106173 | |||
| 3679 | 2852615577 | |||
| 3680 | 2852622804 | |||
| 3681 | 2852662865 | |||
| 3682 | 2852670545 | |||
| 3683 | 2854601947 | |||
| 3684 | 2860340680 | |||
| 3685 | 2860868969 | |||
| 3686 | 2876605734 | |||
| 3687 | 2878030741 | |||
| 3688 | 2880231654 | |||
| 3689 | 2881716114 | |||
| 3690 | 2887632686 | |||
| 3691 | 2888367246 | |||
| 3692 | 2904444683 | |||
| 3693 | 2904507062 | |||
| 3694 | 2904520688 | |||
| 3695 | 2904534670 | |||
| 3696 | 2904553039 | |||
| 3697 | 2904584557 | |||
| 3698 | 2904591024 | |||
| 3699 | 2904605353 | |||
| 3700 | 2908447717 | |||
| 3701 | 2908673114 | |||
| 3702 | 2912968174 | |||
| 3703 | 2913041721 | |||
| 3704 | 2916702829 | |||
| 3705 | 2917071749 | |||
| 3706 | 2917834223 | |||
| 3707 | 2919047475 | |||
| 3708 | 2919067309 | |||
| 3709 | 2919080962 | |||
| 3710 | 2919127779 | |||
| 3711 | 2919156594 | |||
| 3712 | 2919385791 | |||
| 3713 | 2919458397 | |||
| 3714 | 2919484660 | |||
| 3715 | 2919492832 | |||
| 3716 | 2919501743 | |||
| 3717 | 2919534569 | |||
| 3718 | 2919689925 | |||
| 3719 | 2919699909 | |||
| 3720 | 2923154630 | |||
| 3721 | 2923512541 | |||
| 3722 | 2923524891 | |||
| 3723 | 2923590368 | |||
| 3724 | 2926063416 | |||
| 3725 | 2928132573 | |||
| 3726 | 2929149041 | |||
| 3727 | 2929190961 | |||
| 3728 | 2931373538 | |||
| 3729 | 2931391953 | |||
| 3730 | 2931399419 | |||
| 3731 | 2935353922 | |||
| 3732 | 2937970756 | |||
| 3733 | 2939637013 | |||
| 3734 | 2939652657 | |||
| 3735 | 2945929619 | |||
| 3736 | 2945965869 | |||
| 3737 | 2946011903 | |||
| 3738 | 2946029208 | |||
| 3739 | 2947235754 | |||
| 3740 | 2952255420 | |||
| 3741 | 2969305563 | |||
| 3742 | 2974292806 | |||
| 3743 | 2974298621 | |||
| 3744 | 2984291400 | |||
| 3745 | 2984500866 | |||
| 3746 | 2984505690 | |||
| 3747 | 2984570030 | |||
| 3748 | 2988730640 | |||
| 3749 | 2990200730 | |||
| 3750 | 2998141002 | |||
| 3751 | 3007256024 | |||
| 3752 | 3007319905 | |||
| 3753 | 3007400160 | |||
| 3754 | 3007424966 | |||
| 3755 | 3007512312 | |||
| 3756 | 3007618704 | |||
| 3757 | 3007624460 | |||
| 3758 | 3007719751 | |||
| 3759 | 3007860890 | |||
| 3760 | 3007863775 | |||
| 3761 | 3007867618 | |||
| 3762 | 3007873329 | |||
| 3763 | 637318365 | |||
| 3764 | 640487126 | |||
| 3765 | 651174998 | |||
| 3766 | 8004597851 | |||
| 3767 | 8011353729 | |||
| 3768 | 8015396124 | |||
| 3769 | 8016732377 | |||
| 3770 | 8016737263 | |||
| 3771 | 8019502464 | |||
| 3772 | 8019772409 | |||
| 3773 | 8019776575 | |||
| 3774 | 8029999757 | |||
| 3775 | 8033233547 | |||
| 3776 | 8034962999 | |||
| 3777 | 8048749691 | |||
| 3778 | 8052495524 | |||
| 3779 | 8054290160 | |||
| 3780 | 8054352623 | |||
| 3781 | 8054359369 | |||
| 3782 | 8054504546 | |||
| 3783 | 8054933046 | |||
| 3784 | 8055771983 | |||
| 3785 | 8055818979 | |||
| 3786 | 8055883748 | |||
| 3787 | 8056117225 | |||
| 3788 | 8056121712 | |||
| 3789 | 8056130834 | |||
| 3790 | 8056132864 | |||
| 3791 | 8056138373 | |||
| 3792 | 8056144352 | |||
| 3793 | 8056149064 | |||
| 3794 | 8056161134 | |||
| 3795 | 8056161272 | |||
| 3796 | 8056170048 | |||
| 3797 | 8056176177 | |||
| 3798 | 8056183447 | |||
| 3799 | 8056569656 | |||
| 3800 | 8057803277 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5caj-assembly2.cif.gz_B | crystal structure of e. coli yaaa, a member of the duf328/upf0246 family | 0.9879 | 1 | 256 |
| 5caj-assembly2.cif.gz_B | crystal structure of e. coli yaaa, a member of the duf328/upf0246 family | 0.9803 | 1 | 256 |
| 4wul-assembly1.cif.gz_B | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.6148 | 29 | 59 |
| 3lmz-assembly1.cif.gz_A-2 | crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution | 0.607 | 150 | 192 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.5706 | 29 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0V2P3_82_156_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7102 | 150 | 169 | 3.20.20.70 |
| 3nrbB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.6759 | 150 | 173 | 3.40.50.170 |
| af_Q92370_536_758_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.657 | 152 | 193 | 3.20.20.70 |
| af_P00912_12_224_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.6564 | 152 | 193 | 3.20.20.70 |
| af_P27836_65_232_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6381 | 150 | 169 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0XQF4-F1-model_v4 | Peroxide stress protein YaaA | 1.002 | 21 | 148 |
GO:0005829
GO:0033194 |
| AF-A0A381GSW7-F1-model_v4 | deleted | 1.001 | 1 | 176 |
|
| AF-A0A3C0H068-F1-model_v4 | deleted | 1.001 | 95 | 194 |
|
| AF-A0A836ZHI6-F1-model_v4 | deleted | 1 | 1 | 126 |
|
| AF-C6DF16-F1-model_v4 | UPF0246 protein PC1_3665 | 0.9994 | 1 | 257 |
GO:0005829
GO:0033194 |