F496009
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1898 | 397 | 3796 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_12371992|Ga0157378_123719921 |
| Length | 143 |
| Sequence | MNSGLGRVINKGTMEGSTGSPTIRVEIASSSEYRSSPTIRGKIYNQTYNFRSDGDTEYIIQLAEFVDSRMREISSGTLTVDSLKVAILAALHIADELHRLKNMHEQADSQLAARSSECAEMLDRLLKVRSTVDQSGAGKLSLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 214 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 215 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 247 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 255 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 256 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 262 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 312 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 313 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 315 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 326 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 327 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 328 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 330 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 331 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 335 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 336 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 341 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 343 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 345 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 346 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 347 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 349 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 351 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 352 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 353 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 358 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 360 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 362 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 363 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 364 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 365 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 366 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 369 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 98.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 42.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_12371992 | 3300013297 | Unclassified | 582 |
| 2 | SwRhRL3b_contig_2606832 | 2162886006 | Bacteria | 1085 |
| 3 | SwRhRL2b_contig_2182236 | 2162886007 | Bacteria | 2139 |
| 4 | SwRhRL2b_contig_2678464 | 2162886007 | Bacteria | 1016 |
| 5 | SwRhRL2b_contig_3329882 | 2162886007 | Bacteria | 1075 |
| 6 | SwRhRL2b_contig_493489 | 2162886007 | Bacteria | 1017 |
| 7 | MBSR1b_contig_13030068 | 2162886012 | Unclassified | 827 |
| 8 | CNBas_1009198 | 3300000531 | Bacteria | 592 |
| 9 | CNAas_1000026 | 3300000532 | Bacteria | 9657 |
| 10 | JGI24748J21848_1000007 | 3300002074 | Bacteria | 208838 |
| 11 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 12 | JGI24742J22300_10097535 | 3300002244 | Unclassified | 566 |
| 13 | JGI24751J29686_10000017 | 3300002459 | Bacteria | 109415 |
| 14 | JGI25406J46586_10001585 | 3300003203 | Bacteria | 10736 |
| 15 | JGI25406J46586_10038246 | 3300003203 | Unclassified | 1722 |
| 16 | rootL2_10066759 | 3300003322 | Bacteria | 1415 |
| 17 | Ga0065714_10064596 | 3300005288 | Bacteria | 30781 |
| 18 | Ga0065714_10155715 | 3300005288 | Bacteria | 1079 |
| 19 | Ga0065704_10085200 | 3300005289 | Bacteria | 3244 |
| 20 | Ga0065704_10096907 | 3300005289 | Bacteria | 2418 |
| 21 | Ga0065704_10156697 | 3300005289 | Bacteria | 1383 |
| 22 | Ga0065704_10157323 | 3300005289 | Bacteria | 1381 |
| 23 | Ga0065704_10189830 | 3300005289 | Bacteria | 1153 |
| 24 | Ga0065704_10230677 | 3300005289 | Bacteria | 1044 |
| 25 | Ga0065704_10253257 | 3300005289 | Bacteria | 984 |
| 26 | Ga0065704_10542488 | 3300005289 | Unclassified | 639 |
| 27 | Ga0065704_10699561 | 3300005289 | Unclassified | 561 |
| 28 | Ga0065712_10012497 | 3300005290 | Bacteria | 2927 |
| 29 | Ga0065712_10017635 | 3300005290 | Bacteria | 1369 |
| 30 | Ga0065712_10068446 | 3300005290 | Bacteria | 10594 |
| 31 | Ga0065712_10073588 | 3300005290 | Bacteria | 4340 |
| 32 | Ga0065712_10170628 | 3300005290 | Bacteria | 1246 |
| 33 | Ga0065712_10437363 | 3300005290 | Unclassified | 697 |
| 34 | Ga0065712_10799569 | 3300005290 | Unclassified | 510 |
| 35 | Ga0065715_10089589 | 3300005293 | Bacteria | 9352 |
| 36 | Ga0065715_10105571 | 3300005293 | Bacteria | 2884 |
| 37 | Ga0065715_10114416 | 3300005293 | Bacteria | 2452 |
| 38 | Ga0065715_10143814 | 3300005293 | Unclassified | 1816 |
| 39 | Ga0065715_10143933 | 3300005293 | Unclassified | 1814 |
| 40 | Ga0065715_10166621 | 3300005293 | Bacteria | 1577 |
| 41 | Ga0065715_10242280 | 3300005293 | Bacteria | 1195 |
| 42 | Ga0065715_10253488 | 3300005293 | Unclassified | 1160 |
| 43 | Ga0065715_10302654 | 3300005293 | Bacteria | 1038 |
| 44 | Ga0065715_10307704 | 3300005293 | Bacteria | 1027 |
| 45 | Ga0065715_10410560 | 3300005293 | Unclassified | 863 |
| 46 | Ga0065715_10416639 | 3300005293 | Unclassified | 863 |
| 47 | Ga0065715_10421457 | 3300005293 | Bacteria | 853 |
| 48 | Ga0065715_10560110 | 3300005293 | Unclassified | 734 |
| 49 | Ga0065715_10666358 | 3300005293 | Unclassified | 656 |
| 50 | Ga0065707_10001863 | 3300005295 | Bacteria | 6114 |
| 51 | Ga0065707_10031290 | 3300005295 | Bacteria | 1160 |
| 52 | Ga0065707_10056378 | 3300005295 | Unclassified | 828 |
| 53 | Ga0065707_10085169 | 3300005295 | Bacteria | 6387 |
| 54 | Ga0065707_10120297 | 3300005295 | Bacteria | 2138 |
| 55 | Ga0065707_10142778 | 3300005295 | Unclassified | 1751 |
| 56 | Ga0065707_10173065 | 3300005295 | Bacteria | 1463 |
| 57 | Ga0065707_10191731 | 3300005295 | Bacteria | 1357 |
| 58 | Ga0065707_10258876 | 3300005295 | Unclassified | 1103 |
| 59 | Ga0065707_10322032 | 3300005295 | Unclassified | 964 |
| 60 | Ga0065707_10489315 | 3300005295 | Unclassified | 766 |
| 61 | Ga0065707_10615549 | 3300005295 | Unclassified | 674 |
| 62 | Ga0065707_10707242 | 3300005295 | Unclassified | 636 |
| 63 | Ga0070676_10047850 | 3300005328 | Bacteria | 2499 |
| 64 | Ga0070676_10119856 | 3300005328 | Unclassified | 1650 |
| 65 | Ga0070676_11229767 | 3300005328 | Unclassified | 570 |
| 66 | Ga0070676_11341115 | 3300005328 | Bacteria | 547 |
| 67 | Ga0070683_100029338 | 3300005329 | Bacteria | 4979 |
| 68 | Ga0070690_100008280 | 3300005330 | Bacteria | 5980 |
| 69 | Ga0070690_100017532 | 3300005330 | Bacteria | 4309 |
| 70 | Ga0070690_100091789 | 3300005330 | Bacteria | 2001 |
| 71 | Ga0070690_100198775 | 3300005330 | Unclassified | 1394 |
| 72 | Ga0070690_100218282 | 3300005330 | Unclassified | 1335 |
| 73 | Ga0070690_100351653 | 3300005330 | Unclassified | 1070 |
| 74 | Ga0070690_100558567 | 3300005330 | Bacteria | 864 |
| 75 | Ga0070690_100628223 | 3300005330 | Unclassified | 818 |
| 76 | Ga0070670_100018951 | 3300005331 | Bacteria | 5901 |
| 77 | Ga0070670_100091664 | 3300005331 | Bacteria | 2613 |
| 78 | Ga0070670_100227248 | 3300005331 | Bacteria | 1624 |
| 79 | Ga0070670_100233014 | 3300005331 | Bacteria | 1602 |
| 80 | Ga0070670_100259548 | 3300005331 | Bacteria | 1514 |
| 81 | Ga0070670_100287380 | 3300005331 | Unclassified | 1436 |
| 82 | Ga0070670_100365621 | 3300005331 | Bacteria | 1269 |
| 83 | Ga0070670_100474437 | 3300005331 | Bacteria | 1110 |
| 84 | Ga0070670_100935932 | 3300005331 | Unclassified | 786 |
| 85 | Ga0070670_101411142 | 3300005331 | Unclassified | 638 |
| 86 | Ga0070677_10324477 | 3300005333 | Unclassified | 790 |
| 87 | Ga0068869_100042317 | 3300005334 | Unclassified | 3265 |
| 88 | Ga0068869_100071714 | 3300005334 | Bacteria | 2565 |
| 89 | Ga0068869_100082590 | 3300005334 | Unclassified | 2402 |
| 90 | Ga0068869_100109200 | 3300005334 | Bacteria | 2102 |
| 91 | Ga0068869_100513787 | 3300005334 | Bacteria | 1002 |
| 92 | Ga0068869_100899213 | 3300005334 | Bacteria | 766 |
| 93 | Ga0068869_100912852 | 3300005334 | Unclassified | 760 |
| 94 | Ga0068869_100981376 | 3300005334 | Unclassified | 735 |
| 95 | Ga0068869_101167199 | 3300005334 | Unclassified | 676 |
| 96 | Ga0068869_101261364 | 3300005334 | Unclassified | 651 |
| 97 | Ga0068869_101536944 | 3300005334 | Bacteria | 591 |
| 98 | Ga0070666_10077380 | 3300005335 | Bacteria | 2271 |
| 99 | Ga0070666_10089671 | 3300005335 | Unclassified | 2111 |
| 100 | Ga0070666_10165588 | 3300005335 | Bacteria | 1546 |
| 101 | Ga0070666_10210007 | 3300005335 | Unclassified | 1371 |
| 102 | Ga0070666_11137559 | 3300005335 | Unclassified | 581 |
| 103 | Ga0070680_100075635 | 3300005336 | Unclassified | 2772 |
| 104 | Ga0070680_100092736 | 3300005336 | Bacteria | 2501 |
| 105 | Ga0070680_100604699 | 3300005336 | Bacteria | 941 |
| 106 | Ga0070680_101743412 | 3300005336 | Unclassified | 540 |
| 107 | Ga0070682_100308754 | 3300005337 | Bacteria | 1164 |
| 108 | Ga0070682_100579655 | 3300005337 | Unclassified | 882 |
| 109 | Ga0068868_100043939 | 3300005338 | Bacteria | 3491 |
| 110 | Ga0068868_100045354 | 3300005338 | Bacteria | 3439 |
| 111 | Ga0068868_100302998 | 3300005338 | Bacteria | 1357 |
| 112 | Ga0068868_100727430 | 3300005338 | Bacteria | 890 |
| 113 | Ga0068868_101636718 | 3300005338 | Unclassified | 605 |
| 114 | Ga0068868_102163695 | 3300005338 | Bacteria | 530 |
| 115 | Ga0070660_100136948 | 3300005339 | Bacteria | 1962 |
| 116 | Ga0070660_100347076 | 3300005339 | Unclassified | 1222 |
| 117 | Ga0070660_100927300 | 3300005339 | Unclassified | 735 |
| 118 | Ga0070689_100048155 | 3300005340 | Bacteria | 3287 |
| 119 | Ga0070689_100114116 | 3300005340 | Unclassified | 2152 |
| 120 | Ga0070689_100182392 | 3300005340 | Unclassified | 1705 |
| 121 | Ga0070689_100612400 | 3300005340 | Unclassified | 944 |
| 122 | Ga0070689_100792098 | 3300005340 | Unclassified | 833 |
| 123 | Ga0070689_100801047 | 3300005340 | Bacteria | 828 |
| 124 | Ga0070689_100915224 | 3300005340 | Unclassified | 776 |
| 125 | Ga0070689_100976095 | 3300005340 | Unclassified | 753 |
| 126 | Ga0070689_101231086 | 3300005340 | Bacteria | 673 |
| 127 | Ga0070689_101261497 | 3300005340 | Unclassified | 665 |
| 128 | Ga0070689_101379984 | 3300005340 | Unclassified | 636 |
| 129 | Ga0070689_101798378 | 3300005340 | Unclassified | 559 |
| 130 | Ga0070691_10058073 | 3300005341 | Bacteria | 1857 |
| 131 | Ga0070691_10466935 | 3300005341 | Unclassified | 723 |
| 132 | Ga0070687_100024091 | 3300005343 | Bacteria | 2901 |
| 133 | Ga0070687_100025782 | 3300005343 | Bacteria | 2825 |
| 134 | Ga0070687_100070835 | 3300005343 | Unclassified | 1871 |
| 135 | Ga0070687_100084954 | 3300005343 | Bacteria | 1736 |
| 136 | Ga0070687_100413834 | 3300005343 | Bacteria | 887 |
| 137 | Ga0070687_100432701 | 3300005343 | Unclassified | 871 |
| 138 | Ga0070687_100644176 | 3300005343 | Bacteria | 733 |
| 139 | Ga0070687_101247132 | 3300005343 | Unclassified | 550 |
| 140 | Ga0070661_100009109 | 3300005344 | Bacteria | 6861 |
| 141 | Ga0070661_100277369 | 3300005344 | Bacteria | 1299 |
| 142 | Ga0070661_100377622 | 3300005344 | Unclassified | 1117 |
| 143 | Ga0070661_100584649 | 3300005344 | Bacteria | 901 |
| 144 | Ga0070661_100879594 | 3300005344 | Unclassified | 739 |
| 145 | Ga0070661_100899954 | 3300005344 | Bacteria | 730 |
| 146 | Ga0070661_101068651 | 3300005344 | Unclassified | 671 |
| 147 | Ga0070661_101608780 | 3300005344 | Unclassified | 549 |
| 148 | Ga0070692_10057713 | 3300005345 | Bacteria | 2036 |
| 149 | Ga0070692_10074545 | 3300005345 | Bacteria | 1815 |
| 150 | Ga0070692_10103987 | 3300005345 | Bacteria | 1561 |
| 151 | Ga0070692_10141869 | 3300005345 | Bacteria | 1360 |
| 152 | Ga0070692_10152704 | 3300005345 | Bacteria | 1316 |
| 153 | Ga0070692_10423875 | 3300005345 | Unclassified | 845 |
| 154 | Ga0070692_10569979 | 3300005345 | Bacteria | 744 |
| 155 | Ga0070692_11066994 | 3300005345 | Unclassified | 568 |
| 156 | Ga0070668_100022818 | 3300005347 | Bacteria | 4731 |
| 157 | Ga0070668_100102868 | 3300005347 | Unclassified | 2265 |
| 158 | Ga0070668_100902224 | 3300005347 | Bacteria | 790 |
| 159 | Ga0070669_100001947 | 3300005353 | Bacteria | 14905 |
| 160 | Ga0070669_100008114 | 3300005353 | Bacteria | 7501 |
| 161 | Ga0070669_100011425 | 3300005353 | Bacteria | 6303 |
| 162 | Ga0070669_100013610 | 3300005353 | Bacteria | 5781 |
| 163 | Ga0070669_100214875 | 3300005353 | Bacteria | 1518 |
| 164 | Ga0070669_101094149 | 3300005353 | Unclassified | 686 |
| 165 | Ga0070669_101176012 | 3300005353 | Unclassified | 662 |
| 166 | Ga0070669_101301904 | 3300005353 | Bacteria | 629 |
| 167 | Ga0070675_100219024 | 3300005354 | Bacteria | 1657 |
| 168 | Ga0070675_100340379 | 3300005354 | Unclassified | 1328 |
| 169 | Ga0070675_100420842 | 3300005354 | Unclassified | 1194 |
| 170 | Ga0070675_100580437 | 3300005354 | Unclassified | 1016 |
| 171 | Ga0070675_100867426 | 3300005354 | Bacteria | 826 |
| 172 | Ga0070675_101832422 | 3300005354 | Unclassified | 560 |
| 173 | Ga0070671_100001256 | 3300005355 | Bacteria | 19009 |
| 174 | Ga0070671_100007418 | 3300005355 | Bacteria | 8766 |
| 175 | Ga0070671_100098235 | 3300005355 | Bacteria | 2456 |
| 176 | Ga0070671_100106170 | 3300005355 | Bacteria | 2357 |
| 177 | Ga0070671_100175034 | 3300005355 | Unclassified | 1815 |
| 178 | Ga0070671_100190022 | 3300005355 | Bacteria | 1740 |
| 179 | Ga0070674_100165824 | 3300005356 | Bacteria | 1680 |
| 180 | Ga0070674_100355874 | 3300005356 | Bacteria | 1184 |
| 181 | Ga0070674_101989599 | 3300005356 | Bacteria | 529 |
| 182 | Ga0070673_100004450 | 3300005364 | Bacteria | 8859 |
| 183 | Ga0070673_100109455 | 3300005364 | Bacteria | 2289 |
| 184 | Ga0070673_100114359 | 3300005364 | Bacteria | 2242 |
| 185 | Ga0070673_100149071 | 3300005364 | Unclassified | 1980 |
| 186 | Ga0070673_100241304 | 3300005364 | Unclassified | 1571 |
| 187 | Ga0070673_100405270 | 3300005364 | Unclassified | 1220 |
| 188 | Ga0070673_100469880 | 3300005364 | Bacteria | 1134 |
| 189 | Ga0070673_101120566 | 3300005364 | Bacteria | 735 |
| 190 | Ga0070673_101364789 | 3300005364 | Unclassified | 667 |
| 191 | Ga0070673_101510124 | 3300005364 | Unclassified | 634 |
| 192 | Ga0070673_101511025 | 3300005364 | Unclassified | 633 |
| 193 | Ga0070673_101885102 | 3300005364 | Unclassified | 567 |
| 194 | Ga0070673_102010185 | 3300005364 | Bacteria | 549 |
| 195 | Ga0070673_102129758 | 3300005364 | Unclassified | 533 |
| 196 | Ga0070688_100023832 | 3300005365 | Bacteria | 3605 |
| 197 | Ga0070688_100552373 | 3300005365 | Bacteria | 875 |
| 198 | Ga0070688_100938862 | 3300005365 | Unclassified | 684 |
| 199 | Ga0070659_100015215 | 3300005366 | Bacteria | 5758 |
| 200 | Ga0070659_100082434 | 3300005366 | Bacteria | 2569 |
| 201 | Ga0070659_100133946 | 3300005366 | Bacteria | 2014 |
| 202 | Ga0070659_100291319 | 3300005366 | Unclassified | 1359 |
| 203 | Ga0070659_100831866 | 3300005366 | Unclassified | 804 |
| 204 | Ga0070667_100015535 | 3300005367 | Bacteria | 6293 |
| 205 | Ga0070667_100072731 | 3300005367 | Bacteria | 2930 |
| 206 | Ga0070703_10001368 | 3300005406 | Bacteria | 7405 |
| 207 | Ga0070703_10068408 | 3300005406 | Unclassified | 1180 |
| 208 | Ga0070703_10275264 | 3300005406 | Unclassified | 692 |
| 209 | Ga0070709_11005617 | 3300005434 | Unclassified | 663 |
| 210 | Ga0070709_11325766 | 3300005434 | Bacteria | 581 |
| 211 | Ga0070709_11785012 | 3300005434 | Unclassified | 503 |
| 212 | Ga0070710_11135714 | 3300005437 | Bacteria | 575 |
| 213 | Ga0070701_10116203 | 3300005438 | Bacteria | 1501 |
| 214 | Ga0070701_10141915 | 3300005438 | Bacteria | 1375 |
| 215 | Ga0070701_10341047 | 3300005438 | Bacteria | 933 |
| 216 | Ga0070705_100016905 | 3300005440 | Unclassified | 3799 |
| 217 | Ga0070705_100022103 | 3300005440 | Bacteria | 3394 |
| 218 | Ga0070705_100033199 | 3300005440 | Unclassified | 2875 |
| 219 | Ga0070705_100115914 | 3300005440 | Bacteria | 1721 |
| 220 | Ga0070705_100391981 | 3300005440 | Bacteria | 1026 |
| 221 | Ga0070705_100454282 | 3300005440 | Unclassified | 962 |
| 222 | Ga0070705_100584473 | 3300005440 | Unclassified | 861 |
| 223 | Ga0070705_100643677 | 3300005440 | Unclassified | 826 |
| 224 | Ga0070705_100877628 | 3300005440 | Unclassified | 720 |
| 225 | Ga0070705_100886461 | 3300005440 | Unclassified | 716 |
| 226 | Ga0070705_101494769 | 3300005440 | Unclassified | 566 |
| 227 | Ga0070705_101709442 | 3300005440 | Unclassified | 532 |
| 228 | Ga0070705_101888888 | 3300005440 | Unclassified | 508 |
| 229 | Ga0070700_100008091 | 3300005441 | Bacteria | 5714 |
| 230 | Ga0070700_100021298 | 3300005441 | Bacteria | 3767 |
| 231 | Ga0070700_100035918 | 3300005441 | Bacteria | 3002 |
| 232 | Ga0070700_100077203 | 3300005441 | Bacteria | 2141 |
| 233 | Ga0070700_100121005 | 3300005441 | Bacteria | 1754 |
| 234 | Ga0070700_100183930 | 3300005441 | Bacteria | 1456 |
| 235 | Ga0070700_100309882 | 3300005441 | Bacteria | 1156 |
| 236 | Ga0070700_100503396 | 3300005441 | Unclassified | 932 |
| 237 | Ga0070700_100625860 | 3300005441 | Bacteria | 847 |
| 238 | Ga0070700_100925504 | 3300005441 | Bacteria | 711 |
| 239 | Ga0070700_101029313 | 3300005441 | Unclassified | 679 |
| 240 | Ga0070694_100006114 | 3300005444 | Bacteria | 7303 |
| 241 | Ga0070694_100017025 | 3300005444 | Bacteria | 4587 |
| 242 | Ga0070694_100017068 | 3300005444 | Bacteria | 4582 |
| 243 | Ga0070694_100030850 | 3300005444 | Bacteria | 3511 |
| 244 | Ga0070694_100066429 | 3300005444 | Bacteria | 2474 |
| 245 | Ga0070694_100069673 | 3300005444 | Unclassified | 2420 |
| 246 | Ga0070694_100088638 | 3300005444 | Bacteria | 2166 |
| 247 | Ga0070694_100110123 | 3300005444 | Unclassified | 1961 |
| 248 | Ga0070694_100211432 | 3300005444 | Bacteria | 1451 |
| 249 | Ga0070694_100233892 | 3300005444 | Bacteria | 1384 |
| 250 | Ga0070694_100248390 | 3300005444 | Unclassified | 1345 |
| 251 | Ga0070694_100265475 | 3300005444 | Bacteria | 1303 |
| 252 | Ga0070694_100282232 | 3300005444 | Unclassified | 1266 |
| 253 | Ga0070694_100374061 | 3300005444 | Bacteria | 1109 |
| 254 | Ga0070694_100407346 | 3300005444 | Bacteria | 1066 |
| 255 | Ga0070694_100482870 | 3300005444 | Unclassified | 983 |
| 256 | Ga0070694_100564772 | 3300005444 | Unclassified | 912 |
| 257 | Ga0070694_100617349 | 3300005444 | Unclassified | 875 |
| 258 | Ga0070694_100707529 | 3300005444 | Bacteria | 820 |
| 259 | Ga0070694_100722399 | 3300005444 | Bacteria | 812 |
| 260 | Ga0070694_100791916 | 3300005444 | Unclassified | 777 |
| 261 | Ga0070694_100893024 | 3300005444 | Unclassified | 733 |
| 262 | Ga0070694_100928613 | 3300005444 | Unclassified | 719 |
| 263 | Ga0070694_101188352 | 3300005444 | Unclassified | 639 |
| 264 | Ga0070708_100001683 | 3300005445 | Bacteria | 16984 |
| 265 | Ga0070708_100151043 | 3300005445 | Unclassified | 2160 |
| 266 | Ga0070708_100188649 | 3300005445 | Bacteria | 1928 |
| 267 | Ga0070708_100539072 | 3300005445 | Unclassified | 1101 |
| 268 | Ga0070708_100712104 | 3300005445 | Bacteria | 945 |
| 269 | Ga0070708_100751763 | 3300005445 | Bacteria | 917 |
| 270 | Ga0070663_100523728 | 3300005455 | Unclassified | 987 |
| 271 | Ga0070678_100027941 | 3300005456 | Bacteria | 3839 |
| 272 | Ga0070678_100209385 | 3300005456 | Bacteria | 1615 |
| 273 | Ga0070678_100376056 | 3300005456 | Bacteria | 1228 |
| 274 | Ga0070678_100494588 | 3300005456 | Unclassified | 1078 |
| 275 | Ga0070678_101082263 | 3300005456 | Unclassified | 740 |
| 276 | Ga0070662_100077443 | 3300005457 | Unclassified | 2468 |
| 277 | Ga0070662_100088200 | 3300005457 | Bacteria | 2325 |
| 278 | Ga0070662_100188953 | 3300005457 | Unclassified | 1628 |
| 279 | Ga0070662_100295795 | 3300005457 | Bacteria | 1314 |
| 280 | Ga0070662_100368913 | 3300005457 | Bacteria | 1179 |
| 281 | Ga0070662_100378086 | 3300005457 | Bacteria | 1165 |
| 282 | Ga0070662_100481658 | 3300005457 | Bacteria | 1033 |
| 283 | Ga0070662_100513138 | 3300005457 | Bacteria | 1001 |
| 284 | Ga0070662_101001034 | 3300005457 | Unclassified | 715 |
| 285 | Ga0070662_101615268 | 3300005457 | Unclassified | 560 |
| 286 | Ga0070681_10000417 | 3300005458 | Bacteria | 34518 |
| 287 | Ga0070681_10005337 | 3300005458 | Bacteria | 12405 |
| 288 | Ga0070681_10006520 | 3300005458 | Bacteria | 11359 |
| 289 | Ga0070681_10017987 | 3300005458 | Bacteria | 7062 |
| 290 | Ga0070681_10130732 | 3300005458 | Bacteria | 2443 |
| 291 | Ga0068867_100020741 | 3300005459 | Bacteria | 4684 |
| 292 | Ga0068867_100090267 | 3300005459 | Unclassified | 2324 |
| 293 | Ga0068867_100113031 | 3300005459 | Bacteria | 2089 |
| 294 | Ga0068867_100143720 | 3300005459 | Unclassified | 1867 |
| 295 | Ga0068867_100777683 | 3300005459 | Bacteria | 852 |
| 296 | Ga0068867_101020617 | 3300005459 | Unclassified | 751 |
| 297 | Ga0068867_101032110 | 3300005459 | Unclassified | 747 |
| 298 | Ga0068867_101130278 | 3300005459 | Unclassified | 716 |
| 299 | Ga0070685_10042338 | 3300005466 | Bacteria | 2599 |
| 300 | Ga0070685_10210118 | 3300005466 | Bacteria | 1270 |
| 301 | Ga0070706_100000088 | 3300005467 | Bacteria | 107818 |
| 302 | Ga0070706_100002494 | 3300005467 | Bacteria | 18540 |
| 303 | Ga0070706_100003757 | 3300005467 | Bacteria | 14826 |
| 304 | Ga0070706_100010028 | 3300005467 | Bacteria | 8797 |
| 305 | Ga0070706_100048296 | 3300005467 | Unclassified | 3928 |
| 306 | Ga0070706_100060959 | 3300005467 | Unclassified | 3483 |
| 307 | Ga0070706_100127468 | 3300005467 | Unclassified | 2374 |
| 308 | Ga0070706_100132548 | 3300005467 | Bacteria | 2326 |
| 309 | Ga0070706_100217672 | 3300005467 | Bacteria | 1783 |
| 310 | Ga0070706_100672474 | 3300005467 | Unclassified | 961 |
| 311 | Ga0070706_100897812 | 3300005467 | Bacteria | 819 |
| 312 | Ga0070706_100987091 | 3300005467 | Unclassified | 777 |
| 313 | Ga0070706_101487867 | 3300005467 | Bacteria | 619 |
| 314 | Ga0070706_101962829 | 3300005467 | Unclassified | 530 |
| 315 | Ga0070707_100001325 | 3300005468 | Bacteria | 24376 |
| 316 | Ga0070707_100008179 | 3300005468 | Bacteria | 9705 |
| 317 | Ga0070707_100014868 | 3300005468 | Bacteria | 7299 |
| 318 | Ga0070707_100070878 | 3300005468 | Bacteria | 3357 |
| 319 | Ga0070707_100133757 | 3300005468 | Unclassified | 2412 |
| 320 | Ga0070707_100142361 | 3300005468 | Unclassified | 2334 |
| 321 | Ga0070707_100477753 | 3300005468 | Unclassified | 1208 |
| 322 | Ga0070707_100555056 | 3300005468 | Bacteria | 1111 |
| 323 | Ga0070707_100645870 | 3300005468 | Unclassified | 1021 |
| 324 | Ga0070707_100707100 | 3300005468 | Bacteria | 971 |
| 325 | Ga0070707_100912847 | 3300005468 | Unclassified | 843 |
| 326 | Ga0070698_100007026 | 3300005471 | Bacteria | 12193 |
| 327 | Ga0070698_100007616 | 3300005471 | Bacteria | 11718 |
| 328 | Ga0070698_100022051 | 3300005471 | Bacteria | 6668 |
| 329 | Ga0070698_100030847 | 3300005471 | Bacteria | 5558 |
| 330 | Ga0070698_100061585 | 3300005471 | Bacteria | 3787 |
| 331 | Ga0070698_100077625 | 3300005471 | Unclassified | 3320 |
| 332 | Ga0070698_100078648 | 3300005471 | Bacteria | 3296 |
| 333 | Ga0070698_100159275 | 3300005471 | Unclassified | 2202 |
| 334 | Ga0070698_100570912 | 3300005471 | Unclassified | 1071 |
| 335 | Ga0070698_100740749 | 3300005471 | Unclassified | 926 |
| 336 | Ga0070698_101590068 | 3300005471 | Unclassified | 606 |
| 337 | Ga0070699_100003262 | 3300005518 | Bacteria | 14357 |
| 338 | Ga0070699_100007628 | 3300005518 | Bacteria | 9407 |
| 339 | Ga0070699_100026044 | 3300005518 | Bacteria | 5044 |
| 340 | Ga0070699_100047431 | 3300005518 | Bacteria | 3717 |
| 341 | Ga0070699_100054211 | 3300005518 | Bacteria | 3471 |
| 342 | Ga0070699_100175910 | 3300005518 | Bacteria | 1898 |
| 343 | Ga0070699_100207918 | 3300005518 | Unclassified | 1741 |
| 344 | Ga0070699_100290595 | 3300005518 | Bacteria | 1466 |
| 345 | Ga0070699_100403511 | 3300005518 | Unclassified | 1236 |
| 346 | Ga0070699_100696042 | 3300005518 | Unclassified | 928 |
| 347 | Ga0070699_100723489 | 3300005518 | Unclassified | 910 |
| 348 | Ga0070679_100000797 | 3300005530 | Bacteria | 27372 |
| 349 | Ga0070679_100001091 | 3300005530 | Bacteria | 23751 |
| 350 | Ga0070679_100159214 | 3300005530 | Bacteria | 2232 |
| 351 | Ga0070684_100263437 | 3300005535 | Bacteria | 1577 |
| 352 | Ga0070684_100500613 | 3300005535 | Bacteria | 1125 |
| 353 | Ga0070684_100633784 | 3300005535 | Bacteria | 995 |
| 354 | Ga0070684_100698411 | 3300005535 | Bacteria | 946 |
| 355 | Ga0070697_100000155 | 3300005536 | Bacteria | 55402 |
| 356 | Ga0070697_100000205 | 3300005536 | Bacteria | 48600 |
| 357 | Ga0070697_100010667 | 3300005536 | Bacteria | 7172 |
| 358 | Ga0070697_100012364 | 3300005536 | Bacteria | 6687 |
| 359 | Ga0070697_100102832 | 3300005536 | Unclassified | 2374 |
| 360 | Ga0070697_100135478 | 3300005536 | Unclassified | 2068 |
| 361 | Ga0070697_100166061 | 3300005536 | Bacteria | 1866 |
| 362 | Ga0070697_100182354 | 3300005536 | Bacteria | 1779 |
| 363 | Ga0070697_100188907 | 3300005536 | Bacteria | 1748 |
| 364 | Ga0070697_100196973 | 3300005536 | Bacteria | 1711 |
| 365 | Ga0070697_100213928 | 3300005536 | Unclassified | 1642 |
| 366 | Ga0070697_100277376 | 3300005536 | Unclassified | 1438 |
| 367 | Ga0070697_100317819 | 3300005536 | Bacteria | 1340 |
| 368 | Ga0070697_100420130 | 3300005536 | Bacteria | 1162 |
| 369 | Ga0070697_100454809 | 3300005536 | Bacteria | 1116 |
| 370 | Ga0068853_100002482 | 3300005539 | Bacteria | 13818 |
| 371 | Ga0068853_100009445 | 3300005539 | Bacteria | 7858 |
| 372 | Ga0068853_100019123 | 3300005539 | Bacteria | 5675 |
| 373 | Ga0068853_100047228 | 3300005539 | Bacteria | 3694 |
| 374 | Ga0068853_100055959 | 3300005539 | Bacteria | 3400 |
| 375 | Ga0068853_100386123 | 3300005539 | Bacteria | 1308 |
| 376 | Ga0068853_101415176 | 3300005539 | Bacteria | 673 |
| 377 | Ga0068853_101631827 | 3300005539 | Unclassified | 625 |
| 378 | Ga0070672_100014398 | 3300005543 | Bacteria | 5605 |
| 379 | Ga0070672_100077694 | 3300005543 | Bacteria | 2655 |
| 380 | Ga0070672_100693715 | 3300005543 | Bacteria | 891 |
| 381 | Ga0070672_100731410 | 3300005543 | Bacteria | 868 |
| 382 | Ga0070672_100961588 | 3300005543 | Unclassified | 756 |
| 383 | Ga0070686_100001133 | 3300005544 | Bacteria | 15326 |
| 384 | Ga0070686_100069827 | 3300005544 | Bacteria | 2296 |
| 385 | Ga0070686_100098136 | 3300005544 | Bacteria | 1974 |
| 386 | Ga0070686_100108160 | 3300005544 | Unclassified | 1889 |
| 387 | Ga0070686_100125175 | 3300005544 | Unclassified | 1770 |
| 388 | Ga0070686_100160897 | 3300005544 | Bacteria | 1581 |
| 389 | Ga0070686_100313995 | 3300005544 | Unclassified | 1166 |
| 390 | Ga0070686_100543088 | 3300005544 | Unclassified | 908 |
| 391 | Ga0070686_100960797 | 3300005544 | Unclassified | 698 |
| 392 | Ga0070695_100079556 | 3300005545 | Bacteria | 2164 |
| 393 | Ga0070695_100080896 | 3300005545 | Bacteria | 2148 |
| 394 | Ga0070695_100095384 | 3300005545 | Bacteria | 1993 |
| 395 | Ga0070695_100111594 | 3300005545 | Bacteria | 1856 |
| 396 | Ga0070695_100175514 | 3300005545 | Unclassified | 1514 |
| 397 | Ga0070695_100176264 | 3300005545 | Unclassified | 1512 |
| 398 | Ga0070695_100179168 | 3300005545 | Bacteria | 1500 |
| 399 | Ga0070695_100187823 | 3300005545 | Bacteria | 1468 |
| 400 | Ga0070695_100274574 | 3300005545 | Unclassified | 1236 |
| 401 | Ga0070695_100281472 | 3300005545 | Bacteria | 1222 |
| 402 | Ga0070695_100354240 | 3300005545 | Bacteria | 1100 |
| 403 | Ga0070695_101108870 | 3300005545 | Unclassified | 648 |
| 404 | Ga0070695_101361126 | 3300005545 | Unclassified | 588 |
| 405 | Ga0070696_100019932 | 3300005546 | Unclassified | 4545 |
| 406 | Ga0070696_100023964 | 3300005546 | Bacteria | 4147 |
| 407 | Ga0070696_100040232 | 3300005546 | Bacteria | 3227 |
| 408 | Ga0070696_100063781 | 3300005546 | Bacteria | 2581 |
| 409 | Ga0070696_100120767 | 3300005546 | Unclassified | 1896 |
| 410 | Ga0070696_100237954 | 3300005546 | Unclassified | 1372 |
| 411 | Ga0070696_100321041 | 3300005546 | Bacteria | 1192 |
| 412 | Ga0070696_100456591 | 3300005546 | Unclassified | 1009 |
| 413 | Ga0070696_100550746 | 3300005546 | Bacteria | 924 |
| 414 | Ga0070696_100602912 | 3300005546 | Bacteria | 886 |
| 415 | Ga0070696_100673846 | 3300005546 | Unclassified | 841 |
| 416 | Ga0070696_100786969 | 3300005546 | Unclassified | 782 |
| 417 | Ga0070696_101000354 | 3300005546 | Unclassified | 698 |
| 418 | Ga0070696_101051317 | 3300005546 | Unclassified | 682 |
| 419 | Ga0070696_101594424 | 3300005546 | Unclassified | 561 |
| 420 | Ga0070693_100001027 | 3300005547 | Bacteria | 12460 |
| 421 | Ga0070693_100020106 | 3300005547 | Bacteria | 3515 |
| 422 | Ga0070693_100040618 | 3300005547 | Unclassified | 2612 |
| 423 | Ga0070693_100120448 | 3300005547 | Bacteria | 1627 |
| 424 | Ga0070693_100146133 | 3300005547 | Bacteria | 1493 |
| 425 | Ga0070693_100161362 | 3300005547 | Bacteria | 1428 |
| 426 | Ga0070693_100231616 | 3300005547 | Bacteria | 1216 |
| 427 | Ga0070693_100234541 | 3300005547 | Bacteria | 1209 |
| 428 | Ga0070693_100260436 | 3300005547 | Unclassified | 1153 |
| 429 | Ga0070693_100325100 | 3300005547 | Unclassified | 1045 |
| 430 | Ga0070693_100356585 | 3300005547 | Bacteria | 1002 |
| 431 | Ga0070693_100512654 | 3300005547 | Bacteria | 852 |
| 432 | Ga0070693_100805751 | 3300005547 | Unclassified | 696 |
| 433 | Ga0070665_102232576 | 3300005548 | Unclassified | 551 |
| 434 | Ga0070665_102537069 | 3300005548 | Unclassified | 514 |
| 435 | Ga0070704_100000638 | 3300005549 | Bacteria | 16925 |
| 436 | Ga0070704_100011390 | 3300005549 | Bacteria | 5449 |
| 437 | Ga0070704_100055340 | 3300005549 | Bacteria | 2812 |
| 438 | Ga0070704_100094157 | 3300005549 | Bacteria | 2240 |
| 439 | Ga0070704_100134596 | 3300005549 | Unclassified | 1921 |
| 440 | Ga0070704_100142336 | 3300005549 | Unclassified | 1874 |
| 441 | Ga0070704_100192071 | 3300005549 | Bacteria | 1642 |
| 442 | Ga0070704_100225477 | 3300005549 | Bacteria | 1526 |
| 443 | Ga0070704_100245537 | 3300005549 | Bacteria | 1467 |
| 444 | Ga0070704_100298268 | 3300005549 | Bacteria | 1342 |
| 445 | Ga0070704_100372851 | 3300005549 | Bacteria | 1210 |
| 446 | Ga0070704_100407869 | 3300005549 | Unclassified | 1161 |
| 447 | Ga0070704_100468200 | 3300005549 | Unclassified | 1088 |
| 448 | Ga0070704_100529797 | 3300005549 | Bacteria | 1026 |
| 449 | Ga0070704_101010391 | 3300005549 | Unclassified | 752 |
| 450 | Ga0070704_101043703 | 3300005549 | Unclassified | 741 |
| 451 | Ga0070704_101186742 | 3300005549 | Unclassified | 696 |
| 452 | Ga0070704_101386499 | 3300005549 | Unclassified | 644 |
| 453 | Ga0070704_101872853 | 3300005549 | Unclassified | 556 |
| 454 | Ga0070704_102225550 | 3300005549 | Unclassified | 510 |
| 455 | Ga0068855_100082116 | 3300005563 | Unclassified | 3735 |
| 456 | Ga0068855_100123812 | 3300005563 | Unclassified | 2957 |
| 457 | Ga0068855_101158766 | 3300005563 | Bacteria | 805 |
| 458 | Ga0070664_100001593 | 3300005564 | Bacteria | 18144 |
| 459 | Ga0070664_100019348 | 3300005564 | Bacteria | 5602 |
| 460 | Ga0070664_100034374 | 3300005564 | Bacteria | 4252 |
| 461 | Ga0070664_100110606 | 3300005564 | Bacteria | 2398 |
| 462 | Ga0070664_100219134 | 3300005564 | Bacteria | 1702 |
| 463 | Ga0070664_100250658 | 3300005564 | Bacteria | 1591 |
| 464 | Ga0070664_100258816 | 3300005564 | Bacteria | 1565 |
| 465 | Ga0070664_100295084 | 3300005564 | Bacteria | 1464 |
| 466 | Ga0070664_100832186 | 3300005564 | Bacteria | 864 |
| 467 | Ga0070664_100865431 | 3300005564 | Unclassified | 847 |
| 468 | Ga0070664_100908978 | 3300005564 | Bacteria | 825 |
| 469 | Ga0070664_101192161 | 3300005564 | Bacteria | 718 |
| 470 | Ga0070664_102184821 | 3300005564 | Unclassified | 525 |
| 471 | Ga0068857_100007456 | 3300005577 | Bacteria | 9414 |
| 472 | Ga0068857_100162531 | 3300005577 | Bacteria | 2026 |
| 473 | Ga0068857_100238232 | 3300005577 | Bacteria | 1665 |
| 474 | Ga0068857_100334645 | 3300005577 | Bacteria | 1400 |
| 475 | Ga0068857_100592349 | 3300005577 | Bacteria | 1047 |
| 476 | Ga0068857_100707492 | 3300005577 | Unclassified | 957 |
| 477 | Ga0068857_100841467 | 3300005577 | Unclassified | 878 |
| 478 | Ga0068857_100977441 | 3300005577 | Unclassified | 814 |
| 479 | Ga0068857_100979100 | 3300005577 | Unclassified | 813 |
| 480 | Ga0068857_101937024 | 3300005577 | Unclassified | 577 |
| 481 | Ga0068854_100066991 | 3300005578 | Bacteria | 2615 |
| 482 | Ga0068854_100165762 | 3300005578 | Bacteria | 1715 |
| 483 | Ga0068854_100222826 | 3300005578 | Unclassified | 1493 |
| 484 | Ga0068854_100247555 | 3300005578 | Bacteria | 1422 |
| 485 | Ga0068854_100309976 | 3300005578 | Unclassified | 1280 |
| 486 | Ga0068854_100339251 | 3300005578 | Bacteria | 1227 |
| 487 | Ga0068854_100506345 | 3300005578 | Unclassified | 1018 |
| 488 | Ga0068854_100595120 | 3300005578 | Bacteria | 943 |
| 489 | Ga0068854_100596486 | 3300005578 | Bacteria | 942 |
| 490 | Ga0068854_100605661 | 3300005578 | Bacteria | 936 |
| 491 | Ga0068854_100619376 | 3300005578 | Unclassified | 926 |
| 492 | Ga0068854_100741171 | 3300005578 | Unclassified | 851 |
| 493 | Ga0068854_100814971 | 3300005578 | Unclassified | 815 |
| 494 | Ga0068854_100935980 | 3300005578 | Unclassified | 763 |
| 495 | Ga0068854_101577272 | 3300005578 | Unclassified | 598 |
| 496 | Ga0068854_102254851 | 3300005578 | Bacteria | 504 |
| 497 | Ga0068856_100013790 | 3300005614 | Bacteria | 7812 |
| 498 | Ga0068856_100377881 | 3300005614 | Bacteria | 1436 |
| 499 | Ga0070702_100008168 | 3300005615 | Bacteria | 5056 |
| 500 | Ga0070702_100083104 | 3300005615 | Unclassified | 1923 |
| 501 | Ga0070702_100151910 | 3300005615 | Bacteria | 1487 |
| 502 | Ga0070702_100154024 | 3300005615 | Unclassified | 1479 |
| 503 | Ga0070702_100155020 | 3300005615 | Unclassified | 1474 |
| 504 | Ga0070702_100165177 | 3300005615 | Unclassified | 1435 |
| 505 | Ga0070702_100276673 | 3300005615 | Unclassified | 1150 |
| 506 | Ga0070702_100308442 | 3300005615 | Unclassified | 1098 |
| 507 | Ga0070702_100453731 | 3300005615 | Bacteria | 931 |
| 508 | Ga0070702_100968627 | 3300005615 | Bacteria | 671 |
| 509 | Ga0070702_100990839 | 3300005615 | Unclassified | 664 |
| 510 | Ga0070702_101279812 | 3300005615 | Bacteria | 595 |
| 511 | Ga0068852_100108736 | 3300005616 | Bacteria | 2517 |
| 512 | Ga0068852_100178412 | 3300005616 | Bacteria | 1996 |
| 513 | Ga0068852_101241939 | 3300005616 | Unclassified | 766 |
| 514 | Ga0068852_101669583 | 3300005616 | Bacteria | 660 |
| 515 | Ga0068852_102264094 | 3300005616 | Bacteria | 565 |
| 516 | Ga0068852_102352623 | 3300005616 | Unclassified | 554 |
| 517 | Ga0068859_100020868 | 3300005617 | Bacteria | 6575 |
| 518 | Ga0068859_100021421 | 3300005617 | Bacteria | 6487 |
| 519 | Ga0068859_100024568 | 3300005617 | Bacteria | 6045 |
| 520 | Ga0068859_100044736 | 3300005617 | Bacteria | 4448 |
| 521 | Ga0068859_100055086 | 3300005617 | Unclassified | 4001 |
| 522 | Ga0068859_100070562 | 3300005617 | Bacteria | 3529 |
| 523 | Ga0068859_100078004 | 3300005617 | Bacteria | 3353 |
| 524 | Ga0068859_100105980 | 3300005617 | Bacteria | 2870 |
| 525 | Ga0068859_100149850 | 3300005617 | Unclassified | 2408 |
| 526 | Ga0068859_100200803 | 3300005617 | Bacteria | 2078 |
| 527 | Ga0068859_100409209 | 3300005617 | Bacteria | 1452 |
| 528 | Ga0068859_100647282 | 3300005617 | Bacteria | 1149 |
| 529 | Ga0068859_100810856 | 3300005617 | Unclassified | 1023 |
| 530 | Ga0068859_100880916 | 3300005617 | Bacteria | 980 |
| 531 | Ga0068859_101080165 | 3300005617 | Unclassified | 882 |
| 532 | Ga0068859_101094391 | 3300005617 | Unclassified | 876 |
| 533 | Ga0068859_101170504 | 3300005617 | Unclassified | 846 |
| 534 | Ga0068859_101186725 | 3300005617 | Unclassified | 840 |
| 535 | Ga0068859_101193960 | 3300005617 | Bacteria | 838 |
| 536 | Ga0068859_101416941 | 3300005617 | Unclassified | 766 |
| 537 | Ga0068859_101513282 | 3300005617 | Unclassified | 741 |
| 538 | Ga0068859_101688571 | 3300005617 | Unclassified | 699 |
| 539 | Ga0068859_102262714 | 3300005617 | Bacteria | 599 |
| 540 | Ga0068859_102373410 | 3300005617 | Unclassified | 585 |
| 541 | Ga0068864_100005538 | 3300005618 | Bacteria | 10354 |
| 542 | Ga0068864_100008111 | 3300005618 | Bacteria | 8660 |
| 543 | Ga0068864_100040762 | 3300005618 | Bacteria | 3971 |
| 544 | Ga0068864_100075005 | 3300005618 | Unclassified | 2952 |
| 545 | Ga0068864_100078291 | 3300005618 | Bacteria | 2893 |
| 546 | Ga0068864_100172601 | 3300005618 | Bacteria | 1972 |
| 547 | Ga0068864_100181671 | 3300005618 | Bacteria | 1923 |
| 548 | Ga0068864_100195558 | 3300005618 | Unclassified | 1855 |
| 549 | Ga0068864_100203478 | 3300005618 | Bacteria | 1820 |
| 550 | Ga0068864_100213940 | 3300005618 | Bacteria | 1776 |
| 551 | Ga0068864_100484924 | 3300005618 | Bacteria | 1187 |
| 552 | Ga0068864_100577812 | 3300005618 | Bacteria | 1089 |
| 553 | Ga0068864_100701912 | 3300005618 | Unclassified | 988 |
| 554 | Ga0068864_100791383 | 3300005618 | Bacteria | 931 |
| 555 | Ga0068864_100866677 | 3300005618 | Unclassified | 890 |
| 556 | Ga0068864_100876566 | 3300005618 | Unclassified | 885 |
| 557 | Ga0068864_101218471 | 3300005618 | Unclassified | 752 |
| 558 | Ga0068864_101344206 | 3300005618 | Unclassified | 715 |
| 559 | Ga0068864_101398182 | 3300005618 | Unclassified | 701 |
| 560 | Ga0068864_101634005 | 3300005618 | Bacteria | 649 |
| 561 | Ga0068864_102149785 | 3300005618 | Unclassified | 564 |
| 562 | Ga0068864_102654219 | 3300005618 | Unclassified | 507 |
| 563 | Ga0068866_10009446 | 3300005718 | Unclassified | 4141 |
| 564 | Ga0068866_10041764 | 3300005718 | Bacteria | 2278 |
| 565 | Ga0068866_10130772 | 3300005718 | Unclassified | 1427 |
| 566 | Ga0068866_10419960 | 3300005718 | Unclassified | 867 |
| 567 | Ga0068861_100014138 | 3300005719 | Bacteria | 5598 |
| 568 | Ga0068861_100018961 | 3300005719 | Bacteria | 4907 |
| 569 | Ga0068861_100032844 | 3300005719 | Unclassified | 3824 |
| 570 | Ga0068861_100077072 | 3300005719 | Unclassified | 2599 |
| 571 | Ga0068861_100120200 | 3300005719 | Unclassified | 2118 |
| 572 | Ga0068861_100158909 | 3300005719 | Bacteria | 1862 |
| 573 | Ga0068861_100562295 | 3300005719 | Bacteria | 1041 |
| 574 | Ga0068861_100588512 | 3300005719 | Unclassified | 1019 |
| 575 | Ga0068861_100647537 | 3300005719 | Unclassified | 976 |
| 576 | Ga0068861_101095075 | 3300005719 | Unclassified | 765 |
| 577 | Ga0068861_101856969 | 3300005719 | Unclassified | 599 |
| 578 | Ga0068861_102404359 | 3300005719 | Unclassified | 530 |
| 579 | Ga0068851_10002483 | 3300005834 | Bacteria | 8106 |
| 580 | Ga0068851_10028961 | 3300005834 | Bacteria | 2739 |
| 581 | Ga0068851_10049073 | 3300005834 | Bacteria | 2140 |
| 582 | Ga0068851_10079733 | 3300005834 | Bacteria | 1708 |
| 583 | Ga0068851_10505632 | 3300005834 | Bacteria | 725 |
| 584 | Ga0068851_10572181 | 3300005834 | Bacteria | 685 |
| 585 | Ga0068870_10046463 | 3300005840 | Unclassified | 2277 |
| 586 | Ga0068870_10674555 | 3300005840 | Unclassified | 710 |
| 587 | Ga0068870_10762924 | 3300005840 | Unclassified | 673 |
| 588 | Ga0068870_11154119 | 3300005840 | Unclassified | 559 |
| 589 | Ga0068863_100009282 | 3300005841 | Bacteria | 9595 |
| 590 | Ga0068863_100084843 | 3300005841 | Unclassified | 3001 |
| 591 | Ga0068863_100086830 | 3300005841 | Bacteria | 2964 |
| 592 | Ga0068863_100217664 | 3300005841 | Unclassified | 1839 |
| 593 | Ga0068863_100274825 | 3300005841 | Bacteria | 1631 |
| 594 | Ga0068863_100533521 | 3300005841 | Bacteria | 1158 |
| 595 | Ga0068863_100609941 | 3300005841 | Bacteria | 1081 |
| 596 | Ga0068863_100735823 | 3300005841 | Bacteria | 981 |
| 597 | Ga0068863_101359847 | 3300005841 | Unclassified | 717 |
| 598 | Ga0068863_101359910 | 3300005841 | Bacteria | 717 |
| 599 | Ga0068863_101743218 | 3300005841 | Bacteria | 632 |
| 600 | Ga0068863_101748588 | 3300005841 | Unclassified | 631 |
| 601 | Ga0068863_101753752 | 3300005841 | Unclassified | 630 |
| 602 | Ga0068863_102608383 | 3300005841 | Unclassified | 514 |
| 603 | Ga0068858_100000008 | 3300005842 | Bacteria | 238361 |
| 604 | Ga0068858_100065422 | 3300005842 | Bacteria | 3364 |
| 605 | Ga0068858_100123156 | 3300005842 | Bacteria | 2426 |
| 606 | Ga0068858_100165722 | 3300005842 | Bacteria | 2082 |
| 607 | Ga0068858_100170948 | 3300005842 | Bacteria | 2049 |
| 608 | Ga0068858_100185912 | 3300005842 | Bacteria | 1962 |
| 609 | Ga0068858_100191906 | 3300005842 | Bacteria | 1930 |
| 610 | Ga0068858_100210695 | 3300005842 | Bacteria | 1839 |
| 611 | Ga0068858_100312237 | 3300005842 | Bacteria | 1501 |
| 612 | Ga0068858_100322088 | 3300005842 | Unclassified | 1477 |
| 613 | Ga0068858_100341351 | 3300005842 | Unclassified | 1433 |
| 614 | Ga0068858_100343091 | 3300005842 | Unclassified | 1430 |
| 615 | Ga0068858_100550737 | 3300005842 | Bacteria | 1117 |
| 616 | Ga0068858_101372634 | 3300005842 | Unclassified | 696 |
| 617 | Ga0068858_101462873 | 3300005842 | Unclassified | 673 |
| 618 | Ga0068858_102471235 | 3300005842 | Unclassified | 513 |
| 619 | Ga0068860_100003829 | 3300005843 | Bacteria | 15471 |
| 620 | Ga0068860_100043301 | 3300005843 | Bacteria | 4295 |
| 621 | Ga0068860_100058850 | 3300005843 | Unclassified | 3654 |
| 622 | Ga0068860_100217941 | 3300005843 | Unclassified | 1853 |
| 623 | Ga0068860_100342031 | 3300005843 | Unclassified | 1471 |
| 624 | Ga0068860_100369436 | 3300005843 | Bacteria | 1414 |
| 625 | Ga0068860_100388239 | 3300005843 | Bacteria | 1379 |
| 626 | Ga0068860_100391879 | 3300005843 | Bacteria | 1373 |
| 627 | Ga0068860_100408955 | 3300005843 | Unclassified | 1343 |
| 628 | Ga0068860_100426055 | 3300005843 | Bacteria | 1316 |
| 629 | Ga0068860_100461606 | 3300005843 | Unclassified | 1264 |
| 630 | Ga0068860_100680614 | 3300005843 | Bacteria | 1038 |
| 631 | Ga0068860_100831712 | 3300005843 | Unclassified | 937 |
| 632 | Ga0068860_100931421 | 3300005843 | Unclassified | 885 |
| 633 | Ga0068860_101281397 | 3300005843 | Unclassified | 753 |
| 634 | Ga0068860_101549482 | 3300005843 | Bacteria | 684 |
| 635 | Ga0068862_100035327 | 3300005844 | Unclassified | 4232 |
| 636 | Ga0068862_100053564 | 3300005844 | Bacteria | 3454 |
| 637 | Ga0068862_100099686 | 3300005844 | Bacteria | 2540 |
| 638 | Ga0068862_100184254 | 3300005844 | Unclassified | 1875 |
| 639 | Ga0068862_100289776 | 3300005844 | Bacteria | 1503 |
| 640 | Ga0068862_100290383 | 3300005844 | Unclassified | 1501 |
| 641 | Ga0068862_100300121 | 3300005844 | Bacteria | 1477 |
| 642 | Ga0068862_100396312 | 3300005844 | Unclassified | 1290 |
| 643 | Ga0068862_100535922 | 3300005844 | Bacteria | 1116 |
| 644 | Ga0068862_101307084 | 3300005844 | Bacteria | 727 |
| 645 | Ga0068862_101996785 | 3300005844 | Bacteria | 591 |
| 646 | Ga0081455_10127815 | 3300005937 | Bacteria | 1991 |
| 647 | Ga0081455_10827037 | 3300005937 | Bacteria | 580 |
| 648 | Ga0081455_11012794 | 3300005937 | Unclassified | 514 |
| 649 | Ga0081540_1269884 | 3300005983 | Bacteria | 589 |
| 650 | Ga0081539_10000043 | 3300005985 | Bacteria | 288108 |
| 651 | Ga0081539_10000239 | 3300005985 | Bacteria | 128819 |
| 652 | Ga0081539_10002560 | 3300005985 | Bacteria | 25204 |
| 653 | Ga0081539_10005773 | 3300005985 | Bacteria | 12340 |
| 654 | Ga0081539_10036660 | 3300005985 | Bacteria | 2931 |
| 655 | Ga0081539_10063712 | 3300005985 | Bacteria | 2010 |
| 656 | Ga0081539_10148326 | 3300005985 | Unclassified | 1131 |
| 657 | Ga0081539_10179901 | 3300005985 | Bacteria | 993 |
| 658 | Ga0075432_10174576 | 3300006058 | Unclassified | 838 |
| 659 | Ga0075432_10183566 | 3300006058 | Unclassified | 820 |
| 660 | Ga0070715_10000031 | 3300006163 | Bacteria | 86230 |
| 661 | Ga0070716_100000007 | 3300006173 | Bacteria | 256300 |
| 662 | Ga0070716_100061133 | 3300006173 | Bacteria | 2179 |
| 663 | Ga0070716_100285362 | 3300006173 | Bacteria | 1141 |
| 664 | Ga0070716_100489502 | 3300006173 | Unclassified | 905 |
| 665 | Ga0070716_100944288 | 3300006173 | Unclassified | 678 |
| 666 | Ga0070716_101129837 | 3300006173 | Bacteria | 626 |
| 667 | Ga0097621_100014473 | 3300006237 | Bacteria | 5903 |
| 668 | Ga0097621_100060925 | 3300006237 | Bacteria | 3094 |
| 669 | Ga0097621_100428458 | 3300006237 | Bacteria | 1188 |
| 670 | Ga0097621_100574052 | 3300006237 | Bacteria | 1028 |
| 671 | Ga0097621_100955395 | 3300006237 | Bacteria | 800 |
| 672 | Ga0097621_101410234 | 3300006237 | Bacteria | 660 |
| 673 | Ga0097621_101607677 | 3300006237 | Unclassified | 618 |
| 674 | Ga0097621_101747823 | 3300006237 | Unclassified | 592 |
| 675 | Ga0097621_101810270 | 3300006237 | Unclassified | 582 |
| 676 | Ga0068871_100006157 | 3300006358 | Bacteria | 8456 |
| 677 | Ga0068871_100040428 | 3300006358 | Bacteria | 3735 |
| 678 | Ga0068871_100123033 | 3300006358 | Unclassified | 2193 |
| 679 | Ga0068871_100679826 | 3300006358 | Unclassified | 942 |
| 680 | Ga0068871_100741079 | 3300006358 | Unclassified | 902 |
| 681 | Ga0068871_100901505 | 3300006358 | Bacteria | 819 |
| 682 | Ga0068871_102057804 | 3300006358 | Unclassified | 544 |
| 683 | Ga0075428_100096869 | 3300006844 | Bacteria | 3216 |
| 684 | Ga0075428_100312649 | 3300006844 | Bacteria | 1689 |
| 685 | Ga0075428_100418959 | 3300006844 | Bacteria | 1435 |
| 686 | Ga0075428_101013906 | 3300006844 | Unclassified | 879 |
| 687 | Ga0075430_100003709 | 3300006846 | Bacteria | 12833 |
| 688 | Ga0075430_100105376 | 3300006846 | Bacteria | 2353 |
| 689 | Ga0075430_101081017 | 3300006846 | Unclassified | 661 |
| 690 | Ga0075431_100081177 | 3300006847 | Bacteria | 3348 |
| 691 | Ga0075431_100171647 | 3300006847 | Bacteria | 2228 |
| 692 | Ga0075431_100481551 | 3300006847 | Bacteria | 1234 |
| 693 | Ga0075433_10026566 | 3300006852 | Bacteria | 4903 |
| 694 | Ga0075433_10053141 | 3300006852 | Unclassified | 3531 |
| 695 | Ga0075433_10058232 | 3300006852 | Bacteria | 3379 |
| 696 | Ga0075433_10097408 | 3300006852 | Bacteria | 2603 |
| 697 | Ga0075433_10114233 | 3300006852 | Bacteria | 2395 |
| 698 | Ga0075433_10226243 | 3300006852 | Bacteria | 1661 |
| 699 | Ga0075433_10278613 | 3300006852 | Unclassified | 1482 |
| 700 | Ga0075433_10299111 | 3300006852 | Bacteria | 1425 |
| 701 | Ga0075433_10299625 | 3300006852 | Bacteria | 1424 |
| 702 | Ga0075433_10327671 | 3300006852 | Bacteria | 1354 |
| 703 | Ga0075433_11580798 | 3300006852 | Unclassified | 566 |
| 704 | Ga0075433_11774185 | 3300006852 | Unclassified | 531 |
| 705 | Ga0075434_100024264 | 3300006871 | Bacteria | 5928 |
| 706 | Ga0075434_100034748 | 3300006871 | Bacteria | 4980 |
| 707 | Ga0075434_100156176 | 3300006871 | Bacteria | 2301 |
| 708 | Ga0075434_100188880 | 3300006871 | Bacteria | 2080 |
| 709 | Ga0075434_100206533 | 3300006871 | Bacteria | 1984 |
| 710 | Ga0075434_100626936 | 3300006871 | Bacteria | 1094 |
| 711 | Ga0075434_100652546 | 3300006871 | Unclassified | 1070 |
| 712 | Ga0075434_100714577 | 3300006871 | Bacteria | 1019 |
| 713 | Ga0075434_100735773 | 3300006871 | Unclassified | 1003 |
| 714 | Ga0075434_100827760 | 3300006871 | Unclassified | 941 |
| 715 | Ga0075434_101243069 | 3300006871 | Unclassified | 756 |
| 716 | Ga0075434_101444314 | 3300006871 | Unclassified | 697 |
| 717 | Ga0075429_100026020 | 3300006880 | Bacteria | 5078 |
| 718 | Ga0075429_100086629 | 3300006880 | Bacteria | 2730 |
| 719 | Ga0075429_100141042 | 3300006880 | Unclassified | 2109 |
| 720 | Ga0075429_100196712 | 3300006880 | Unclassified | 1766 |
| 721 | Ga0075429_100828955 | 3300006880 | Bacteria | 810 |
| 722 | Ga0068865_100009576 | 3300006881 | Bacteria | 6013 |
| 723 | Ga0068865_100115107 | 3300006881 | Bacteria | 1990 |
| 724 | Ga0068865_100510628 | 3300006881 | Bacteria | 1003 |
| 725 | Ga0068865_100520236 | 3300006881 | Bacteria | 995 |
| 726 | Ga0068865_100636443 | 3300006881 | Unclassified | 905 |
| 727 | Ga0075436_100004844 | 3300006914 | Bacteria | 9249 |
| 728 | Ga0075436_100386245 | 3300006914 | Bacteria | 1013 |
| 729 | Ga0075436_100467569 | 3300006914 | Bacteria | 920 |
| 730 | Ga0097620_100020867 | 3300006931 | Bacteria | 6575 |
| 731 | Ga0097620_100021422 | 3300006931 | Bacteria | 6487 |
| 732 | Ga0097620_100024569 | 3300006931 | Bacteria | 6045 |
| 733 | Ga0097620_100044738 | 3300006931 | Bacteria | 4448 |
| 734 | Ga0097620_100055085 | 3300006931 | Unclassified | 4001 |
| 735 | Ga0097620_100070551 | 3300006931 | Bacteria | 3529 |
| 736 | Ga0097620_100078008 | 3300006931 | Bacteria | 3353 |
| 737 | Ga0097620_100105979 | 3300006931 | Bacteria | 2870 |
| 738 | Ga0097620_100149849 | 3300006931 | Unclassified | 2408 |
| 739 | Ga0097620_100200811 | 3300006931 | Bacteria | 2078 |
| 740 | Ga0097620_100409196 | 3300006931 | Bacteria | 1452 |
| 741 | Ga0097620_100647395 | 3300006931 | Bacteria | 1149 |
| 742 | Ga0097620_100810747 | 3300006931 | Unclassified | 1023 |
| 743 | Ga0097620_100880927 | 3300006931 | Bacteria | 980 |
| 744 | Ga0097620_101080110 | 3300006931 | Unclassified | 882 |
| 745 | Ga0097620_101094318 | 3300006931 | Unclassified | 876 |
| 746 | Ga0097620_101170489 | 3300006931 | Unclassified | 846 |
| 747 | Ga0097620_101186737 | 3300006931 | Unclassified | 840 |
| 748 | Ga0097620_101193644 | 3300006931 | Bacteria | 838 |
| 749 | Ga0097620_101417009 | 3300006931 | Unclassified | 766 |
| 750 | Ga0097620_101513451 | 3300006931 | Unclassified | 741 |
| 751 | Ga0097620_101688563 | 3300006931 | Unclassified | 699 |
| 752 | Ga0097620_102262809 | 3300006931 | Bacteria | 599 |
| 753 | Ga0097620_102373448 | 3300006931 | Unclassified | 585 |
| 754 | Ga0075435_100049727 | 3300007076 | Unclassified | 3372 |
| 755 | Ga0075435_100276935 | 3300007076 | Unclassified | 1432 |
| 756 | Ga0075435_100351385 | 3300007076 | Bacteria | 1264 |
| 757 | Ga0075435_100598677 | 3300007076 | Unclassified | 956 |
| 758 | Ga0075435_100842691 | 3300007076 | Bacteria | 799 |
| 759 | Ga0099794_10022132 | 3300007265 | Unclassified | 2896 |
| 760 | Ga0099794_10086451 | 3300007265 | Bacteria | 1553 |
| 761 | Ga0105251_10081845 | 3300009011 | Bacteria | 1491 |
| 762 | Ga0105250_10032491 | 3300009092 | Bacteria | 2096 |
| 763 | Ga0105250_10182539 | 3300009092 | Unclassified | 881 |
| 764 | Ga0105250_10189845 | 3300009092 | Bacteria | 864 |
| 765 | Ga0105240_10027411 | 3300009093 | Bacteria | 7456 |
| 766 | Ga0105240_10218903 | 3300009093 | Bacteria | 2219 |
| 767 | Ga0105240_10221618 | 3300009093 | Bacteria | 2203 |
| 768 | Ga0105240_10658693 | 3300009093 | Unclassified | 1147 |
| 769 | Ga0105240_10685529 | 3300009093 | Bacteria | 1120 |
| 770 | Ga0105240_11626371 | 3300009093 | Bacteria | 675 |
| 771 | Ga0111539_10010730 | 3300009094 | Bacteria | 11530 |
| 772 | Ga0111539_10013968 | 3300009094 | Bacteria | 10038 |
| 773 | Ga0111539_10034502 | 3300009094 | Bacteria | 6134 |
| 774 | Ga0111539_10107492 | 3300009094 | Bacteria | 3274 |
| 775 | Ga0111539_10125939 | 3300009094 | Bacteria | 3001 |
| 776 | Ga0111539_10197686 | 3300009094 | Unclassified | 2345 |
| 777 | Ga0111539_10380973 | 3300009094 | Unclassified | 1642 |
| 778 | Ga0111539_10678434 | 3300009094 | Bacteria | 1200 |
| 779 | Ga0111539_10895653 | 3300009094 | Bacteria | 1032 |
| 780 | Ga0111539_11235102 | 3300009094 | Bacteria | 868 |
| 781 | Ga0111539_12066229 | 3300009094 | Bacteria | 661 |
| 782 | Ga0111539_13067422 | 3300009094 | Unclassified | 539 |
| 783 | Ga0105245_10008532 | 3300009098 | Bacteria | 8939 |
| 784 | Ga0105245_10358338 | 3300009098 | Unclassified | 1447 |
| 785 | Ga0105245_10594437 | 3300009098 | Bacteria | 1132 |
| 786 | Ga0105245_10793083 | 3300009098 | Unclassified | 985 |
| 787 | Ga0105245_10870528 | 3300009098 | Bacteria | 942 |
| 788 | Ga0105245_11028032 | 3300009098 | Bacteria | 869 |
| 789 | Ga0105245_11262982 | 3300009098 | Unclassified | 787 |
| 790 | Ga0105245_11482143 | 3300009098 | Bacteria | 729 |
| 791 | Ga0105245_11650060 | 3300009098 | Unclassified | 693 |
| 792 | Ga0105245_12089003 | 3300009098 | Unclassified | 620 |
| 793 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 794 | Ga0105247_10081690 | 3300009101 | Unclassified | 2038 |
| 795 | Ga0105247_10138873 | 3300009101 | Bacteria | 1590 |
| 796 | Ga0105247_10587115 | 3300009101 | Bacteria | 824 |
| 797 | Ga0105247_10661824 | 3300009101 | Bacteria | 781 |
| 798 | Ga0105247_10890298 | 3300009101 | Unclassified | 686 |
| 799 | Ga0105247_11337822 | 3300009101 | Bacteria | 577 |
| 800 | Ga0114129_10005476 | 3300009147 | Bacteria | 17944 |
| 801 | Ga0114129_10017890 | 3300009147 | Bacteria | 10088 |
| 802 | Ga0114129_10045834 | 3300009147 | Bacteria | 6146 |
| 803 | Ga0114129_10047639 | 3300009147 | Bacteria | 6022 |
| 804 | Ga0114129_10090358 | 3300009147 | Bacteria | 4245 |
| 805 | Ga0114129_10213209 | 3300009147 | Bacteria | 2609 |
| 806 | Ga0114129_10300892 | 3300009147 | Bacteria | 2138 |
| 807 | Ga0114129_10309907 | 3300009147 | Unclassified | 2101 |
| 808 | Ga0114129_10355984 | 3300009147 | Bacteria | 1938 |
| 809 | Ga0114129_10363965 | 3300009147 | Bacteria | 1913 |
| 810 | Ga0114129_11119729 | 3300009147 | Bacteria | 985 |
| 811 | Ga0114129_11126702 | 3300009147 | Unclassified | 981 |
| 812 | Ga0114129_11345260 | 3300009147 | Bacteria | 883 |
| 813 | Ga0114129_11626177 | 3300009147 | Unclassified | 790 |
| 814 | Ga0114129_12156744 | 3300009147 | Bacteria | 671 |
| 815 | Ga0114129_13180303 | 3300009147 | Unclassified | 535 |
| 816 | Ga0105243_10000119 | 3300009148 | Bacteria | 91258 |
| 817 | Ga0105243_10004942 | 3300009148 | Bacteria | 10444 |
| 818 | Ga0105243_10013322 | 3300009148 | Bacteria | 6218 |
| 819 | Ga0105243_10289445 | 3300009148 | Unclassified | 1479 |
| 820 | Ga0105243_10301522 | 3300009148 | Unclassified | 1452 |
| 821 | Ga0105243_10333732 | 3300009148 | Unclassified | 1386 |
| 822 | Ga0105243_10476201 | 3300009148 | Unclassified | 1177 |
| 823 | Ga0105243_10619094 | 3300009148 | Unclassified | 1045 |
| 824 | Ga0105243_10696301 | 3300009148 | Bacteria | 990 |
| 825 | Ga0105243_11006211 | 3300009148 | Unclassified | 836 |
| 826 | Ga0105243_11100562 | 3300009148 | Unclassified | 803 |
| 827 | Ga0105243_11151742 | 3300009148 | Unclassified | 786 |
| 828 | Ga0105243_11414661 | 3300009148 | Bacteria | 716 |
| 829 | Ga0105243_12782872 | 3300009148 | Unclassified | 530 |
| 830 | Ga0105243_12976424 | 3300009148 | Bacteria | 514 |
| 831 | Ga0105241_10102859 | 3300009174 | Bacteria | 2274 |
| 832 | Ga0105241_10106832 | 3300009174 | Bacteria | 2234 |
| 833 | Ga0105241_10176274 | 3300009174 | Bacteria | 1770 |
| 834 | Ga0105241_10192225 | 3300009174 | Bacteria | 1700 |
| 835 | Ga0105241_10304048 | 3300009174 | Bacteria | 1370 |
| 836 | Ga0105241_10317024 | 3300009174 | Bacteria | 1343 |
| 837 | Ga0105241_10349401 | 3300009174 | Bacteria | 1283 |
| 838 | Ga0105241_10485403 | 3300009174 | Bacteria | 1099 |
| 839 | Ga0105241_10524953 | 3300009174 | Bacteria | 1059 |
| 840 | Ga0105241_10665552 | 3300009174 | Unclassified | 947 |
| 841 | Ga0105241_10678226 | 3300009174 | Unclassified | 939 |
| 842 | Ga0105241_10871033 | 3300009174 | Unclassified | 834 |
| 843 | Ga0105241_11204664 | 3300009174 | Unclassified | 717 |
| 844 | Ga0105241_11536491 | 3300009174 | Unclassified | 642 |
| 845 | Ga0105241_11614081 | 3300009174 | Unclassified | 628 |
| 846 | Ga0105241_11713988 | 3300009174 | Bacteria | 611 |
| 847 | Ga0105242_10000113 | 3300009176 | Bacteria | 58633 |
| 848 | Ga0105242_10004299 | 3300009176 | Bacteria | 11099 |
| 849 | Ga0105242_10010627 | 3300009176 | Bacteria | 7068 |
| 850 | Ga0105242_10067704 | 3300009176 | Unclassified | 2952 |
| 851 | Ga0105242_10107097 | 3300009176 | Bacteria | 2377 |
| 852 | Ga0105242_10231377 | 3300009176 | Bacteria | 1656 |
| 853 | Ga0105242_10260890 | 3300009176 | Unclassified | 1565 |
| 854 | Ga0105242_10472962 | 3300009176 | Bacteria | 1186 |
| 855 | Ga0105242_10543083 | 3300009176 | Unclassified | 1113 |
| 856 | Ga0105242_10842674 | 3300009176 | Unclassified | 912 |
| 857 | Ga0105242_11193069 | 3300009176 | Unclassified | 780 |
| 858 | Ga0105242_11645709 | 3300009176 | Unclassified | 677 |
| 859 | Ga0105242_11994581 | 3300009176 | Unclassified | 622 |
| 860 | Ga0105242_12247748 | 3300009176 | Unclassified | 591 |
| 861 | Ga0105242_13263700 | 3300009176 | Unclassified | 504 |
| 862 | Ga0105248_10062642 | 3300009177 | Bacteria | 4176 |
| 863 | Ga0105248_10071853 | 3300009177 | Bacteria | 3888 |
| 864 | Ga0105248_10072593 | 3300009177 | Unclassified | 3868 |
| 865 | Ga0105248_10098050 | 3300009177 | Bacteria | 3302 |
| 866 | Ga0105248_10103880 | 3300009177 | Bacteria | 3203 |
| 867 | Ga0105248_10150142 | 3300009177 | Unclassified | 2629 |
| 868 | Ga0105248_10173620 | 3300009177 | Bacteria | 2429 |
| 869 | Ga0105248_10195936 | 3300009177 | Unclassified | 2276 |
| 870 | Ga0105248_10269984 | 3300009177 | Unclassified | 1915 |
| 871 | Ga0105248_10390234 | 3300009177 | Unclassified | 1567 |
| 872 | Ga0105248_10409461 | 3300009177 | Unclassified | 1527 |
| 873 | Ga0105248_10541022 | 3300009177 | Unclassified | 1314 |
| 874 | Ga0105248_10578011 | 3300009177 | Bacteria | 1268 |
| 875 | Ga0105248_10607460 | 3300009177 | Bacteria | 1234 |
| 876 | Ga0105248_10683283 | 3300009177 | Unclassified | 1158 |
| 877 | Ga0105248_10956220 | 3300009177 | Unclassified | 967 |
| 878 | Ga0105248_11129214 | 3300009177 | Unclassified | 886 |
| 879 | Ga0105248_11206862 | 3300009177 | Bacteria | 855 |
| 880 | Ga0105248_11228766 | 3300009177 | Bacteria | 847 |
| 881 | Ga0105248_11328425 | 3300009177 | Unclassified | 813 |
| 882 | Ga0105248_11394873 | 3300009177 | Unclassified | 793 |
| 883 | Ga0105248_11558213 | 3300009177 | Unclassified | 748 |
| 884 | Ga0105248_12775589 | 3300009177 | Bacteria | 559 |
| 885 | Ga0105248_12805905 | 3300009177 | Unclassified | 556 |
| 886 | Ga0105237_10011061 | 3300009545 | Bacteria | 9568 |
| 887 | Ga0105237_10056051 | 3300009545 | Unclassified | 3946 |
| 888 | Ga0105237_10066585 | 3300009545 | Unclassified | 3597 |
| 889 | Ga0105237_10118503 | 3300009545 | Bacteria | 2641 |
| 890 | Ga0105237_10535835 | 3300009545 | Unclassified | 1177 |
| 891 | Ga0105237_11224785 | 3300009545 | Unclassified | 757 |
| 892 | Ga0105237_12222892 | 3300009545 | Bacteria | 558 |
| 893 | Ga0105238_10030053 | 3300009551 | Bacteria | 5529 |
| 894 | Ga0105238_10467445 | 3300009551 | Bacteria | 1259 |
| 895 | Ga0105238_10719923 | 3300009551 | Bacteria | 1011 |
| 896 | Ga0105238_10913464 | 3300009551 | Unclassified | 897 |
| 897 | Ga0105238_12342741 | 3300009551 | Bacteria | 569 |
| 898 | Ga0105249_10000028 | 3300009553 | Bacteria | 230039 |
| 899 | Ga0105249_10014015 | 3300009553 | Bacteria | 7086 |
| 900 | Ga0105249_10020461 | 3300009553 | Bacteria | 5916 |
| 901 | Ga0105249_10023248 | 3300009553 | Bacteria | 5559 |
| 902 | Ga0105249_10234655 | 3300009553 | Unclassified | 1811 |
| 903 | Ga0105249_10253672 | 3300009553 | Bacteria | 1745 |
| 904 | Ga0105249_10629744 | 3300009553 | Bacteria | 1129 |
| 905 | Ga0105249_10758768 | 3300009553 | Bacteria | 1032 |
| 906 | Ga0105249_11007524 | 3300009553 | Bacteria | 902 |
| 907 | Ga0105249_11027243 | 3300009553 | Unclassified | 893 |
| 908 | Ga0105249_11612003 | 3300009553 | Unclassified | 721 |
| 909 | Ga0105249_11903286 | 3300009553 | Unclassified | 667 |
| 910 | Ga0105249_12467153 | 3300009553 | Unclassified | 592 |
| 911 | Ga0105249_13235024 | 3300009553 | Bacteria | 524 |
| 912 | Ga0099796_10128767 | 3300010159 | Bacteria | 979 |
| 913 | Ga0105239_10030724 | 3300010375 | Bacteria | 5908 |
| 914 | Ga0105239_10107358 | 3300010375 | Bacteria | 3093 |
| 915 | Ga0105239_10289529 | 3300010375 | Bacteria | 1844 |
| 916 | Ga0105239_10369153 | 3300010375 | Bacteria | 1622 |
| 917 | Ga0105239_10387134 | 3300010375 | Bacteria | 1581 |
| 918 | Ga0105239_10718499 | 3300010375 | Unclassified | 1143 |
| 919 | Ga0105239_10909736 | 3300010375 | Unclassified | 1010 |
| 920 | Ga0105239_10919300 | 3300010375 | Bacteria | 1004 |
| 921 | Ga0105239_11159379 | 3300010375 | Unclassified | 890 |
| 922 | Ga0105239_11253958 | 3300010375 | Bacteria | 855 |
| 923 | Ga0105239_11357612 | 3300010375 | Bacteria | 820 |
| 924 | Ga0105239_12531326 | 3300010375 | Unclassified | 598 |
| 925 | Ga0105239_12691519 | 3300010375 | Unclassified | 580 |
| 926 | Ga0105239_12832121 | 3300010375 | Unclassified | 566 |
| 927 | Ga0105246_10064958 | 3300011119 | Bacteria | 2551 |
| 928 | Ga0105246_10069042 | 3300011119 | Bacteria | 2481 |
| 929 | Ga0105246_10090250 | 3300011119 | Bacteria | 2206 |
| 930 | Ga0105246_10205060 | 3300011119 | Bacteria | 1536 |
| 931 | Ga0105246_10214471 | 3300011119 | Bacteria | 1505 |
| 932 | Ga0105246_10621912 | 3300011119 | Unclassified | 936 |
| 933 | Ga0105246_10770518 | 3300011119 | Bacteria | 851 |
| 934 | Ga0105246_11162328 | 3300011119 | Unclassified | 708 |
| 935 | Ga0105246_12047319 | 3300011119 | Bacteria | 553 |
| 936 | Ga0105246_12203546 | 3300011119 | Unclassified | 536 |
| 937 | Ga0105246_12297149 | 3300011119 | Bacteria | 527 |
| 938 | Ga0157373_10062746 | 3300013100 | Bacteria | 2632 |
| 939 | Ga0157373_10095110 | 3300013100 | Bacteria | 2097 |
| 940 | Ga0157373_10103340 | 3300013100 | Bacteria | 2004 |
| 941 | Ga0157373_10110346 | 3300013100 | Bacteria | 1934 |
| 942 | Ga0157373_10123296 | 3300013100 | Unclassified | 1822 |
| 943 | Ga0157373_10178303 | 3300013100 | Bacteria | 1496 |
| 944 | Ga0157373_10340319 | 3300013100 | Bacteria | 1069 |
| 945 | Ga0157371_10090052 | 3300013102 | Bacteria | 2173 |
| 946 | Ga0157371_11009403 | 3300013102 | Bacteria | 635 |
| 947 | Ga0157371_11145118 | 3300013102 | Unclassified | 598 |
| 948 | Ga0157371_11234129 | 3300013102 | Unclassified | 577 |
| 949 | Ga0157370_10072475 | 3300013104 | Bacteria | 3250 |
| 950 | Ga0157370_10171697 | 3300013104 | Bacteria | 2015 |
| 951 | Ga0157370_10311572 | 3300013104 | Bacteria | 1452 |
| 952 | Ga0157369_10092662 | 3300013105 | Unclassified | 3225 |
| 953 | Ga0157369_10152829 | 3300013105 | Bacteria | 2439 |
| 954 | Ga0157369_11178088 | 3300013105 | Unclassified | 782 |
| 955 | Ga0157374_10090602 | 3300013296 | Unclassified | 2915 |
| 956 | Ga0157374_10198619 | 3300013296 | Unclassified | 1963 |
| 957 | Ga0157374_10520036 | 3300013296 | Unclassified | 1196 |
| 958 | Ga0157374_11183740 | 3300013296 | Unclassified | 785 |
| 959 | Ga0157374_12026151 | 3300013296 | Unclassified | 602 |
| 960 | Ga0157378_10000163 | 3300013297 | Bacteria | 63786 |
| 961 | Ga0157378_10001554 | 3300013297 | Bacteria | 20717 |
| 962 | Ga0157378_10008355 | 3300013297 | Bacteria | 9017 |
| 963 | Ga0157378_10034190 | 3300013297 | Bacteria | 4496 |
| 964 | Ga0157378_10050951 | 3300013297 | Bacteria | 3684 |
| 965 | Ga0157378_10071515 | 3300013297 | Bacteria | 3115 |
| 966 | Ga0157378_10083656 | 3300013297 | Bacteria | 2888 |
| 967 | Ga0157378_10141412 | 3300013297 | Bacteria | 2235 |
| 968 | Ga0157378_10154516 | 3300013297 | Unclassified | 2140 |
| 969 | Ga0157378_10176542 | 3300013297 | Unclassified | 2007 |
| 970 | Ga0157378_10276191 | 3300013297 | Bacteria | 1618 |
| 971 | Ga0157378_10369683 | 3300013297 | Unclassified | 1405 |
| 972 | Ga0157378_10372735 | 3300013297 | Unclassified | 1400 |
| 973 | Ga0157378_10403538 | 3300013297 | Bacteria | 1347 |
| 974 | Ga0157378_10694019 | 3300013297 | Bacteria | 1037 |
| 975 | Ga0157378_10879809 | 3300013297 | Unclassified | 926 |
| 976 | Ga0157378_11328606 | 3300013297 | Bacteria | 761 |
| 977 | Ga0157378_11332982 | 3300013297 | Bacteria | 759 |
| 978 | Ga0157378_11487946 | 3300013297 | Unclassified | 721 |
| 979 | Ga0157378_11505329 | 3300013297 | Bacteria | 718 |
| 980 | Ga0157378_11856754 | 3300013297 | Unclassified | 651 |
| 981 | Ga0157378_13088911 | 3300013297 | Unclassified | 517 |
| 982 | Ga0157378_13118554 | 3300013297 | Unclassified | 515 |
| 983 | Ga0163162_10000027 | 3300013306 | Bacteria | 178451 |
| 984 | Ga0163162_10001557 | 3300013306 | Bacteria | 21449 |
| 985 | Ga0163162_10001819 | 3300013306 | Bacteria | 20050 |
| 986 | Ga0163162_10013469 | 3300013306 | Bacteria | 7982 |
| 987 | Ga0163162_10097421 | 3300013306 | Unclassified | 3030 |
| 988 | Ga0163162_10105237 | 3300013306 | Unclassified | 2916 |
| 989 | Ga0163162_10245321 | 3300013306 | Bacteria | 1923 |
| 990 | Ga0163162_10246809 | 3300013306 | Bacteria | 1917 |
| 991 | Ga0163162_10252071 | 3300013306 | Unclassified | 1897 |
| 992 | Ga0163162_10832755 | 3300013306 | Unclassified | 1039 |
| 993 | Ga0163162_11154320 | 3300013306 | Unclassified | 878 |
| 994 | Ga0163162_11452240 | 3300013306 | Unclassified | 781 |
| 995 | Ga0163162_11550111 | 3300013306 | Unclassified | 755 |
| 996 | Ga0163162_12296345 | 3300013306 | Unclassified | 620 |
| 997 | Ga0163162_12313769 | 3300013306 | Bacteria | 617 |
| 998 | Ga0163162_12365236 | 3300013306 | Unclassified | 611 |
| 999 | Ga0163162_12784382 | 3300013306 | Unclassified | 563 |
| 1000 | Ga0163162_13098200 | 3300013306 | Bacteria | 534 |
| 1001 | Ga0157372_10022333 | 3300013307 | Bacteria | 6845 |
| 1002 | Ga0157372_10048333 | 3300013307 | Bacteria | 4729 |
| 1003 | Ga0157372_10061654 | 3300013307 | Unclassified | 4200 |
| 1004 | Ga0157372_10067477 | 3300013307 | Bacteria | 4019 |
| 1005 | Ga0157372_10212217 | 3300013307 | Bacteria | 2243 |
| 1006 | Ga0157372_10258165 | 3300013307 | Bacteria | 2023 |
| 1007 | Ga0157372_10382096 | 3300013307 | Bacteria | 1641 |
| 1008 | Ga0157372_10552124 | 3300013307 | Bacteria | 1343 |
| 1009 | Ga0157372_10798386 | 3300013307 | Bacteria | 1097 |
| 1010 | Ga0157372_10920488 | 3300013307 | Bacteria | 1014 |
| 1011 | Ga0157372_11170491 | 3300013307 | Unclassified | 889 |
| 1012 | Ga0157372_11250813 | 3300013307 | Unclassified | 857 |
| 1013 | Ga0157372_11476518 | 3300013307 | Bacteria | 783 |
| 1014 | Ga0157372_11538492 | 3300013307 | Unclassified | 766 |
| 1015 | Ga0157372_11603615 | 3300013307 | Bacteria | 749 |
| 1016 | Ga0157372_11621976 | 3300013307 | Unclassified | 745 |
| 1017 | Ga0157372_12290610 | 3300013307 | Unclassified | 620 |
| 1018 | Ga0157375_10127326 | 3300013308 | Bacteria | 2663 |
| 1019 | Ga0157375_10149716 | 3300013308 | Bacteria | 2468 |
| 1020 | Ga0157375_10180319 | 3300013308 | Unclassified | 2263 |
| 1021 | Ga0157375_10234970 | 3300013308 | Bacteria | 1992 |
| 1022 | Ga0157375_10422077 | 3300013308 | Unclassified | 1500 |
| 1023 | Ga0157375_10728102 | 3300013308 | Unclassified | 1144 |
| 1024 | Ga0157375_10907609 | 3300013308 | Bacteria | 1025 |
| 1025 | Ga0157375_11029304 | 3300013308 | Unclassified | 962 |
| 1026 | Ga0157375_11056874 | 3300013308 | Bacteria | 949 |
| 1027 | Ga0157375_11107456 | 3300013308 | Bacteria | 927 |
| 1028 | Ga0157375_11265361 | 3300013308 | Bacteria | 867 |
| 1029 | Ga0157375_11533538 | 3300013308 | Unclassified | 787 |
| 1030 | Ga0157375_12921044 | 3300013308 | Unclassified | 571 |
| 1031 | Ga0163163_10009872 | 3300014325 | Bacteria | 8552 |
| 1032 | Ga0163163_10023334 | 3300014325 | Bacteria | 5869 |
| 1033 | Ga0163163_10028121 | 3300014325 | Bacteria | 5395 |
| 1034 | Ga0163163_10047001 | 3300014325 | Bacteria | 4241 |
| 1035 | Ga0163163_10069074 | 3300014325 | Bacteria | 3517 |
| 1036 | Ga0163163_10074742 | 3300014325 | Unclassified | 3381 |
| 1037 | Ga0163163_10173703 | 3300014325 | Bacteria | 2201 |
| 1038 | Ga0163163_10194128 | 3300014325 | Bacteria | 2078 |
| 1039 | Ga0163163_10219841 | 3300014325 | Bacteria | 1948 |
| 1040 | Ga0163163_10382573 | 3300014325 | Bacteria | 1465 |
| 1041 | Ga0163163_10590841 | 3300014325 | Bacteria | 1173 |
| 1042 | Ga0163163_10747604 | 3300014325 | Bacteria | 1041 |
| 1043 | Ga0163163_10920304 | 3300014325 | Bacteria | 938 |
| 1044 | Ga0163163_10971526 | 3300014325 | Unclassified | 913 |
| 1045 | Ga0163163_11082087 | 3300014325 | Unclassified | 865 |
| 1046 | Ga0163163_11369727 | 3300014325 | Unclassified | 769 |
| 1047 | Ga0163163_11462368 | 3300014325 | Bacteria | 745 |
| 1048 | Ga0163163_11576416 | 3300014325 | Unclassified | 718 |
| 1049 | Ga0163163_12025065 | 3300014325 | Unclassified | 635 |
| 1050 | Ga0163163_12197803 | 3300014325 | Unclassified | 611 |
| 1051 | Ga0163163_12896893 | 3300014325 | Bacteria | 535 |
| 1052 | Ga0157380_10001451 | 3300014326 | Bacteria | 15515 |
| 1053 | Ga0157380_10002205 | 3300014326 | Bacteria | 13098 |
| 1054 | Ga0157380_10024802 | 3300014326 | Bacteria | 4543 |
| 1055 | Ga0157380_10043883 | 3300014326 | Bacteria | 3501 |
| 1056 | Ga0157380_10097636 | 3300014326 | Bacteria | 2439 |
| 1057 | Ga0157380_10111079 | 3300014326 | Unclassified | 2304 |
| 1058 | Ga0157380_10318596 | 3300014326 | Unclassified | 1441 |
| 1059 | Ga0157380_10416654 | 3300014326 | Bacteria | 1280 |
| 1060 | Ga0157380_11106312 | 3300014326 | Bacteria | 832 |
| 1061 | Ga0157380_11325256 | 3300014326 | Unclassified | 768 |
| 1062 | Ga0157380_12370458 | 3300014326 | Unclassified | 596 |
| 1063 | Ga0157380_12649011 | 3300014326 | Unclassified | 568 |
| 1064 | Ga0157380_12728529 | 3300014326 | Unclassified | 560 |
| 1065 | Ga0157380_13484822 | 3300014326 | Unclassified | 504 |
| 1066 | Ga0182008_10194375 | 3300014497 | Unclassified | 1030 |
| 1067 | Ga0182008_10215041 | 3300014497 | Bacteria | 982 |
| 1068 | Ga0157377_10084179 | 3300014745 | Unclassified | 1865 |
| 1069 | Ga0157377_10136532 | 3300014745 | Bacteria | 1503 |
| 1070 | Ga0157377_10158760 | 3300014745 | Bacteria | 1404 |
| 1071 | Ga0157377_10278711 | 3300014745 | Unclassified | 1095 |
| 1072 | Ga0157377_10283269 | 3300014745 | Bacteria | 1087 |
| 1073 | Ga0157377_10342555 | 3300014745 | Bacteria | 1000 |
| 1074 | Ga0157377_10876027 | 3300014745 | Unclassified | 669 |
| 1075 | Ga0157377_11193498 | 3300014745 | Bacteria | 589 |
| 1076 | Ga0157379_10042678 | 3300014968 | Bacteria | 4049 |
| 1077 | Ga0157379_10073922 | 3300014968 | Bacteria | 3052 |
| 1078 | Ga0157379_10077774 | 3300014968 | Bacteria | 2971 |
| 1079 | Ga0157379_10451939 | 3300014968 | Bacteria | 1186 |
| 1080 | Ga0157379_10769566 | 3300014968 | Unclassified | 907 |
| 1081 | Ga0157379_10858370 | 3300014968 | Unclassified | 859 |
| 1082 | Ga0157379_10935016 | 3300014968 | Unclassified | 824 |
| 1083 | Ga0157379_11183837 | 3300014968 | Unclassified | 735 |
| 1084 | Ga0157379_11387027 | 3300014968 | Bacteria | 681 |
| 1085 | Ga0157379_11865313 | 3300014968 | Bacteria | 592 |
| 1086 | Ga0157376_10011187 | 3300014969 | Bacteria | 6603 |
| 1087 | Ga0157376_10406943 | 3300014969 | Bacteria | 1317 |
| 1088 | Ga0157376_10474687 | 3300014969 | Bacteria | 1224 |
| 1089 | Ga0182005_1041260 | 3300015265 | Bacteria | 1255 |
| 1090 | Ga0163161_10005583 | 3300017792 | Bacteria | 8720 |
| 1091 | Ga0163161_10010405 | 3300017792 | Bacteria | 6441 |
| 1092 | Ga0163161_10025611 | 3300017792 | Bacteria | 4176 |
| 1093 | Ga0163161_10231932 | 3300017792 | Unclassified | 1433 |
| 1094 | Ga0163161_10446788 | 3300017792 | Bacteria | 1044 |
| 1095 | Ga0163161_10516072 | 3300017792 | Bacteria | 975 |
| 1096 | Ga0163161_11219518 | 3300017792 | Bacteria | 651 |
| 1097 | Ga0213876_10000102 | 3300021384 | Bacteria | 94958 |
| 1098 | Ga0213876_10000277 | 3300021384 | Bacteria | 47161 |
| 1099 | Ga0207697_10009354 | 3300025315 | Bacteria | 4239 |
| 1100 | Ga0207697_10037174 | 3300025315 | Bacteria | 1994 |
| 1101 | Ga0207656_10016582 | 3300025321 | Unclassified | 2870 |
| 1102 | Ga0207656_10155106 | 3300025321 | Bacteria | 1086 |
| 1103 | Ga0207713_1142031 | 3300025735 | Bacteria | 783 |
| 1104 | Ga0207653_10000948 | 3300025885 | Bacteria | 9584 |
| 1105 | Ga0207682_10049097 | 3300025893 | Bacteria | 1741 |
| 1106 | Ga0207682_10169765 | 3300025893 | Unclassified | 992 |
| 1107 | Ga0207642_10002306 | 3300025899 | Bacteria | 5944 |
| 1108 | Ga0207642_10022160 | 3300025899 | Bacteria | 2514 |
| 1109 | Ga0207642_10272013 | 3300025899 | Unclassified | 971 |
| 1110 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 1111 | Ga0207710_10024784 | 3300025900 | Unclassified | 2586 |
| 1112 | Ga0207710_10048922 | 3300025900 | Bacteria | 1893 |
| 1113 | Ga0207710_10112482 | 3300025900 | Bacteria | 1294 |
| 1114 | Ga0207710_10180533 | 3300025900 | Unclassified | 1035 |
| 1115 | Ga0207710_10352063 | 3300025900 | Bacteria | 750 |
| 1116 | Ga0207710_10475166 | 3300025900 | Unclassified | 647 |
| 1117 | Ga0207688_10266886 | 3300025901 | Bacteria | 1040 |
| 1118 | Ga0207680_10067934 | 3300025903 | Bacteria | 2197 |
| 1119 | Ga0207680_10069536 | 3300025903 | Unclassified | 2176 |
| 1120 | Ga0207647_10001815 | 3300025904 | Bacteria | 16384 |
| 1121 | Ga0207647_10094662 | 3300025904 | Bacteria | 1779 |
| 1122 | Ga0207647_10107490 | 3300025904 | Bacteria | 1651 |
| 1123 | Ga0207685_10000007 | 3300025905 | Bacteria | 278341 |
| 1124 | Ga0207699_10855810 | 3300025906 | Unclassified | 670 |
| 1125 | Ga0207699_11338716 | 3300025906 | Unclassified | 530 |
| 1126 | Ga0207645_10064242 | 3300025907 | Unclassified | 2345 |
| 1127 | Ga0207645_10176216 | 3300025907 | Unclassified | 1402 |
| 1128 | Ga0207645_10830273 | 3300025907 | Unclassified | 628 |
| 1129 | Ga0207643_10009763 | 3300025908 | Bacteria | 5151 |
| 1130 | Ga0207643_10057712 | 3300025908 | Unclassified | 2211 |
| 1131 | Ga0207643_10101088 | 3300025908 | Unclassified | 1691 |
| 1132 | Ga0207643_10109604 | 3300025908 | Unclassified | 1626 |
| 1133 | Ga0207643_10436908 | 3300025908 | Unclassified | 831 |
| 1134 | Ga0207643_10787016 | 3300025908 | Unclassified | 616 |
| 1135 | Ga0207643_10868303 | 3300025908 | Unclassified | 585 |
| 1136 | Ga0207684_10000170 | 3300025910 | Bacteria | 107800 |
| 1137 | Ga0207684_10019633 | 3300025910 | Bacteria | 5781 |
| 1138 | Ga0207684_10036958 | 3300025910 | Bacteria | 4145 |
| 1139 | Ga0207684_10086334 | 3300025910 | Unclassified | 2673 |
| 1140 | Ga0207684_10093579 | 3300025910 | Unclassified | 2563 |
| 1141 | Ga0207684_10103112 | 3300025910 | Bacteria | 2439 |
| 1142 | Ga0207684_10200233 | 3300025910 | Bacteria | 1723 |
| 1143 | Ga0207684_10259931 | 3300025910 | Bacteria | 1498 |
| 1144 | Ga0207684_10419270 | 3300025910 | Unclassified | 1150 |
| 1145 | Ga0207654_10005182 | 3300025911 | Bacteria | 6575 |
| 1146 | Ga0207654_10110418 | 3300025911 | Unclassified | 1710 |
| 1147 | Ga0207654_10190310 | 3300025911 | Bacteria | 1344 |
| 1148 | Ga0207654_10218601 | 3300025911 | Bacteria | 1263 |
| 1149 | Ga0207654_10340484 | 3300025911 | Bacteria | 1030 |
| 1150 | Ga0207654_10410130 | 3300025911 | Unclassified | 944 |
| 1151 | Ga0207654_10781507 | 3300025911 | Unclassified | 689 |
| 1152 | Ga0207654_10977504 | 3300025911 | Unclassified | 615 |
| 1153 | Ga0207654_11223755 | 3300025911 | Unclassified | 547 |
| 1154 | Ga0207707_10000015 | 3300025912 | Bacteria | 259670 |
| 1155 | Ga0207707_10008748 | 3300025912 | Bacteria | 8787 |
| 1156 | Ga0207707_10015435 | 3300025912 | Bacteria | 6653 |
| 1157 | Ga0207707_10113718 | 3300025912 | Unclassified | 2365 |
| 1158 | Ga0207707_10178413 | 3300025912 | Unclassified | 1855 |
| 1159 | Ga0207695_10224757 | 3300025913 | Unclassified | 1784 |
| 1160 | Ga0207695_10534985 | 3300025913 | Unclassified | 1053 |
| 1161 | Ga0207695_10569196 | 3300025913 | Bacteria | 1014 |
| 1162 | Ga0207695_10894480 | 3300025913 | Bacteria | 768 |
| 1163 | Ga0207695_10959196 | 3300025913 | Unclassified | 735 |
| 1164 | Ga0207695_11230326 | 3300025913 | Unclassified | 629 |
| 1165 | Ga0207671_10000958 | 3300025914 | Bacteria | 35832 |
| 1166 | Ga0207671_10210336 | 3300025914 | Bacteria | 1521 |
| 1167 | Ga0207671_10413585 | 3300025914 | Bacteria | 1073 |
| 1168 | Ga0207671_10440118 | 3300025914 | Unclassified | 1038 |
| 1169 | Ga0207663_11207957 | 3300025916 | Bacteria | 609 |
| 1170 | Ga0207660_10001103 | 3300025917 | Bacteria | 18024 |
| 1171 | Ga0207660_10010882 | 3300025917 | Bacteria | 5915 |
| 1172 | Ga0207660_10079617 | 3300025917 | Bacteria | 2404 |
| 1173 | Ga0207660_10772129 | 3300025917 | Unclassified | 784 |
| 1174 | Ga0207662_10002814 | 3300025918 | Bacteria | 8798 |
| 1175 | Ga0207662_10033436 | 3300025918 | Bacteria | 2997 |
| 1176 | Ga0207662_10043959 | 3300025918 | Bacteria | 2636 |
| 1177 | Ga0207662_10059477 | 3300025918 | Bacteria | 2290 |
| 1178 | Ga0207662_10104004 | 3300025918 | Unclassified | 1763 |
| 1179 | Ga0207662_10195794 | 3300025918 | Bacteria | 1306 |
| 1180 | Ga0207662_10284955 | 3300025918 | Bacteria | 1094 |
| 1181 | Ga0207662_10334641 | 3300025918 | Bacteria | 1013 |
| 1182 | Ga0207662_10364492 | 3300025918 | Unclassified | 973 |
| 1183 | Ga0207662_10380098 | 3300025918 | Bacteria | 954 |
| 1184 | Ga0207662_10698942 | 3300025918 | Unclassified | 711 |
| 1185 | Ga0207657_10546050 | 3300025919 | Unclassified | 906 |
| 1186 | Ga0207657_10689536 | 3300025919 | Bacteria | 794 |
| 1187 | Ga0207649_10040447 | 3300025920 | Bacteria | 2834 |
| 1188 | Ga0207649_10044914 | 3300025920 | Unclassified | 2707 |
| 1189 | Ga0207649_10143064 | 3300025920 | Unclassified | 1639 |
| 1190 | Ga0207649_10316372 | 3300025920 | Bacteria | 1145 |
| 1191 | Ga0207649_10560789 | 3300025920 | Bacteria | 875 |
| 1192 | Ga0207649_11120229 | 3300025920 | Unclassified | 621 |
| 1193 | Ga0207649_11470604 | 3300025920 | Unclassified | 539 |
| 1194 | Ga0207652_10000252 | 3300025921 | Bacteria | 55772 |
| 1195 | Ga0207652_10988215 | 3300025921 | Bacteria | 740 |
| 1196 | Ga0207646_10003914 | 3300025922 | Bacteria | 16534 |
| 1197 | Ga0207646_10049029 | 3300025922 | Unclassified | 3783 |
| 1198 | Ga0207646_10063422 | 3300025922 | Bacteria | 3299 |
| 1199 | Ga0207646_10079652 | 3300025922 | Unclassified | 2929 |
| 1200 | Ga0207646_10124291 | 3300025922 | Unclassified | 2319 |
| 1201 | Ga0207646_10584162 | 3300025922 | Bacteria | 1003 |
| 1202 | Ga0207646_10854790 | 3300025922 | Unclassified | 809 |
| 1203 | Ga0207681_10005772 | 3300025923 | Bacteria | 7591 |
| 1204 | Ga0207681_10006488 | 3300025923 | Bacteria | 7181 |
| 1205 | Ga0207681_10022095 | 3300025923 | Bacteria | 4053 |
| 1206 | Ga0207681_10036809 | 3300025923 | Bacteria | 3231 |
| 1207 | Ga0207681_10113375 | 3300025923 | Bacteria | 1976 |
| 1208 | Ga0207681_10563264 | 3300025923 | Bacteria | 939 |
| 1209 | Ga0207681_10694335 | 3300025923 | Bacteria | 846 |
| 1210 | Ga0207681_10800936 | 3300025923 | Bacteria | 787 |
| 1211 | Ga0207681_11069120 | 3300025923 | Unclassified | 677 |
| 1212 | Ga0207681_11238412 | 3300025923 | Unclassified | 627 |
| 1213 | Ga0207681_11304117 | 3300025923 | Bacteria | 610 |
| 1214 | Ga0207694_10004960 | 3300025924 | Bacteria | 10306 |
| 1215 | Ga0207694_10068494 | 3300025924 | Bacteria | 2771 |
| 1216 | Ga0207650_10000005 | 3300025925 | Bacteria | 663190 |
| 1217 | Ga0207650_10001694 | 3300025925 | Bacteria | 15668 |
| 1218 | Ga0207650_10047533 | 3300025925 | Bacteria | 3162 |
| 1219 | Ga0207650_10114046 | 3300025925 | Bacteria | 2096 |
| 1220 | Ga0207650_10118649 | 3300025925 | Bacteria | 2057 |
| 1221 | Ga0207650_10180046 | 3300025925 | Unclassified | 1684 |
| 1222 | Ga0207650_10257644 | 3300025925 | Bacteria | 1414 |
| 1223 | Ga0207650_10316409 | 3300025925 | Bacteria | 1277 |
| 1224 | Ga0207650_10403790 | 3300025925 | Bacteria | 1131 |
| 1225 | Ga0207650_10498050 | 3300025925 | Bacteria | 1018 |
| 1226 | Ga0207650_10543558 | 3300025925 | Bacteria | 974 |
| 1227 | Ga0207650_10633926 | 3300025925 | Bacteria | 900 |
| 1228 | Ga0207650_10775976 | 3300025925 | Unclassified | 812 |
| 1229 | Ga0207659_10373815 | 3300025926 | Unclassified | 1187 |
| 1230 | Ga0207659_10459101 | 3300025926 | Bacteria | 1074 |
| 1231 | Ga0207659_10568740 | 3300025926 | Unclassified | 964 |
| 1232 | Ga0207659_11032480 | 3300025926 | Unclassified | 707 |
| 1233 | Ga0207659_11083540 | 3300025926 | Unclassified | 689 |
| 1234 | Ga0207687_10133222 | 3300025927 | Unclassified | 1876 |
| 1235 | Ga0207687_10841384 | 3300025927 | Unclassified | 784 |
| 1236 | Ga0207687_10886191 | 3300025927 | Unclassified | 763 |
| 1237 | Ga0207687_11317472 | 3300025927 | Bacteria | 621 |
| 1238 | Ga0207644_10000209 | 3300025931 | Bacteria | 40524 |
| 1239 | Ga0207644_10007515 | 3300025931 | Bacteria | 7106 |
| 1240 | Ga0207644_10018688 | 3300025931 | Bacteria | 4692 |
| 1241 | Ga0207644_10077140 | 3300025931 | Bacteria | 2453 |
| 1242 | Ga0207644_10224780 | 3300025931 | Bacteria | 1489 |
| 1243 | Ga0207644_10330400 | 3300025931 | Unclassified | 1234 |
| 1244 | Ga0207690_10094122 | 3300025932 | Bacteria | 2125 |
| 1245 | Ga0207690_10165270 | 3300025932 | Bacteria | 1653 |
| 1246 | Ga0207690_10202760 | 3300025932 | Bacteria | 1507 |
| 1247 | Ga0207690_11130193 | 3300025932 | Unclassified | 653 |
| 1248 | Ga0207690_11469818 | 3300025932 | Unclassified | 570 |
| 1249 | Ga0207706_10068958 | 3300025933 | Bacteria | 3110 |
| 1250 | Ga0207706_10089618 | 3300025933 | Unclassified | 2704 |
| 1251 | Ga0207706_10240155 | 3300025933 | Bacteria | 1584 |
| 1252 | Ga0207706_10319637 | 3300025933 | Bacteria | 1351 |
| 1253 | Ga0207706_10409390 | 3300025933 | Unclassified | 1175 |
| 1254 | Ga0207706_11365577 | 3300025933 | Unclassified | 583 |
| 1255 | Ga0207686_10000114 | 3300025934 | Bacteria | 64832 |
| 1256 | Ga0207686_10000400 | 3300025934 | Bacteria | 30163 |
| 1257 | Ga0207686_10006928 | 3300025934 | Bacteria | 6102 |
| 1258 | Ga0207686_10019085 | 3300025934 | Bacteria | 3893 |
| 1259 | Ga0207686_10026180 | 3300025934 | Bacteria | 3401 |
| 1260 | Ga0207686_10031105 | 3300025934 | Bacteria | 3167 |
| 1261 | Ga0207686_10075397 | 3300025934 | Bacteria | 2183 |
| 1262 | Ga0207686_10450241 | 3300025934 | Unclassified | 990 |
| 1263 | Ga0207686_10662521 | 3300025934 | Unclassified | 827 |
| 1264 | Ga0207686_11257672 | 3300025934 | Unclassified | 607 |
| 1265 | Ga0207709_10000162 | 3300025935 | Bacteria | 91279 |
| 1266 | Ga0207709_10002929 | 3300025935 | Bacteria | 10423 |
| 1267 | Ga0207709_10058798 | 3300025935 | Bacteria | 2391 |
| 1268 | Ga0207709_10334193 | 3300025935 | Bacteria | 1138 |
| 1269 | Ga0207709_10398188 | 3300025935 | Unclassified | 1052 |
| 1270 | Ga0207709_10427051 | 3300025935 | Unclassified | 1019 |
| 1271 | Ga0207709_10787701 | 3300025935 | Unclassified | 767 |
| 1272 | Ga0207709_10821343 | 3300025935 | Bacteria | 751 |
| 1273 | Ga0207670_10036048 | 3300025936 | Unclassified | 3214 |
| 1274 | Ga0207670_10070067 | 3300025936 | Bacteria | 2421 |
| 1275 | Ga0207670_10393594 | 3300025936 | Unclassified | 1106 |
| 1276 | Ga0207670_10396242 | 3300025936 | Bacteria | 1103 |
| 1277 | Ga0207670_10603808 | 3300025936 | Unclassified | 901 |
| 1278 | Ga0207670_10738278 | 3300025936 | Bacteria | 817 |
| 1279 | Ga0207670_11443971 | 3300025936 | Unclassified | 584 |
| 1280 | Ga0207670_11836590 | 3300025936 | Unclassified | 515 |
| 1281 | Ga0207669_10284224 | 3300025937 | Bacteria | 1249 |
| 1282 | Ga0207669_11581955 | 3300025937 | Bacteria | 559 |
| 1283 | Ga0207704_10080963 | 3300025938 | Unclassified | 2098 |
| 1284 | Ga0207704_10444825 | 3300025938 | Unclassified | 1033 |
| 1285 | Ga0207704_10519736 | 3300025938 | Unclassified | 962 |
| 1286 | Ga0207704_10744986 | 3300025938 | Unclassified | 814 |
| 1287 | Ga0207665_10000018 | 3300025939 | Bacteria | 122653 |
| 1288 | Ga0207665_10047602 | 3300025939 | Unclassified | 2875 |
| 1289 | Ga0207665_10126614 | 3300025939 | Bacteria | 1809 |
| 1290 | Ga0207665_10182251 | 3300025939 | Unclassified | 1521 |
| 1291 | Ga0207665_10265017 | 3300025939 | Bacteria | 1274 |
| 1292 | Ga0207665_10478505 | 3300025939 | Bacteria | 959 |
| 1293 | Ga0207665_10958669 | 3300025939 | Bacteria | 680 |
| 1294 | Ga0207691_10005480 | 3300025940 | Bacteria | 12254 |
| 1295 | Ga0207691_10011710 | 3300025940 | Bacteria | 8422 |
| 1296 | Ga0207691_10221603 | 3300025940 | Unclassified | 1640 |
| 1297 | Ga0207691_10283457 | 3300025940 | Bacteria | 1425 |
| 1298 | Ga0207691_11035407 | 3300025940 | Bacteria | 684 |
| 1299 | Ga0207691_11065415 | 3300025940 | Unclassified | 673 |
| 1300 | Ga0207711_10004919 | 3300025941 | Bacteria | 11344 |
| 1301 | Ga0207711_10044927 | 3300025941 | Unclassified | 3773 |
| 1302 | Ga0207711_10054983 | 3300025941 | Bacteria | 3417 |
| 1303 | Ga0207711_10101440 | 3300025941 | Bacteria | 2547 |
| 1304 | Ga0207711_10108714 | 3300025941 | Unclassified | 2464 |
| 1305 | Ga0207711_10192914 | 3300025941 | Bacteria | 1857 |
| 1306 | Ga0207711_10365493 | 3300025941 | Bacteria | 1337 |
| 1307 | Ga0207711_10436521 | 3300025941 | Unclassified | 1218 |
| 1308 | Ga0207711_10475339 | 3300025941 | Unclassified | 1164 |
| 1309 | Ga0207711_10523454 | 3300025941 | Unclassified | 1106 |
| 1310 | Ga0207711_10828604 | 3300025941 | Unclassified | 861 |
| 1311 | Ga0207711_11959275 | 3300025941 | Unclassified | 529 |
| 1312 | Ga0207689_10004566 | 3300025942 | Bacteria | 12534 |
| 1313 | Ga0207689_10037086 | 3300025942 | Bacteria | 4045 |
| 1314 | Ga0207689_10057085 | 3300025942 | Unclassified | 3212 |
| 1315 | Ga0207689_10065176 | 3300025942 | Bacteria | 2997 |
| 1316 | Ga0207689_10251785 | 3300025942 | Bacteria | 1460 |
| 1317 | Ga0207689_10262503 | 3300025942 | Bacteria | 1429 |
| 1318 | Ga0207689_10556010 | 3300025942 | Unclassified | 964 |
| 1319 | Ga0207689_10680662 | 3300025942 | Bacteria | 867 |
| 1320 | Ga0207689_10767911 | 3300025942 | Bacteria | 813 |
| 1321 | Ga0207689_10818446 | 3300025942 | Unclassified | 786 |
| 1322 | Ga0207689_10894665 | 3300025942 | Unclassified | 749 |
| 1323 | Ga0207689_11066735 | 3300025942 | Bacteria | 681 |
| 1324 | Ga0207661_10431236 | 3300025944 | Bacteria | 1198 |
| 1325 | Ga0207679_10007735 | 3300025945 | Bacteria | 6829 |
| 1326 | Ga0207679_10049367 | 3300025945 | Bacteria | 3070 |
| 1327 | Ga0207679_10068310 | 3300025945 | Unclassified | 2669 |
| 1328 | Ga0207679_10095263 | 3300025945 | Bacteria | 2313 |
| 1329 | Ga0207679_10587018 | 3300025945 | Bacteria | 1003 |
| 1330 | Ga0207679_10647977 | 3300025945 | Bacteria | 955 |
| 1331 | Ga0207679_10716643 | 3300025945 | Bacteria | 909 |
| 1332 | Ga0207679_11034252 | 3300025945 | Unclassified | 753 |
| 1333 | Ga0207679_11060397 | 3300025945 | Unclassified | 743 |
| 1334 | Ga0207679_11256571 | 3300025945 | Unclassified | 680 |
| 1335 | Ga0207679_11792415 | 3300025945 | Unclassified | 561 |
| 1336 | Ga0207667_10036979 | 3300025949 | Bacteria | 5224 |
| 1337 | Ga0207667_10150953 | 3300025949 | Unclassified | 2391 |
| 1338 | Ga0207667_10543477 | 3300025949 | Bacteria | 1175 |
| 1339 | Ga0207667_10574190 | 3300025949 | Bacteria | 1139 |
| 1340 | Ga0207667_11021183 | 3300025949 | Bacteria | 813 |
| 1341 | Ga0207651_10012707 | 3300025960 | Unclassified | 4779 |
| 1342 | Ga0207651_10030462 | 3300025960 | Bacteria | 3436 |
| 1343 | Ga0207651_10108245 | 3300025960 | Bacteria | 2080 |
| 1344 | Ga0207651_10145698 | 3300025960 | Bacteria | 1836 |
| 1345 | Ga0207651_10260360 | 3300025960 | Bacteria | 1424 |
| 1346 | Ga0207651_10326001 | 3300025960 | Bacteria | 1285 |
| 1347 | Ga0207651_10331965 | 3300025960 | Unclassified | 1275 |
| 1348 | Ga0207651_10410654 | 3300025960 | Bacteria | 1153 |
| 1349 | Ga0207651_10710345 | 3300025960 | Unclassified | 886 |
| 1350 | Ga0207651_10986522 | 3300025960 | Bacteria | 752 |
| 1351 | Ga0207651_11793364 | 3300025960 | Unclassified | 552 |
| 1352 | Ga0207651_11837560 | 3300025960 | Unclassified | 545 |
| 1353 | Ga0207712_10000110 | 3300025961 | Bacteria | 89234 |
| 1354 | Ga0207712_10012290 | 3300025961 | Bacteria | 5471 |
| 1355 | Ga0207712_10017368 | 3300025961 | Bacteria | 4672 |
| 1356 | Ga0207712_10021709 | 3300025961 | Bacteria | 4217 |
| 1357 | Ga0207712_10121896 | 3300025961 | Bacteria | 1974 |
| 1358 | Ga0207712_10238367 | 3300025961 | Unclassified | 1464 |
| 1359 | Ga0207712_10257828 | 3300025961 | Bacteria | 1413 |
| 1360 | Ga0207712_10523236 | 3300025961 | Unclassified | 1017 |
| 1361 | Ga0207712_10538632 | 3300025961 | Bacteria | 1003 |
| 1362 | Ga0207712_10622259 | 3300025961 | Bacteria | 936 |
| 1363 | Ga0207712_10922584 | 3300025961 | Unclassified | 772 |
| 1364 | Ga0207668_10015518 | 3300025972 | Bacteria | 4735 |
| 1365 | Ga0207668_10483142 | 3300025972 | Bacteria | 1063 |
| 1366 | Ga0207640_10209869 | 3300025981 | Bacteria | 1483 |
| 1367 | Ga0207640_10227447 | 3300025981 | Unclassified | 1432 |
| 1368 | Ga0207640_10391746 | 3300025981 | Unclassified | 1129 |
| 1369 | Ga0207640_10422111 | 3300025981 | Unclassified | 1092 |
| 1370 | Ga0207640_10439666 | 3300025981 | Bacteria | 1072 |
| 1371 | Ga0207640_10581708 | 3300025981 | Unclassified | 945 |
| 1372 | Ga0207640_11244336 | 3300025981 | Unclassified | 663 |
| 1373 | Ga0207640_11990223 | 3300025981 | Unclassified | 526 |
| 1374 | Ga0207658_10196267 | 3300025986 | Bacteria | 1681 |
| 1375 | Ga0207658_10808428 | 3300025986 | Unclassified | 851 |
| 1376 | Ga0207677_10030542 | 3300026023 | Bacteria | 3441 |
| 1377 | Ga0207677_10144422 | 3300026023 | Bacteria | 1827 |
| 1378 | Ga0207677_10221622 | 3300026023 | Bacteria | 1517 |
| 1379 | Ga0207677_10410939 | 3300026023 | Bacteria | 1150 |
| 1380 | Ga0207677_10614925 | 3300026023 | Unclassified | 955 |
| 1381 | Ga0207677_11572603 | 3300026023 | Unclassified | 608 |
| 1382 | Ga0207677_12081629 | 3300026023 | Bacteria | 528 |
| 1383 | Ga0207703_10000354 | 3300026035 | Bacteria | 49391 |
| 1384 | Ga0207703_10030675 | 3300026035 | Bacteria | 4249 |
| 1385 | Ga0207703_10045085 | 3300026035 | Bacteria | 3546 |
| 1386 | Ga0207703_10057479 | 3300026035 | Bacteria | 3172 |
| 1387 | Ga0207703_10105027 | 3300026035 | Unclassified | 2401 |
| 1388 | Ga0207703_10280311 | 3300026035 | Unclassified | 1513 |
| 1389 | Ga0207703_10468992 | 3300026035 | Bacteria | 1178 |
| 1390 | Ga0207703_10884731 | 3300026035 | Unclassified | 855 |
| 1391 | Ga0207703_10950271 | 3300026035 | Bacteria | 824 |
| 1392 | Ga0207703_10958384 | 3300026035 | Unclassified | 820 |
| 1393 | Ga0207703_10972656 | 3300026035 | Bacteria | 814 |
| 1394 | Ga0207703_11296928 | 3300026035 | Unclassified | 700 |
| 1395 | Ga0207703_11304613 | 3300026035 | Bacteria | 698 |
| 1396 | Ga0207703_11485294 | 3300026035 | Unclassified | 652 |
| 1397 | Ga0207703_11553978 | 3300026035 | Bacteria | 637 |
| 1398 | Ga0207703_11603271 | 3300026035 | Unclassified | 626 |
| 1399 | Ga0207639_10022288 | 3300026041 | Unclassified | 4561 |
| 1400 | Ga0207639_10029011 | 3300026041 | Bacteria | 4046 |
| 1401 | Ga0207639_10067826 | 3300026041 | Bacteria | 2777 |
| 1402 | Ga0207639_10120554 | 3300026041 | Unclassified | 2154 |
| 1403 | Ga0207639_10212778 | 3300026041 | Unclassified | 1665 |
| 1404 | Ga0207639_10381317 | 3300026041 | Bacteria | 1266 |
| 1405 | Ga0207639_10736273 | 3300026041 | Bacteria | 916 |
| 1406 | Ga0207639_10863911 | 3300026041 | Unclassified | 845 |
| 1407 | Ga0207639_11023959 | 3300026041 | Unclassified | 774 |
| 1408 | Ga0207639_11136222 | 3300026041 | Unclassified | 733 |
| 1409 | Ga0207678_11540782 | 3300026067 | Unclassified | 586 |
| 1410 | Ga0207708_10000043 | 3300026075 | Bacteria | 121725 |
| 1411 | Ga0207708_10008562 | 3300026075 | Bacteria | 7569 |
| 1412 | Ga0207708_10080486 | 3300026075 | Bacteria | 2503 |
| 1413 | Ga0207708_10091884 | 3300026075 | Bacteria | 2341 |
| 1414 | Ga0207708_10098786 | 3300026075 | Unclassified | 2257 |
| 1415 | Ga0207708_10116230 | 3300026075 | Bacteria | 2081 |
| 1416 | Ga0207708_10177441 | 3300026075 | Bacteria | 1690 |
| 1417 | Ga0207708_10178691 | 3300026075 | Bacteria | 1684 |
| 1418 | Ga0207708_10951789 | 3300026075 | Unclassified | 745 |
| 1419 | Ga0207702_10009027 | 3300026078 | Bacteria | 8397 |
| 1420 | Ga0207702_12077363 | 3300026078 | Bacteria | 558 |
| 1421 | Ga0207641_10042907 | 3300026088 | Unclassified | 3796 |
| 1422 | Ga0207641_10043453 | 3300026088 | Bacteria | 3774 |
| 1423 | Ga0207641_10072372 | 3300026088 | Unclassified | 2968 |
| 1424 | Ga0207641_10177448 | 3300026088 | Unclassified | 1949 |
| 1425 | Ga0207641_10399291 | 3300026088 | Bacteria | 1320 |
| 1426 | Ga0207641_10439481 | 3300026088 | Unclassified | 1259 |
| 1427 | Ga0207641_10490034 | 3300026088 | Bacteria | 1192 |
| 1428 | Ga0207641_10665904 | 3300026088 | Unclassified | 1023 |
| 1429 | Ga0207641_10792588 | 3300026088 | Unclassified | 937 |
| 1430 | Ga0207641_11085107 | 3300026088 | Unclassified | 799 |
| 1431 | Ga0207641_11932658 | 3300026088 | Unclassified | 591 |
| 1432 | Ga0207641_12117418 | 3300026088 | Unclassified | 563 |
| 1433 | Ga0207648_10013061 | 3300026089 | Bacteria | 7744 |
| 1434 | Ga0207648_10069732 | 3300026089 | Bacteria | 3063 |
| 1435 | Ga0207648_10293972 | 3300026089 | Bacteria | 1455 |
| 1436 | Ga0207648_10378199 | 3300026089 | Bacteria | 1280 |
| 1437 | Ga0207648_10391305 | 3300026089 | Bacteria | 1258 |
| 1438 | Ga0207648_10396564 | 3300026089 | Bacteria | 1250 |
| 1439 | Ga0207648_10424307 | 3300026089 | Unclassified | 1208 |
| 1440 | Ga0207648_10536464 | 3300026089 | Bacteria | 1073 |
| 1441 | Ga0207648_10595373 | 3300026089 | Bacteria | 1019 |
| 1442 | Ga0207648_10640379 | 3300026089 | Unclassified | 982 |
| 1443 | Ga0207648_10667869 | 3300026089 | Bacteria | 961 |
| 1444 | Ga0207648_10827179 | 3300026089 | Unclassified | 863 |
| 1445 | Ga0207648_11060720 | 3300026089 | Bacteria | 760 |
| 1446 | Ga0207648_11123060 | 3300026089 | Unclassified | 737 |
| 1447 | Ga0207676_10002979 | 3300026095 | Bacteria | 12069 |
| 1448 | Ga0207676_10005890 | 3300026095 | Bacteria | 8655 |
| 1449 | Ga0207676_10008806 | 3300026095 | Bacteria | 7183 |
| 1450 | Ga0207676_10022931 | 3300026095 | Bacteria | 4596 |
| 1451 | Ga0207676_10044217 | 3300026095 | Bacteria | 3435 |
| 1452 | Ga0207676_10062217 | 3300026095 | Unclassified | 2959 |
| 1453 | Ga0207676_10080889 | 3300026095 | Bacteria | 2638 |
| 1454 | Ga0207676_10137391 | 3300026095 | Bacteria | 2088 |
| 1455 | Ga0207676_10179796 | 3300026095 | Bacteria | 1851 |
| 1456 | Ga0207676_10429136 | 3300026095 | Bacteria | 1241 |
| 1457 | Ga0207676_10567109 | 3300026095 | Bacteria | 1086 |
| 1458 | Ga0207676_10607355 | 3300026095 | Bacteria | 1051 |
| 1459 | Ga0207676_10724123 | 3300026095 | Bacteria | 966 |
| 1460 | Ga0207676_11165434 | 3300026095 | Unclassified | 763 |
| 1461 | Ga0207676_11189402 | 3300026095 | Unclassified | 755 |
| 1462 | Ga0207676_11331360 | 3300026095 | Unclassified | 713 |
| 1463 | Ga0207676_11401262 | 3300026095 | Unclassified | 695 |
| 1464 | Ga0207676_11409525 | 3300026095 | Bacteria | 693 |
| 1465 | Ga0207676_11427061 | 3300026095 | Unclassified | 688 |
| 1466 | Ga0207676_12365990 | 3300026095 | Unclassified | 528 |
| 1467 | Ga0207674_10005214 | 3300026116 | Bacteria | 15471 |
| 1468 | Ga0207674_10036996 | 3300026116 | Bacteria | 5080 |
| 1469 | Ga0207674_10119573 | 3300026116 | Unclassified | 2603 |
| 1470 | Ga0207674_10119925 | 3300026116 | Bacteria | 2599 |
| 1471 | Ga0207674_10237703 | 3300026116 | Bacteria | 1769 |
| 1472 | Ga0207674_10238337 | 3300026116 | Bacteria | 1766 |
| 1473 | Ga0207674_10284283 | 3300026116 | Bacteria | 1602 |
| 1474 | Ga0207674_10750537 | 3300026116 | Unclassified | 942 |
| 1475 | Ga0207674_11100217 | 3300026116 | Unclassified | 764 |
| 1476 | Ga0207675_100001995 | 3300026118 | Bacteria | 20351 |
| 1477 | Ga0207675_100002789 | 3300026118 | Bacteria | 17170 |
| 1478 | Ga0207675_100019390 | 3300026118 | Bacteria | 6345 |
| 1479 | Ga0207675_100059323 | 3300026118 | Bacteria | 3570 |
| 1480 | Ga0207675_100084649 | 3300026118 | Bacteria | 2976 |
| 1481 | Ga0207675_100186975 | 3300026118 | Unclassified | 1986 |
| 1482 | Ga0207675_100369775 | 3300026118 | Unclassified | 1408 |
| 1483 | Ga0207675_100446338 | 3300026118 | Bacteria | 1281 |
| 1484 | Ga0207675_100668915 | 3300026118 | Bacteria | 1045 |
| 1485 | Ga0207675_100782754 | 3300026118 | Unclassified | 966 |
| 1486 | Ga0207675_100817740 | 3300026118 | Unclassified | 946 |
| 1487 | Ga0207683_10032905 | 3300026121 | Bacteria | 4504 |
| 1488 | Ga0207683_10232608 | 3300026121 | Bacteria | 1681 |
| 1489 | Ga0207683_10243667 | 3300026121 | Unclassified | 1640 |
| 1490 | Ga0207683_10468141 | 3300026121 | Unclassified | 1163 |
| 1491 | Ga0207683_11229718 | 3300026121 | Unclassified | 694 |
| 1492 | Ga0207698_10181654 | 3300026142 | Bacteria | 1864 |
| 1493 | Ga0207698_10608367 | 3300026142 | Bacteria | 1078 |
| 1494 | Ga0207698_10680470 | 3300026142 | Bacteria | 1022 |
| 1495 | Ga0207698_10828684 | 3300026142 | Bacteria | 929 |
| 1496 | Ga0207698_11145649 | 3300026142 | Bacteria | 791 |
| 1497 | Ga0207698_11177691 | 3300026142 | Bacteria | 780 |
| 1498 | Ga0207698_12464915 | 3300026142 | Bacteria | 531 |
| 1499 | Ga0209588_1012747 | 3300027671 | Bacteria | 2556 |
| 1500 | Ga0209998_10075284 | 3300027717 | Unclassified | 811 |
| 1501 | Ga0207428_10065696 | 3300027907 | Unclassified | 2861 |
| 1502 | Ga0207428_10070786 | 3300027907 | Bacteria | 2741 |
| 1503 | Ga0207428_10657281 | 3300027907 | Unclassified | 752 |
| 1504 | Ga0207428_10736473 | 3300027907 | Unclassified | 703 |
| 1505 | Ga0207428_10910815 | 3300027907 | Unclassified | 621 |
| 1506 | Ga0268266_11862810 | 3300028379 | Unclassified | 576 |
| 1507 | Ga0268265_10017259 | 3300028380 | Unclassified | 4978 |
| 1508 | Ga0268265_10057467 | 3300028380 | Bacteria | 2965 |
| 1509 | Ga0268265_10096691 | 3300028380 | Bacteria | 2374 |
| 1510 | Ga0268265_10274850 | 3300028380 | Bacteria | 1504 |
| 1511 | Ga0268265_10298436 | 3300028380 | Unclassified | 1449 |
| 1512 | Ga0268265_10312780 | 3300028380 | Unclassified | 1419 |
| 1513 | Ga0268265_10576803 | 3300028380 | Bacteria | 1071 |
| 1514 | Ga0268265_10577171 | 3300028380 | Bacteria | 1071 |
| 1515 | Ga0268265_10588721 | 3300028380 | Bacteria | 1061 |
| 1516 | Ga0268265_10977818 | 3300028380 | Unclassified | 835 |
| 1517 | Ga0268265_11914691 | 3300028380 | Unclassified | 600 |
| 1518 | Ga0268264_10043770 | 3300028381 | Bacteria | 3712 |
| 1519 | Ga0268264_10050755 | 3300028381 | Bacteria | 3455 |
| 1520 | Ga0268264_10082424 | 3300028381 | Bacteria | 2752 |
| 1521 | Ga0268264_10090034 | 3300028381 | Unclassified | 2643 |
| 1522 | Ga0268264_10094624 | 3300028381 | Bacteria | 2583 |
| 1523 | Ga0268264_10127843 | 3300028381 | Bacteria | 2248 |
| 1524 | Ga0268264_10132530 | 3300028381 | Unclassified | 2211 |
| 1525 | Ga0268264_10153007 | 3300028381 | Unclassified | 2070 |
| 1526 | Ga0268264_10424708 | 3300028381 | Bacteria | 1283 |
| 1527 | Ga0268264_10529729 | 3300028381 | Unclassified | 1153 |
| 1528 | Ga0268264_10630881 | 3300028381 | Unclassified | 1059 |
| 1529 | Ga0268264_10756828 | 3300028381 | Unclassified | 968 |
| 1530 | Ga0268264_10808951 | 3300028381 | Unclassified | 937 |
| 1531 | Ga0268264_11477167 | 3300028381 | Unclassified | 690 |
| 1532 | Ga0268264_11682154 | 3300028381 | Bacteria | 645 |
| 1533 | Ga0307515_10538640 | 3300028794 | Bacteria | 777 |
| 1534 | Ga0314311_1139834 | 3300030733 | Bacteria | 1293 |
| 1535 | Ga0316178_1142882 | 3300030735 | Bacteria | 718 |
| 1536 | Ga0316182_1148632 | 3300030745 | Bacteria | 879 |
| 1537 | Ga0307513_10005598 | 3300031456 | Bacteria | 16565 |
| 1538 | Ga0307408_100385006 | 3300031548 | Bacteria | 1200 |
| 1539 | Ga0307408_100446041 | 3300031548 | Unclassified | 1121 |
| 1540 | Ga0307408_101156004 | 3300031548 | Unclassified | 720 |
| 1541 | Ga0307408_102520166 | 3300031548 | Unclassified | 500 |
| 1542 | Ga0307405_10179549 | 3300031731 | Unclassified | 1518 |
| 1543 | Ga0307405_10235300 | 3300031731 | Bacteria | 1353 |
| 1544 | Ga0307405_10289468 | 3300031731 | Bacteria | 1237 |
| 1545 | Ga0307405_10376675 | 3300031731 | Bacteria | 1103 |
| 1546 | Ga0307405_11040058 | 3300031731 | Unclassified | 701 |
| 1547 | Ga0307413_10032967 | 3300031824 | Archaea | 2942 |
| 1548 | Ga0307410_10039430 | 3300031852 | Archaea | 3101 |
| 1549 | Ga0307410_10164481 | 3300031852 | Bacteria | 1666 |
| 1550 | Ga0307410_10235960 | 3300031852 | Archaea | 1415 |
| 1551 | Ga0307410_10561925 | 3300031852 | Unclassified | 947 |
| 1552 | Ga0307406_10013493 | 3300031901 | Bacteria | 4680 |
| 1553 | Ga0307406_10017531 | 3300031901 | Unclassified | 4171 |
| 1554 | Ga0307406_10489063 | 3300031901 | Unclassified | 995 |
| 1555 | Ga0307406_10564726 | 3300031901 | Unclassified | 933 |
| 1556 | Ga0307407_10026139 | 3300031903 | Archaea | 3087 |
| 1557 | Ga0307407_10142309 | 3300031903 | Bacteria | 1549 |
| 1558 | Ga0307407_10514336 | 3300031903 | Unclassified | 879 |
| 1559 | Ga0307412_10053675 | 3300031911 | Unclassified | 2672 |
| 1560 | Ga0307412_10201000 | 3300031911 | Unclassified | 1513 |
| 1561 | Ga0307412_10317114 | 3300031911 | Bacteria | 1239 |
| 1562 | Ga0307412_10777775 | 3300031911 | Bacteria | 829 |
| 1563 | Ga0307412_10933548 | 3300031911 | Unclassified | 763 |
| 1564 | Ga0307409_100058421 | 3300031995 | Archaea | 2995 |
| 1565 | Ga0307409_100156791 | 3300031995 | Bacteria | 1985 |
| 1566 | Ga0307409_102649159 | 3300031995 | Unclassified | 530 |
| 1567 | Ga0307416_100011954 | 3300032002 | Bacteria | 5824 |
| 1568 | Ga0307416_100033296 | 3300032002 | Bacteria | 3905 |
| 1569 | Ga0307416_100392925 | 3300032002 | Bacteria | 1421 |
| 1570 | Ga0307416_100525371 | 3300032002 | Bacteria | 1252 |
| 1571 | Ga0307416_100939695 | 3300032002 | Unclassified | 966 |
| 1572 | Ga0307416_101175142 | 3300032002 | Bacteria | 873 |
| 1573 | Ga0307416_101435174 | 3300032002 | Unclassified | 796 |
| 1574 | Ga0307416_101642387 | 3300032002 | Unclassified | 748 |
| 1575 | Ga0307416_103606258 | 3300032002 | Unclassified | 518 |
| 1576 | Ga0307414_10000977 | 3300032004 | Bacteria | 14587 |
| 1577 | Ga0307414_10078412 | 3300032004 | Unclassified | 2408 |
| 1578 | Ga0307414_10137096 | 3300032004 | Unclassified | 1910 |
| 1579 | Ga0307414_10198823 | 3300032004 | Bacteria | 1628 |
| 1580 | Ga0307414_11757143 | 3300032004 | Bacteria | 579 |
| 1581 | Ga0307411_10074618 | 3300032005 | Bacteria | 2312 |
| 1582 | Ga0307411_10233335 | 3300032005 | Unclassified | 1436 |
| 1583 | Ga0307411_10244264 | 3300032005 | Unclassified | 1407 |
| 1584 | Ga0307411_10907235 | 3300032005 | Unclassified | 783 |
| 1585 | Ga0307411_11119931 | 3300032005 | Unclassified | 710 |
| 1586 | Ga0307415_100037442 | 3300032126 | Archaea | 3188 |
| 1587 | Ga0307415_100176510 | 3300032126 | Bacteria | 1672 |
| 1588 | Ga0307415_100347705 | 3300032126 | Unclassified | 1247 |
| 1589 | Ga0373950_0048464 | 3300034818 | Bacteria | 830 |
| 1590 | Ga0373929_0251653 | 3300035085 | Unclassified | 513 |
| 1591 | Ga0373940_0155622 | 3300035088 | Bacteria | 731 |
| 1592 | Ga0373951_0023668 | 3300035091 | Bacteria | 1420 |
| 1593 | Ga0373941_0009414 | 3300035115 | Unclassified | 2461 |
| 1594 | Ga0373941_0013541 | 3300035115 | Bacteria | 2158 |
| 1595 | Ga0373942_0004655 | 3300035207 | Unclassified | 3178 |
| 1596 | Ga0373961_0177239 | 3300035241 | Bacteria | 741 |
| 1597 | Ga0373961_0254092 | 3300035241 | Unclassified | 637 |
| 1598 | Ga0373962_0378234 | 3300035242 | Unclassified | 517 |
| 1599 | Ga0373931_0449195 | 3300035691 | Bacteria | 824 |
| 1600 | Ga0373935_0606208 | 3300035692 | Unclassified | 801 |
| 1601 | Ga0373937_0733945 | 3300036401 | Bacteria | 935 |
| 1602 | Ga0373925_1349093 | 3300037068 | Unclassified | 585 |
| 1603 | Ga0395900_0057486 | 3300037418 | Unclassified | 4005 |
| 1604 | Ga0395900_0158741 | 3300037418 | Bacteria | 2308 |
| 1605 | Ga0395900_0848922 | 3300037418 | Unclassified | 839 |
| 1606 | Ga0395900_0878894 | 3300037418 | Bacteria | 821 |
| 1607 | Ga0395900_1353970 | 3300037418 | Unclassified | 625 |
| 1608 | Ga0395898_0153361 | 3300037466 | Bacteria | 2204 |
| 1609 | Ga0395898_0942013 | 3300037466 | Bacteria | 801 |
| 1610 | Ga0395898_1144769 | 3300037466 | Unclassified | 710 |
| 1611 | Ga0395905_0002781 | 3300037471 | Bacteria | 19157 |
| 1612 | Ga0395905_0029119 | 3300037471 | Bacteria | 5205 |
| 1613 | Ga0395905_0803208 | 3300037471 | Bacteria | 844 |
| 1614 | Ga0395905_1854701 | 3300037471 | Unclassified | 509 |
| 1615 | Ga0436364_1177179 | 3300037853 | Unclassified | 559 |
| 1616 | Ga0395901_0176126 | 3300038443 | Bacteria | 2244 |
| 1617 | Ga0395901_0808868 | 3300038443 | Bacteria | 926 |
| 1618 | Ga0395901_1858813 | 3300038443 | Bacteria | 550 |
| 1619 | Ga0242422_02081 | 3300038699 | Bacteria | 1369 |
| 1620 | Ga0242420_061324 | 3300038996 | Unclassified | 751 |
| 1621 | Ga0436365_0557003 | 3300039437 | Bacteria | 48655 |
| 1622 | Ga0436365_0744561 | 3300039437 | Unclassified | 1265 |
| 1623 | Ga0436365_0802786 | 3300039437 | Bacteria | 54200 |
| 1624 | Ga0436363_0057732 | 3300039450 | Bacteria | 916 |
| 1625 | Ga0451793_1711702 | 3300041452 | Unclassified | 794 |
| 1626 | Ga0451807_0635481 | 3300041486 | Bacteria | 544 |
| 1627 | Ga0451807_1877268 | 3300041486 | Unclassified | 736 |
| 1628 | Ga0451853_3186910 | 3300041512 | Bacteria | 1193 |
| 1629 | Ga0439448_0015162 | 3300042005 | Bacteria | 2332 |
| 1630 | Ga0439432_014864 | 3300042006 | Bacteria | 2632 |
| 1631 | Ga0439455_0123271 | 3300042012 | Unclassified | 727 |
| 1632 | Ga0439462_0193974 | 3300042015 | Bacteria | 577 |
| 1633 | Ga0439446_0069853 | 3300042156 | Bacteria | 1073 |
| 1634 | Ga0439458_0004943 | 3300042157 | Unclassified | 3023 |
| 1635 | Ga0439458_0165737 | 3300042157 | Unclassified | 596 |
| 1636 | Ga0439434_0004396 | 3300042435 | Bacteria | 4122 |
| 1637 | Ga0439434_0089917 | 3300042435 | Bacteria | 981 |
| 1638 | Ga0439435_0109874 | 3300042436 | Bacteria | 855 |
| 1639 | Ga0439459_0222521 | 3300042438 | Unclassified | 523 |
| 1640 | Ga0439464_0010763 | 3300042439 | Bacteria | 2418 |
| 1641 | Ga0451577_0528632 | 3300042876 | Bacteria | 1071 |
| 1642 | Ga0453683_0010562 | 3300044673 | Bacteria | 6117 |
| 1643 | Ga0453683_1035877 | 3300044673 | Unclassified | 546 |
| 1644 | Ga0453684_1410385 | 3300044712 | Unclassified | 722 |
| 1645 | Ga0466960_0860746 | 3300044901 | Unclassified | 551 |
| 1646 | Ga0451576_0005147 | 3300045051 | Bacteria | 16559 |
| 1647 | Ga0451576_0311562 | 3300045051 | Unclassified | 1647 |
| 1648 | Ga0451576_0407534 | 3300045051 | Unclassified | 1426 |
| 1649 | Ga0451576_0902485 | 3300045051 | Bacteria | 927 |
| 1650 | Ga0451576_1775920 | 3300045051 | Bacteria | 638 |
| 1651 | Ga0495592_0614521 | 3300046454 | Unclassified | 662 |
| 1652 | Ga0495629_0600031 | 3300046459 | Unclassified | 736 |
| 1653 | Ga0495651_0445892 | 3300046462 | Unclassified | 837 |
| 1654 | Ga0495580_0419989 | 3300046472 | Unclassified | 900 |
| 1655 | Ga0495639_0109479 | 3300046475 | Unclassified | 1310 |
| 1656 | Ga0495664_0387253 | 3300046477 | Bacteria | 840 |
| 1657 | Ga0495618_0147288 | 3300046514 | Bacteria | 1505 |
| 1658 | Ga0495632_0033115 | 3300046519 | Bacteria | 2656 |
| 1659 | Ga0495643_0293688 | 3300046522 | Unclassified | 743 |
| 1660 | Ga0495663_0218879 | 3300046525 | Unclassified | 669 |
| 1661 | Ga0495586_0091430 | 3300046535 | Bacteria | 1682 |
| 1662 | Ga0495598_0286926 | 3300046537 | Unclassified | 619 |
| 1663 | Ga0495621_0036583 | 3300046539 | Bacteria | 1704 |
| 1664 | Ga0495621_0263646 | 3300046539 | Bacteria | 706 |
| 1665 | Ga0495645_0111154 | 3300046543 | Bacteria | 1939 |
| 1666 | Ga0495667_0523741 | 3300046559 | Unclassified | 742 |
| 1667 | Ga0495656_0033559 | 3300046615 | Bacteria | 2096 |
| 1668 | Ga0495634_0319925 | 3300046642 | Unclassified | 934 |
| 1669 | Ga0495635_0321269 | 3300046663 | Bacteria | 1036 |
| 1670 | Ga0495659_0030422 | 3300046664 | Bacteria | 1879 |
| 1671 | Ga0495599_0535317 | 3300046678 | Unclassified | 687 |
| 1672 | Ga0495658_0623392 | 3300046683 | Unclassified | 691 |
| 1673 | Ga0495658_0923733 | 3300046683 | Unclassified | 558 |
| 1674 | Ga0495669_0112499 | 3300046684 | Bacteria | 1272 |
| 1675 | Ga0495669_0556207 | 3300046684 | Bacteria | 558 |
| 1676 | Ga0495613_0343003 | 3300046689 | Unclassified | 1027 |
| 1677 | Ga0495613_0950394 | 3300046689 | Unclassified | 554 |
| 1678 | Ga0495636_0289207 | 3300047318 | Unclassified | 765 |
| 1679 | Ga0495674_0202623 | 3300047319 | Bacteria | 1646 |
| 1680 | Ga0495672_0180552 | 3300047320 | Unclassified | 1069 |
| 1681 | Ga0495676_0639422 | 3300047321 | Unclassified | 691 |
| 1682 | Ga0495680_0304969 | 3300047322 | Unclassified | 1117 |
| 1683 | Ga0495684_0238417 | 3300047471 | Unclassified | 1328 |
| 1684 | Ga0496100_0179322 | 3300048903 | Bacteria | 1531 |
| 1685 | Ga0496100_1157036 | 3300048903 | Unclassified | 610 |
| 1686 | Ga0496102_0335442 | 3300048905 | Bacteria | 1424 |
| 1687 | Ga0496103_0437785 | 3300048906 | Unclassified | 839 |
| 1688 | Ga0496104_0316002 | 3300048907 | Bacteria | 1475 |
| 1689 | Ga0496105_0496595 | 3300048908 | Bacteria | 958 |
| 1690 | Ga0496106_0048317 | 3300048909 | Bacteria | 3205 |
| 1691 | Ga0496106_0686255 | 3300048909 | Bacteria | 817 |
| 1692 | Ga0496107_0542035 | 3300048910 | Bacteria | 862 |
| 1693 | Ga0496107_0730513 | 3300048910 | Bacteria | 727 |
| 1694 | Ga0496108_0369203 | 3300048911 | Unclassified | 1253 |
| 1695 | Ga0496108_0397826 | 3300048911 | Bacteria | 1203 |
| 1696 | Ga0496108_1303888 | 3300048911 | Bacteria | 611 |
| 1697 | Ga0496110_1867855 | 3300048913 | Unclassified | 511 |
| 1698 | Ga0496112_0127939 | 3300048915 | Unclassified | 2511 |
| 1699 | Ga0496112_0887194 | 3300048915 | Bacteria | 814 |
| 1700 | Ga0496112_1648897 | 3300048915 | Unclassified | 554 |
| 1701 | Ga0496112_1764855 | 3300048915 | Unclassified | 531 |
| 1702 | Ga0496113_0693932 | 3300048916 | Unclassified | 813 |
| 1703 | Ga0496113_1188640 | 3300048916 | Unclassified | 596 |
| 1704 | Ga0496113_1435599 | 3300048916 | Bacteria | 534 |
| 1705 | Ga0501306_047967 | 3300049127 | Unclassified | 679 |
| 1706 | Ga0501291_024043 | 3300049514 | Unclassified | 988 |
| 1707 | Ga0501292_005612 | 3300049515 | Unclassified | 1756 |
| 1708 | Ga0501292_109767 | 3300049515 | Unclassified | 554 |
| 1709 | Ga0501296_001466 | 3300049519 | Unclassified | 2395 |
| 1710 | Ga0501296_008296 | 3300049519 | Bacteria | 1201 |
| 1711 | Ga0501297_000547 | 3300049520 | Bacteria | 3402 |
| 1712 | Ga0501298_009494 | 3300049521 | Bacteria | 1657 |
| 1713 | Ga0501299_000445 | 3300049522 | Bacteria | 4895 |
| 1714 | Ga0501299_017318 | 3300049522 | Bacteria | 1284 |
| 1715 | Ga0501302_006596 | 3300049525 | Unclassified | 757 |
| 1716 | Ga0501031_0250921 | 3300049568 | Bacteria | 1150 |
| 1717 | Ga0501038_0002264 | 3300049574 | Bacteria | 17906 |
| 1718 | Ga0501040_0456466 | 3300049576 | Bacteria | 920 |
| 1719 | Ga0501040_1386623 | 3300049576 | Bacteria | 510 |
| 1720 | Ga0501042_1138767 | 3300049578 | Unclassified | 569 |
| 1721 | Ga0501068_1119296 | 3300049584 | Unclassified | 521 |
| 1722 | Ga0501071_0426168 | 3300049587 | Bacteria | 1014 |
| 1723 | Ga0501071_1100341 | 3300049587 | Unclassified | 614 |
| 1724 | Ga0501074_0461150 | 3300049590 | Bacteria | 901 |
| 1725 | Ga0501075_0721590 | 3300049591 | Bacteria | 759 |
| 1726 | Ga0501076_1702648 | 3300049592 | Unclassified | 517 |
| 1727 | Ga0501202_070562 | 3300049652 | Unclassified | 804 |
| 1728 | Ga0501202_082970 | 3300049652 | Unclassified | 756 |
| 1729 | Ga0501206_028358 | 3300049653 | Unclassified | 823 |
| 1730 | Ga0501206_092843 | 3300049653 | Unclassified | 538 |
| 1731 | Ga0501207_003686 | 3300049654 | Bacteria | 2053 |
| 1732 | Ga0501207_010119 | 3300049654 | Bacteria | 1387 |
| 1733 | Ga0501209_261165 | 3300049656 | Unclassified | 542 |
| 1734 | Ga0501216_001484 | 3300049660 | Unclassified | 3170 |
| 1735 | Ga0501216_049063 | 3300049660 | Bacteria | 826 |
| 1736 | Ga0501217_002716 | 3300049661 | Unclassified | 3509 |
| 1737 | Ga0501217_011755 | 3300049661 | Unclassified | 1941 |
| 1738 | Ga0501217_016282 | 3300049661 | Bacteria | 1702 |
| 1739 | Ga0501217_030047 | 3300049661 | Bacteria | 1332 |
| 1740 | Ga0501217_073356 | 3300049661 | Bacteria | 935 |
| 1741 | Ga0501223_000914 | 3300049663 | Bacteria | 6978 |
| 1742 | Ga0501224_008456 | 3300049664 | Bacteria | 1501 |
| 1743 | Ga0501224_009480 | 3300049664 | Unclassified | 1425 |
| 1744 | Ga0501224_012920 | 3300049664 | Bacteria | 1232 |
| 1745 | Ga0501224_028677 | 3300049664 | Unclassified | 833 |
| 1746 | Ga0501227_013007 | 3300049665 | Bacteria | 1828 |
| 1747 | Ga0501227_060935 | 3300049665 | Unclassified | 967 |
| 1748 | Ga0501227_108220 | 3300049665 | Unclassified | 743 |
| 1749 | Ga0501227_223389 | 3300049665 | Bacteria | 536 |
| 1750 | Ga0501228_000957 | 3300049666 | Unclassified | 1989 |
| 1751 | Ga0501230_001733 | 3300049667 | Unclassified | 2657 |
| 1752 | Ga0501230_031522 | 3300049667 | Unclassified | 989 |
| 1753 | Ga0501230_107171 | 3300049667 | Unclassified | 608 |
| 1754 | Ga0501233_000913 | 3300049668 | Unclassified | 4995 |
| 1755 | Ga0501233_001382 | 3300049668 | Bacteria | 4150 |
| 1756 | Ga0501233_010608 | 3300049668 | Bacteria | 1818 |
| 1757 | Ga0501235_004859 | 3300049669 | Bacteria | 2911 |
| 1758 | Ga0501235_007230 | 3300049669 | Archaea | 2422 |
| 1759 | Ga0501235_024707 | 3300049669 | Bacteria | 1342 |
| 1760 | Ga0501235_045912 | 3300049669 | Bacteria | 1005 |
| 1761 | Ga0501235_062601 | 3300049669 | Unclassified | 873 |
| 1762 | Ga0501236_070496 | 3300049670 | Unclassified | 638 |
| 1763 | Ga0501238_025570 | 3300049671 | Unclassified | 846 |
| 1764 | Ga0501239_018589 | 3300049672 | Unclassified | 836 |
| 1765 | Ga0501242_008911 | 3300049674 | Unclassified | 1180 |
| 1766 | Ga0501247_002464 | 3300049677 | Archaea | 1924 |
| 1767 | Ga0501249_003205 | 3300049679 | Archaea | 3295 |
| 1768 | Ga0501249_022689 | 3300049679 | Unclassified | 1375 |
| 1769 | Ga0501249_086269 | 3300049679 | Bacteria | 741 |
| 1770 | Ga0501255_009317 | 3300049684 | Bacteria | 1086 |
| 1771 | Ga0501255_059191 | 3300049684 | Unclassified | 604 |
| 1772 | Ga0501256_001685 | 3300049685 | Bacteria | 1670 |
| 1773 | Ga0501256_008997 | 3300049685 | Unclassified | 937 |
| 1774 | Ga0501257_010091 | 3300049686 | Archaea | 2138 |
| 1775 | Ga0501257_025537 | 3300049686 | Bacteria | 1406 |
| 1776 | Ga0501257_043823 | 3300049686 | Unclassified | 1103 |
| 1777 | Ga0501258_013724 | 3300049687 | Unclassified | 892 |
| 1778 | Ga0501259_007540 | 3300049688 | Bacteria | 1744 |
| 1779 | Ga0501260_001245 | 3300049689 | Bacteria | 2083 |
| 1780 | Ga0501261_002239 | 3300049690 | Unclassified | 2375 |
| 1781 | Ga0501261_061670 | 3300049690 | Unclassified | 638 |
| 1782 | Ga0501219_015825 | 3300049703 | Unclassified | 614 |
| 1783 | Ga0501221_004377 | 3300049704 | Unclassified | 2342 |
| 1784 | Ga0501221_013198 | 3300049704 | Bacteria | 1516 |
| 1785 | Ga0501225_0000533 | 3300049705 | Bacteria | 11907 |
| 1786 | Ga0501225_0006298 | 3300049705 | Unclassified | 3469 |
| 1787 | Ga0501225_0006664 | 3300049705 | Unclassified | 3367 |
| 1788 | Ga0501225_0027023 | 3300049705 | Unclassified | 1579 |
| 1789 | Ga0501225_0077452 | 3300049705 | Unclassified | 951 |
| 1790 | Ga0501234_000103 | 3300049707 | Bacteria | 10792 |
| 1791 | Ga0501234_004496 | 3300049707 | Bacteria | 2191 |
| 1792 | Ga0501234_021066 | 3300049707 | Unclassified | 1038 |
| 1793 | Ga0501245_027776 | 3300049708 | Unclassified | 920 |
| 1794 | Ga0501081_0568735 | 3300049743 | Bacteria | 847 |
| 1795 | Ga0501241_031060 | 3300049758 | Unclassified | 1010 |
| 1796 | Ga0501262_033403 | 3300049759 | Unclassified | 748 |
| 1797 | Ga0501268_005132 | 3300049765 | Unclassified | 1870 |
| 1798 | Ga0501268_055652 | 3300049765 | Bacteria | 774 |
| 1799 | Ga0501270_001352 | 3300049767 | Archaea | 2329 |
| 1800 | Ga0501270_022792 | 3300049767 | Unclassified | 970 |
| 1801 | Ga0501270_069657 | 3300049767 | Unclassified | 677 |
| 1802 | Ga0501272_000807 | 3300049769 | Unclassified | 2845 |
| 1803 | Ga0501273_001458 | 3300049770 | Archaea | 2255 |
| 1804 | Ga0501273_038118 | 3300049770 | Unclassified | 704 |
| 1805 | Ga0501274_027304 | 3300049771 | Unclassified | 626 |
| 1806 | Ga0501276_034898 | 3300049773 | Unclassified | 540 |
| 1807 | Ga0501279_008611 | 3300049775 | Bacteria | 1364 |
| 1808 | Ga0501283_003147 | 3300049779 | Bacteria | 2172 |
| 1809 | Ga0501045_0462498 | 3300049824 | Bacteria | 943 |
| 1810 | Ga0501204_004815 | 3300049850 | Unclassified | 1463 |
| 1811 | Ga0501212_004055 | 3300049851 | Bacteria | 1869 |
| 1812 | Ga0501212_012910 | 3300049851 | Unclassified | 1221 |
| 1813 | Ga0501226_021370 | 3300049853 | Unclassified | 717 |
| 1814 | Ga0501226_029881 | 3300049853 | Unclassified | 617 |
| 1815 | nmdc:mga05p37_1326369_c1 | 3300050507 | Unclassified | 731 |
| 1816 | nmdc:mga05p37_144080_c1 | 3300050507 | Unclassified | 2918 |
| 1817 | nmdc:mga05p37_1550_c1 | 3300050507 | Bacteria | 26715 |
| 1818 | nmdc:mga05p37_175010_c1 | 3300050507 | Unclassified | 2615 |
| 1819 | nmdc:mga05p37_176287_c1 | 3300050507 | Unclassified | 2604 |
| 1820 | nmdc:mga05p37_203665_c1 | 3300050507 | Unclassified | 2395 |
| 1821 | nmdc:mga05p37_257432_c1 | 3300050507 | Bacteria | 2091 |
| 1822 | nmdc:mga09592_105125_c1 | 3300050508 | Bacteria | 2420 |
| 1823 | nmdc:mga09592_133783_c1 | 3300050508 | Unclassified | 2135 |
| 1824 | nmdc:mga09592_1713037_c1 | 3300050508 | Unclassified | 506 |
| 1825 | nmdc:mga09592_287578_c1 | 3300050508 | Bacteria | 1425 |
| 1826 | nmdc:mga09592_448085_c1 | 3300050508 | Bacteria | 1114 |
| 1827 | nmdc:mga09592_500134_c1 | 3300050508 | Bacteria | 1047 |
| 1828 | nmdc:mga09592_794318_c1 | 3300050508 | Unclassified | 801 |
| 1829 | nmdc:mga0qj67_119633_c1 | 3300050509 | Bacteria | 2130 |
| 1830 | nmdc:mga0qj67_19703_c1 | 3300050509 | Bacteria | 5158 |
| 1831 | nmdc:mga0qj67_721058_c1 | 3300050509 | Unclassified | 792 |
| 1832 | nmdc:mga06r32_1421689_c1 | 3300050510 | Unclassified | 635 |
| 1833 | nmdc:mga06r32_160852_c1 | 3300050510 | Bacteria | 2228 |
| 1834 | nmdc:mga06r32_309702_c1 | 3300050510 | Unclassified | 1565 |
| 1835 | nmdc:mga06r32_929707_c1 | 3300050510 | Bacteria | 825 |
| 1836 | nmdc:mga08y16_1131534_c1 | 3300050511 | Unclassified | 757 |
| 1837 | nmdc:mga08y16_1143473_c1 | 3300050511 | Unclassified | 752 |
| 1838 | nmdc:mga08y16_14198_c1 | 3300050511 | Bacteria | 8381 |
| 1839 | nmdc:mga08y16_21530_c1 | 3300050511 | Bacteria | 6807 |
| 1840 | nmdc:mga08y16_233803_c1 | 3300050511 | Bacteria | 1901 |
| 1841 | nmdc:mga08y16_91785_c1 | 3300050511 | Bacteria | 3165 |
| 1842 | nmdc:mga0n895_1000796_c1 | 3300050512 | Unclassified | 817 |
| 1843 | nmdc:mga0n895_1020694_c1 | 3300050512 | Bacteria | 807 |
| 1844 | nmdc:mga0n895_1025419_c1 | 3300050512 | Unclassified | 805 |
| 1845 | nmdc:mga0n895_1098030_c1 | 3300050512 | Unclassified | 773 |
| 1846 | nmdc:mga0n895_1195966_c1 | 3300050512 | Unclassified | 734 |
| 1847 | nmdc:mga0n895_1419271_c1 | 3300050512 | Bacteria | 662 |
| 1848 | nmdc:mga0n895_14374_c1 | 3300050512 | Bacteria | 7186 |
| 1849 | nmdc:mga0n895_146599_c1 | 3300050512 | Bacteria | 2390 |
| 1850 | nmdc:mga0n895_157804_c1 | 3300050512 | Bacteria | 2300 |
| 1851 | nmdc:mga0n895_190141_c1 | 3300050512 | Bacteria | 2084 |
| 1852 | nmdc:mga0n895_22555_c1 | 3300050512 | Bacteria | 5904 |
| 1853 | nmdc:mga0n895_268488_c1 | 3300050512 | Unclassified | 1731 |
| 1854 | nmdc:mga0n895_422547_c1 | 3300050512 | Unclassified | 1347 |
| 1855 | nmdc:mga0n895_547301_c1 | 3300050512 | Bacteria | 1163 |
| 1856 | nmdc:mga0n895_603158_c1 | 3300050512 | Bacteria | 1100 |
| 1857 | nmdc:mga0n895_916310_c1 | 3300050512 | Unclassified | 861 |
| 1858 | nmdc:mga0n895_995488_c1 | 3300050512 | Unclassified | 820 |
| 1859 | nmdc:mga0rr50_265436_c1 | 3300050513 | Unclassified | 1429 |
| 1860 | nmdc:mga0rr50_663509_c1 | 3300050513 | Unclassified | 890 |
| 1861 | nmdc:mga08x19_1934_c1 | 3300050514 | Bacteria | 4074 |
| 1862 | nmdc:mga08x19_504765_c1 | 3300050514 | Bacteria | 854 |
| 1863 | nmdc:mga08x19_517049_c1 | 3300050514 | Bacteria | 843 |
| 1864 | nmdc:mga08x19_638733_c1 | 3300050514 | Unclassified | 755 |
| 1865 | nmdc:mga0a205_104849_c1 | 3300050515 | Unclassified | 2726 |
| 1866 | nmdc:mga0a205_1059515_c1 | 3300050515 | Unclassified | 658 |
| 1867 | nmdc:mga0a205_162022_c1 | 3300050515 | Bacteria | 2133 |
| 1868 | nmdc:mga0a205_164983_c1 | 3300050515 | Bacteria | 2111 |
| 1869 | nmdc:mga0a205_39871_c1 | 3300050515 | Unclassified | 4521 |
| 1870 | nmdc:mga0a205_428450_c1 | 3300050515 | Bacteria | 1184 |
| 1871 | nmdc:mga0a205_438131_c1 | 3300050515 | Bacteria | 1168 |
| 1872 | nmdc:mga0a205_505895_c1 | 3300050515 | Bacteria | 1065 |
| 1873 | nmdc:mga0a205_5706_c1 | 3300050515 | Bacteria | 11216 |
| 1874 | nmdc:mga0a205_575064_c1 | 3300050515 | Bacteria | 981 |
| 1875 | nmdc:mga0a205_631495_c1 | 3300050515 | Bacteria | 923 |
| 1876 | nmdc:mga0a205_648089_c1 | 3300050515 | Unclassified | 908 |
| 1877 | nmdc:mga0a205_717966_c1 | 3300050515 | Bacteria | 849 |
| 1878 | nmdc:mga0a205_869612_c1 | 3300050515 | Unclassified | 748 |
| 1879 | Ga0495601_0587568 | 3300053077 | Unclassified | 715 |
| 1880 | Ga0495619_0442099 | 3300053085 | Unclassified | 897 |
| 1881 | Ga0500566_0195253 | 3300053094 | Bacteria | 1027 |
| 1882 | Ga0500616_0005403 | 3300053153 | Bacteria | 8672 |
| 1883 | Ga0501084_0057400 | 3300054114 | Unclassified | 3258 |
| 1884 | Ga0501084_0627741 | 3300054114 | Unclassified | 907 |
| 1885 | Ga0587066_072192 | 3300059490 | Bacteria | 729 |
| 1886 | Ga0587083_0101657 | 3300059505 | Unclassified | 717 |
| 1887 | Ga0587085_051446 | 3300059506 | Unclassified | 752 |
| 1888 | Ga0587094_055174 | 3300059513 | Unclassified | 683 |
| 1889 | Ga0587062_088234 | 3300059639 | Unclassified | 587 |
| 1890 | Ga0587067_100281 | 3300059640 | Bacteria | 669 |
| 1891 | Ga0587068_132302 | 3300059641 | Bacteria | 550 |
| 1892 | Ga0587069_079635 | 3300059642 | Bacteria | 637 |
| 1893 | Ga0587069_132285 | 3300059642 | Bacteria | 539 |
| 1894 | Ga0587072_145355 | 3300059643 | Unclassified | 569 |
| 1895 | Ga0587076_077303 | 3300059645 | Bacteria | 703 |
| 1896 | Ga0587107_098115 | 3300059652 | Bacteria | 576 |
| 1897 | Ga0587111_0110881 | 3300060346 | Unclassified | 695 |
| 1898 | Ga0501082_0880283 | 3300060353 | Bacteria | 783 |
| 1899 | Ga0157378_12371992 | |||
| 1900 | SwRhRL3b_contig_2606832 | |||
| 1901 | SwRhRL2b_contig_2182236 | |||
| 1902 | SwRhRL2b_contig_2678464 | |||
| 1903 | SwRhRL2b_contig_3329882 | |||
| 1904 | SwRhRL2b_contig_493489 | |||
| 1905 | MBSR1b_contig_13030068 | |||
| 1906 | CNBas_1009198 | |||
| 1907 | CNAas_1000026 | |||
| 1908 | JGI24748J21848_1000007 | |||
| 1909 | JGI24034J26672_10000002 | |||
| 1910 | JGI24742J22300_10097535 | |||
| 1911 | JGI24751J29686_10000017 | |||
| 1912 | JGI25406J46586_10001585 | |||
| 1913 | JGI25406J46586_10038246 | |||
| 1914 | rootL2_10066759 | |||
| 1915 | Ga0065714_10064596 | |||
| 1916 | Ga0065714_10155715 | |||
| 1917 | Ga0065704_10085200 | |||
| 1918 | Ga0065704_10096907 | |||
| 1919 | Ga0065704_10156697 | |||
| 1920 | Ga0065704_10157323 | |||
| 1921 | Ga0065704_10189830 | |||
| 1922 | Ga0065704_10230677 | |||
| 1923 | Ga0065704_10253257 | |||
| 1924 | Ga0065704_10542488 | |||
| 1925 | Ga0065704_10699561 | |||
| 1926 | Ga0065712_10012497 | |||
| 1927 | Ga0065712_10017635 | |||
| 1928 | Ga0065712_10068446 | |||
| 1929 | Ga0065712_10073588 | |||
| 1930 | Ga0065712_10170628 | |||
| 1931 | Ga0065712_10437363 | |||
| 1932 | Ga0065712_10799569 | |||
| 1933 | Ga0065715_10089589 | |||
| 1934 | Ga0065715_10105571 | |||
| 1935 | Ga0065715_10114416 | |||
| 1936 | Ga0065715_10143814 | |||
| 1937 | Ga0065715_10143933 | |||
| 1938 | Ga0065715_10166621 | |||
| 1939 | Ga0065715_10242280 | |||
| 1940 | Ga0065715_10253488 | |||
| 1941 | Ga0065715_10302654 | |||
| 1942 | Ga0065715_10307704 | |||
| 1943 | Ga0065715_10410560 | |||
| 1944 | Ga0065715_10416639 | |||
| 1945 | Ga0065715_10421457 | |||
| 1946 | Ga0065715_10560110 | |||
| 1947 | Ga0065715_10666358 | |||
| 1948 | Ga0065707_10001863 | |||
| 1949 | Ga0065707_10031290 | |||
| 1950 | Ga0065707_10056378 | |||
| 1951 | Ga0065707_10085169 | |||
| 1952 | Ga0065707_10120297 | |||
| 1953 | Ga0065707_10142778 | |||
| 1954 | Ga0065707_10173065 | |||
| 1955 | Ga0065707_10191731 | |||
| 1956 | Ga0065707_10258876 | |||
| 1957 | Ga0065707_10322032 | |||
| 1958 | Ga0065707_10489315 | |||
| 1959 | Ga0065707_10615549 | |||
| 1960 | Ga0065707_10707242 | |||
| 1961 | Ga0070676_10047850 | |||
| 1962 | Ga0070676_10119856 | |||
| 1963 | Ga0070676_11229767 | |||
| 1964 | Ga0070676_11341115 | |||
| 1965 | Ga0070683_100029338 | |||
| 1966 | Ga0070690_100008280 | |||
| 1967 | Ga0070690_100017532 | |||
| 1968 | Ga0070690_100091789 | |||
| 1969 | Ga0070690_100198775 | |||
| 1970 | Ga0070690_100218282 | |||
| 1971 | Ga0070690_100351653 | |||
| 1972 | Ga0070690_100558567 | |||
| 1973 | Ga0070690_100628223 | |||
| 1974 | Ga0070670_100018951 | |||
| 1975 | Ga0070670_100091664 | |||
| 1976 | Ga0070670_100227248 | |||
| 1977 | Ga0070670_100233014 | |||
| 1978 | Ga0070670_100259548 | |||
| 1979 | Ga0070670_100287380 | |||
| 1980 | Ga0070670_100365621 | |||
| 1981 | Ga0070670_100474437 | |||
| 1982 | Ga0070670_100935932 | |||
| 1983 | Ga0070670_101411142 | |||
| 1984 | Ga0070677_10324477 | |||
| 1985 | Ga0068869_100042317 | |||
| 1986 | Ga0068869_100071714 | |||
| 1987 | Ga0068869_100082590 | |||
| 1988 | Ga0068869_100109200 | |||
| 1989 | Ga0068869_100513787 | |||
| 1990 | Ga0068869_100899213 | |||
| 1991 | Ga0068869_100912852 | |||
| 1992 | Ga0068869_100981376 | |||
| 1993 | Ga0068869_101167199 | |||
| 1994 | Ga0068869_101261364 | |||
| 1995 | Ga0068869_101536944 | |||
| 1996 | Ga0070666_10077380 | |||
| 1997 | Ga0070666_10089671 | |||
| 1998 | Ga0070666_10165588 | |||
| 1999 | Ga0070666_10210007 | |||
| 2000 | Ga0070666_11137559 | |||
| 2001 | Ga0070680_100075635 | |||
| 2002 | Ga0070680_100092736 | |||
| 2003 | Ga0070680_100604699 | |||
| 2004 | Ga0070680_101743412 | |||
| 2005 | Ga0070682_100308754 | |||
| 2006 | Ga0070682_100579655 | |||
| 2007 | Ga0068868_100043939 | |||
| 2008 | Ga0068868_100045354 | |||
| 2009 | Ga0068868_100302998 | |||
| 2010 | Ga0068868_100727430 | |||
| 2011 | Ga0068868_101636718 | |||
| 2012 | Ga0068868_102163695 | |||
| 2013 | Ga0070660_100136948 | |||
| 2014 | Ga0070660_100347076 | |||
| 2015 | Ga0070660_100927300 | |||
| 2016 | Ga0070689_100048155 | |||
| 2017 | Ga0070689_100114116 | |||
| 2018 | Ga0070689_100182392 | |||
| 2019 | Ga0070689_100612400 | |||
| 2020 | Ga0070689_100792098 | |||
| 2021 | Ga0070689_100801047 | |||
| 2022 | Ga0070689_100915224 | |||
| 2023 | Ga0070689_100976095 | |||
| 2024 | Ga0070689_101231086 | |||
| 2025 | Ga0070689_101261497 | |||
| 2026 | Ga0070689_101379984 | |||
| 2027 | Ga0070689_101798378 | |||
| 2028 | Ga0070691_10058073 | |||
| 2029 | Ga0070691_10466935 | |||
| 2030 | Ga0070687_100024091 | |||
| 2031 | Ga0070687_100025782 | |||
| 2032 | Ga0070687_100070835 | |||
| 2033 | Ga0070687_100084954 | |||
| 2034 | Ga0070687_100413834 | |||
| 2035 | Ga0070687_100432701 | |||
| 2036 | Ga0070687_100644176 | |||
| 2037 | Ga0070687_101247132 | |||
| 2038 | Ga0070661_100009109 | |||
| 2039 | Ga0070661_100277369 | |||
| 2040 | Ga0070661_100377622 | |||
| 2041 | Ga0070661_100584649 | |||
| 2042 | Ga0070661_100879594 | |||
| 2043 | Ga0070661_100899954 | |||
| 2044 | Ga0070661_101068651 | |||
| 2045 | Ga0070661_101608780 | |||
| 2046 | Ga0070692_10057713 | |||
| 2047 | Ga0070692_10074545 | |||
| 2048 | Ga0070692_10103987 | |||
| 2049 | Ga0070692_10141869 | |||
| 2050 | Ga0070692_10152704 | |||
| 2051 | Ga0070692_10423875 | |||
| 2052 | Ga0070692_10569979 | |||
| 2053 | Ga0070692_11066994 | |||
| 2054 | Ga0070668_100022818 | |||
| 2055 | Ga0070668_100102868 | |||
| 2056 | Ga0070668_100902224 | |||
| 2057 | Ga0070669_100001947 | |||
| 2058 | Ga0070669_100008114 | |||
| 2059 | Ga0070669_100011425 | |||
| 2060 | Ga0070669_100013610 | |||
| 2061 | Ga0070669_100214875 | |||
| 2062 | Ga0070669_101094149 | |||
| 2063 | Ga0070669_101176012 | |||
| 2064 | Ga0070669_101301904 | |||
| 2065 | Ga0070675_100219024 | |||
| 2066 | Ga0070675_100340379 | |||
| 2067 | Ga0070675_100420842 | |||
| 2068 | Ga0070675_100580437 | |||
| 2069 | Ga0070675_100867426 | |||
| 2070 | Ga0070675_101832422 | |||
| 2071 | Ga0070671_100001256 | |||
| 2072 | Ga0070671_100007418 | |||
| 2073 | Ga0070671_100098235 | |||
| 2074 | Ga0070671_100106170 | |||
| 2075 | Ga0070671_100175034 | |||
| 2076 | Ga0070671_100190022 | |||
| 2077 | Ga0070674_100165824 | |||
| 2078 | Ga0070674_100355874 | |||
| 2079 | Ga0070674_101989599 | |||
| 2080 | Ga0070673_100004450 | |||
| 2081 | Ga0070673_100109455 | |||
| 2082 | Ga0070673_100114359 | |||
| 2083 | Ga0070673_100149071 | |||
| 2084 | Ga0070673_100241304 | |||
| 2085 | Ga0070673_100405270 | |||
| 2086 | Ga0070673_100469880 | |||
| 2087 | Ga0070673_101120566 | |||
| 2088 | Ga0070673_101364789 | |||
| 2089 | Ga0070673_101510124 | |||
| 2090 | Ga0070673_101511025 | |||
| 2091 | Ga0070673_101885102 | |||
| 2092 | Ga0070673_102010185 | |||
| 2093 | Ga0070673_102129758 | |||
| 2094 | Ga0070688_100023832 | |||
| 2095 | Ga0070688_100552373 | |||
| 2096 | Ga0070688_100938862 | |||
| 2097 | Ga0070659_100015215 | |||
| 2098 | Ga0070659_100082434 | |||
| 2099 | Ga0070659_100133946 | |||
| 2100 | Ga0070659_100291319 | |||
| 2101 | Ga0070659_100831866 | |||
| 2102 | Ga0070667_100015535 | |||
| 2103 | Ga0070667_100072731 | |||
| 2104 | Ga0070703_10001368 | |||
| 2105 | Ga0070703_10068408 | |||
| 2106 | Ga0070703_10275264 | |||
| 2107 | Ga0070709_11005617 | |||
| 2108 | Ga0070709_11325766 | |||
| 2109 | Ga0070709_11785012 | |||
| 2110 | Ga0070710_11135714 | |||
| 2111 | Ga0070701_10116203 | |||
| 2112 | Ga0070701_10141915 | |||
| 2113 | Ga0070701_10341047 | |||
| 2114 | Ga0070705_100016905 | |||
| 2115 | Ga0070705_100022103 | |||
| 2116 | Ga0070705_100033199 | |||
| 2117 | Ga0070705_100115914 | |||
| 2118 | Ga0070705_100391981 | |||
| 2119 | Ga0070705_100454282 | |||
| 2120 | Ga0070705_100584473 | |||
| 2121 | Ga0070705_100643677 | |||
| 2122 | Ga0070705_100877628 | |||
| 2123 | Ga0070705_100886461 | |||
| 2124 | Ga0070705_101494769 | |||
| 2125 | Ga0070705_101709442 | |||
| 2126 | Ga0070705_101888888 | |||
| 2127 | Ga0070700_100008091 | |||
| 2128 | Ga0070700_100021298 | |||
| 2129 | Ga0070700_100035918 | |||
| 2130 | Ga0070700_100077203 | |||
| 2131 | Ga0070700_100121005 | |||
| 2132 | Ga0070700_100183930 | |||
| 2133 | Ga0070700_100309882 | |||
| 2134 | Ga0070700_100503396 | |||
| 2135 | Ga0070700_100625860 | |||
| 2136 | Ga0070700_100925504 | |||
| 2137 | Ga0070700_101029313 | |||
| 2138 | Ga0070694_100006114 | |||
| 2139 | Ga0070694_100017025 | |||
| 2140 | Ga0070694_100017068 | |||
| 2141 | Ga0070694_100030850 | |||
| 2142 | Ga0070694_100066429 | |||
| 2143 | Ga0070694_100069673 | |||
| 2144 | Ga0070694_100088638 | |||
| 2145 | Ga0070694_100110123 | |||
| 2146 | Ga0070694_100211432 | |||
| 2147 | Ga0070694_100233892 | |||
| 2148 | Ga0070694_100248390 | |||
| 2149 | Ga0070694_100265475 | |||
| 2150 | Ga0070694_100282232 | |||
| 2151 | Ga0070694_100374061 | |||
| 2152 | Ga0070694_100407346 | |||
| 2153 | Ga0070694_100482870 | |||
| 2154 | Ga0070694_100564772 | |||
| 2155 | Ga0070694_100617349 | |||
| 2156 | Ga0070694_100707529 | |||
| 2157 | Ga0070694_100722399 | |||
| 2158 | Ga0070694_100791916 | |||
| 2159 | Ga0070694_100893024 | |||
| 2160 | Ga0070694_100928613 | |||
| 2161 | Ga0070694_101188352 | |||
| 2162 | Ga0070708_100001683 | |||
| 2163 | Ga0070708_100151043 | |||
| 2164 | Ga0070708_100188649 | |||
| 2165 | Ga0070708_100539072 | |||
| 2166 | Ga0070708_100712104 | |||
| 2167 | Ga0070708_100751763 | |||
| 2168 | Ga0070663_100523728 | |||
| 2169 | Ga0070678_100027941 | |||
| 2170 | Ga0070678_100209385 | |||
| 2171 | Ga0070678_100376056 | |||
| 2172 | Ga0070678_100494588 | |||
| 2173 | Ga0070678_101082263 | |||
| 2174 | Ga0070662_100077443 | |||
| 2175 | Ga0070662_100088200 | |||
| 2176 | Ga0070662_100188953 | |||
| 2177 | Ga0070662_100295795 | |||
| 2178 | Ga0070662_100368913 | |||
| 2179 | Ga0070662_100378086 | |||
| 2180 | Ga0070662_100481658 | |||
| 2181 | Ga0070662_100513138 | |||
| 2182 | Ga0070662_101001034 | |||
| 2183 | Ga0070662_101615268 | |||
| 2184 | Ga0070681_10000417 | |||
| 2185 | Ga0070681_10005337 | |||
| 2186 | Ga0070681_10006520 | |||
| 2187 | Ga0070681_10017987 | |||
| 2188 | Ga0070681_10130732 | |||
| 2189 | Ga0068867_100020741 | |||
| 2190 | Ga0068867_100090267 | |||
| 2191 | Ga0068867_100113031 | |||
| 2192 | Ga0068867_100143720 | |||
| 2193 | Ga0068867_100777683 | |||
| 2194 | Ga0068867_101020617 | |||
| 2195 | Ga0068867_101032110 | |||
| 2196 | Ga0068867_101130278 | |||
| 2197 | Ga0070685_10042338 | |||
| 2198 | Ga0070685_10210118 | |||
| 2199 | Ga0070706_100000088 | |||
| 2200 | Ga0070706_100002494 | |||
| 2201 | Ga0070706_100003757 | |||
| 2202 | Ga0070706_100010028 | |||
| 2203 | Ga0070706_100048296 | |||
| 2204 | Ga0070706_100060959 | |||
| 2205 | Ga0070706_100127468 | |||
| 2206 | Ga0070706_100132548 | |||
| 2207 | Ga0070706_100217672 | |||
| 2208 | Ga0070706_100672474 | |||
| 2209 | Ga0070706_100897812 | |||
| 2210 | Ga0070706_100987091 | |||
| 2211 | Ga0070706_101487867 | |||
| 2212 | Ga0070706_101962829 | |||
| 2213 | Ga0070707_100001325 | |||
| 2214 | Ga0070707_100008179 | |||
| 2215 | Ga0070707_100014868 | |||
| 2216 | Ga0070707_100070878 | |||
| 2217 | Ga0070707_100133757 | |||
| 2218 | Ga0070707_100142361 | |||
| 2219 | Ga0070707_100477753 | |||
| 2220 | Ga0070707_100555056 | |||
| 2221 | Ga0070707_100645870 | |||
| 2222 | Ga0070707_100707100 | |||
| 2223 | Ga0070707_100912847 | |||
| 2224 | Ga0070698_100007026 | |||
| 2225 | Ga0070698_100007616 | |||
| 2226 | Ga0070698_100022051 | |||
| 2227 | Ga0070698_100030847 | |||
| 2228 | Ga0070698_100061585 | |||
| 2229 | Ga0070698_100077625 | |||
| 2230 | Ga0070698_100078648 | |||
| 2231 | Ga0070698_100159275 | |||
| 2232 | Ga0070698_100570912 | |||
| 2233 | Ga0070698_100740749 | |||
| 2234 | Ga0070698_101590068 | |||
| 2235 | Ga0070699_100003262 | |||
| 2236 | Ga0070699_100007628 | |||
| 2237 | Ga0070699_100026044 | |||
| 2238 | Ga0070699_100047431 | |||
| 2239 | Ga0070699_100054211 | |||
| 2240 | Ga0070699_100175910 | |||
| 2241 | Ga0070699_100207918 | |||
| 2242 | Ga0070699_100290595 | |||
| 2243 | Ga0070699_100403511 | |||
| 2244 | Ga0070699_100696042 | |||
| 2245 | Ga0070699_100723489 | |||
| 2246 | Ga0070679_100000797 | |||
| 2247 | Ga0070679_100001091 | |||
| 2248 | Ga0070679_100159214 | |||
| 2249 | Ga0070684_100263437 | |||
| 2250 | Ga0070684_100500613 | |||
| 2251 | Ga0070684_100633784 | |||
| 2252 | Ga0070684_100698411 | |||
| 2253 | Ga0070697_100000155 | |||
| 2254 | Ga0070697_100000205 | |||
| 2255 | Ga0070697_100010667 | |||
| 2256 | Ga0070697_100012364 | |||
| 2257 | Ga0070697_100102832 | |||
| 2258 | Ga0070697_100135478 | |||
| 2259 | Ga0070697_100166061 | |||
| 2260 | Ga0070697_100182354 | |||
| 2261 | Ga0070697_100188907 | |||
| 2262 | Ga0070697_100196973 | |||
| 2263 | Ga0070697_100213928 | |||
| 2264 | Ga0070697_100277376 | |||
| 2265 | Ga0070697_100317819 | |||
| 2266 | Ga0070697_100420130 | |||
| 2267 | Ga0070697_100454809 | |||
| 2268 | Ga0068853_100002482 | |||
| 2269 | Ga0068853_100009445 | |||
| 2270 | Ga0068853_100019123 | |||
| 2271 | Ga0068853_100047228 | |||
| 2272 | Ga0068853_100055959 | |||
| 2273 | Ga0068853_100386123 | |||
| 2274 | Ga0068853_101415176 | |||
| 2275 | Ga0068853_101631827 | |||
| 2276 | Ga0070672_100014398 | |||
| 2277 | Ga0070672_100077694 | |||
| 2278 | Ga0070672_100693715 | |||
| 2279 | Ga0070672_100731410 | |||
| 2280 | Ga0070672_100961588 | |||
| 2281 | Ga0070686_100001133 | |||
| 2282 | Ga0070686_100069827 | |||
| 2283 | Ga0070686_100098136 | |||
| 2284 | Ga0070686_100108160 | |||
| 2285 | Ga0070686_100125175 | |||
| 2286 | Ga0070686_100160897 | |||
| 2287 | Ga0070686_100313995 | |||
| 2288 | Ga0070686_100543088 | |||
| 2289 | Ga0070686_100960797 | |||
| 2290 | Ga0070695_100079556 | |||
| 2291 | Ga0070695_100080896 | |||
| 2292 | Ga0070695_100095384 | |||
| 2293 | Ga0070695_100111594 | |||
| 2294 | Ga0070695_100175514 | |||
| 2295 | Ga0070695_100176264 | |||
| 2296 | Ga0070695_100179168 | |||
| 2297 | Ga0070695_100187823 | |||
| 2298 | Ga0070695_100274574 | |||
| 2299 | Ga0070695_100281472 | |||
| 2300 | Ga0070695_100354240 | |||
| 2301 | Ga0070695_101108870 | |||
| 2302 | Ga0070695_101361126 | |||
| 2303 | Ga0070696_100019932 | |||
| 2304 | Ga0070696_100023964 | |||
| 2305 | Ga0070696_100040232 | |||
| 2306 | Ga0070696_100063781 | |||
| 2307 | Ga0070696_100120767 | |||
| 2308 | Ga0070696_100237954 | |||
| 2309 | Ga0070696_100321041 | |||
| 2310 | Ga0070696_100456591 | |||
| 2311 | Ga0070696_100550746 | |||
| 2312 | Ga0070696_100602912 | |||
| 2313 | Ga0070696_100673846 | |||
| 2314 | Ga0070696_100786969 | |||
| 2315 | Ga0070696_101000354 | |||
| 2316 | Ga0070696_101051317 | |||
| 2317 | Ga0070696_101594424 | |||
| 2318 | Ga0070693_100001027 | |||
| 2319 | Ga0070693_100020106 | |||
| 2320 | Ga0070693_100040618 | |||
| 2321 | Ga0070693_100120448 | |||
| 2322 | Ga0070693_100146133 | |||
| 2323 | Ga0070693_100161362 | |||
| 2324 | Ga0070693_100231616 | |||
| 2325 | Ga0070693_100234541 | |||
| 2326 | Ga0070693_100260436 | |||
| 2327 | Ga0070693_100325100 | |||
| 2328 | Ga0070693_100356585 | |||
| 2329 | Ga0070693_100512654 | |||
| 2330 | Ga0070693_100805751 | |||
| 2331 | Ga0070665_102232576 | |||
| 2332 | Ga0070665_102537069 | |||
| 2333 | Ga0070704_100000638 | |||
| 2334 | Ga0070704_100011390 | |||
| 2335 | Ga0070704_100055340 | |||
| 2336 | Ga0070704_100094157 | |||
| 2337 | Ga0070704_100134596 | |||
| 2338 | Ga0070704_100142336 | |||
| 2339 | Ga0070704_100192071 | |||
| 2340 | Ga0070704_100225477 | |||
| 2341 | Ga0070704_100245537 | |||
| 2342 | Ga0070704_100298268 | |||
| 2343 | Ga0070704_100372851 | |||
| 2344 | Ga0070704_100407869 | |||
| 2345 | Ga0070704_100468200 | |||
| 2346 | Ga0070704_100529797 | |||
| 2347 | Ga0070704_101010391 | |||
| 2348 | Ga0070704_101043703 | |||
| 2349 | Ga0070704_101186742 | |||
| 2350 | Ga0070704_101386499 | |||
| 2351 | Ga0070704_101872853 | |||
| 2352 | Ga0070704_102225550 | |||
| 2353 | Ga0068855_100082116 | |||
| 2354 | Ga0068855_100123812 | |||
| 2355 | Ga0068855_101158766 | |||
| 2356 | Ga0070664_100001593 | |||
| 2357 | Ga0070664_100019348 | |||
| 2358 | Ga0070664_100034374 | |||
| 2359 | Ga0070664_100110606 | |||
| 2360 | Ga0070664_100219134 | |||
| 2361 | Ga0070664_100250658 | |||
| 2362 | Ga0070664_100258816 | |||
| 2363 | Ga0070664_100295084 | |||
| 2364 | Ga0070664_100832186 | |||
| 2365 | Ga0070664_100865431 | |||
| 2366 | Ga0070664_100908978 | |||
| 2367 | Ga0070664_101192161 | |||
| 2368 | Ga0070664_102184821 | |||
| 2369 | Ga0068857_100007456 | |||
| 2370 | Ga0068857_100162531 | |||
| 2371 | Ga0068857_100238232 | |||
| 2372 | Ga0068857_100334645 | |||
| 2373 | Ga0068857_100592349 | |||
| 2374 | Ga0068857_100707492 | |||
| 2375 | Ga0068857_100841467 | |||
| 2376 | Ga0068857_100977441 | |||
| 2377 | Ga0068857_100979100 | |||
| 2378 | Ga0068857_101937024 | |||
| 2379 | Ga0068854_100066991 | |||
| 2380 | Ga0068854_100165762 | |||
| 2381 | Ga0068854_100222826 | |||
| 2382 | Ga0068854_100247555 | |||
| 2383 | Ga0068854_100309976 | |||
| 2384 | Ga0068854_100339251 | |||
| 2385 | Ga0068854_100506345 | |||
| 2386 | Ga0068854_100595120 | |||
| 2387 | Ga0068854_100596486 | |||
| 2388 | Ga0068854_100605661 | |||
| 2389 | Ga0068854_100619376 | |||
| 2390 | Ga0068854_100741171 | |||
| 2391 | Ga0068854_100814971 | |||
| 2392 | Ga0068854_100935980 | |||
| 2393 | Ga0068854_101577272 | |||
| 2394 | Ga0068854_102254851 | |||
| 2395 | Ga0068856_100013790 | |||
| 2396 | Ga0068856_100377881 | |||
| 2397 | Ga0070702_100008168 | |||
| 2398 | Ga0070702_100083104 | |||
| 2399 | Ga0070702_100151910 | |||
| 2400 | Ga0070702_100154024 | |||
| 2401 | Ga0070702_100155020 | |||
| 2402 | Ga0070702_100165177 | |||
| 2403 | Ga0070702_100276673 | |||
| 2404 | Ga0070702_100308442 | |||
| 2405 | Ga0070702_100453731 | |||
| 2406 | Ga0070702_100968627 | |||
| 2407 | Ga0070702_100990839 | |||
| 2408 | Ga0070702_101279812 | |||
| 2409 | Ga0068852_100108736 | |||
| 2410 | Ga0068852_100178412 | |||
| 2411 | Ga0068852_101241939 | |||
| 2412 | Ga0068852_101669583 | |||
| 2413 | Ga0068852_102264094 | |||
| 2414 | Ga0068852_102352623 | |||
| 2415 | Ga0068859_100020868 | |||
| 2416 | Ga0068859_100021421 | |||
| 2417 | Ga0068859_100024568 | |||
| 2418 | Ga0068859_100044736 | |||
| 2419 | Ga0068859_100055086 | |||
| 2420 | Ga0068859_100070562 | |||
| 2421 | Ga0068859_100078004 | |||
| 2422 | Ga0068859_100105980 | |||
| 2423 | Ga0068859_100149850 | |||
| 2424 | Ga0068859_100200803 | |||
| 2425 | Ga0068859_100409209 | |||
| 2426 | Ga0068859_100647282 | |||
| 2427 | Ga0068859_100810856 | |||
| 2428 | Ga0068859_100880916 | |||
| 2429 | Ga0068859_101080165 | |||
| 2430 | Ga0068859_101094391 | |||
| 2431 | Ga0068859_101170504 | |||
| 2432 | Ga0068859_101186725 | |||
| 2433 | Ga0068859_101193960 | |||
| 2434 | Ga0068859_101416941 | |||
| 2435 | Ga0068859_101513282 | |||
| 2436 | Ga0068859_101688571 | |||
| 2437 | Ga0068859_102262714 | |||
| 2438 | Ga0068859_102373410 | |||
| 2439 | Ga0068864_100005538 | |||
| 2440 | Ga0068864_100008111 | |||
| 2441 | Ga0068864_100040762 | |||
| 2442 | Ga0068864_100075005 | |||
| 2443 | Ga0068864_100078291 | |||
| 2444 | Ga0068864_100172601 | |||
| 2445 | Ga0068864_100181671 | |||
| 2446 | Ga0068864_100195558 | |||
| 2447 | Ga0068864_100203478 | |||
| 2448 | Ga0068864_100213940 | |||
| 2449 | Ga0068864_100484924 | |||
| 2450 | Ga0068864_100577812 | |||
| 2451 | Ga0068864_100701912 | |||
| 2452 | Ga0068864_100791383 | |||
| 2453 | Ga0068864_100866677 | |||
| 2454 | Ga0068864_100876566 | |||
| 2455 | Ga0068864_101218471 | |||
| 2456 | Ga0068864_101344206 | |||
| 2457 | Ga0068864_101398182 | |||
| 2458 | Ga0068864_101634005 | |||
| 2459 | Ga0068864_102149785 | |||
| 2460 | Ga0068864_102654219 | |||
| 2461 | Ga0068866_10009446 | |||
| 2462 | Ga0068866_10041764 | |||
| 2463 | Ga0068866_10130772 | |||
| 2464 | Ga0068866_10419960 | |||
| 2465 | Ga0068861_100014138 | |||
| 2466 | Ga0068861_100018961 | |||
| 2467 | Ga0068861_100032844 | |||
| 2468 | Ga0068861_100077072 | |||
| 2469 | Ga0068861_100120200 | |||
| 2470 | Ga0068861_100158909 | |||
| 2471 | Ga0068861_100562295 | |||
| 2472 | Ga0068861_100588512 | |||
| 2473 | Ga0068861_100647537 | |||
| 2474 | Ga0068861_101095075 | |||
| 2475 | Ga0068861_101856969 | |||
| 2476 | Ga0068861_102404359 | |||
| 2477 | Ga0068851_10002483 | |||
| 2478 | Ga0068851_10028961 | |||
| 2479 | Ga0068851_10049073 | |||
| 2480 | Ga0068851_10079733 | |||
| 2481 | Ga0068851_10505632 | |||
| 2482 | Ga0068851_10572181 | |||
| 2483 | Ga0068870_10046463 | |||
| 2484 | Ga0068870_10674555 | |||
| 2485 | Ga0068870_10762924 | |||
| 2486 | Ga0068870_11154119 | |||
| 2487 | Ga0068863_100009282 | |||
| 2488 | Ga0068863_100084843 | |||
| 2489 | Ga0068863_100086830 | |||
| 2490 | Ga0068863_100217664 | |||
| 2491 | Ga0068863_100274825 | |||
| 2492 | Ga0068863_100533521 | |||
| 2493 | Ga0068863_100609941 | |||
| 2494 | Ga0068863_100735823 | |||
| 2495 | Ga0068863_101359847 | |||
| 2496 | Ga0068863_101359910 | |||
| 2497 | Ga0068863_101743218 | |||
| 2498 | Ga0068863_101748588 | |||
| 2499 | Ga0068863_101753752 | |||
| 2500 | Ga0068863_102608383 | |||
| 2501 | Ga0068858_100000008 | |||
| 2502 | Ga0068858_100065422 | |||
| 2503 | Ga0068858_100123156 | |||
| 2504 | Ga0068858_100165722 | |||
| 2505 | Ga0068858_100170948 | |||
| 2506 | Ga0068858_100185912 | |||
| 2507 | Ga0068858_100191906 | |||
| 2508 | Ga0068858_100210695 | |||
| 2509 | Ga0068858_100312237 | |||
| 2510 | Ga0068858_100322088 | |||
| 2511 | Ga0068858_100341351 | |||
| 2512 | Ga0068858_100343091 | |||
| 2513 | Ga0068858_100550737 | |||
| 2514 | Ga0068858_101372634 | |||
| 2515 | Ga0068858_101462873 | |||
| 2516 | Ga0068858_102471235 | |||
| 2517 | Ga0068860_100003829 | |||
| 2518 | Ga0068860_100043301 | |||
| 2519 | Ga0068860_100058850 | |||
| 2520 | Ga0068860_100217941 | |||
| 2521 | Ga0068860_100342031 | |||
| 2522 | Ga0068860_100369436 | |||
| 2523 | Ga0068860_100388239 | |||
| 2524 | Ga0068860_100391879 | |||
| 2525 | Ga0068860_100408955 | |||
| 2526 | Ga0068860_100426055 | |||
| 2527 | Ga0068860_100461606 | |||
| 2528 | Ga0068860_100680614 | |||
| 2529 | Ga0068860_100831712 | |||
| 2530 | Ga0068860_100931421 | |||
| 2531 | Ga0068860_101281397 | |||
| 2532 | Ga0068860_101549482 | |||
| 2533 | Ga0068862_100035327 | |||
| 2534 | Ga0068862_100053564 | |||
| 2535 | Ga0068862_100099686 | |||
| 2536 | Ga0068862_100184254 | |||
| 2537 | Ga0068862_100289776 | |||
| 2538 | Ga0068862_100290383 | |||
| 2539 | Ga0068862_100300121 | |||
| 2540 | Ga0068862_100396312 | |||
| 2541 | Ga0068862_100535922 | |||
| 2542 | Ga0068862_101307084 | |||
| 2543 | Ga0068862_101996785 | |||
| 2544 | Ga0081455_10127815 | |||
| 2545 | Ga0081455_10827037 | |||
| 2546 | Ga0081455_11012794 | |||
| 2547 | Ga0081540_1269884 | |||
| 2548 | Ga0081539_10000043 | |||
| 2549 | Ga0081539_10000239 | |||
| 2550 | Ga0081539_10002560 | |||
| 2551 | Ga0081539_10005773 | |||
| 2552 | Ga0081539_10036660 | |||
| 2553 | Ga0081539_10063712 | |||
| 2554 | Ga0081539_10148326 | |||
| 2555 | Ga0081539_10179901 | |||
| 2556 | Ga0075432_10174576 | |||
| 2557 | Ga0075432_10183566 | |||
| 2558 | Ga0070715_10000031 | |||
| 2559 | Ga0070716_100000007 | |||
| 2560 | Ga0070716_100061133 | |||
| 2561 | Ga0070716_100285362 | |||
| 2562 | Ga0070716_100489502 | |||
| 2563 | Ga0070716_100944288 | |||
| 2564 | Ga0070716_101129837 | |||
| 2565 | Ga0097621_100014473 | |||
| 2566 | Ga0097621_100060925 | |||
| 2567 | Ga0097621_100428458 | |||
| 2568 | Ga0097621_100574052 | |||
| 2569 | Ga0097621_100955395 | |||
| 2570 | Ga0097621_101410234 | |||
| 2571 | Ga0097621_101607677 | |||
| 2572 | Ga0097621_101747823 | |||
| 2573 | Ga0097621_101810270 | |||
| 2574 | Ga0068871_100006157 | |||
| 2575 | Ga0068871_100040428 | |||
| 2576 | Ga0068871_100123033 | |||
| 2577 | Ga0068871_100679826 | |||
| 2578 | Ga0068871_100741079 | |||
| 2579 | Ga0068871_100901505 | |||
| 2580 | Ga0068871_102057804 | |||
| 2581 | Ga0075428_100096869 | |||
| 2582 | Ga0075428_100312649 | |||
| 2583 | Ga0075428_100418959 | |||
| 2584 | Ga0075428_101013906 | |||
| 2585 | Ga0075430_100003709 | |||
| 2586 | Ga0075430_100105376 | |||
| 2587 | Ga0075430_101081017 | |||
| 2588 | Ga0075431_100081177 | |||
| 2589 | Ga0075431_100171647 | |||
| 2590 | Ga0075431_100481551 | |||
| 2591 | Ga0075433_10026566 | |||
| 2592 | Ga0075433_10053141 | |||
| 2593 | Ga0075433_10058232 | |||
| 2594 | Ga0075433_10097408 | |||
| 2595 | Ga0075433_10114233 | |||
| 2596 | Ga0075433_10226243 | |||
| 2597 | Ga0075433_10278613 | |||
| 2598 | Ga0075433_10299111 | |||
| 2599 | Ga0075433_10299625 | |||
| 2600 | Ga0075433_10327671 | |||
| 2601 | Ga0075433_11580798 | |||
| 2602 | Ga0075433_11774185 | |||
| 2603 | Ga0075434_100024264 | |||
| 2604 | Ga0075434_100034748 | |||
| 2605 | Ga0075434_100156176 | |||
| 2606 | Ga0075434_100188880 | |||
| 2607 | Ga0075434_100206533 | |||
| 2608 | Ga0075434_100626936 | |||
| 2609 | Ga0075434_100652546 | |||
| 2610 | Ga0075434_100714577 | |||
| 2611 | Ga0075434_100735773 | |||
| 2612 | Ga0075434_100827760 | |||
| 2613 | Ga0075434_101243069 | |||
| 2614 | Ga0075434_101444314 | |||
| 2615 | Ga0075429_100026020 | |||
| 2616 | Ga0075429_100086629 | |||
| 2617 | Ga0075429_100141042 | |||
| 2618 | Ga0075429_100196712 | |||
| 2619 | Ga0075429_100828955 | |||
| 2620 | Ga0068865_100009576 | |||
| 2621 | Ga0068865_100115107 | |||
| 2622 | Ga0068865_100510628 | |||
| 2623 | Ga0068865_100520236 | |||
| 2624 | Ga0068865_100636443 | |||
| 2625 | Ga0075436_100004844 | |||
| 2626 | Ga0075436_100386245 | |||
| 2627 | Ga0075436_100467569 | |||
| 2628 | Ga0097620_100020867 | |||
| 2629 | Ga0097620_100021422 | |||
| 2630 | Ga0097620_100024569 | |||
| 2631 | Ga0097620_100044738 | |||
| 2632 | Ga0097620_100055085 | |||
| 2633 | Ga0097620_100070551 | |||
| 2634 | Ga0097620_100078008 | |||
| 2635 | Ga0097620_100105979 | |||
| 2636 | Ga0097620_100149849 | |||
| 2637 | Ga0097620_100200811 | |||
| 2638 | Ga0097620_100409196 | |||
| 2639 | Ga0097620_100647395 | |||
| 2640 | Ga0097620_100810747 | |||
| 2641 | Ga0097620_100880927 | |||
| 2642 | Ga0097620_101080110 | |||
| 2643 | Ga0097620_101094318 | |||
| 2644 | Ga0097620_101170489 | |||
| 2645 | Ga0097620_101186737 | |||
| 2646 | Ga0097620_101193644 | |||
| 2647 | Ga0097620_101417009 | |||
| 2648 | Ga0097620_101513451 | |||
| 2649 | Ga0097620_101688563 | |||
| 2650 | Ga0097620_102262809 | |||
| 2651 | Ga0097620_102373448 | |||
| 2652 | Ga0075435_100049727 | |||
| 2653 | Ga0075435_100276935 | |||
| 2654 | Ga0075435_100351385 | |||
| 2655 | Ga0075435_100598677 | |||
| 2656 | Ga0075435_100842691 | |||
| 2657 | Ga0099794_10022132 | |||
| 2658 | Ga0099794_10086451 | |||
| 2659 | Ga0105251_10081845 | |||
| 2660 | Ga0105250_10032491 | |||
| 2661 | Ga0105250_10182539 | |||
| 2662 | Ga0105250_10189845 | |||
| 2663 | Ga0105240_10027411 | |||
| 2664 | Ga0105240_10218903 | |||
| 2665 | Ga0105240_10221618 | |||
| 2666 | Ga0105240_10658693 | |||
| 2667 | Ga0105240_10685529 | |||
| 2668 | Ga0105240_11626371 | |||
| 2669 | Ga0111539_10010730 | |||
| 2670 | Ga0111539_10013968 | |||
| 2671 | Ga0111539_10034502 | |||
| 2672 | Ga0111539_10107492 | |||
| 2673 | Ga0111539_10125939 | |||
| 2674 | Ga0111539_10197686 | |||
| 2675 | Ga0111539_10380973 | |||
| 2676 | Ga0111539_10678434 | |||
| 2677 | Ga0111539_10895653 | |||
| 2678 | Ga0111539_11235102 | |||
| 2679 | Ga0111539_12066229 | |||
| 2680 | Ga0111539_13067422 | |||
| 2681 | Ga0105245_10008532 | |||
| 2682 | Ga0105245_10358338 | |||
| 2683 | Ga0105245_10594437 | |||
| 2684 | Ga0105245_10793083 | |||
| 2685 | Ga0105245_10870528 | |||
| 2686 | Ga0105245_11028032 | |||
| 2687 | Ga0105245_11262982 | |||
| 2688 | Ga0105245_11482143 | |||
| 2689 | Ga0105245_11650060 | |||
| 2690 | Ga0105245_12089003 | |||
| 2691 | Ga0105247_10000001 | |||
| 2692 | Ga0105247_10081690 | |||
| 2693 | Ga0105247_10138873 | |||
| 2694 | Ga0105247_10587115 | |||
| 2695 | Ga0105247_10661824 | |||
| 2696 | Ga0105247_10890298 | |||
| 2697 | Ga0105247_11337822 | |||
| 2698 | Ga0114129_10005476 | |||
| 2699 | Ga0114129_10017890 | |||
| 2700 | Ga0114129_10045834 | |||
| 2701 | Ga0114129_10047639 | |||
| 2702 | Ga0114129_10090358 | |||
| 2703 | Ga0114129_10213209 | |||
| 2704 | Ga0114129_10300892 | |||
| 2705 | Ga0114129_10309907 | |||
| 2706 | Ga0114129_10355984 | |||
| 2707 | Ga0114129_10363965 | |||
| 2708 | Ga0114129_11119729 | |||
| 2709 | Ga0114129_11126702 | |||
| 2710 | Ga0114129_11345260 | |||
| 2711 | Ga0114129_11626177 | |||
| 2712 | Ga0114129_12156744 | |||
| 2713 | Ga0114129_13180303 | |||
| 2714 | Ga0105243_10000119 | |||
| 2715 | Ga0105243_10004942 | |||
| 2716 | Ga0105243_10013322 | |||
| 2717 | Ga0105243_10289445 | |||
| 2718 | Ga0105243_10301522 | |||
| 2719 | Ga0105243_10333732 | |||
| 2720 | Ga0105243_10476201 | |||
| 2721 | Ga0105243_10619094 | |||
| 2722 | Ga0105243_10696301 | |||
| 2723 | Ga0105243_11006211 | |||
| 2724 | Ga0105243_11100562 | |||
| 2725 | Ga0105243_11151742 | |||
| 2726 | Ga0105243_11414661 | |||
| 2727 | Ga0105243_12782872 | |||
| 2728 | Ga0105243_12976424 | |||
| 2729 | Ga0105241_10102859 | |||
| 2730 | Ga0105241_10106832 | |||
| 2731 | Ga0105241_10176274 | |||
| 2732 | Ga0105241_10192225 | |||
| 2733 | Ga0105241_10304048 | |||
| 2734 | Ga0105241_10317024 | |||
| 2735 | Ga0105241_10349401 | |||
| 2736 | Ga0105241_10485403 | |||
| 2737 | Ga0105241_10524953 | |||
| 2738 | Ga0105241_10665552 | |||
| 2739 | Ga0105241_10678226 | |||
| 2740 | Ga0105241_10871033 | |||
| 2741 | Ga0105241_11204664 | |||
| 2742 | Ga0105241_11536491 | |||
| 2743 | Ga0105241_11614081 | |||
| 2744 | Ga0105241_11713988 | |||
| 2745 | Ga0105242_10000113 | |||
| 2746 | Ga0105242_10004299 | |||
| 2747 | Ga0105242_10010627 | |||
| 2748 | Ga0105242_10067704 | |||
| 2749 | Ga0105242_10107097 | |||
| 2750 | Ga0105242_10231377 | |||
| 2751 | Ga0105242_10260890 | |||
| 2752 | Ga0105242_10472962 | |||
| 2753 | Ga0105242_10543083 | |||
| 2754 | Ga0105242_10842674 | |||
| 2755 | Ga0105242_11193069 | |||
| 2756 | Ga0105242_11645709 | |||
| 2757 | Ga0105242_11994581 | |||
| 2758 | Ga0105242_12247748 | |||
| 2759 | Ga0105242_13263700 | |||
| 2760 | Ga0105248_10062642 | |||
| 2761 | Ga0105248_10071853 | |||
| 2762 | Ga0105248_10072593 | |||
| 2763 | Ga0105248_10098050 | |||
| 2764 | Ga0105248_10103880 | |||
| 2765 | Ga0105248_10150142 | |||
| 2766 | Ga0105248_10173620 | |||
| 2767 | Ga0105248_10195936 | |||
| 2768 | Ga0105248_10269984 | |||
| 2769 | Ga0105248_10390234 | |||
| 2770 | Ga0105248_10409461 | |||
| 2771 | Ga0105248_10541022 | |||
| 2772 | Ga0105248_10578011 | |||
| 2773 | Ga0105248_10607460 | |||
| 2774 | Ga0105248_10683283 | |||
| 2775 | Ga0105248_10956220 | |||
| 2776 | Ga0105248_11129214 | |||
| 2777 | Ga0105248_11206862 | |||
| 2778 | Ga0105248_11228766 | |||
| 2779 | Ga0105248_11328425 | |||
| 2780 | Ga0105248_11394873 | |||
| 2781 | Ga0105248_11558213 | |||
| 2782 | Ga0105248_12775589 | |||
| 2783 | Ga0105248_12805905 | |||
| 2784 | Ga0105237_10011061 | |||
| 2785 | Ga0105237_10056051 | |||
| 2786 | Ga0105237_10066585 | |||
| 2787 | Ga0105237_10118503 | |||
| 2788 | Ga0105237_10535835 | |||
| 2789 | Ga0105237_11224785 | |||
| 2790 | Ga0105237_12222892 | |||
| 2791 | Ga0105238_10030053 | |||
| 2792 | Ga0105238_10467445 | |||
| 2793 | Ga0105238_10719923 | |||
| 2794 | Ga0105238_10913464 | |||
| 2795 | Ga0105238_12342741 | |||
| 2796 | Ga0105249_10000028 | |||
| 2797 | Ga0105249_10014015 | |||
| 2798 | Ga0105249_10020461 | |||
| 2799 | Ga0105249_10023248 | |||
| 2800 | Ga0105249_10234655 | |||
| 2801 | Ga0105249_10253672 | |||
| 2802 | Ga0105249_10629744 | |||
| 2803 | Ga0105249_10758768 | |||
| 2804 | Ga0105249_11007524 | |||
| 2805 | Ga0105249_11027243 | |||
| 2806 | Ga0105249_11612003 | |||
| 2807 | Ga0105249_11903286 | |||
| 2808 | Ga0105249_12467153 | |||
| 2809 | Ga0105249_13235024 | |||
| 2810 | Ga0099796_10128767 | |||
| 2811 | Ga0105239_10030724 | |||
| 2812 | Ga0105239_10107358 | |||
| 2813 | Ga0105239_10289529 | |||
| 2814 | Ga0105239_10369153 | |||
| 2815 | Ga0105239_10387134 | |||
| 2816 | Ga0105239_10718499 | |||
| 2817 | Ga0105239_10909736 | |||
| 2818 | Ga0105239_10919300 | |||
| 2819 | Ga0105239_11159379 | |||
| 2820 | Ga0105239_11253958 | |||
| 2821 | Ga0105239_11357612 | |||
| 2822 | Ga0105239_12531326 | |||
| 2823 | Ga0105239_12691519 | |||
| 2824 | Ga0105239_12832121 | |||
| 2825 | Ga0105246_10064958 | |||
| 2826 | Ga0105246_10069042 | |||
| 2827 | Ga0105246_10090250 | |||
| 2828 | Ga0105246_10205060 | |||
| 2829 | Ga0105246_10214471 | |||
| 2830 | Ga0105246_10621912 | |||
| 2831 | Ga0105246_10770518 | |||
| 2832 | Ga0105246_11162328 | |||
| 2833 | Ga0105246_12047319 | |||
| 2834 | Ga0105246_12203546 | |||
| 2835 | Ga0105246_12297149 | |||
| 2836 | Ga0157373_10062746 | |||
| 2837 | Ga0157373_10095110 | |||
| 2838 | Ga0157373_10103340 | |||
| 2839 | Ga0157373_10110346 | |||
| 2840 | Ga0157373_10123296 | |||
| 2841 | Ga0157373_10178303 | |||
| 2842 | Ga0157373_10340319 | |||
| 2843 | Ga0157371_10090052 | |||
| 2844 | Ga0157371_11009403 | |||
| 2845 | Ga0157371_11145118 | |||
| 2846 | Ga0157371_11234129 | |||
| 2847 | Ga0157370_10072475 | |||
| 2848 | Ga0157370_10171697 | |||
| 2849 | Ga0157370_10311572 | |||
| 2850 | Ga0157369_10092662 | |||
| 2851 | Ga0157369_10152829 | |||
| 2852 | Ga0157369_11178088 | |||
| 2853 | Ga0157374_10090602 | |||
| 2854 | Ga0157374_10198619 | |||
| 2855 | Ga0157374_10520036 | |||
| 2856 | Ga0157374_11183740 | |||
| 2857 | Ga0157374_12026151 | |||
| 2858 | Ga0157378_10000163 | |||
| 2859 | Ga0157378_10001554 | |||
| 2860 | Ga0157378_10008355 | |||
| 2861 | Ga0157378_10034190 | |||
| 2862 | Ga0157378_10050951 | |||
| 2863 | Ga0157378_10071515 | |||
| 2864 | Ga0157378_10083656 | |||
| 2865 | Ga0157378_10141412 | |||
| 2866 | Ga0157378_10154516 | |||
| 2867 | Ga0157378_10176542 | |||
| 2868 | Ga0157378_10276191 | |||
| 2869 | Ga0157378_10369683 | |||
| 2870 | Ga0157378_10372735 | |||
| 2871 | Ga0157378_10403538 | |||
| 2872 | Ga0157378_10694019 | |||
| 2873 | Ga0157378_10879809 | |||
| 2874 | Ga0157378_11328606 | |||
| 2875 | Ga0157378_11332982 | |||
| 2876 | Ga0157378_11487946 | |||
| 2877 | Ga0157378_11505329 | |||
| 2878 | Ga0157378_11856754 | |||
| 2879 | Ga0157378_13088911 | |||
| 2880 | Ga0157378_13118554 | |||
| 2881 | Ga0163162_10000027 | |||
| 2882 | Ga0163162_10001557 | |||
| 2883 | Ga0163162_10001819 | |||
| 2884 | Ga0163162_10013469 | |||
| 2885 | Ga0163162_10097421 | |||
| 2886 | Ga0163162_10105237 | |||
| 2887 | Ga0163162_10245321 | |||
| 2888 | Ga0163162_10246809 | |||
| 2889 | Ga0163162_10252071 | |||
| 2890 | Ga0163162_10832755 | |||
| 2891 | Ga0163162_11154320 | |||
| 2892 | Ga0163162_11452240 | |||
| 2893 | Ga0163162_11550111 | |||
| 2894 | Ga0163162_12296345 | |||
| 2895 | Ga0163162_12313769 | |||
| 2896 | Ga0163162_12365236 | |||
| 2897 | Ga0163162_12784382 | |||
| 2898 | Ga0163162_13098200 | |||
| 2899 | Ga0157372_10022333 | |||
| 2900 | Ga0157372_10048333 | |||
| 2901 | Ga0157372_10061654 | |||
| 2902 | Ga0157372_10067477 | |||
| 2903 | Ga0157372_10212217 | |||
| 2904 | Ga0157372_10258165 | |||
| 2905 | Ga0157372_10382096 | |||
| 2906 | Ga0157372_10552124 | |||
| 2907 | Ga0157372_10798386 | |||
| 2908 | Ga0157372_10920488 | |||
| 2909 | Ga0157372_11170491 | |||
| 2910 | Ga0157372_11250813 | |||
| 2911 | Ga0157372_11476518 | |||
| 2912 | Ga0157372_11538492 | |||
| 2913 | Ga0157372_11603615 | |||
| 2914 | Ga0157372_11621976 | |||
| 2915 | Ga0157372_12290610 | |||
| 2916 | Ga0157375_10127326 | |||
| 2917 | Ga0157375_10149716 | |||
| 2918 | Ga0157375_10180319 | |||
| 2919 | Ga0157375_10234970 | |||
| 2920 | Ga0157375_10422077 | |||
| 2921 | Ga0157375_10728102 | |||
| 2922 | Ga0157375_10907609 | |||
| 2923 | Ga0157375_11029304 | |||
| 2924 | Ga0157375_11056874 | |||
| 2925 | Ga0157375_11107456 | |||
| 2926 | Ga0157375_11265361 | |||
| 2927 | Ga0157375_11533538 | |||
| 2928 | Ga0157375_12921044 | |||
| 2929 | Ga0163163_10009872 | |||
| 2930 | Ga0163163_10023334 | |||
| 2931 | Ga0163163_10028121 | |||
| 2932 | Ga0163163_10047001 | |||
| 2933 | Ga0163163_10069074 | |||
| 2934 | Ga0163163_10074742 | |||
| 2935 | Ga0163163_10173703 | |||
| 2936 | Ga0163163_10194128 | |||
| 2937 | Ga0163163_10219841 | |||
| 2938 | Ga0163163_10382573 | |||
| 2939 | Ga0163163_10590841 | |||
| 2940 | Ga0163163_10747604 | |||
| 2941 | Ga0163163_10920304 | |||
| 2942 | Ga0163163_10971526 | |||
| 2943 | Ga0163163_11082087 | |||
| 2944 | Ga0163163_11369727 | |||
| 2945 | Ga0163163_11462368 | |||
| 2946 | Ga0163163_11576416 | |||
| 2947 | Ga0163163_12025065 | |||
| 2948 | Ga0163163_12197803 | |||
| 2949 | Ga0163163_12896893 | |||
| 2950 | Ga0157380_10001451 | |||
| 2951 | Ga0157380_10002205 | |||
| 2952 | Ga0157380_10024802 | |||
| 2953 | Ga0157380_10043883 | |||
| 2954 | Ga0157380_10097636 | |||
| 2955 | Ga0157380_10111079 | |||
| 2956 | Ga0157380_10318596 | |||
| 2957 | Ga0157380_10416654 | |||
| 2958 | Ga0157380_11106312 | |||
| 2959 | Ga0157380_11325256 | |||
| 2960 | Ga0157380_12370458 | |||
| 2961 | Ga0157380_12649011 | |||
| 2962 | Ga0157380_12728529 | |||
| 2963 | Ga0157380_13484822 | |||
| 2964 | Ga0182008_10194375 | |||
| 2965 | Ga0182008_10215041 | |||
| 2966 | Ga0157377_10084179 | |||
| 2967 | Ga0157377_10136532 | |||
| 2968 | Ga0157377_10158760 | |||
| 2969 | Ga0157377_10278711 | |||
| 2970 | Ga0157377_10283269 | |||
| 2971 | Ga0157377_10342555 | |||
| 2972 | Ga0157377_10876027 | |||
| 2973 | Ga0157377_11193498 | |||
| 2974 | Ga0157379_10042678 | |||
| 2975 | Ga0157379_10073922 | |||
| 2976 | Ga0157379_10077774 | |||
| 2977 | Ga0157379_10451939 | |||
| 2978 | Ga0157379_10769566 | |||
| 2979 | Ga0157379_10858370 | |||
| 2980 | Ga0157379_10935016 | |||
| 2981 | Ga0157379_11183837 | |||
| 2982 | Ga0157379_11387027 | |||
| 2983 | Ga0157379_11865313 | |||
| 2984 | Ga0157376_10011187 | |||
| 2985 | Ga0157376_10406943 | |||
| 2986 | Ga0157376_10474687 | |||
| 2987 | Ga0182005_1041260 | |||
| 2988 | Ga0163161_10005583 | |||
| 2989 | Ga0163161_10010405 | |||
| 2990 | Ga0163161_10025611 | |||
| 2991 | Ga0163161_10231932 | |||
| 2992 | Ga0163161_10446788 | |||
| 2993 | Ga0163161_10516072 | |||
| 2994 | Ga0163161_11219518 | |||
| 2995 | Ga0213876_10000102 | |||
| 2996 | Ga0213876_10000277 | |||
| 2997 | Ga0207697_10009354 | |||
| 2998 | Ga0207697_10037174 | |||
| 2999 | Ga0207656_10016582 | |||
| 3000 | Ga0207656_10155106 | |||
| 3001 | Ga0207713_1142031 | |||
| 3002 | Ga0207653_10000948 | |||
| 3003 | Ga0207682_10049097 | |||
| 3004 | Ga0207682_10169765 | |||
| 3005 | Ga0207642_10002306 | |||
| 3006 | Ga0207642_10022160 | |||
| 3007 | Ga0207642_10272013 | |||
| 3008 | Ga0207710_10000003 | |||
| 3009 | Ga0207710_10024784 | |||
| 3010 | Ga0207710_10048922 | |||
| 3011 | Ga0207710_10112482 | |||
| 3012 | Ga0207710_10180533 | |||
| 3013 | Ga0207710_10352063 | |||
| 3014 | Ga0207710_10475166 | |||
| 3015 | Ga0207688_10266886 | |||
| 3016 | Ga0207680_10067934 | |||
| 3017 | Ga0207680_10069536 | |||
| 3018 | Ga0207647_10001815 | |||
| 3019 | Ga0207647_10094662 | |||
| 3020 | Ga0207647_10107490 | |||
| 3021 | Ga0207685_10000007 | |||
| 3022 | Ga0207699_10855810 | |||
| 3023 | Ga0207699_11338716 | |||
| 3024 | Ga0207645_10064242 | |||
| 3025 | Ga0207645_10176216 | |||
| 3026 | Ga0207645_10830273 | |||
| 3027 | Ga0207643_10009763 | |||
| 3028 | Ga0207643_10057712 | |||
| 3029 | Ga0207643_10101088 | |||
| 3030 | Ga0207643_10109604 | |||
| 3031 | Ga0207643_10436908 | |||
| 3032 | Ga0207643_10787016 | |||
| 3033 | Ga0207643_10868303 | |||
| 3034 | Ga0207684_10000170 | |||
| 3035 | Ga0207684_10019633 | |||
| 3036 | Ga0207684_10036958 | |||
| 3037 | Ga0207684_10086334 | |||
| 3038 | Ga0207684_10093579 | |||
| 3039 | Ga0207684_10103112 | |||
| 3040 | Ga0207684_10200233 | |||
| 3041 | Ga0207684_10259931 | |||
| 3042 | Ga0207684_10419270 | |||
| 3043 | Ga0207654_10005182 | |||
| 3044 | Ga0207654_10110418 | |||
| 3045 | Ga0207654_10190310 | |||
| 3046 | Ga0207654_10218601 | |||
| 3047 | Ga0207654_10340484 | |||
| 3048 | Ga0207654_10410130 | |||
| 3049 | Ga0207654_10781507 | |||
| 3050 | Ga0207654_10977504 | |||
| 3051 | Ga0207654_11223755 | |||
| 3052 | Ga0207707_10000015 | |||
| 3053 | Ga0207707_10008748 | |||
| 3054 | Ga0207707_10015435 | |||
| 3055 | Ga0207707_10113718 | |||
| 3056 | Ga0207707_10178413 | |||
| 3057 | Ga0207695_10224757 | |||
| 3058 | Ga0207695_10534985 | |||
| 3059 | Ga0207695_10569196 | |||
| 3060 | Ga0207695_10894480 | |||
| 3061 | Ga0207695_10959196 | |||
| 3062 | Ga0207695_11230326 | |||
| 3063 | Ga0207671_10000958 | |||
| 3064 | Ga0207671_10210336 | |||
| 3065 | Ga0207671_10413585 | |||
| 3066 | Ga0207671_10440118 | |||
| 3067 | Ga0207663_11207957 | |||
| 3068 | Ga0207660_10001103 | |||
| 3069 | Ga0207660_10010882 | |||
| 3070 | Ga0207660_10079617 | |||
| 3071 | Ga0207660_10772129 | |||
| 3072 | Ga0207662_10002814 | |||
| 3073 | Ga0207662_10033436 | |||
| 3074 | Ga0207662_10043959 | |||
| 3075 | Ga0207662_10059477 | |||
| 3076 | Ga0207662_10104004 | |||
| 3077 | Ga0207662_10195794 | |||
| 3078 | Ga0207662_10284955 | |||
| 3079 | Ga0207662_10334641 | |||
| 3080 | Ga0207662_10364492 | |||
| 3081 | Ga0207662_10380098 | |||
| 3082 | Ga0207662_10698942 | |||
| 3083 | Ga0207657_10546050 | |||
| 3084 | Ga0207657_10689536 | |||
| 3085 | Ga0207649_10040447 | |||
| 3086 | Ga0207649_10044914 | |||
| 3087 | Ga0207649_10143064 | |||
| 3088 | Ga0207649_10316372 | |||
| 3089 | Ga0207649_10560789 | |||
| 3090 | Ga0207649_11120229 | |||
| 3091 | Ga0207649_11470604 | |||
| 3092 | Ga0207652_10000252 | |||
| 3093 | Ga0207652_10988215 | |||
| 3094 | Ga0207646_10003914 | |||
| 3095 | Ga0207646_10049029 | |||
| 3096 | Ga0207646_10063422 | |||
| 3097 | Ga0207646_10079652 | |||
| 3098 | Ga0207646_10124291 | |||
| 3099 | Ga0207646_10584162 | |||
| 3100 | Ga0207646_10854790 | |||
| 3101 | Ga0207681_10005772 | |||
| 3102 | Ga0207681_10006488 | |||
| 3103 | Ga0207681_10022095 | |||
| 3104 | Ga0207681_10036809 | |||
| 3105 | Ga0207681_10113375 | |||
| 3106 | Ga0207681_10563264 | |||
| 3107 | Ga0207681_10694335 | |||
| 3108 | Ga0207681_10800936 | |||
| 3109 | Ga0207681_11069120 | |||
| 3110 | Ga0207681_11238412 | |||
| 3111 | Ga0207681_11304117 | |||
| 3112 | Ga0207694_10004960 | |||
| 3113 | Ga0207694_10068494 | |||
| 3114 | Ga0207650_10000005 | |||
| 3115 | Ga0207650_10001694 | |||
| 3116 | Ga0207650_10047533 | |||
| 3117 | Ga0207650_10114046 | |||
| 3118 | Ga0207650_10118649 | |||
| 3119 | Ga0207650_10180046 | |||
| 3120 | Ga0207650_10257644 | |||
| 3121 | Ga0207650_10316409 | |||
| 3122 | Ga0207650_10403790 | |||
| 3123 | Ga0207650_10498050 | |||
| 3124 | Ga0207650_10543558 | |||
| 3125 | Ga0207650_10633926 | |||
| 3126 | Ga0207650_10775976 | |||
| 3127 | Ga0207659_10373815 | |||
| 3128 | Ga0207659_10459101 | |||
| 3129 | Ga0207659_10568740 | |||
| 3130 | Ga0207659_11032480 | |||
| 3131 | Ga0207659_11083540 | |||
| 3132 | Ga0207687_10133222 | |||
| 3133 | Ga0207687_10841384 | |||
| 3134 | Ga0207687_10886191 | |||
| 3135 | Ga0207687_11317472 | |||
| 3136 | Ga0207644_10000209 | |||
| 3137 | Ga0207644_10007515 | |||
| 3138 | Ga0207644_10018688 | |||
| 3139 | Ga0207644_10077140 | |||
| 3140 | Ga0207644_10224780 | |||
| 3141 | Ga0207644_10330400 | |||
| 3142 | Ga0207690_10094122 | |||
| 3143 | Ga0207690_10165270 | |||
| 3144 | Ga0207690_10202760 | |||
| 3145 | Ga0207690_11130193 | |||
| 3146 | Ga0207690_11469818 | |||
| 3147 | Ga0207706_10068958 | |||
| 3148 | Ga0207706_10089618 | |||
| 3149 | Ga0207706_10240155 | |||
| 3150 | Ga0207706_10319637 | |||
| 3151 | Ga0207706_10409390 | |||
| 3152 | Ga0207706_11365577 | |||
| 3153 | Ga0207686_10000114 | |||
| 3154 | Ga0207686_10000400 | |||
| 3155 | Ga0207686_10006928 | |||
| 3156 | Ga0207686_10019085 | |||
| 3157 | Ga0207686_10026180 | |||
| 3158 | Ga0207686_10031105 | |||
| 3159 | Ga0207686_10075397 | |||
| 3160 | Ga0207686_10450241 | |||
| 3161 | Ga0207686_10662521 | |||
| 3162 | Ga0207686_11257672 | |||
| 3163 | Ga0207709_10000162 | |||
| 3164 | Ga0207709_10002929 | |||
| 3165 | Ga0207709_10058798 | |||
| 3166 | Ga0207709_10334193 | |||
| 3167 | Ga0207709_10398188 | |||
| 3168 | Ga0207709_10427051 | |||
| 3169 | Ga0207709_10787701 | |||
| 3170 | Ga0207709_10821343 | |||
| 3171 | Ga0207670_10036048 | |||
| 3172 | Ga0207670_10070067 | |||
| 3173 | Ga0207670_10393594 | |||
| 3174 | Ga0207670_10396242 | |||
| 3175 | Ga0207670_10603808 | |||
| 3176 | Ga0207670_10738278 | |||
| 3177 | Ga0207670_11443971 | |||
| 3178 | Ga0207670_11836590 | |||
| 3179 | Ga0207669_10284224 | |||
| 3180 | Ga0207669_11581955 | |||
| 3181 | Ga0207704_10080963 | |||
| 3182 | Ga0207704_10444825 | |||
| 3183 | Ga0207704_10519736 | |||
| 3184 | Ga0207704_10744986 | |||
| 3185 | Ga0207665_10000018 | |||
| 3186 | Ga0207665_10047602 | |||
| 3187 | Ga0207665_10126614 | |||
| 3188 | Ga0207665_10182251 | |||
| 3189 | Ga0207665_10265017 | |||
| 3190 | Ga0207665_10478505 | |||
| 3191 | Ga0207665_10958669 | |||
| 3192 | Ga0207691_10005480 | |||
| 3193 | Ga0207691_10011710 | |||
| 3194 | Ga0207691_10221603 | |||
| 3195 | Ga0207691_10283457 | |||
| 3196 | Ga0207691_11035407 | |||
| 3197 | Ga0207691_11065415 | |||
| 3198 | Ga0207711_10004919 | |||
| 3199 | Ga0207711_10044927 | |||
| 3200 | Ga0207711_10054983 | |||
| 3201 | Ga0207711_10101440 | |||
| 3202 | Ga0207711_10108714 | |||
| 3203 | Ga0207711_10192914 | |||
| 3204 | Ga0207711_10365493 | |||
| 3205 | Ga0207711_10436521 | |||
| 3206 | Ga0207711_10475339 | |||
| 3207 | Ga0207711_10523454 | |||
| 3208 | Ga0207711_10828604 | |||
| 3209 | Ga0207711_11959275 | |||
| 3210 | Ga0207689_10004566 | |||
| 3211 | Ga0207689_10037086 | |||
| 3212 | Ga0207689_10057085 | |||
| 3213 | Ga0207689_10065176 | |||
| 3214 | Ga0207689_10251785 | |||
| 3215 | Ga0207689_10262503 | |||
| 3216 | Ga0207689_10556010 | |||
| 3217 | Ga0207689_10680662 | |||
| 3218 | Ga0207689_10767911 | |||
| 3219 | Ga0207689_10818446 | |||
| 3220 | Ga0207689_10894665 | |||
| 3221 | Ga0207689_11066735 | |||
| 3222 | Ga0207661_10431236 | |||
| 3223 | Ga0207679_10007735 | |||
| 3224 | Ga0207679_10049367 | |||
| 3225 | Ga0207679_10068310 | |||
| 3226 | Ga0207679_10095263 | |||
| 3227 | Ga0207679_10587018 | |||
| 3228 | Ga0207679_10647977 | |||
| 3229 | Ga0207679_10716643 | |||
| 3230 | Ga0207679_11034252 | |||
| 3231 | Ga0207679_11060397 | |||
| 3232 | Ga0207679_11256571 | |||
| 3233 | Ga0207679_11792415 | |||
| 3234 | Ga0207667_10036979 | |||
| 3235 | Ga0207667_10150953 | |||
| 3236 | Ga0207667_10543477 | |||
| 3237 | Ga0207667_10574190 | |||
| 3238 | Ga0207667_11021183 | |||
| 3239 | Ga0207651_10012707 | |||
| 3240 | Ga0207651_10030462 | |||
| 3241 | Ga0207651_10108245 | |||
| 3242 | Ga0207651_10145698 | |||
| 3243 | Ga0207651_10260360 | |||
| 3244 | Ga0207651_10326001 | |||
| 3245 | Ga0207651_10331965 | |||
| 3246 | Ga0207651_10410654 | |||
| 3247 | Ga0207651_10710345 | |||
| 3248 | Ga0207651_10986522 | |||
| 3249 | Ga0207651_11793364 | |||
| 3250 | Ga0207651_11837560 | |||
| 3251 | Ga0207712_10000110 | |||
| 3252 | Ga0207712_10012290 | |||
| 3253 | Ga0207712_10017368 | |||
| 3254 | Ga0207712_10021709 | |||
| 3255 | Ga0207712_10121896 | |||
| 3256 | Ga0207712_10238367 | |||
| 3257 | Ga0207712_10257828 | |||
| 3258 | Ga0207712_10523236 | |||
| 3259 | Ga0207712_10538632 | |||
| 3260 | Ga0207712_10622259 | |||
| 3261 | Ga0207712_10922584 | |||
| 3262 | Ga0207668_10015518 | |||
| 3263 | Ga0207668_10483142 | |||
| 3264 | Ga0207640_10209869 | |||
| 3265 | Ga0207640_10227447 | |||
| 3266 | Ga0207640_10391746 | |||
| 3267 | Ga0207640_10422111 | |||
| 3268 | Ga0207640_10439666 | |||
| 3269 | Ga0207640_10581708 | |||
| 3270 | Ga0207640_11244336 | |||
| 3271 | Ga0207640_11990223 | |||
| 3272 | Ga0207658_10196267 | |||
| 3273 | Ga0207658_10808428 | |||
| 3274 | Ga0207677_10030542 | |||
| 3275 | Ga0207677_10144422 | |||
| 3276 | Ga0207677_10221622 | |||
| 3277 | Ga0207677_10410939 | |||
| 3278 | Ga0207677_10614925 | |||
| 3279 | Ga0207677_11572603 | |||
| 3280 | Ga0207677_12081629 | |||
| 3281 | Ga0207703_10000354 | |||
| 3282 | Ga0207703_10030675 | |||
| 3283 | Ga0207703_10045085 | |||
| 3284 | Ga0207703_10057479 | |||
| 3285 | Ga0207703_10105027 | |||
| 3286 | Ga0207703_10280311 | |||
| 3287 | Ga0207703_10468992 | |||
| 3288 | Ga0207703_10884731 | |||
| 3289 | Ga0207703_10950271 | |||
| 3290 | Ga0207703_10958384 | |||
| 3291 | Ga0207703_10972656 | |||
| 3292 | Ga0207703_11296928 | |||
| 3293 | Ga0207703_11304613 | |||
| 3294 | Ga0207703_11485294 | |||
| 3295 | Ga0207703_11553978 | |||
| 3296 | Ga0207703_11603271 | |||
| 3297 | Ga0207639_10022288 | |||
| 3298 | Ga0207639_10029011 | |||
| 3299 | Ga0207639_10067826 | |||
| 3300 | Ga0207639_10120554 | |||
| 3301 | Ga0207639_10212778 | |||
| 3302 | Ga0207639_10381317 | |||
| 3303 | Ga0207639_10736273 | |||
| 3304 | Ga0207639_10863911 | |||
| 3305 | Ga0207639_11023959 | |||
| 3306 | Ga0207639_11136222 | |||
| 3307 | Ga0207678_11540782 | |||
| 3308 | Ga0207708_10000043 | |||
| 3309 | Ga0207708_10008562 | |||
| 3310 | Ga0207708_10080486 | |||
| 3311 | Ga0207708_10091884 | |||
| 3312 | Ga0207708_10098786 | |||
| 3313 | Ga0207708_10116230 | |||
| 3314 | Ga0207708_10177441 | |||
| 3315 | Ga0207708_10178691 | |||
| 3316 | Ga0207708_10951789 | |||
| 3317 | Ga0207702_10009027 | |||
| 3318 | Ga0207702_12077363 | |||
| 3319 | Ga0207641_10042907 | |||
| 3320 | Ga0207641_10043453 | |||
| 3321 | Ga0207641_10072372 | |||
| 3322 | Ga0207641_10177448 | |||
| 3323 | Ga0207641_10399291 | |||
| 3324 | Ga0207641_10439481 | |||
| 3325 | Ga0207641_10490034 | |||
| 3326 | Ga0207641_10665904 | |||
| 3327 | Ga0207641_10792588 | |||
| 3328 | Ga0207641_11085107 | |||
| 3329 | Ga0207641_11932658 | |||
| 3330 | Ga0207641_12117418 | |||
| 3331 | Ga0207648_10013061 | |||
| 3332 | Ga0207648_10069732 | |||
| 3333 | Ga0207648_10293972 | |||
| 3334 | Ga0207648_10378199 | |||
| 3335 | Ga0207648_10391305 | |||
| 3336 | Ga0207648_10396564 | |||
| 3337 | Ga0207648_10424307 | |||
| 3338 | Ga0207648_10536464 | |||
| 3339 | Ga0207648_10595373 | |||
| 3340 | Ga0207648_10640379 | |||
| 3341 | Ga0207648_10667869 | |||
| 3342 | Ga0207648_10827179 | |||
| 3343 | Ga0207648_11060720 | |||
| 3344 | Ga0207648_11123060 | |||
| 3345 | Ga0207676_10002979 | |||
| 3346 | Ga0207676_10005890 | |||
| 3347 | Ga0207676_10008806 | |||
| 3348 | Ga0207676_10022931 | |||
| 3349 | Ga0207676_10044217 | |||
| 3350 | Ga0207676_10062217 | |||
| 3351 | Ga0207676_10080889 | |||
| 3352 | Ga0207676_10137391 | |||
| 3353 | Ga0207676_10179796 | |||
| 3354 | Ga0207676_10429136 | |||
| 3355 | Ga0207676_10567109 | |||
| 3356 | Ga0207676_10607355 | |||
| 3357 | Ga0207676_10724123 | |||
| 3358 | Ga0207676_11165434 | |||
| 3359 | Ga0207676_11189402 | |||
| 3360 | Ga0207676_11331360 | |||
| 3361 | Ga0207676_11401262 | |||
| 3362 | Ga0207676_11409525 | |||
| 3363 | Ga0207676_11427061 | |||
| 3364 | Ga0207676_12365990 | |||
| 3365 | Ga0207674_10005214 | |||
| 3366 | Ga0207674_10036996 | |||
| 3367 | Ga0207674_10119573 | |||
| 3368 | Ga0207674_10119925 | |||
| 3369 | Ga0207674_10237703 | |||
| 3370 | Ga0207674_10238337 | |||
| 3371 | Ga0207674_10284283 | |||
| 3372 | Ga0207674_10750537 | |||
| 3373 | Ga0207674_11100217 | |||
| 3374 | Ga0207675_100001995 | |||
| 3375 | Ga0207675_100002789 | |||
| 3376 | Ga0207675_100019390 | |||
| 3377 | Ga0207675_100059323 | |||
| 3378 | Ga0207675_100084649 | |||
| 3379 | Ga0207675_100186975 | |||
| 3380 | Ga0207675_100369775 | |||
| 3381 | Ga0207675_100446338 | |||
| 3382 | Ga0207675_100668915 | |||
| 3383 | Ga0207675_100782754 | |||
| 3384 | Ga0207675_100817740 | |||
| 3385 | Ga0207683_10032905 | |||
| 3386 | Ga0207683_10232608 | |||
| 3387 | Ga0207683_10243667 | |||
| 3388 | Ga0207683_10468141 | |||
| 3389 | Ga0207683_11229718 | |||
| 3390 | Ga0207698_10181654 | |||
| 3391 | Ga0207698_10608367 | |||
| 3392 | Ga0207698_10680470 | |||
| 3393 | Ga0207698_10828684 | |||
| 3394 | Ga0207698_11145649 | |||
| 3395 | Ga0207698_11177691 | |||
| 3396 | Ga0207698_12464915 | |||
| 3397 | Ga0209588_1012747 | |||
| 3398 | Ga0209998_10075284 | |||
| 3399 | Ga0207428_10065696 | |||
| 3400 | Ga0207428_10070786 | |||
| 3401 | Ga0207428_10657281 | |||
| 3402 | Ga0207428_10736473 | |||
| 3403 | Ga0207428_10910815 | |||
| 3404 | Ga0268266_11862810 | |||
| 3405 | Ga0268265_10017259 | |||
| 3406 | Ga0268265_10057467 | |||
| 3407 | Ga0268265_10096691 | |||
| 3408 | Ga0268265_10274850 | |||
| 3409 | Ga0268265_10298436 | |||
| 3410 | Ga0268265_10312780 | |||
| 3411 | Ga0268265_10576803 | |||
| 3412 | Ga0268265_10577171 | |||
| 3413 | Ga0268265_10588721 | |||
| 3414 | Ga0268265_10977818 | |||
| 3415 | Ga0268265_11914691 | |||
| 3416 | Ga0268264_10043770 | |||
| 3417 | Ga0268264_10050755 | |||
| 3418 | Ga0268264_10082424 | |||
| 3419 | Ga0268264_10090034 | |||
| 3420 | Ga0268264_10094624 | |||
| 3421 | Ga0268264_10127843 | |||
| 3422 | Ga0268264_10132530 | |||
| 3423 | Ga0268264_10153007 | |||
| 3424 | Ga0268264_10424708 | |||
| 3425 | Ga0268264_10529729 | |||
| 3426 | Ga0268264_10630881 | |||
| 3427 | Ga0268264_10756828 | |||
| 3428 | Ga0268264_10808951 | |||
| 3429 | Ga0268264_11477167 | |||
| 3430 | Ga0268264_11682154 | |||
| 3431 | Ga0307515_10538640 | |||
| 3432 | Ga0314311_1139834 | |||
| 3433 | Ga0316178_1142882 | |||
| 3434 | Ga0316182_1148632 | |||
| 3435 | Ga0307513_10005598 | |||
| 3436 | Ga0307408_100385006 | |||
| 3437 | Ga0307408_100446041 | |||
| 3438 | Ga0307408_101156004 | |||
| 3439 | Ga0307408_102520166 | |||
| 3440 | Ga0307405_10179549 | |||
| 3441 | Ga0307405_10235300 | |||
| 3442 | Ga0307405_10289468 | |||
| 3443 | Ga0307405_10376675 | |||
| 3444 | Ga0307405_11040058 | |||
| 3445 | Ga0307413_10032967 | |||
| 3446 | Ga0307410_10039430 | |||
| 3447 | Ga0307410_10164481 | |||
| 3448 | Ga0307410_10235960 | |||
| 3449 | Ga0307410_10561925 | |||
| 3450 | Ga0307406_10013493 | |||
| 3451 | Ga0307406_10017531 | |||
| 3452 | Ga0307406_10489063 | |||
| 3453 | Ga0307406_10564726 | |||
| 3454 | Ga0307407_10026139 | |||
| 3455 | Ga0307407_10142309 | |||
| 3456 | Ga0307407_10514336 | |||
| 3457 | Ga0307412_10053675 | |||
| 3458 | Ga0307412_10201000 | |||
| 3459 | Ga0307412_10317114 | |||
| 3460 | Ga0307412_10777775 | |||
| 3461 | Ga0307412_10933548 | |||
| 3462 | Ga0307409_100058421 | |||
| 3463 | Ga0307409_100156791 | |||
| 3464 | Ga0307409_102649159 | |||
| 3465 | Ga0307416_100011954 | |||
| 3466 | Ga0307416_100033296 | |||
| 3467 | Ga0307416_100392925 | |||
| 3468 | Ga0307416_100525371 | |||
| 3469 | Ga0307416_100939695 | |||
| 3470 | Ga0307416_101175142 | |||
| 3471 | Ga0307416_101435174 | |||
| 3472 | Ga0307416_101642387 | |||
| 3473 | Ga0307416_103606258 | |||
| 3474 | Ga0307414_10000977 | |||
| 3475 | Ga0307414_10078412 | |||
| 3476 | Ga0307414_10137096 | |||
| 3477 | Ga0307414_10198823 | |||
| 3478 | Ga0307414_11757143 | |||
| 3479 | Ga0307411_10074618 | |||
| 3480 | Ga0307411_10233335 | |||
| 3481 | Ga0307411_10244264 | |||
| 3482 | Ga0307411_10907235 | |||
| 3483 | Ga0307411_11119931 | |||
| 3484 | Ga0307415_100037442 | |||
| 3485 | Ga0307415_100176510 | |||
| 3486 | Ga0307415_100347705 | |||
| 3487 | Ga0373950_0048464 | |||
| 3488 | Ga0373929_0251653 | |||
| 3489 | Ga0373940_0155622 | |||
| 3490 | Ga0373951_0023668 | |||
| 3491 | Ga0373941_0009414 | |||
| 3492 | Ga0373941_0013541 | |||
| 3493 | Ga0373942_0004655 | |||
| 3494 | Ga0373961_0177239 | |||
| 3495 | Ga0373961_0254092 | |||
| 3496 | Ga0373962_0378234 | |||
| 3497 | Ga0373931_0449195 | |||
| 3498 | Ga0373935_0606208 | |||
| 3499 | Ga0373937_0733945 | |||
| 3500 | Ga0373925_1349093 | |||
| 3501 | Ga0395900_0057486 | |||
| 3502 | Ga0395900_0158741 | |||
| 3503 | Ga0395900_0848922 | |||
| 3504 | Ga0395900_0878894 | |||
| 3505 | Ga0395900_1353970 | |||
| 3506 | Ga0395898_0153361 | |||
| 3507 | Ga0395898_0942013 | |||
| 3508 | Ga0395898_1144769 | |||
| 3509 | Ga0395905_0002781 | |||
| 3510 | Ga0395905_0029119 | |||
| 3511 | Ga0395905_0803208 | |||
| 3512 | Ga0395905_1854701 | |||
| 3513 | Ga0436364_1177179 | |||
| 3514 | Ga0395901_0176126 | |||
| 3515 | Ga0395901_0808868 | |||
| 3516 | Ga0395901_1858813 | |||
| 3517 | Ga0242422_02081 | |||
| 3518 | Ga0242420_061324 | |||
| 3519 | Ga0436365_0557003 | |||
| 3520 | Ga0436365_0744561 | |||
| 3521 | Ga0436365_0802786 | |||
| 3522 | Ga0436363_0057732 | |||
| 3523 | Ga0451793_1711702 | |||
| 3524 | Ga0451807_0635481 | |||
| 3525 | Ga0451807_1877268 | |||
| 3526 | Ga0451853_3186910 | |||
| 3527 | Ga0439448_0015162 | |||
| 3528 | Ga0439432_014864 | |||
| 3529 | Ga0439455_0123271 | |||
| 3530 | Ga0439462_0193974 | |||
| 3531 | Ga0439446_0069853 | |||
| 3532 | Ga0439458_0004943 | |||
| 3533 | Ga0439458_0165737 | |||
| 3534 | Ga0439434_0004396 | |||
| 3535 | Ga0439434_0089917 | |||
| 3536 | Ga0439435_0109874 | |||
| 3537 | Ga0439459_0222521 | |||
| 3538 | Ga0439464_0010763 | |||
| 3539 | Ga0451577_0528632 | |||
| 3540 | Ga0453683_0010562 | |||
| 3541 | Ga0453683_1035877 | |||
| 3542 | Ga0453684_1410385 | |||
| 3543 | Ga0466960_0860746 | |||
| 3544 | Ga0451576_0005147 | |||
| 3545 | Ga0451576_0311562 | |||
| 3546 | Ga0451576_0407534 | |||
| 3547 | Ga0451576_0902485 | |||
| 3548 | Ga0451576_1775920 | |||
| 3549 | Ga0495592_0614521 | |||
| 3550 | Ga0495629_0600031 | |||
| 3551 | Ga0495651_0445892 | |||
| 3552 | Ga0495580_0419989 | |||
| 3553 | Ga0495639_0109479 | |||
| 3554 | Ga0495664_0387253 | |||
| 3555 | Ga0495618_0147288 | |||
| 3556 | Ga0495632_0033115 | |||
| 3557 | Ga0495643_0293688 | |||
| 3558 | Ga0495663_0218879 | |||
| 3559 | Ga0495586_0091430 | |||
| 3560 | Ga0495598_0286926 | |||
| 3561 | Ga0495621_0036583 | |||
| 3562 | Ga0495621_0263646 | |||
| 3563 | Ga0495645_0111154 | |||
| 3564 | Ga0495667_0523741 | |||
| 3565 | Ga0495656_0033559 | |||
| 3566 | Ga0495634_0319925 | |||
| 3567 | Ga0495635_0321269 | |||
| 3568 | Ga0495659_0030422 | |||
| 3569 | Ga0495599_0535317 | |||
| 3570 | Ga0495658_0623392 | |||
| 3571 | Ga0495658_0923733 | |||
| 3572 | Ga0495669_0112499 | |||
| 3573 | Ga0495669_0556207 | |||
| 3574 | Ga0495613_0343003 | |||
| 3575 | Ga0495613_0950394 | |||
| 3576 | Ga0495636_0289207 | |||
| 3577 | Ga0495674_0202623 | |||
| 3578 | Ga0495672_0180552 | |||
| 3579 | Ga0495676_0639422 | |||
| 3580 | Ga0495680_0304969 | |||
| 3581 | Ga0495684_0238417 | |||
| 3582 | Ga0496100_0179322 | |||
| 3583 | Ga0496100_1157036 | |||
| 3584 | Ga0496102_0335442 | |||
| 3585 | Ga0496103_0437785 | |||
| 3586 | Ga0496104_0316002 | |||
| 3587 | Ga0496105_0496595 | |||
| 3588 | Ga0496106_0048317 | |||
| 3589 | Ga0496106_0686255 | |||
| 3590 | Ga0496107_0542035 | |||
| 3591 | Ga0496107_0730513 | |||
| 3592 | Ga0496108_0369203 | |||
| 3593 | Ga0496108_0397826 | |||
| 3594 | Ga0496108_1303888 | |||
| 3595 | Ga0496110_1867855 | |||
| 3596 | Ga0496112_0127939 | |||
| 3597 | Ga0496112_0887194 | |||
| 3598 | Ga0496112_1648897 | |||
| 3599 | Ga0496112_1764855 | |||
| 3600 | Ga0496113_0693932 | |||
| 3601 | Ga0496113_1188640 | |||
| 3602 | Ga0496113_1435599 | |||
| 3603 | Ga0501306_047967 | |||
| 3604 | Ga0501291_024043 | |||
| 3605 | Ga0501292_005612 | |||
| 3606 | Ga0501292_109767 | |||
| 3607 | Ga0501296_001466 | |||
| 3608 | Ga0501296_008296 | |||
| 3609 | Ga0501297_000547 | |||
| 3610 | Ga0501298_009494 | |||
| 3611 | Ga0501299_000445 | |||
| 3612 | Ga0501299_017318 | |||
| 3613 | Ga0501302_006596 | |||
| 3614 | Ga0501031_0250921 | |||
| 3615 | Ga0501038_0002264 | |||
| 3616 | Ga0501040_0456466 | |||
| 3617 | Ga0501040_1386623 | |||
| 3618 | Ga0501042_1138767 | |||
| 3619 | Ga0501068_1119296 | |||
| 3620 | Ga0501071_0426168 | |||
| 3621 | Ga0501071_1100341 | |||
| 3622 | Ga0501074_0461150 | |||
| 3623 | Ga0501075_0721590 | |||
| 3624 | Ga0501076_1702648 | |||
| 3625 | Ga0501202_070562 | |||
| 3626 | Ga0501202_082970 | |||
| 3627 | Ga0501206_028358 | |||
| 3628 | Ga0501206_092843 | |||
| 3629 | Ga0501207_003686 | |||
| 3630 | Ga0501207_010119 | |||
| 3631 | Ga0501209_261165 | |||
| 3632 | Ga0501216_001484 | |||
| 3633 | Ga0501216_049063 | |||
| 3634 | Ga0501217_002716 | |||
| 3635 | Ga0501217_011755 | |||
| 3636 | Ga0501217_016282 | |||
| 3637 | Ga0501217_030047 | |||
| 3638 | Ga0501217_073356 | |||
| 3639 | Ga0501223_000914 | |||
| 3640 | Ga0501224_008456 | |||
| 3641 | Ga0501224_009480 | |||
| 3642 | Ga0501224_012920 | |||
| 3643 | Ga0501224_028677 | |||
| 3644 | Ga0501227_013007 | |||
| 3645 | Ga0501227_060935 | |||
| 3646 | Ga0501227_108220 | |||
| 3647 | Ga0501227_223389 | |||
| 3648 | Ga0501228_000957 | |||
| 3649 | Ga0501230_001733 | |||
| 3650 | Ga0501230_031522 | |||
| 3651 | Ga0501230_107171 | |||
| 3652 | Ga0501233_000913 | |||
| 3653 | Ga0501233_001382 | |||
| 3654 | Ga0501233_010608 | |||
| 3655 | Ga0501235_004859 | |||
| 3656 | Ga0501235_007230 | |||
| 3657 | Ga0501235_024707 | |||
| 3658 | Ga0501235_045912 | |||
| 3659 | Ga0501235_062601 | |||
| 3660 | Ga0501236_070496 | |||
| 3661 | Ga0501238_025570 | |||
| 3662 | Ga0501239_018589 | |||
| 3663 | Ga0501242_008911 | |||
| 3664 | Ga0501247_002464 | |||
| 3665 | Ga0501249_003205 | |||
| 3666 | Ga0501249_022689 | |||
| 3667 | Ga0501249_086269 | |||
| 3668 | Ga0501255_009317 | |||
| 3669 | Ga0501255_059191 | |||
| 3670 | Ga0501256_001685 | |||
| 3671 | Ga0501256_008997 | |||
| 3672 | Ga0501257_010091 | |||
| 3673 | Ga0501257_025537 | |||
| 3674 | Ga0501257_043823 | |||
| 3675 | Ga0501258_013724 | |||
| 3676 | Ga0501259_007540 | |||
| 3677 | Ga0501260_001245 | |||
| 3678 | Ga0501261_002239 | |||
| 3679 | Ga0501261_061670 | |||
| 3680 | Ga0501219_015825 | |||
| 3681 | Ga0501221_004377 | |||
| 3682 | Ga0501221_013198 | |||
| 3683 | Ga0501225_0000533 | |||
| 3684 | Ga0501225_0006298 | |||
| 3685 | Ga0501225_0006664 | |||
| 3686 | Ga0501225_0027023 | |||
| 3687 | Ga0501225_0077452 | |||
| 3688 | Ga0501234_000103 | |||
| 3689 | Ga0501234_004496 | |||
| 3690 | Ga0501234_021066 | |||
| 3691 | Ga0501245_027776 | |||
| 3692 | Ga0501081_0568735 | |||
| 3693 | Ga0501241_031060 | |||
| 3694 | Ga0501262_033403 | |||
| 3695 | Ga0501268_005132 | |||
| 3696 | Ga0501268_055652 | |||
| 3697 | Ga0501270_001352 | |||
| 3698 | Ga0501270_022792 | |||
| 3699 | Ga0501270_069657 | |||
| 3700 | Ga0501272_000807 | |||
| 3701 | Ga0501273_001458 | |||
| 3702 | Ga0501273_038118 | |||
| 3703 | Ga0501274_027304 | |||
| 3704 | Ga0501276_034898 | |||
| 3705 | Ga0501279_008611 | |||
| 3706 | Ga0501283_003147 | |||
| 3707 | Ga0501045_0462498 | |||
| 3708 | Ga0501204_004815 | |||
| 3709 | Ga0501212_004055 | |||
| 3710 | Ga0501212_012910 | |||
| 3711 | Ga0501226_021370 | |||
| 3712 | Ga0501226_029881 | |||
| 3713 | nmdc:mga05p37_1326369_c1 | |||
| 3714 | nmdc:mga05p37_144080_c1 | |||
| 3715 | nmdc:mga05p37_1550_c1 | |||
| 3716 | nmdc:mga05p37_175010_c1 | |||
| 3717 | nmdc:mga05p37_176287_c1 | |||
| 3718 | nmdc:mga05p37_203665_c1 | |||
| 3719 | nmdc:mga05p37_257432_c1 | |||
| 3720 | nmdc:mga09592_105125_c1 | |||
| 3721 | nmdc:mga09592_133783_c1 | |||
| 3722 | nmdc:mga09592_1713037_c1 | |||
| 3723 | nmdc:mga09592_287578_c1 | |||
| 3724 | nmdc:mga09592_448085_c1 | |||
| 3725 | nmdc:mga09592_500134_c1 | |||
| 3726 | nmdc:mga09592_794318_c1 | |||
| 3727 | nmdc:mga0qj67_119633_c1 | |||
| 3728 | nmdc:mga0qj67_19703_c1 | |||
| 3729 | nmdc:mga0qj67_721058_c1 | |||
| 3730 | nmdc:mga06r32_1421689_c1 | |||
| 3731 | nmdc:mga06r32_160852_c1 | |||
| 3732 | nmdc:mga06r32_309702_c1 | |||
| 3733 | nmdc:mga06r32_929707_c1 | |||
| 3734 | nmdc:mga08y16_1131534_c1 | |||
| 3735 | nmdc:mga08y16_1143473_c1 | |||
| 3736 | nmdc:mga08y16_14198_c1 | |||
| 3737 | nmdc:mga08y16_21530_c1 | |||
| 3738 | nmdc:mga08y16_233803_c1 | |||
| 3739 | nmdc:mga08y16_91785_c1 | |||
| 3740 | nmdc:mga0n895_1000796_c1 | |||
| 3741 | nmdc:mga0n895_1020694_c1 | |||
| 3742 | nmdc:mga0n895_1025419_c1 | |||
| 3743 | nmdc:mga0n895_1098030_c1 | |||
| 3744 | nmdc:mga0n895_1195966_c1 | |||
| 3745 | nmdc:mga0n895_1419271_c1 | |||
| 3746 | nmdc:mga0n895_14374_c1 | |||
| 3747 | nmdc:mga0n895_146599_c1 | |||
| 3748 | nmdc:mga0n895_157804_c1 | |||
| 3749 | nmdc:mga0n895_190141_c1 | |||
| 3750 | nmdc:mga0n895_22555_c1 | |||
| 3751 | nmdc:mga0n895_268488_c1 | |||
| 3752 | nmdc:mga0n895_422547_c1 | |||
| 3753 | nmdc:mga0n895_547301_c1 | |||
| 3754 | nmdc:mga0n895_603158_c1 | |||
| 3755 | nmdc:mga0n895_916310_c1 | |||
| 3756 | nmdc:mga0n895_995488_c1 | |||
| 3757 | nmdc:mga0rr50_265436_c1 | |||
| 3758 | nmdc:mga0rr50_663509_c1 | |||
| 3759 | nmdc:mga08x19_1934_c1 | |||
| 3760 | nmdc:mga08x19_504765_c1 | |||
| 3761 | nmdc:mga08x19_517049_c1 | |||
| 3762 | nmdc:mga08x19_638733_c1 | |||
| 3763 | nmdc:mga0a205_104849_c1 | |||
| 3764 | nmdc:mga0a205_1059515_c1 | |||
| 3765 | nmdc:mga0a205_162022_c1 | |||
| 3766 | nmdc:mga0a205_164983_c1 | |||
| 3767 | nmdc:mga0a205_39871_c1 | |||
| 3768 | nmdc:mga0a205_428450_c1 | |||
| 3769 | nmdc:mga0a205_438131_c1 | |||
| 3770 | nmdc:mga0a205_505895_c1 | |||
| 3771 | nmdc:mga0a205_5706_c1 | |||
| 3772 | nmdc:mga0a205_575064_c1 | |||
| 3773 | nmdc:mga0a205_631495_c1 | |||
| 3774 | nmdc:mga0a205_648089_c1 | |||
| 3775 | nmdc:mga0a205_717966_c1 | |||
| 3776 | nmdc:mga0a205_869612_c1 | |||
| 3777 | Ga0495601_0587568 | |||
| 3778 | Ga0495619_0442099 | |||
| 3779 | Ga0500566_0195253 | |||
| 3780 | Ga0500616_0005403 | |||
| 3781 | Ga0501084_0057400 | |||
| 3782 | Ga0501084_0627741 | |||
| 3783 | Ga0587066_072192 | |||
| 3784 | Ga0587083_0101657 | |||
| 3785 | Ga0587085_051446 | |||
| 3786 | Ga0587094_055174 | |||
| 3787 | Ga0587062_088234 | |||
| 3788 | Ga0587067_100281 | |||
| 3789 | Ga0587068_132302 | |||
| 3790 | Ga0587069_079635 | |||
| 3791 | Ga0587069_132285 | |||
| 3792 | Ga0587072_145355 | |||
| 3793 | Ga0587076_077303 | |||
| 3794 | Ga0587107_098115 | |||
| 3795 | Ga0587111_0110881 | |||
| 3796 | Ga0501082_0880283 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy