F496009

General Info

Members Datasets Scaffolds Average Seq Length
1898 397 3796 125

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12371992|Ga0157378_123719921
Length 143
Sequence MNSGLGRVINKGTMEGSTGSPTIRVEIASSSEYRSSPTIRGKIYNQTYNFRSDGDTEYIIQLAEFVDSRMREISSGTLTVDSLKVAILAALHIADELHRLKNMHEQADSQLAARSSECAEMLDRLLKVRSTVDQSGAGKLSLG

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
6 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
214 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
215 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
247 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
256 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
262 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
310 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
311 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
312 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
315 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
326 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
327 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
328 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
329 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
330 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
331 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
332 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
333 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
334 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
335 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
336 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
337 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
338 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
339 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
340 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
341 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
342 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
345 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
346 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
347 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
348 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
349 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
350 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
351 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
352 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
355 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
358 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
359 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
360 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
361 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
362 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
363 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
364 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
365 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
366 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
369 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
370 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.26
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 42.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_12371992 3300013297 Unclassified 582
2 SwRhRL3b_contig_2606832 2162886006 Bacteria 1085
3 SwRhRL2b_contig_2182236 2162886007 Bacteria 2139
4 SwRhRL2b_contig_2678464 2162886007 Bacteria 1016
5 SwRhRL2b_contig_3329882 2162886007 Bacteria 1075
6 SwRhRL2b_contig_493489 2162886007 Bacteria 1017
7 MBSR1b_contig_13030068 2162886012 Unclassified 827
8 CNBas_1009198 3300000531 Bacteria 592
9 CNAas_1000026 3300000532 Bacteria 9657
10 JGI24748J21848_1000007 3300002074 Bacteria 208838
11 JGI24034J26672_10000002 3300002239 Bacteria 925353
12 JGI24742J22300_10097535 3300002244 Unclassified 566
13 JGI24751J29686_10000017 3300002459 Bacteria 109415
14 JGI25406J46586_10001585 3300003203 Bacteria 10736
15 JGI25406J46586_10038246 3300003203 Unclassified 1722
16 rootL2_10066759 3300003322 Bacteria 1415
17 Ga0065714_10064596 3300005288 Bacteria 30781
18 Ga0065714_10155715 3300005288 Bacteria 1079
19 Ga0065704_10085200 3300005289 Bacteria 3244
20 Ga0065704_10096907 3300005289 Bacteria 2418
21 Ga0065704_10156697 3300005289 Bacteria 1383
22 Ga0065704_10157323 3300005289 Bacteria 1381
23 Ga0065704_10189830 3300005289 Bacteria 1153
24 Ga0065704_10230677 3300005289 Bacteria 1044
25 Ga0065704_10253257 3300005289 Bacteria 984
26 Ga0065704_10542488 3300005289 Unclassified 639
27 Ga0065704_10699561 3300005289 Unclassified 561
28 Ga0065712_10012497 3300005290 Bacteria 2927
29 Ga0065712_10017635 3300005290 Bacteria 1369
30 Ga0065712_10068446 3300005290 Bacteria 10594
31 Ga0065712_10073588 3300005290 Bacteria 4340
32 Ga0065712_10170628 3300005290 Bacteria 1246
33 Ga0065712_10437363 3300005290 Unclassified 697
34 Ga0065712_10799569 3300005290 Unclassified 510
35 Ga0065715_10089589 3300005293 Bacteria 9352
36 Ga0065715_10105571 3300005293 Bacteria 2884
37 Ga0065715_10114416 3300005293 Bacteria 2452
38 Ga0065715_10143814 3300005293 Unclassified 1816
39 Ga0065715_10143933 3300005293 Unclassified 1814
40 Ga0065715_10166621 3300005293 Bacteria 1577
41 Ga0065715_10242280 3300005293 Bacteria 1195
42 Ga0065715_10253488 3300005293 Unclassified 1160
43 Ga0065715_10302654 3300005293 Bacteria 1038
44 Ga0065715_10307704 3300005293 Bacteria 1027
45 Ga0065715_10410560 3300005293 Unclassified 863
46 Ga0065715_10416639 3300005293 Unclassified 863
47 Ga0065715_10421457 3300005293 Bacteria 853
48 Ga0065715_10560110 3300005293 Unclassified 734
49 Ga0065715_10666358 3300005293 Unclassified 656
50 Ga0065707_10001863 3300005295 Bacteria 6114
51 Ga0065707_10031290 3300005295 Bacteria 1160
52 Ga0065707_10056378 3300005295 Unclassified 828
53 Ga0065707_10085169 3300005295 Bacteria 6387
54 Ga0065707_10120297 3300005295 Bacteria 2138
55 Ga0065707_10142778 3300005295 Unclassified 1751
56 Ga0065707_10173065 3300005295 Bacteria 1463
57 Ga0065707_10191731 3300005295 Bacteria 1357
58 Ga0065707_10258876 3300005295 Unclassified 1103
59 Ga0065707_10322032 3300005295 Unclassified 964
60 Ga0065707_10489315 3300005295 Unclassified 766
61 Ga0065707_10615549 3300005295 Unclassified 674
62 Ga0065707_10707242 3300005295 Unclassified 636
63 Ga0070676_10047850 3300005328 Bacteria 2499
64 Ga0070676_10119856 3300005328 Unclassified 1650
65 Ga0070676_11229767 3300005328 Unclassified 570
66 Ga0070676_11341115 3300005328 Bacteria 547
67 Ga0070683_100029338 3300005329 Bacteria 4979
68 Ga0070690_100008280 3300005330 Bacteria 5980
69 Ga0070690_100017532 3300005330 Bacteria 4309
70 Ga0070690_100091789 3300005330 Bacteria 2001
71 Ga0070690_100198775 3300005330 Unclassified 1394
72 Ga0070690_100218282 3300005330 Unclassified 1335
73 Ga0070690_100351653 3300005330 Unclassified 1070
74 Ga0070690_100558567 3300005330 Bacteria 864
75 Ga0070690_100628223 3300005330 Unclassified 818
76 Ga0070670_100018951 3300005331 Bacteria 5901
77 Ga0070670_100091664 3300005331 Bacteria 2613
78 Ga0070670_100227248 3300005331 Bacteria 1624
79 Ga0070670_100233014 3300005331 Bacteria 1602
80 Ga0070670_100259548 3300005331 Bacteria 1514
81 Ga0070670_100287380 3300005331 Unclassified 1436
82 Ga0070670_100365621 3300005331 Bacteria 1269
83 Ga0070670_100474437 3300005331 Bacteria 1110
84 Ga0070670_100935932 3300005331 Unclassified 786
85 Ga0070670_101411142 3300005331 Unclassified 638
86 Ga0070677_10324477 3300005333 Unclassified 790
87 Ga0068869_100042317 3300005334 Unclassified 3265
88 Ga0068869_100071714 3300005334 Bacteria 2565
89 Ga0068869_100082590 3300005334 Unclassified 2402
90 Ga0068869_100109200 3300005334 Bacteria 2102
91 Ga0068869_100513787 3300005334 Bacteria 1002
92 Ga0068869_100899213 3300005334 Bacteria 766
93 Ga0068869_100912852 3300005334 Unclassified 760
94 Ga0068869_100981376 3300005334 Unclassified 735
95 Ga0068869_101167199 3300005334 Unclassified 676
96 Ga0068869_101261364 3300005334 Unclassified 651
97 Ga0068869_101536944 3300005334 Bacteria 591
98 Ga0070666_10077380 3300005335 Bacteria 2271
99 Ga0070666_10089671 3300005335 Unclassified 2111
100 Ga0070666_10165588 3300005335 Bacteria 1546
101 Ga0070666_10210007 3300005335 Unclassified 1371
102 Ga0070666_11137559 3300005335 Unclassified 581
103 Ga0070680_100075635 3300005336 Unclassified 2772
104 Ga0070680_100092736 3300005336 Bacteria 2501
105 Ga0070680_100604699 3300005336 Bacteria 941
106 Ga0070680_101743412 3300005336 Unclassified 540
107 Ga0070682_100308754 3300005337 Bacteria 1164
108 Ga0070682_100579655 3300005337 Unclassified 882
109 Ga0068868_100043939 3300005338 Bacteria 3491
110 Ga0068868_100045354 3300005338 Bacteria 3439
111 Ga0068868_100302998 3300005338 Bacteria 1357
112 Ga0068868_100727430 3300005338 Bacteria 890
113 Ga0068868_101636718 3300005338 Unclassified 605
114 Ga0068868_102163695 3300005338 Bacteria 530
115 Ga0070660_100136948 3300005339 Bacteria 1962
116 Ga0070660_100347076 3300005339 Unclassified 1222
117 Ga0070660_100927300 3300005339 Unclassified 735
118 Ga0070689_100048155 3300005340 Bacteria 3287
119 Ga0070689_100114116 3300005340 Unclassified 2152
120 Ga0070689_100182392 3300005340 Unclassified 1705
121 Ga0070689_100612400 3300005340 Unclassified 944
122 Ga0070689_100792098 3300005340 Unclassified 833
123 Ga0070689_100801047 3300005340 Bacteria 828
124 Ga0070689_100915224 3300005340 Unclassified 776
125 Ga0070689_100976095 3300005340 Unclassified 753
126 Ga0070689_101231086 3300005340 Bacteria 673
127 Ga0070689_101261497 3300005340 Unclassified 665
128 Ga0070689_101379984 3300005340 Unclassified 636
129 Ga0070689_101798378 3300005340 Unclassified 559
130 Ga0070691_10058073 3300005341 Bacteria 1857
131 Ga0070691_10466935 3300005341 Unclassified 723
132 Ga0070687_100024091 3300005343 Bacteria 2901
133 Ga0070687_100025782 3300005343 Bacteria 2825
134 Ga0070687_100070835 3300005343 Unclassified 1871
135 Ga0070687_100084954 3300005343 Bacteria 1736
136 Ga0070687_100413834 3300005343 Bacteria 887
137 Ga0070687_100432701 3300005343 Unclassified 871
138 Ga0070687_100644176 3300005343 Bacteria 733
139 Ga0070687_101247132 3300005343 Unclassified 550
140 Ga0070661_100009109 3300005344 Bacteria 6861
141 Ga0070661_100277369 3300005344 Bacteria 1299
142 Ga0070661_100377622 3300005344 Unclassified 1117
143 Ga0070661_100584649 3300005344 Bacteria 901
144 Ga0070661_100879594 3300005344 Unclassified 739
145 Ga0070661_100899954 3300005344 Bacteria 730
146 Ga0070661_101068651 3300005344 Unclassified 671
147 Ga0070661_101608780 3300005344 Unclassified 549
148 Ga0070692_10057713 3300005345 Bacteria 2036
149 Ga0070692_10074545 3300005345 Bacteria 1815
150 Ga0070692_10103987 3300005345 Bacteria 1561
151 Ga0070692_10141869 3300005345 Bacteria 1360
152 Ga0070692_10152704 3300005345 Bacteria 1316
153 Ga0070692_10423875 3300005345 Unclassified 845
154 Ga0070692_10569979 3300005345 Bacteria 744
155 Ga0070692_11066994 3300005345 Unclassified 568
156 Ga0070668_100022818 3300005347 Bacteria 4731
157 Ga0070668_100102868 3300005347 Unclassified 2265
158 Ga0070668_100902224 3300005347 Bacteria 790
159 Ga0070669_100001947 3300005353 Bacteria 14905
160 Ga0070669_100008114 3300005353 Bacteria 7501
161 Ga0070669_100011425 3300005353 Bacteria 6303
162 Ga0070669_100013610 3300005353 Bacteria 5781
163 Ga0070669_100214875 3300005353 Bacteria 1518
164 Ga0070669_101094149 3300005353 Unclassified 686
165 Ga0070669_101176012 3300005353 Unclassified 662
166 Ga0070669_101301904 3300005353 Bacteria 629
167 Ga0070675_100219024 3300005354 Bacteria 1657
168 Ga0070675_100340379 3300005354 Unclassified 1328
169 Ga0070675_100420842 3300005354 Unclassified 1194
170 Ga0070675_100580437 3300005354 Unclassified 1016
171 Ga0070675_100867426 3300005354 Bacteria 826
172 Ga0070675_101832422 3300005354 Unclassified 560
173 Ga0070671_100001256 3300005355 Bacteria 19009
174 Ga0070671_100007418 3300005355 Bacteria 8766
175 Ga0070671_100098235 3300005355 Bacteria 2456
176 Ga0070671_100106170 3300005355 Bacteria 2357
177 Ga0070671_100175034 3300005355 Unclassified 1815
178 Ga0070671_100190022 3300005355 Bacteria 1740
179 Ga0070674_100165824 3300005356 Bacteria 1680
180 Ga0070674_100355874 3300005356 Bacteria 1184
181 Ga0070674_101989599 3300005356 Bacteria 529
182 Ga0070673_100004450 3300005364 Bacteria 8859
183 Ga0070673_100109455 3300005364 Bacteria 2289
184 Ga0070673_100114359 3300005364 Bacteria 2242
185 Ga0070673_100149071 3300005364 Unclassified 1980
186 Ga0070673_100241304 3300005364 Unclassified 1571
187 Ga0070673_100405270 3300005364 Unclassified 1220
188 Ga0070673_100469880 3300005364 Bacteria 1134
189 Ga0070673_101120566 3300005364 Bacteria 735
190 Ga0070673_101364789 3300005364 Unclassified 667
191 Ga0070673_101510124 3300005364 Unclassified 634
192 Ga0070673_101511025 3300005364 Unclassified 633
193 Ga0070673_101885102 3300005364 Unclassified 567
194 Ga0070673_102010185 3300005364 Bacteria 549
195 Ga0070673_102129758 3300005364 Unclassified 533
196 Ga0070688_100023832 3300005365 Bacteria 3605
197 Ga0070688_100552373 3300005365 Bacteria 875
198 Ga0070688_100938862 3300005365 Unclassified 684
199 Ga0070659_100015215 3300005366 Bacteria 5758
200 Ga0070659_100082434 3300005366 Bacteria 2569
201 Ga0070659_100133946 3300005366 Bacteria 2014
202 Ga0070659_100291319 3300005366 Unclassified 1359
203 Ga0070659_100831866 3300005366 Unclassified 804
204 Ga0070667_100015535 3300005367 Bacteria 6293
205 Ga0070667_100072731 3300005367 Bacteria 2930
206 Ga0070703_10001368 3300005406 Bacteria 7405
207 Ga0070703_10068408 3300005406 Unclassified 1180
208 Ga0070703_10275264 3300005406 Unclassified 692
209 Ga0070709_11005617 3300005434 Unclassified 663
210 Ga0070709_11325766 3300005434 Bacteria 581
211 Ga0070709_11785012 3300005434 Unclassified 503
212 Ga0070710_11135714 3300005437 Bacteria 575
213 Ga0070701_10116203 3300005438 Bacteria 1501
214 Ga0070701_10141915 3300005438 Bacteria 1375
215 Ga0070701_10341047 3300005438 Bacteria 933
216 Ga0070705_100016905 3300005440 Unclassified 3799
217 Ga0070705_100022103 3300005440 Bacteria 3394
218 Ga0070705_100033199 3300005440 Unclassified 2875
219 Ga0070705_100115914 3300005440 Bacteria 1721
220 Ga0070705_100391981 3300005440 Bacteria 1026
221 Ga0070705_100454282 3300005440 Unclassified 962
222 Ga0070705_100584473 3300005440 Unclassified 861
223 Ga0070705_100643677 3300005440 Unclassified 826
224 Ga0070705_100877628 3300005440 Unclassified 720
225 Ga0070705_100886461 3300005440 Unclassified 716
226 Ga0070705_101494769 3300005440 Unclassified 566
227 Ga0070705_101709442 3300005440 Unclassified 532
228 Ga0070705_101888888 3300005440 Unclassified 508
229 Ga0070700_100008091 3300005441 Bacteria 5714
230 Ga0070700_100021298 3300005441 Bacteria 3767
231 Ga0070700_100035918 3300005441 Bacteria 3002
232 Ga0070700_100077203 3300005441 Bacteria 2141
233 Ga0070700_100121005 3300005441 Bacteria 1754
234 Ga0070700_100183930 3300005441 Bacteria 1456
235 Ga0070700_100309882 3300005441 Bacteria 1156
236 Ga0070700_100503396 3300005441 Unclassified 932
237 Ga0070700_100625860 3300005441 Bacteria 847
238 Ga0070700_100925504 3300005441 Bacteria 711
239 Ga0070700_101029313 3300005441 Unclassified 679
240 Ga0070694_100006114 3300005444 Bacteria 7303
241 Ga0070694_100017025 3300005444 Bacteria 4587
242 Ga0070694_100017068 3300005444 Bacteria 4582
243 Ga0070694_100030850 3300005444 Bacteria 3511
244 Ga0070694_100066429 3300005444 Bacteria 2474
245 Ga0070694_100069673 3300005444 Unclassified 2420
246 Ga0070694_100088638 3300005444 Bacteria 2166
247 Ga0070694_100110123 3300005444 Unclassified 1961
248 Ga0070694_100211432 3300005444 Bacteria 1451
249 Ga0070694_100233892 3300005444 Bacteria 1384
250 Ga0070694_100248390 3300005444 Unclassified 1345
251 Ga0070694_100265475 3300005444 Bacteria 1303
252 Ga0070694_100282232 3300005444 Unclassified 1266
253 Ga0070694_100374061 3300005444 Bacteria 1109
254 Ga0070694_100407346 3300005444 Bacteria 1066
255 Ga0070694_100482870 3300005444 Unclassified 983
256 Ga0070694_100564772 3300005444 Unclassified 912
257 Ga0070694_100617349 3300005444 Unclassified 875
258 Ga0070694_100707529 3300005444 Bacteria 820
259 Ga0070694_100722399 3300005444 Bacteria 812
260 Ga0070694_100791916 3300005444 Unclassified 777
261 Ga0070694_100893024 3300005444 Unclassified 733
262 Ga0070694_100928613 3300005444 Unclassified 719
263 Ga0070694_101188352 3300005444 Unclassified 639
264 Ga0070708_100001683 3300005445 Bacteria 16984
265 Ga0070708_100151043 3300005445 Unclassified 2160
266 Ga0070708_100188649 3300005445 Bacteria 1928
267 Ga0070708_100539072 3300005445 Unclassified 1101
268 Ga0070708_100712104 3300005445 Bacteria 945
269 Ga0070708_100751763 3300005445 Bacteria 917
270 Ga0070663_100523728 3300005455 Unclassified 987
271 Ga0070678_100027941 3300005456 Bacteria 3839
272 Ga0070678_100209385 3300005456 Bacteria 1615
273 Ga0070678_100376056 3300005456 Bacteria 1228
274 Ga0070678_100494588 3300005456 Unclassified 1078
275 Ga0070678_101082263 3300005456 Unclassified 740
276 Ga0070662_100077443 3300005457 Unclassified 2468
277 Ga0070662_100088200 3300005457 Bacteria 2325
278 Ga0070662_100188953 3300005457 Unclassified 1628
279 Ga0070662_100295795 3300005457 Bacteria 1314
280 Ga0070662_100368913 3300005457 Bacteria 1179
281 Ga0070662_100378086 3300005457 Bacteria 1165
282 Ga0070662_100481658 3300005457 Bacteria 1033
283 Ga0070662_100513138 3300005457 Bacteria 1001
284 Ga0070662_101001034 3300005457 Unclassified 715
285 Ga0070662_101615268 3300005457 Unclassified 560
286 Ga0070681_10000417 3300005458 Bacteria 34518
287 Ga0070681_10005337 3300005458 Bacteria 12405
288 Ga0070681_10006520 3300005458 Bacteria 11359
289 Ga0070681_10017987 3300005458 Bacteria 7062
290 Ga0070681_10130732 3300005458 Bacteria 2443
291 Ga0068867_100020741 3300005459 Bacteria 4684
292 Ga0068867_100090267 3300005459 Unclassified 2324
293 Ga0068867_100113031 3300005459 Bacteria 2089
294 Ga0068867_100143720 3300005459 Unclassified 1867
295 Ga0068867_100777683 3300005459 Bacteria 852
296 Ga0068867_101020617 3300005459 Unclassified 751
297 Ga0068867_101032110 3300005459 Unclassified 747
298 Ga0068867_101130278 3300005459 Unclassified 716
299 Ga0070685_10042338 3300005466 Bacteria 2599
300 Ga0070685_10210118 3300005466 Bacteria 1270
301 Ga0070706_100000088 3300005467 Bacteria 107818
302 Ga0070706_100002494 3300005467 Bacteria 18540
303 Ga0070706_100003757 3300005467 Bacteria 14826
304 Ga0070706_100010028 3300005467 Bacteria 8797
305 Ga0070706_100048296 3300005467 Unclassified 3928
306 Ga0070706_100060959 3300005467 Unclassified 3483
307 Ga0070706_100127468 3300005467 Unclassified 2374
308 Ga0070706_100132548 3300005467 Bacteria 2326
309 Ga0070706_100217672 3300005467 Bacteria 1783
310 Ga0070706_100672474 3300005467 Unclassified 961
311 Ga0070706_100897812 3300005467 Bacteria 819
312 Ga0070706_100987091 3300005467 Unclassified 777
313 Ga0070706_101487867 3300005467 Bacteria 619
314 Ga0070706_101962829 3300005467 Unclassified 530
315 Ga0070707_100001325 3300005468 Bacteria 24376
316 Ga0070707_100008179 3300005468 Bacteria 9705
317 Ga0070707_100014868 3300005468 Bacteria 7299
318 Ga0070707_100070878 3300005468 Bacteria 3357
319 Ga0070707_100133757 3300005468 Unclassified 2412
320 Ga0070707_100142361 3300005468 Unclassified 2334
321 Ga0070707_100477753 3300005468 Unclassified 1208
322 Ga0070707_100555056 3300005468 Bacteria 1111
323 Ga0070707_100645870 3300005468 Unclassified 1021
324 Ga0070707_100707100 3300005468 Bacteria 971
325 Ga0070707_100912847 3300005468 Unclassified 843
326 Ga0070698_100007026 3300005471 Bacteria 12193
327 Ga0070698_100007616 3300005471 Bacteria 11718
328 Ga0070698_100022051 3300005471 Bacteria 6668
329 Ga0070698_100030847 3300005471 Bacteria 5558
330 Ga0070698_100061585 3300005471 Bacteria 3787
331 Ga0070698_100077625 3300005471 Unclassified 3320
332 Ga0070698_100078648 3300005471 Bacteria 3296
333 Ga0070698_100159275 3300005471 Unclassified 2202
334 Ga0070698_100570912 3300005471 Unclassified 1071
335 Ga0070698_100740749 3300005471 Unclassified 926
336 Ga0070698_101590068 3300005471 Unclassified 606
337 Ga0070699_100003262 3300005518 Bacteria 14357
338 Ga0070699_100007628 3300005518 Bacteria 9407
339 Ga0070699_100026044 3300005518 Bacteria 5044
340 Ga0070699_100047431 3300005518 Bacteria 3717
341 Ga0070699_100054211 3300005518 Bacteria 3471
342 Ga0070699_100175910 3300005518 Bacteria 1898
343 Ga0070699_100207918 3300005518 Unclassified 1741
344 Ga0070699_100290595 3300005518 Bacteria 1466
345 Ga0070699_100403511 3300005518 Unclassified 1236
346 Ga0070699_100696042 3300005518 Unclassified 928
347 Ga0070699_100723489 3300005518 Unclassified 910
348 Ga0070679_100000797 3300005530 Bacteria 27372
349 Ga0070679_100001091 3300005530 Bacteria 23751
350 Ga0070679_100159214 3300005530 Bacteria 2232
351 Ga0070684_100263437 3300005535 Bacteria 1577
352 Ga0070684_100500613 3300005535 Bacteria 1125
353 Ga0070684_100633784 3300005535 Bacteria 995
354 Ga0070684_100698411 3300005535 Bacteria 946
355 Ga0070697_100000155 3300005536 Bacteria 55402
356 Ga0070697_100000205 3300005536 Bacteria 48600
357 Ga0070697_100010667 3300005536 Bacteria 7172
358 Ga0070697_100012364 3300005536 Bacteria 6687
359 Ga0070697_100102832 3300005536 Unclassified 2374
360 Ga0070697_100135478 3300005536 Unclassified 2068
361 Ga0070697_100166061 3300005536 Bacteria 1866
362 Ga0070697_100182354 3300005536 Bacteria 1779
363 Ga0070697_100188907 3300005536 Bacteria 1748
364 Ga0070697_100196973 3300005536 Bacteria 1711
365 Ga0070697_100213928 3300005536 Unclassified 1642
366 Ga0070697_100277376 3300005536 Unclassified 1438
367 Ga0070697_100317819 3300005536 Bacteria 1340
368 Ga0070697_100420130 3300005536 Bacteria 1162
369 Ga0070697_100454809 3300005536 Bacteria 1116
370 Ga0068853_100002482 3300005539 Bacteria 13818
371 Ga0068853_100009445 3300005539 Bacteria 7858
372 Ga0068853_100019123 3300005539 Bacteria 5675
373 Ga0068853_100047228 3300005539 Bacteria 3694
374 Ga0068853_100055959 3300005539 Bacteria 3400
375 Ga0068853_100386123 3300005539 Bacteria 1308
376 Ga0068853_101415176 3300005539 Bacteria 673
377 Ga0068853_101631827 3300005539 Unclassified 625
378 Ga0070672_100014398 3300005543 Bacteria 5605
379 Ga0070672_100077694 3300005543 Bacteria 2655
380 Ga0070672_100693715 3300005543 Bacteria 891
381 Ga0070672_100731410 3300005543 Bacteria 868
382 Ga0070672_100961588 3300005543 Unclassified 756
383 Ga0070686_100001133 3300005544 Bacteria 15326
384 Ga0070686_100069827 3300005544 Bacteria 2296
385 Ga0070686_100098136 3300005544 Bacteria 1974
386 Ga0070686_100108160 3300005544 Unclassified 1889
387 Ga0070686_100125175 3300005544 Unclassified 1770
388 Ga0070686_100160897 3300005544 Bacteria 1581
389 Ga0070686_100313995 3300005544 Unclassified 1166
390 Ga0070686_100543088 3300005544 Unclassified 908
391 Ga0070686_100960797 3300005544 Unclassified 698
392 Ga0070695_100079556 3300005545 Bacteria 2164
393 Ga0070695_100080896 3300005545 Bacteria 2148
394 Ga0070695_100095384 3300005545 Bacteria 1993
395 Ga0070695_100111594 3300005545 Bacteria 1856
396 Ga0070695_100175514 3300005545 Unclassified 1514
397 Ga0070695_100176264 3300005545 Unclassified 1512
398 Ga0070695_100179168 3300005545 Bacteria 1500
399 Ga0070695_100187823 3300005545 Bacteria 1468
400 Ga0070695_100274574 3300005545 Unclassified 1236
401 Ga0070695_100281472 3300005545 Bacteria 1222
402 Ga0070695_100354240 3300005545 Bacteria 1100
403 Ga0070695_101108870 3300005545 Unclassified 648
404 Ga0070695_101361126 3300005545 Unclassified 588
405 Ga0070696_100019932 3300005546 Unclassified 4545
406 Ga0070696_100023964 3300005546 Bacteria 4147
407 Ga0070696_100040232 3300005546 Bacteria 3227
408 Ga0070696_100063781 3300005546 Bacteria 2581
409 Ga0070696_100120767 3300005546 Unclassified 1896
410 Ga0070696_100237954 3300005546 Unclassified 1372
411 Ga0070696_100321041 3300005546 Bacteria 1192
412 Ga0070696_100456591 3300005546 Unclassified 1009
413 Ga0070696_100550746 3300005546 Bacteria 924
414 Ga0070696_100602912 3300005546 Bacteria 886
415 Ga0070696_100673846 3300005546 Unclassified 841
416 Ga0070696_100786969 3300005546 Unclassified 782
417 Ga0070696_101000354 3300005546 Unclassified 698
418 Ga0070696_101051317 3300005546 Unclassified 682
419 Ga0070696_101594424 3300005546 Unclassified 561
420 Ga0070693_100001027 3300005547 Bacteria 12460
421 Ga0070693_100020106 3300005547 Bacteria 3515
422 Ga0070693_100040618 3300005547 Unclassified 2612
423 Ga0070693_100120448 3300005547 Bacteria 1627
424 Ga0070693_100146133 3300005547 Bacteria 1493
425 Ga0070693_100161362 3300005547 Bacteria 1428
426 Ga0070693_100231616 3300005547 Bacteria 1216
427 Ga0070693_100234541 3300005547 Bacteria 1209
428 Ga0070693_100260436 3300005547 Unclassified 1153
429 Ga0070693_100325100 3300005547 Unclassified 1045
430 Ga0070693_100356585 3300005547 Bacteria 1002
431 Ga0070693_100512654 3300005547 Bacteria 852
432 Ga0070693_100805751 3300005547 Unclassified 696
433 Ga0070665_102232576 3300005548 Unclassified 551
434 Ga0070665_102537069 3300005548 Unclassified 514
435 Ga0070704_100000638 3300005549 Bacteria 16925
436 Ga0070704_100011390 3300005549 Bacteria 5449
437 Ga0070704_100055340 3300005549 Bacteria 2812
438 Ga0070704_100094157 3300005549 Bacteria 2240
439 Ga0070704_100134596 3300005549 Unclassified 1921
440 Ga0070704_100142336 3300005549 Unclassified 1874
441 Ga0070704_100192071 3300005549 Bacteria 1642
442 Ga0070704_100225477 3300005549 Bacteria 1526
443 Ga0070704_100245537 3300005549 Bacteria 1467
444 Ga0070704_100298268 3300005549 Bacteria 1342
445 Ga0070704_100372851 3300005549 Bacteria 1210
446 Ga0070704_100407869 3300005549 Unclassified 1161
447 Ga0070704_100468200 3300005549 Unclassified 1088
448 Ga0070704_100529797 3300005549 Bacteria 1026
449 Ga0070704_101010391 3300005549 Unclassified 752
450 Ga0070704_101043703 3300005549 Unclassified 741
451 Ga0070704_101186742 3300005549 Unclassified 696
452 Ga0070704_101386499 3300005549 Unclassified 644
453 Ga0070704_101872853 3300005549 Unclassified 556
454 Ga0070704_102225550 3300005549 Unclassified 510
455 Ga0068855_100082116 3300005563 Unclassified 3735
456 Ga0068855_100123812 3300005563 Unclassified 2957
457 Ga0068855_101158766 3300005563 Bacteria 805
458 Ga0070664_100001593 3300005564 Bacteria 18144
459 Ga0070664_100019348 3300005564 Bacteria 5602
460 Ga0070664_100034374 3300005564 Bacteria 4252
461 Ga0070664_100110606 3300005564 Bacteria 2398
462 Ga0070664_100219134 3300005564 Bacteria 1702
463 Ga0070664_100250658 3300005564 Bacteria 1591
464 Ga0070664_100258816 3300005564 Bacteria 1565
465 Ga0070664_100295084 3300005564 Bacteria 1464
466 Ga0070664_100832186 3300005564 Bacteria 864
467 Ga0070664_100865431 3300005564 Unclassified 847
468 Ga0070664_100908978 3300005564 Bacteria 825
469 Ga0070664_101192161 3300005564 Bacteria 718
470 Ga0070664_102184821 3300005564 Unclassified 525
471 Ga0068857_100007456 3300005577 Bacteria 9414
472 Ga0068857_100162531 3300005577 Bacteria 2026
473 Ga0068857_100238232 3300005577 Bacteria 1665
474 Ga0068857_100334645 3300005577 Bacteria 1400
475 Ga0068857_100592349 3300005577 Bacteria 1047
476 Ga0068857_100707492 3300005577 Unclassified 957
477 Ga0068857_100841467 3300005577 Unclassified 878
478 Ga0068857_100977441 3300005577 Unclassified 814
479 Ga0068857_100979100 3300005577 Unclassified 813
480 Ga0068857_101937024 3300005577 Unclassified 577
481 Ga0068854_100066991 3300005578 Bacteria 2615
482 Ga0068854_100165762 3300005578 Bacteria 1715
483 Ga0068854_100222826 3300005578 Unclassified 1493
484 Ga0068854_100247555 3300005578 Bacteria 1422
485 Ga0068854_100309976 3300005578 Unclassified 1280
486 Ga0068854_100339251 3300005578 Bacteria 1227
487 Ga0068854_100506345 3300005578 Unclassified 1018
488 Ga0068854_100595120 3300005578 Bacteria 943
489 Ga0068854_100596486 3300005578 Bacteria 942
490 Ga0068854_100605661 3300005578 Bacteria 936
491 Ga0068854_100619376 3300005578 Unclassified 926
492 Ga0068854_100741171 3300005578 Unclassified 851
493 Ga0068854_100814971 3300005578 Unclassified 815
494 Ga0068854_100935980 3300005578 Unclassified 763
495 Ga0068854_101577272 3300005578 Unclassified 598
496 Ga0068854_102254851 3300005578 Bacteria 504
497 Ga0068856_100013790 3300005614 Bacteria 7812
498 Ga0068856_100377881 3300005614 Bacteria 1436
499 Ga0070702_100008168 3300005615 Bacteria 5056
500 Ga0070702_100083104 3300005615 Unclassified 1923
501 Ga0070702_100151910 3300005615 Bacteria 1487
502 Ga0070702_100154024 3300005615 Unclassified 1479
503 Ga0070702_100155020 3300005615 Unclassified 1474
504 Ga0070702_100165177 3300005615 Unclassified 1435
505 Ga0070702_100276673 3300005615 Unclassified 1150
506 Ga0070702_100308442 3300005615 Unclassified 1098
507 Ga0070702_100453731 3300005615 Bacteria 931
508 Ga0070702_100968627 3300005615 Bacteria 671
509 Ga0070702_100990839 3300005615 Unclassified 664
510 Ga0070702_101279812 3300005615 Bacteria 595
511 Ga0068852_100108736 3300005616 Bacteria 2517
512 Ga0068852_100178412 3300005616 Bacteria 1996
513 Ga0068852_101241939 3300005616 Unclassified 766
514 Ga0068852_101669583 3300005616 Bacteria 660
515 Ga0068852_102264094 3300005616 Bacteria 565
516 Ga0068852_102352623 3300005616 Unclassified 554
517 Ga0068859_100020868 3300005617 Bacteria 6575
518 Ga0068859_100021421 3300005617 Bacteria 6487
519 Ga0068859_100024568 3300005617 Bacteria 6045
520 Ga0068859_100044736 3300005617 Bacteria 4448
521 Ga0068859_100055086 3300005617 Unclassified 4001
522 Ga0068859_100070562 3300005617 Bacteria 3529
523 Ga0068859_100078004 3300005617 Bacteria 3353
524 Ga0068859_100105980 3300005617 Bacteria 2870
525 Ga0068859_100149850 3300005617 Unclassified 2408
526 Ga0068859_100200803 3300005617 Bacteria 2078
527 Ga0068859_100409209 3300005617 Bacteria 1452
528 Ga0068859_100647282 3300005617 Bacteria 1149
529 Ga0068859_100810856 3300005617 Unclassified 1023
530 Ga0068859_100880916 3300005617 Bacteria 980
531 Ga0068859_101080165 3300005617 Unclassified 882
532 Ga0068859_101094391 3300005617 Unclassified 876
533 Ga0068859_101170504 3300005617 Unclassified 846
534 Ga0068859_101186725 3300005617 Unclassified 840
535 Ga0068859_101193960 3300005617 Bacteria 838
536 Ga0068859_101416941 3300005617 Unclassified 766
537 Ga0068859_101513282 3300005617 Unclassified 741
538 Ga0068859_101688571 3300005617 Unclassified 699
539 Ga0068859_102262714 3300005617 Bacteria 599
540 Ga0068859_102373410 3300005617 Unclassified 585
541 Ga0068864_100005538 3300005618 Bacteria 10354
542 Ga0068864_100008111 3300005618 Bacteria 8660
543 Ga0068864_100040762 3300005618 Bacteria 3971
544 Ga0068864_100075005 3300005618 Unclassified 2952
545 Ga0068864_100078291 3300005618 Bacteria 2893
546 Ga0068864_100172601 3300005618 Bacteria 1972
547 Ga0068864_100181671 3300005618 Bacteria 1923
548 Ga0068864_100195558 3300005618 Unclassified 1855
549 Ga0068864_100203478 3300005618 Bacteria 1820
550 Ga0068864_100213940 3300005618 Bacteria 1776
551 Ga0068864_100484924 3300005618 Bacteria 1187
552 Ga0068864_100577812 3300005618 Bacteria 1089
553 Ga0068864_100701912 3300005618 Unclassified 988
554 Ga0068864_100791383 3300005618 Bacteria 931
555 Ga0068864_100866677 3300005618 Unclassified 890
556 Ga0068864_100876566 3300005618 Unclassified 885
557 Ga0068864_101218471 3300005618 Unclassified 752
558 Ga0068864_101344206 3300005618 Unclassified 715
559 Ga0068864_101398182 3300005618 Unclassified 701
560 Ga0068864_101634005 3300005618 Bacteria 649
561 Ga0068864_102149785 3300005618 Unclassified 564
562 Ga0068864_102654219 3300005618 Unclassified 507
563 Ga0068866_10009446 3300005718 Unclassified 4141
564 Ga0068866_10041764 3300005718 Bacteria 2278
565 Ga0068866_10130772 3300005718 Unclassified 1427
566 Ga0068866_10419960 3300005718 Unclassified 867
567 Ga0068861_100014138 3300005719 Bacteria 5598
568 Ga0068861_100018961 3300005719 Bacteria 4907
569 Ga0068861_100032844 3300005719 Unclassified 3824
570 Ga0068861_100077072 3300005719 Unclassified 2599
571 Ga0068861_100120200 3300005719 Unclassified 2118
572 Ga0068861_100158909 3300005719 Bacteria 1862
573 Ga0068861_100562295 3300005719 Bacteria 1041
574 Ga0068861_100588512 3300005719 Unclassified 1019
575 Ga0068861_100647537 3300005719 Unclassified 976
576 Ga0068861_101095075 3300005719 Unclassified 765
577 Ga0068861_101856969 3300005719 Unclassified 599
578 Ga0068861_102404359 3300005719 Unclassified 530
579 Ga0068851_10002483 3300005834 Bacteria 8106
580 Ga0068851_10028961 3300005834 Bacteria 2739
581 Ga0068851_10049073 3300005834 Bacteria 2140
582 Ga0068851_10079733 3300005834 Bacteria 1708
583 Ga0068851_10505632 3300005834 Bacteria 725
584 Ga0068851_10572181 3300005834 Bacteria 685
585 Ga0068870_10046463 3300005840 Unclassified 2277
586 Ga0068870_10674555 3300005840 Unclassified 710
587 Ga0068870_10762924 3300005840 Unclassified 673
588 Ga0068870_11154119 3300005840 Unclassified 559
589 Ga0068863_100009282 3300005841 Bacteria 9595
590 Ga0068863_100084843 3300005841 Unclassified 3001
591 Ga0068863_100086830 3300005841 Bacteria 2964
592 Ga0068863_100217664 3300005841 Unclassified 1839
593 Ga0068863_100274825 3300005841 Bacteria 1631
594 Ga0068863_100533521 3300005841 Bacteria 1158
595 Ga0068863_100609941 3300005841 Bacteria 1081
596 Ga0068863_100735823 3300005841 Bacteria 981
597 Ga0068863_101359847 3300005841 Unclassified 717
598 Ga0068863_101359910 3300005841 Bacteria 717
599 Ga0068863_101743218 3300005841 Bacteria 632
600 Ga0068863_101748588 3300005841 Unclassified 631
601 Ga0068863_101753752 3300005841 Unclassified 630
602 Ga0068863_102608383 3300005841 Unclassified 514
603 Ga0068858_100000008 3300005842 Bacteria 238361
604 Ga0068858_100065422 3300005842 Bacteria 3364
605 Ga0068858_100123156 3300005842 Bacteria 2426
606 Ga0068858_100165722 3300005842 Bacteria 2082
607 Ga0068858_100170948 3300005842 Bacteria 2049
608 Ga0068858_100185912 3300005842 Bacteria 1962
609 Ga0068858_100191906 3300005842 Bacteria 1930
610 Ga0068858_100210695 3300005842 Bacteria 1839
611 Ga0068858_100312237 3300005842 Bacteria 1501
612 Ga0068858_100322088 3300005842 Unclassified 1477
613 Ga0068858_100341351 3300005842 Unclassified 1433
614 Ga0068858_100343091 3300005842 Unclassified 1430
615 Ga0068858_100550737 3300005842 Bacteria 1117
616 Ga0068858_101372634 3300005842 Unclassified 696
617 Ga0068858_101462873 3300005842 Unclassified 673
618 Ga0068858_102471235 3300005842 Unclassified 513
619 Ga0068860_100003829 3300005843 Bacteria 15471
620 Ga0068860_100043301 3300005843 Bacteria 4295
621 Ga0068860_100058850 3300005843 Unclassified 3654
622 Ga0068860_100217941 3300005843 Unclassified 1853
623 Ga0068860_100342031 3300005843 Unclassified 1471
624 Ga0068860_100369436 3300005843 Bacteria 1414
625 Ga0068860_100388239 3300005843 Bacteria 1379
626 Ga0068860_100391879 3300005843 Bacteria 1373
627 Ga0068860_100408955 3300005843 Unclassified 1343
628 Ga0068860_100426055 3300005843 Bacteria 1316
629 Ga0068860_100461606 3300005843 Unclassified 1264
630 Ga0068860_100680614 3300005843 Bacteria 1038
631 Ga0068860_100831712 3300005843 Unclassified 937
632 Ga0068860_100931421 3300005843 Unclassified 885
633 Ga0068860_101281397 3300005843 Unclassified 753
634 Ga0068860_101549482 3300005843 Bacteria 684
635 Ga0068862_100035327 3300005844 Unclassified 4232
636 Ga0068862_100053564 3300005844 Bacteria 3454
637 Ga0068862_100099686 3300005844 Bacteria 2540
638 Ga0068862_100184254 3300005844 Unclassified 1875
639 Ga0068862_100289776 3300005844 Bacteria 1503
640 Ga0068862_100290383 3300005844 Unclassified 1501
641 Ga0068862_100300121 3300005844 Bacteria 1477
642 Ga0068862_100396312 3300005844 Unclassified 1290
643 Ga0068862_100535922 3300005844 Bacteria 1116
644 Ga0068862_101307084 3300005844 Bacteria 727
645 Ga0068862_101996785 3300005844 Bacteria 591
646 Ga0081455_10127815 3300005937 Bacteria 1991
647 Ga0081455_10827037 3300005937 Bacteria 580
648 Ga0081455_11012794 3300005937 Unclassified 514
649 Ga0081540_1269884 3300005983 Bacteria 589
650 Ga0081539_10000043 3300005985 Bacteria 288108
651 Ga0081539_10000239 3300005985 Bacteria 128819
652 Ga0081539_10002560 3300005985 Bacteria 25204
653 Ga0081539_10005773 3300005985 Bacteria 12340
654 Ga0081539_10036660 3300005985 Bacteria 2931
655 Ga0081539_10063712 3300005985 Bacteria 2010
656 Ga0081539_10148326 3300005985 Unclassified 1131
657 Ga0081539_10179901 3300005985 Bacteria 993
658 Ga0075432_10174576 3300006058 Unclassified 838
659 Ga0075432_10183566 3300006058 Unclassified 820
660 Ga0070715_10000031 3300006163 Bacteria 86230
661 Ga0070716_100000007 3300006173 Bacteria 256300
662 Ga0070716_100061133 3300006173 Bacteria 2179
663 Ga0070716_100285362 3300006173 Bacteria 1141
664 Ga0070716_100489502 3300006173 Unclassified 905
665 Ga0070716_100944288 3300006173 Unclassified 678
666 Ga0070716_101129837 3300006173 Bacteria 626
667 Ga0097621_100014473 3300006237 Bacteria 5903
668 Ga0097621_100060925 3300006237 Bacteria 3094
669 Ga0097621_100428458 3300006237 Bacteria 1188
670 Ga0097621_100574052 3300006237 Bacteria 1028
671 Ga0097621_100955395 3300006237 Bacteria 800
672 Ga0097621_101410234 3300006237 Bacteria 660
673 Ga0097621_101607677 3300006237 Unclassified 618
674 Ga0097621_101747823 3300006237 Unclassified 592
675 Ga0097621_101810270 3300006237 Unclassified 582
676 Ga0068871_100006157 3300006358 Bacteria 8456
677 Ga0068871_100040428 3300006358 Bacteria 3735
678 Ga0068871_100123033 3300006358 Unclassified 2193
679 Ga0068871_100679826 3300006358 Unclassified 942
680 Ga0068871_100741079 3300006358 Unclassified 902
681 Ga0068871_100901505 3300006358 Bacteria 819
682 Ga0068871_102057804 3300006358 Unclassified 544
683 Ga0075428_100096869 3300006844 Bacteria 3216
684 Ga0075428_100312649 3300006844 Bacteria 1689
685 Ga0075428_100418959 3300006844 Bacteria 1435
686 Ga0075428_101013906 3300006844 Unclassified 879
687 Ga0075430_100003709 3300006846 Bacteria 12833
688 Ga0075430_100105376 3300006846 Bacteria 2353
689 Ga0075430_101081017 3300006846 Unclassified 661
690 Ga0075431_100081177 3300006847 Bacteria 3348
691 Ga0075431_100171647 3300006847 Bacteria 2228
692 Ga0075431_100481551 3300006847 Bacteria 1234
693 Ga0075433_10026566 3300006852 Bacteria 4903
694 Ga0075433_10053141 3300006852 Unclassified 3531
695 Ga0075433_10058232 3300006852 Bacteria 3379
696 Ga0075433_10097408 3300006852 Bacteria 2603
697 Ga0075433_10114233 3300006852 Bacteria 2395
698 Ga0075433_10226243 3300006852 Bacteria 1661
699 Ga0075433_10278613 3300006852 Unclassified 1482
700 Ga0075433_10299111 3300006852 Bacteria 1425
701 Ga0075433_10299625 3300006852 Bacteria 1424
702 Ga0075433_10327671 3300006852 Bacteria 1354
703 Ga0075433_11580798 3300006852 Unclassified 566
704 Ga0075433_11774185 3300006852 Unclassified 531
705 Ga0075434_100024264 3300006871 Bacteria 5928
706 Ga0075434_100034748 3300006871 Bacteria 4980
707 Ga0075434_100156176 3300006871 Bacteria 2301
708 Ga0075434_100188880 3300006871 Bacteria 2080
709 Ga0075434_100206533 3300006871 Bacteria 1984
710 Ga0075434_100626936 3300006871 Bacteria 1094
711 Ga0075434_100652546 3300006871 Unclassified 1070
712 Ga0075434_100714577 3300006871 Bacteria 1019
713 Ga0075434_100735773 3300006871 Unclassified 1003
714 Ga0075434_100827760 3300006871 Unclassified 941
715 Ga0075434_101243069 3300006871 Unclassified 756
716 Ga0075434_101444314 3300006871 Unclassified 697
717 Ga0075429_100026020 3300006880 Bacteria 5078
718 Ga0075429_100086629 3300006880 Bacteria 2730
719 Ga0075429_100141042 3300006880 Unclassified 2109
720 Ga0075429_100196712 3300006880 Unclassified 1766
721 Ga0075429_100828955 3300006880 Bacteria 810
722 Ga0068865_100009576 3300006881 Bacteria 6013
723 Ga0068865_100115107 3300006881 Bacteria 1990
724 Ga0068865_100510628 3300006881 Bacteria 1003
725 Ga0068865_100520236 3300006881 Bacteria 995
726 Ga0068865_100636443 3300006881 Unclassified 905
727 Ga0075436_100004844 3300006914 Bacteria 9249
728 Ga0075436_100386245 3300006914 Bacteria 1013
729 Ga0075436_100467569 3300006914 Bacteria 920
730 Ga0097620_100020867 3300006931 Bacteria 6575
731 Ga0097620_100021422 3300006931 Bacteria 6487
732 Ga0097620_100024569 3300006931 Bacteria 6045
733 Ga0097620_100044738 3300006931 Bacteria 4448
734 Ga0097620_100055085 3300006931 Unclassified 4001
735 Ga0097620_100070551 3300006931 Bacteria 3529
736 Ga0097620_100078008 3300006931 Bacteria 3353
737 Ga0097620_100105979 3300006931 Bacteria 2870
738 Ga0097620_100149849 3300006931 Unclassified 2408
739 Ga0097620_100200811 3300006931 Bacteria 2078
740 Ga0097620_100409196 3300006931 Bacteria 1452
741 Ga0097620_100647395 3300006931 Bacteria 1149
742 Ga0097620_100810747 3300006931 Unclassified 1023
743 Ga0097620_100880927 3300006931 Bacteria 980
744 Ga0097620_101080110 3300006931 Unclassified 882
745 Ga0097620_101094318 3300006931 Unclassified 876
746 Ga0097620_101170489 3300006931 Unclassified 846
747 Ga0097620_101186737 3300006931 Unclassified 840
748 Ga0097620_101193644 3300006931 Bacteria 838
749 Ga0097620_101417009 3300006931 Unclassified 766
750 Ga0097620_101513451 3300006931 Unclassified 741
751 Ga0097620_101688563 3300006931 Unclassified 699
752 Ga0097620_102262809 3300006931 Bacteria 599
753 Ga0097620_102373448 3300006931 Unclassified 585
754 Ga0075435_100049727 3300007076 Unclassified 3372
755 Ga0075435_100276935 3300007076 Unclassified 1432
756 Ga0075435_100351385 3300007076 Bacteria 1264
757 Ga0075435_100598677 3300007076 Unclassified 956
758 Ga0075435_100842691 3300007076 Bacteria 799
759 Ga0099794_10022132 3300007265 Unclassified 2896
760 Ga0099794_10086451 3300007265 Bacteria 1553
761 Ga0105251_10081845 3300009011 Bacteria 1491
762 Ga0105250_10032491 3300009092 Bacteria 2096
763 Ga0105250_10182539 3300009092 Unclassified 881
764 Ga0105250_10189845 3300009092 Bacteria 864
765 Ga0105240_10027411 3300009093 Bacteria 7456
766 Ga0105240_10218903 3300009093 Bacteria 2219
767 Ga0105240_10221618 3300009093 Bacteria 2203
768 Ga0105240_10658693 3300009093 Unclassified 1147
769 Ga0105240_10685529 3300009093 Bacteria 1120
770 Ga0105240_11626371 3300009093 Bacteria 675
771 Ga0111539_10010730 3300009094 Bacteria 11530
772 Ga0111539_10013968 3300009094 Bacteria 10038
773 Ga0111539_10034502 3300009094 Bacteria 6134
774 Ga0111539_10107492 3300009094 Bacteria 3274
775 Ga0111539_10125939 3300009094 Bacteria 3001
776 Ga0111539_10197686 3300009094 Unclassified 2345
777 Ga0111539_10380973 3300009094 Unclassified 1642
778 Ga0111539_10678434 3300009094 Bacteria 1200
779 Ga0111539_10895653 3300009094 Bacteria 1032
780 Ga0111539_11235102 3300009094 Bacteria 868
781 Ga0111539_12066229 3300009094 Bacteria 661
782 Ga0111539_13067422 3300009094 Unclassified 539
783 Ga0105245_10008532 3300009098 Bacteria 8939
784 Ga0105245_10358338 3300009098 Unclassified 1447
785 Ga0105245_10594437 3300009098 Bacteria 1132
786 Ga0105245_10793083 3300009098 Unclassified 985
787 Ga0105245_10870528 3300009098 Bacteria 942
788 Ga0105245_11028032 3300009098 Bacteria 869
789 Ga0105245_11262982 3300009098 Unclassified 787
790 Ga0105245_11482143 3300009098 Bacteria 729
791 Ga0105245_11650060 3300009098 Unclassified 693
792 Ga0105245_12089003 3300009098 Unclassified 620
793 Ga0105247_10000001 3300009101 Bacteria 739726
794 Ga0105247_10081690 3300009101 Unclassified 2038
795 Ga0105247_10138873 3300009101 Bacteria 1590
796 Ga0105247_10587115 3300009101 Bacteria 824
797 Ga0105247_10661824 3300009101 Bacteria 781
798 Ga0105247_10890298 3300009101 Unclassified 686
799 Ga0105247_11337822 3300009101 Bacteria 577
800 Ga0114129_10005476 3300009147 Bacteria 17944
801 Ga0114129_10017890 3300009147 Bacteria 10088
802 Ga0114129_10045834 3300009147 Bacteria 6146
803 Ga0114129_10047639 3300009147 Bacteria 6022
804 Ga0114129_10090358 3300009147 Bacteria 4245
805 Ga0114129_10213209 3300009147 Bacteria 2609
806 Ga0114129_10300892 3300009147 Bacteria 2138
807 Ga0114129_10309907 3300009147 Unclassified 2101
808 Ga0114129_10355984 3300009147 Bacteria 1938
809 Ga0114129_10363965 3300009147 Bacteria 1913
810 Ga0114129_11119729 3300009147 Bacteria 985
811 Ga0114129_11126702 3300009147 Unclassified 981
812 Ga0114129_11345260 3300009147 Bacteria 883
813 Ga0114129_11626177 3300009147 Unclassified 790
814 Ga0114129_12156744 3300009147 Bacteria 671
815 Ga0114129_13180303 3300009147 Unclassified 535
816 Ga0105243_10000119 3300009148 Bacteria 91258
817 Ga0105243_10004942 3300009148 Bacteria 10444
818 Ga0105243_10013322 3300009148 Bacteria 6218
819 Ga0105243_10289445 3300009148 Unclassified 1479
820 Ga0105243_10301522 3300009148 Unclassified 1452
821 Ga0105243_10333732 3300009148 Unclassified 1386
822 Ga0105243_10476201 3300009148 Unclassified 1177
823 Ga0105243_10619094 3300009148 Unclassified 1045
824 Ga0105243_10696301 3300009148 Bacteria 990
825 Ga0105243_11006211 3300009148 Unclassified 836
826 Ga0105243_11100562 3300009148 Unclassified 803
827 Ga0105243_11151742 3300009148 Unclassified 786
828 Ga0105243_11414661 3300009148 Bacteria 716
829 Ga0105243_12782872 3300009148 Unclassified 530
830 Ga0105243_12976424 3300009148 Bacteria 514
831 Ga0105241_10102859 3300009174 Bacteria 2274
832 Ga0105241_10106832 3300009174 Bacteria 2234
833 Ga0105241_10176274 3300009174 Bacteria 1770
834 Ga0105241_10192225 3300009174 Bacteria 1700
835 Ga0105241_10304048 3300009174 Bacteria 1370
836 Ga0105241_10317024 3300009174 Bacteria 1343
837 Ga0105241_10349401 3300009174 Bacteria 1283
838 Ga0105241_10485403 3300009174 Bacteria 1099
839 Ga0105241_10524953 3300009174 Bacteria 1059
840 Ga0105241_10665552 3300009174 Unclassified 947
841 Ga0105241_10678226 3300009174 Unclassified 939
842 Ga0105241_10871033 3300009174 Unclassified 834
843 Ga0105241_11204664 3300009174 Unclassified 717
844 Ga0105241_11536491 3300009174 Unclassified 642
845 Ga0105241_11614081 3300009174 Unclassified 628
846 Ga0105241_11713988 3300009174 Bacteria 611
847 Ga0105242_10000113 3300009176 Bacteria 58633
848 Ga0105242_10004299 3300009176 Bacteria 11099
849 Ga0105242_10010627 3300009176 Bacteria 7068
850 Ga0105242_10067704 3300009176 Unclassified 2952
851 Ga0105242_10107097 3300009176 Bacteria 2377
852 Ga0105242_10231377 3300009176 Bacteria 1656
853 Ga0105242_10260890 3300009176 Unclassified 1565
854 Ga0105242_10472962 3300009176 Bacteria 1186
855 Ga0105242_10543083 3300009176 Unclassified 1113
856 Ga0105242_10842674 3300009176 Unclassified 912
857 Ga0105242_11193069 3300009176 Unclassified 780
858 Ga0105242_11645709 3300009176 Unclassified 677
859 Ga0105242_11994581 3300009176 Unclassified 622
860 Ga0105242_12247748 3300009176 Unclassified 591
861 Ga0105242_13263700 3300009176 Unclassified 504
862 Ga0105248_10062642 3300009177 Bacteria 4176
863 Ga0105248_10071853 3300009177 Bacteria 3888
864 Ga0105248_10072593 3300009177 Unclassified 3868
865 Ga0105248_10098050 3300009177 Bacteria 3302
866 Ga0105248_10103880 3300009177 Bacteria 3203
867 Ga0105248_10150142 3300009177 Unclassified 2629
868 Ga0105248_10173620 3300009177 Bacteria 2429
869 Ga0105248_10195936 3300009177 Unclassified 2276
870 Ga0105248_10269984 3300009177 Unclassified 1915
871 Ga0105248_10390234 3300009177 Unclassified 1567
872 Ga0105248_10409461 3300009177 Unclassified 1527
873 Ga0105248_10541022 3300009177 Unclassified 1314
874 Ga0105248_10578011 3300009177 Bacteria 1268
875 Ga0105248_10607460 3300009177 Bacteria 1234
876 Ga0105248_10683283 3300009177 Unclassified 1158
877 Ga0105248_10956220 3300009177 Unclassified 967
878 Ga0105248_11129214 3300009177 Unclassified 886
879 Ga0105248_11206862 3300009177 Bacteria 855
880 Ga0105248_11228766 3300009177 Bacteria 847
881 Ga0105248_11328425 3300009177 Unclassified 813
882 Ga0105248_11394873 3300009177 Unclassified 793
883 Ga0105248_11558213 3300009177 Unclassified 748
884 Ga0105248_12775589 3300009177 Bacteria 559
885 Ga0105248_12805905 3300009177 Unclassified 556
886 Ga0105237_10011061 3300009545 Bacteria 9568
887 Ga0105237_10056051 3300009545 Unclassified 3946
888 Ga0105237_10066585 3300009545 Unclassified 3597
889 Ga0105237_10118503 3300009545 Bacteria 2641
890 Ga0105237_10535835 3300009545 Unclassified 1177
891 Ga0105237_11224785 3300009545 Unclassified 757
892 Ga0105237_12222892 3300009545 Bacteria 558
893 Ga0105238_10030053 3300009551 Bacteria 5529
894 Ga0105238_10467445 3300009551 Bacteria 1259
895 Ga0105238_10719923 3300009551 Bacteria 1011
896 Ga0105238_10913464 3300009551 Unclassified 897
897 Ga0105238_12342741 3300009551 Bacteria 569
898 Ga0105249_10000028 3300009553 Bacteria 230039
899 Ga0105249_10014015 3300009553 Bacteria 7086
900 Ga0105249_10020461 3300009553 Bacteria 5916
901 Ga0105249_10023248 3300009553 Bacteria 5559
902 Ga0105249_10234655 3300009553 Unclassified 1811
903 Ga0105249_10253672 3300009553 Bacteria 1745
904 Ga0105249_10629744 3300009553 Bacteria 1129
905 Ga0105249_10758768 3300009553 Bacteria 1032
906 Ga0105249_11007524 3300009553 Bacteria 902
907 Ga0105249_11027243 3300009553 Unclassified 893
908 Ga0105249_11612003 3300009553 Unclassified 721
909 Ga0105249_11903286 3300009553 Unclassified 667
910 Ga0105249_12467153 3300009553 Unclassified 592
911 Ga0105249_13235024 3300009553 Bacteria 524
912 Ga0099796_10128767 3300010159 Bacteria 979
913 Ga0105239_10030724 3300010375 Bacteria 5908
914 Ga0105239_10107358 3300010375 Bacteria 3093
915 Ga0105239_10289529 3300010375 Bacteria 1844
916 Ga0105239_10369153 3300010375 Bacteria 1622
917 Ga0105239_10387134 3300010375 Bacteria 1581
918 Ga0105239_10718499 3300010375 Unclassified 1143
919 Ga0105239_10909736 3300010375 Unclassified 1010
920 Ga0105239_10919300 3300010375 Bacteria 1004
921 Ga0105239_11159379 3300010375 Unclassified 890
922 Ga0105239_11253958 3300010375 Bacteria 855
923 Ga0105239_11357612 3300010375 Bacteria 820
924 Ga0105239_12531326 3300010375 Unclassified 598
925 Ga0105239_12691519 3300010375 Unclassified 580
926 Ga0105239_12832121 3300010375 Unclassified 566
927 Ga0105246_10064958 3300011119 Bacteria 2551
928 Ga0105246_10069042 3300011119 Bacteria 2481
929 Ga0105246_10090250 3300011119 Bacteria 2206
930 Ga0105246_10205060 3300011119 Bacteria 1536
931 Ga0105246_10214471 3300011119 Bacteria 1505
932 Ga0105246_10621912 3300011119 Unclassified 936
933 Ga0105246_10770518 3300011119 Bacteria 851
934 Ga0105246_11162328 3300011119 Unclassified 708
935 Ga0105246_12047319 3300011119 Bacteria 553
936 Ga0105246_12203546 3300011119 Unclassified 536
937 Ga0105246_12297149 3300011119 Bacteria 527
938 Ga0157373_10062746 3300013100 Bacteria 2632
939 Ga0157373_10095110 3300013100 Bacteria 2097
940 Ga0157373_10103340 3300013100 Bacteria 2004
941 Ga0157373_10110346 3300013100 Bacteria 1934
942 Ga0157373_10123296 3300013100 Unclassified 1822
943 Ga0157373_10178303 3300013100 Bacteria 1496
944 Ga0157373_10340319 3300013100 Bacteria 1069
945 Ga0157371_10090052 3300013102 Bacteria 2173
946 Ga0157371_11009403 3300013102 Bacteria 635
947 Ga0157371_11145118 3300013102 Unclassified 598
948 Ga0157371_11234129 3300013102 Unclassified 577
949 Ga0157370_10072475 3300013104 Bacteria 3250
950 Ga0157370_10171697 3300013104 Bacteria 2015
951 Ga0157370_10311572 3300013104 Bacteria 1452
952 Ga0157369_10092662 3300013105 Unclassified 3225
953 Ga0157369_10152829 3300013105 Bacteria 2439
954 Ga0157369_11178088 3300013105 Unclassified 782
955 Ga0157374_10090602 3300013296 Unclassified 2915
956 Ga0157374_10198619 3300013296 Unclassified 1963
957 Ga0157374_10520036 3300013296 Unclassified 1196
958 Ga0157374_11183740 3300013296 Unclassified 785
959 Ga0157374_12026151 3300013296 Unclassified 602
960 Ga0157378_10000163 3300013297 Bacteria 63786
961 Ga0157378_10001554 3300013297 Bacteria 20717
962 Ga0157378_10008355 3300013297 Bacteria 9017
963 Ga0157378_10034190 3300013297 Bacteria 4496
964 Ga0157378_10050951 3300013297 Bacteria 3684
965 Ga0157378_10071515 3300013297 Bacteria 3115
966 Ga0157378_10083656 3300013297 Bacteria 2888
967 Ga0157378_10141412 3300013297 Bacteria 2235
968 Ga0157378_10154516 3300013297 Unclassified 2140
969 Ga0157378_10176542 3300013297 Unclassified 2007
970 Ga0157378_10276191 3300013297 Bacteria 1618
971 Ga0157378_10369683 3300013297 Unclassified 1405
972 Ga0157378_10372735 3300013297 Unclassified 1400
973 Ga0157378_10403538 3300013297 Bacteria 1347
974 Ga0157378_10694019 3300013297 Bacteria 1037
975 Ga0157378_10879809 3300013297 Unclassified 926
976 Ga0157378_11328606 3300013297 Bacteria 761
977 Ga0157378_11332982 3300013297 Bacteria 759
978 Ga0157378_11487946 3300013297 Unclassified 721
979 Ga0157378_11505329 3300013297 Bacteria 718
980 Ga0157378_11856754 3300013297 Unclassified 651
981 Ga0157378_13088911 3300013297 Unclassified 517
982 Ga0157378_13118554 3300013297 Unclassified 515
983 Ga0163162_10000027 3300013306 Bacteria 178451
984 Ga0163162_10001557 3300013306 Bacteria 21449
985 Ga0163162_10001819 3300013306 Bacteria 20050
986 Ga0163162_10013469 3300013306 Bacteria 7982
987 Ga0163162_10097421 3300013306 Unclassified 3030
988 Ga0163162_10105237 3300013306 Unclassified 2916
989 Ga0163162_10245321 3300013306 Bacteria 1923
990 Ga0163162_10246809 3300013306 Bacteria 1917
991 Ga0163162_10252071 3300013306 Unclassified 1897
992 Ga0163162_10832755 3300013306 Unclassified 1039
993 Ga0163162_11154320 3300013306 Unclassified 878
994 Ga0163162_11452240 3300013306 Unclassified 781
995 Ga0163162_11550111 3300013306 Unclassified 755
996 Ga0163162_12296345 3300013306 Unclassified 620
997 Ga0163162_12313769 3300013306 Bacteria 617
998 Ga0163162_12365236 3300013306 Unclassified 611
999 Ga0163162_12784382 3300013306 Unclassified 563
1000 Ga0163162_13098200 3300013306 Bacteria 534
1001 Ga0157372_10022333 3300013307 Bacteria 6845
1002 Ga0157372_10048333 3300013307 Bacteria 4729
1003 Ga0157372_10061654 3300013307 Unclassified 4200
1004 Ga0157372_10067477 3300013307 Bacteria 4019
1005 Ga0157372_10212217 3300013307 Bacteria 2243
1006 Ga0157372_10258165 3300013307 Bacteria 2023
1007 Ga0157372_10382096 3300013307 Bacteria 1641
1008 Ga0157372_10552124 3300013307 Bacteria 1343
1009 Ga0157372_10798386 3300013307 Bacteria 1097
1010 Ga0157372_10920488 3300013307 Bacteria 1014
1011 Ga0157372_11170491 3300013307 Unclassified 889
1012 Ga0157372_11250813 3300013307 Unclassified 857
1013 Ga0157372_11476518 3300013307 Bacteria 783
1014 Ga0157372_11538492 3300013307 Unclassified 766
1015 Ga0157372_11603615 3300013307 Bacteria 749
1016 Ga0157372_11621976 3300013307 Unclassified 745
1017 Ga0157372_12290610 3300013307 Unclassified 620
1018 Ga0157375_10127326 3300013308 Bacteria 2663
1019 Ga0157375_10149716 3300013308 Bacteria 2468
1020 Ga0157375_10180319 3300013308 Unclassified 2263
1021 Ga0157375_10234970 3300013308 Bacteria 1992
1022 Ga0157375_10422077 3300013308 Unclassified 1500
1023 Ga0157375_10728102 3300013308 Unclassified 1144
1024 Ga0157375_10907609 3300013308 Bacteria 1025
1025 Ga0157375_11029304 3300013308 Unclassified 962
1026 Ga0157375_11056874 3300013308 Bacteria 949
1027 Ga0157375_11107456 3300013308 Bacteria 927
1028 Ga0157375_11265361 3300013308 Bacteria 867
1029 Ga0157375_11533538 3300013308 Unclassified 787
1030 Ga0157375_12921044 3300013308 Unclassified 571
1031 Ga0163163_10009872 3300014325 Bacteria 8552
1032 Ga0163163_10023334 3300014325 Bacteria 5869
1033 Ga0163163_10028121 3300014325 Bacteria 5395
1034 Ga0163163_10047001 3300014325 Bacteria 4241
1035 Ga0163163_10069074 3300014325 Bacteria 3517
1036 Ga0163163_10074742 3300014325 Unclassified 3381
1037 Ga0163163_10173703 3300014325 Bacteria 2201
1038 Ga0163163_10194128 3300014325 Bacteria 2078
1039 Ga0163163_10219841 3300014325 Bacteria 1948
1040 Ga0163163_10382573 3300014325 Bacteria 1465
1041 Ga0163163_10590841 3300014325 Bacteria 1173
1042 Ga0163163_10747604 3300014325 Bacteria 1041
1043 Ga0163163_10920304 3300014325 Bacteria 938
1044 Ga0163163_10971526 3300014325 Unclassified 913
1045 Ga0163163_11082087 3300014325 Unclassified 865
1046 Ga0163163_11369727 3300014325 Unclassified 769
1047 Ga0163163_11462368 3300014325 Bacteria 745
1048 Ga0163163_11576416 3300014325 Unclassified 718
1049 Ga0163163_12025065 3300014325 Unclassified 635
1050 Ga0163163_12197803 3300014325 Unclassified 611
1051 Ga0163163_12896893 3300014325 Bacteria 535
1052 Ga0157380_10001451 3300014326 Bacteria 15515
1053 Ga0157380_10002205 3300014326 Bacteria 13098
1054 Ga0157380_10024802 3300014326 Bacteria 4543
1055 Ga0157380_10043883 3300014326 Bacteria 3501
1056 Ga0157380_10097636 3300014326 Bacteria 2439
1057 Ga0157380_10111079 3300014326 Unclassified 2304
1058 Ga0157380_10318596 3300014326 Unclassified 1441
1059 Ga0157380_10416654 3300014326 Bacteria 1280
1060 Ga0157380_11106312 3300014326 Bacteria 832
1061 Ga0157380_11325256 3300014326 Unclassified 768
1062 Ga0157380_12370458 3300014326 Unclassified 596
1063 Ga0157380_12649011 3300014326 Unclassified 568
1064 Ga0157380_12728529 3300014326 Unclassified 560
1065 Ga0157380_13484822 3300014326 Unclassified 504
1066 Ga0182008_10194375 3300014497 Unclassified 1030
1067 Ga0182008_10215041 3300014497 Bacteria 982
1068 Ga0157377_10084179 3300014745 Unclassified 1865
1069 Ga0157377_10136532 3300014745 Bacteria 1503
1070 Ga0157377_10158760 3300014745 Bacteria 1404
1071 Ga0157377_10278711 3300014745 Unclassified 1095
1072 Ga0157377_10283269 3300014745 Bacteria 1087
1073 Ga0157377_10342555 3300014745 Bacteria 1000
1074 Ga0157377_10876027 3300014745 Unclassified 669
1075 Ga0157377_11193498 3300014745 Bacteria 589
1076 Ga0157379_10042678 3300014968 Bacteria 4049
1077 Ga0157379_10073922 3300014968 Bacteria 3052
1078 Ga0157379_10077774 3300014968 Bacteria 2971
1079 Ga0157379_10451939 3300014968 Bacteria 1186
1080 Ga0157379_10769566 3300014968 Unclassified 907
1081 Ga0157379_10858370 3300014968 Unclassified 859
1082 Ga0157379_10935016 3300014968 Unclassified 824
1083 Ga0157379_11183837 3300014968 Unclassified 735
1084 Ga0157379_11387027 3300014968 Bacteria 681
1085 Ga0157379_11865313 3300014968 Bacteria 592
1086 Ga0157376_10011187 3300014969 Bacteria 6603
1087 Ga0157376_10406943 3300014969 Bacteria 1317
1088 Ga0157376_10474687 3300014969 Bacteria 1224
1089 Ga0182005_1041260 3300015265 Bacteria 1255
1090 Ga0163161_10005583 3300017792 Bacteria 8720
1091 Ga0163161_10010405 3300017792 Bacteria 6441
1092 Ga0163161_10025611 3300017792 Bacteria 4176
1093 Ga0163161_10231932 3300017792 Unclassified 1433
1094 Ga0163161_10446788 3300017792 Bacteria 1044
1095 Ga0163161_10516072 3300017792 Bacteria 975
1096 Ga0163161_11219518 3300017792 Bacteria 651
1097 Ga0213876_10000102 3300021384 Bacteria 94958
1098 Ga0213876_10000277 3300021384 Bacteria 47161
1099 Ga0207697_10009354 3300025315 Bacteria 4239
1100 Ga0207697_10037174 3300025315 Bacteria 1994
1101 Ga0207656_10016582 3300025321 Unclassified 2870
1102 Ga0207656_10155106 3300025321 Bacteria 1086
1103 Ga0207713_1142031 3300025735 Bacteria 783
1104 Ga0207653_10000948 3300025885 Bacteria 9584
1105 Ga0207682_10049097 3300025893 Bacteria 1741
1106 Ga0207682_10169765 3300025893 Unclassified 992
1107 Ga0207642_10002306 3300025899 Bacteria 5944
1108 Ga0207642_10022160 3300025899 Bacteria 2514
1109 Ga0207642_10272013 3300025899 Unclassified 971
1110 Ga0207710_10000003 3300025900 Bacteria 1071597
1111 Ga0207710_10024784 3300025900 Unclassified 2586
1112 Ga0207710_10048922 3300025900 Bacteria 1893
1113 Ga0207710_10112482 3300025900 Bacteria 1294
1114 Ga0207710_10180533 3300025900 Unclassified 1035
1115 Ga0207710_10352063 3300025900 Bacteria 750
1116 Ga0207710_10475166 3300025900 Unclassified 647
1117 Ga0207688_10266886 3300025901 Bacteria 1040
1118 Ga0207680_10067934 3300025903 Bacteria 2197
1119 Ga0207680_10069536 3300025903 Unclassified 2176
1120 Ga0207647_10001815 3300025904 Bacteria 16384
1121 Ga0207647_10094662 3300025904 Bacteria 1779
1122 Ga0207647_10107490 3300025904 Bacteria 1651
1123 Ga0207685_10000007 3300025905 Bacteria 278341
1124 Ga0207699_10855810 3300025906 Unclassified 670
1125 Ga0207699_11338716 3300025906 Unclassified 530
1126 Ga0207645_10064242 3300025907 Unclassified 2345
1127 Ga0207645_10176216 3300025907 Unclassified 1402
1128 Ga0207645_10830273 3300025907 Unclassified 628
1129 Ga0207643_10009763 3300025908 Bacteria 5151
1130 Ga0207643_10057712 3300025908 Unclassified 2211
1131 Ga0207643_10101088 3300025908 Unclassified 1691
1132 Ga0207643_10109604 3300025908 Unclassified 1626
1133 Ga0207643_10436908 3300025908 Unclassified 831
1134 Ga0207643_10787016 3300025908 Unclassified 616
1135 Ga0207643_10868303 3300025908 Unclassified 585
1136 Ga0207684_10000170 3300025910 Bacteria 107800
1137 Ga0207684_10019633 3300025910 Bacteria 5781
1138 Ga0207684_10036958 3300025910 Bacteria 4145
1139 Ga0207684_10086334 3300025910 Unclassified 2673
1140 Ga0207684_10093579 3300025910 Unclassified 2563
1141 Ga0207684_10103112 3300025910 Bacteria 2439
1142 Ga0207684_10200233 3300025910 Bacteria 1723
1143 Ga0207684_10259931 3300025910 Bacteria 1498
1144 Ga0207684_10419270 3300025910 Unclassified 1150
1145 Ga0207654_10005182 3300025911 Bacteria 6575
1146 Ga0207654_10110418 3300025911 Unclassified 1710
1147 Ga0207654_10190310 3300025911 Bacteria 1344
1148 Ga0207654_10218601 3300025911 Bacteria 1263
1149 Ga0207654_10340484 3300025911 Bacteria 1030
1150 Ga0207654_10410130 3300025911 Unclassified 944
1151 Ga0207654_10781507 3300025911 Unclassified 689
1152 Ga0207654_10977504 3300025911 Unclassified 615
1153 Ga0207654_11223755 3300025911 Unclassified 547
1154 Ga0207707_10000015 3300025912 Bacteria 259670
1155 Ga0207707_10008748 3300025912 Bacteria 8787
1156 Ga0207707_10015435 3300025912 Bacteria 6653
1157 Ga0207707_10113718 3300025912 Unclassified 2365
1158 Ga0207707_10178413 3300025912 Unclassified 1855
1159 Ga0207695_10224757 3300025913 Unclassified 1784
1160 Ga0207695_10534985 3300025913 Unclassified 1053
1161 Ga0207695_10569196 3300025913 Bacteria 1014
1162 Ga0207695_10894480 3300025913 Bacteria 768
1163 Ga0207695_10959196 3300025913 Unclassified 735
1164 Ga0207695_11230326 3300025913 Unclassified 629
1165 Ga0207671_10000958 3300025914 Bacteria 35832
1166 Ga0207671_10210336 3300025914 Bacteria 1521
1167 Ga0207671_10413585 3300025914 Bacteria 1073
1168 Ga0207671_10440118 3300025914 Unclassified 1038
1169 Ga0207663_11207957 3300025916 Bacteria 609
1170 Ga0207660_10001103 3300025917 Bacteria 18024
1171 Ga0207660_10010882 3300025917 Bacteria 5915
1172 Ga0207660_10079617 3300025917 Bacteria 2404
1173 Ga0207660_10772129 3300025917 Unclassified 784
1174 Ga0207662_10002814 3300025918 Bacteria 8798
1175 Ga0207662_10033436 3300025918 Bacteria 2997
1176 Ga0207662_10043959 3300025918 Bacteria 2636
1177 Ga0207662_10059477 3300025918 Bacteria 2290
1178 Ga0207662_10104004 3300025918 Unclassified 1763
1179 Ga0207662_10195794 3300025918 Bacteria 1306
1180 Ga0207662_10284955 3300025918 Bacteria 1094
1181 Ga0207662_10334641 3300025918 Bacteria 1013
1182 Ga0207662_10364492 3300025918 Unclassified 973
1183 Ga0207662_10380098 3300025918 Bacteria 954
1184 Ga0207662_10698942 3300025918 Unclassified 711
1185 Ga0207657_10546050 3300025919 Unclassified 906
1186 Ga0207657_10689536 3300025919 Bacteria 794
1187 Ga0207649_10040447 3300025920 Bacteria 2834
1188 Ga0207649_10044914 3300025920 Unclassified 2707
1189 Ga0207649_10143064 3300025920 Unclassified 1639
1190 Ga0207649_10316372 3300025920 Bacteria 1145
1191 Ga0207649_10560789 3300025920 Bacteria 875
1192 Ga0207649_11120229 3300025920 Unclassified 621
1193 Ga0207649_11470604 3300025920 Unclassified 539
1194 Ga0207652_10000252 3300025921 Bacteria 55772
1195 Ga0207652_10988215 3300025921 Bacteria 740
1196 Ga0207646_10003914 3300025922 Bacteria 16534
1197 Ga0207646_10049029 3300025922 Unclassified 3783
1198 Ga0207646_10063422 3300025922 Bacteria 3299
1199 Ga0207646_10079652 3300025922 Unclassified 2929
1200 Ga0207646_10124291 3300025922 Unclassified 2319
1201 Ga0207646_10584162 3300025922 Bacteria 1003
1202 Ga0207646_10854790 3300025922 Unclassified 809
1203 Ga0207681_10005772 3300025923 Bacteria 7591
1204 Ga0207681_10006488 3300025923 Bacteria 7181
1205 Ga0207681_10022095 3300025923 Bacteria 4053
1206 Ga0207681_10036809 3300025923 Bacteria 3231
1207 Ga0207681_10113375 3300025923 Bacteria 1976
1208 Ga0207681_10563264 3300025923 Bacteria 939
1209 Ga0207681_10694335 3300025923 Bacteria 846
1210 Ga0207681_10800936 3300025923 Bacteria 787
1211 Ga0207681_11069120 3300025923 Unclassified 677
1212 Ga0207681_11238412 3300025923 Unclassified 627
1213 Ga0207681_11304117 3300025923 Bacteria 610
1214 Ga0207694_10004960 3300025924 Bacteria 10306
1215 Ga0207694_10068494 3300025924 Bacteria 2771
1216 Ga0207650_10000005 3300025925 Bacteria 663190
1217 Ga0207650_10001694 3300025925 Bacteria 15668
1218 Ga0207650_10047533 3300025925 Bacteria 3162
1219 Ga0207650_10114046 3300025925 Bacteria 2096
1220 Ga0207650_10118649 3300025925 Bacteria 2057
1221 Ga0207650_10180046 3300025925 Unclassified 1684
1222 Ga0207650_10257644 3300025925 Bacteria 1414
1223 Ga0207650_10316409 3300025925 Bacteria 1277
1224 Ga0207650_10403790 3300025925 Bacteria 1131
1225 Ga0207650_10498050 3300025925 Bacteria 1018
1226 Ga0207650_10543558 3300025925 Bacteria 974
1227 Ga0207650_10633926 3300025925 Bacteria 900
1228 Ga0207650_10775976 3300025925 Unclassified 812
1229 Ga0207659_10373815 3300025926 Unclassified 1187
1230 Ga0207659_10459101 3300025926 Bacteria 1074
1231 Ga0207659_10568740 3300025926 Unclassified 964
1232 Ga0207659_11032480 3300025926 Unclassified 707
1233 Ga0207659_11083540 3300025926 Unclassified 689
1234 Ga0207687_10133222 3300025927 Unclassified 1876
1235 Ga0207687_10841384 3300025927 Unclassified 784
1236 Ga0207687_10886191 3300025927 Unclassified 763
1237 Ga0207687_11317472 3300025927 Bacteria 621
1238 Ga0207644_10000209 3300025931 Bacteria 40524
1239 Ga0207644_10007515 3300025931 Bacteria 7106
1240 Ga0207644_10018688 3300025931 Bacteria 4692
1241 Ga0207644_10077140 3300025931 Bacteria 2453
1242 Ga0207644_10224780 3300025931 Bacteria 1489
1243 Ga0207644_10330400 3300025931 Unclassified 1234
1244 Ga0207690_10094122 3300025932 Bacteria 2125
1245 Ga0207690_10165270 3300025932 Bacteria 1653
1246 Ga0207690_10202760 3300025932 Bacteria 1507
1247 Ga0207690_11130193 3300025932 Unclassified 653
1248 Ga0207690_11469818 3300025932 Unclassified 570
1249 Ga0207706_10068958 3300025933 Bacteria 3110
1250 Ga0207706_10089618 3300025933 Unclassified 2704
1251 Ga0207706_10240155 3300025933 Bacteria 1584
1252 Ga0207706_10319637 3300025933 Bacteria 1351
1253 Ga0207706_10409390 3300025933 Unclassified 1175
1254 Ga0207706_11365577 3300025933 Unclassified 583
1255 Ga0207686_10000114 3300025934 Bacteria 64832
1256 Ga0207686_10000400 3300025934 Bacteria 30163
1257 Ga0207686_10006928 3300025934 Bacteria 6102
1258 Ga0207686_10019085 3300025934 Bacteria 3893
1259 Ga0207686_10026180 3300025934 Bacteria 3401
1260 Ga0207686_10031105 3300025934 Bacteria 3167
1261 Ga0207686_10075397 3300025934 Bacteria 2183
1262 Ga0207686_10450241 3300025934 Unclassified 990
1263 Ga0207686_10662521 3300025934 Unclassified 827
1264 Ga0207686_11257672 3300025934 Unclassified 607
1265 Ga0207709_10000162 3300025935 Bacteria 91279
1266 Ga0207709_10002929 3300025935 Bacteria 10423
1267 Ga0207709_10058798 3300025935 Bacteria 2391
1268 Ga0207709_10334193 3300025935 Bacteria 1138
1269 Ga0207709_10398188 3300025935 Unclassified 1052
1270 Ga0207709_10427051 3300025935 Unclassified 1019
1271 Ga0207709_10787701 3300025935 Unclassified 767
1272 Ga0207709_10821343 3300025935 Bacteria 751
1273 Ga0207670_10036048 3300025936 Unclassified 3214
1274 Ga0207670_10070067 3300025936 Bacteria 2421
1275 Ga0207670_10393594 3300025936 Unclassified 1106
1276 Ga0207670_10396242 3300025936 Bacteria 1103
1277 Ga0207670_10603808 3300025936 Unclassified 901
1278 Ga0207670_10738278 3300025936 Bacteria 817
1279 Ga0207670_11443971 3300025936 Unclassified 584
1280 Ga0207670_11836590 3300025936 Unclassified 515
1281 Ga0207669_10284224 3300025937 Bacteria 1249
1282 Ga0207669_11581955 3300025937 Bacteria 559
1283 Ga0207704_10080963 3300025938 Unclassified 2098
1284 Ga0207704_10444825 3300025938 Unclassified 1033
1285 Ga0207704_10519736 3300025938 Unclassified 962
1286 Ga0207704_10744986 3300025938 Unclassified 814
1287 Ga0207665_10000018 3300025939 Bacteria 122653
1288 Ga0207665_10047602 3300025939 Unclassified 2875
1289 Ga0207665_10126614 3300025939 Bacteria 1809
1290 Ga0207665_10182251 3300025939 Unclassified 1521
1291 Ga0207665_10265017 3300025939 Bacteria 1274
1292 Ga0207665_10478505 3300025939 Bacteria 959
1293 Ga0207665_10958669 3300025939 Bacteria 680
1294 Ga0207691_10005480 3300025940 Bacteria 12254
1295 Ga0207691_10011710 3300025940 Bacteria 8422
1296 Ga0207691_10221603 3300025940 Unclassified 1640
1297 Ga0207691_10283457 3300025940 Bacteria 1425
1298 Ga0207691_11035407 3300025940 Bacteria 684
1299 Ga0207691_11065415 3300025940 Unclassified 673
1300 Ga0207711_10004919 3300025941 Bacteria 11344
1301 Ga0207711_10044927 3300025941 Unclassified 3773
1302 Ga0207711_10054983 3300025941 Bacteria 3417
1303 Ga0207711_10101440 3300025941 Bacteria 2547
1304 Ga0207711_10108714 3300025941 Unclassified 2464
1305 Ga0207711_10192914 3300025941 Bacteria 1857
1306 Ga0207711_10365493 3300025941 Bacteria 1337
1307 Ga0207711_10436521 3300025941 Unclassified 1218
1308 Ga0207711_10475339 3300025941 Unclassified 1164
1309 Ga0207711_10523454 3300025941 Unclassified 1106
1310 Ga0207711_10828604 3300025941 Unclassified 861
1311 Ga0207711_11959275 3300025941 Unclassified 529
1312 Ga0207689_10004566 3300025942 Bacteria 12534
1313 Ga0207689_10037086 3300025942 Bacteria 4045
1314 Ga0207689_10057085 3300025942 Unclassified 3212
1315 Ga0207689_10065176 3300025942 Bacteria 2997
1316 Ga0207689_10251785 3300025942 Bacteria 1460
1317 Ga0207689_10262503 3300025942 Bacteria 1429
1318 Ga0207689_10556010 3300025942 Unclassified 964
1319 Ga0207689_10680662 3300025942 Bacteria 867
1320 Ga0207689_10767911 3300025942 Bacteria 813
1321 Ga0207689_10818446 3300025942 Unclassified 786
1322 Ga0207689_10894665 3300025942 Unclassified 749
1323 Ga0207689_11066735 3300025942 Bacteria 681
1324 Ga0207661_10431236 3300025944 Bacteria 1198
1325 Ga0207679_10007735 3300025945 Bacteria 6829
1326 Ga0207679_10049367 3300025945 Bacteria 3070
1327 Ga0207679_10068310 3300025945 Unclassified 2669
1328 Ga0207679_10095263 3300025945 Bacteria 2313
1329 Ga0207679_10587018 3300025945 Bacteria 1003
1330 Ga0207679_10647977 3300025945 Bacteria 955
1331 Ga0207679_10716643 3300025945 Bacteria 909
1332 Ga0207679_11034252 3300025945 Unclassified 753
1333 Ga0207679_11060397 3300025945 Unclassified 743
1334 Ga0207679_11256571 3300025945 Unclassified 680
1335 Ga0207679_11792415 3300025945 Unclassified 561
1336 Ga0207667_10036979 3300025949 Bacteria 5224
1337 Ga0207667_10150953 3300025949 Unclassified 2391
1338 Ga0207667_10543477 3300025949 Bacteria 1175
1339 Ga0207667_10574190 3300025949 Bacteria 1139
1340 Ga0207667_11021183 3300025949 Bacteria 813
1341 Ga0207651_10012707 3300025960 Unclassified 4779
1342 Ga0207651_10030462 3300025960 Bacteria 3436
1343 Ga0207651_10108245 3300025960 Bacteria 2080
1344 Ga0207651_10145698 3300025960 Bacteria 1836
1345 Ga0207651_10260360 3300025960 Bacteria 1424
1346 Ga0207651_10326001 3300025960 Bacteria 1285
1347 Ga0207651_10331965 3300025960 Unclassified 1275
1348 Ga0207651_10410654 3300025960 Bacteria 1153
1349 Ga0207651_10710345 3300025960 Unclassified 886
1350 Ga0207651_10986522 3300025960 Bacteria 752
1351 Ga0207651_11793364 3300025960 Unclassified 552
1352 Ga0207651_11837560 3300025960 Unclassified 545
1353 Ga0207712_10000110 3300025961 Bacteria 89234
1354 Ga0207712_10012290 3300025961 Bacteria 5471
1355 Ga0207712_10017368 3300025961 Bacteria 4672
1356 Ga0207712_10021709 3300025961 Bacteria 4217
1357 Ga0207712_10121896 3300025961 Bacteria 1974
1358 Ga0207712_10238367 3300025961 Unclassified 1464
1359 Ga0207712_10257828 3300025961 Bacteria 1413
1360 Ga0207712_10523236 3300025961 Unclassified 1017
1361 Ga0207712_10538632 3300025961 Bacteria 1003
1362 Ga0207712_10622259 3300025961 Bacteria 936
1363 Ga0207712_10922584 3300025961 Unclassified 772
1364 Ga0207668_10015518 3300025972 Bacteria 4735
1365 Ga0207668_10483142 3300025972 Bacteria 1063
1366 Ga0207640_10209869 3300025981 Bacteria 1483
1367 Ga0207640_10227447 3300025981 Unclassified 1432
1368 Ga0207640_10391746 3300025981 Unclassified 1129
1369 Ga0207640_10422111 3300025981 Unclassified 1092
1370 Ga0207640_10439666 3300025981 Bacteria 1072
1371 Ga0207640_10581708 3300025981 Unclassified 945
1372 Ga0207640_11244336 3300025981 Unclassified 663
1373 Ga0207640_11990223 3300025981 Unclassified 526
1374 Ga0207658_10196267 3300025986 Bacteria 1681
1375 Ga0207658_10808428 3300025986 Unclassified 851
1376 Ga0207677_10030542 3300026023 Bacteria 3441
1377 Ga0207677_10144422 3300026023 Bacteria 1827
1378 Ga0207677_10221622 3300026023 Bacteria 1517
1379 Ga0207677_10410939 3300026023 Bacteria 1150
1380 Ga0207677_10614925 3300026023 Unclassified 955
1381 Ga0207677_11572603 3300026023 Unclassified 608
1382 Ga0207677_12081629 3300026023 Bacteria 528
1383 Ga0207703_10000354 3300026035 Bacteria 49391
1384 Ga0207703_10030675 3300026035 Bacteria 4249
1385 Ga0207703_10045085 3300026035 Bacteria 3546
1386 Ga0207703_10057479 3300026035 Bacteria 3172
1387 Ga0207703_10105027 3300026035 Unclassified 2401
1388 Ga0207703_10280311 3300026035 Unclassified 1513
1389 Ga0207703_10468992 3300026035 Bacteria 1178
1390 Ga0207703_10884731 3300026035 Unclassified 855
1391 Ga0207703_10950271 3300026035 Bacteria 824
1392 Ga0207703_10958384 3300026035 Unclassified 820
1393 Ga0207703_10972656 3300026035 Bacteria 814
1394 Ga0207703_11296928 3300026035 Unclassified 700
1395 Ga0207703_11304613 3300026035 Bacteria 698
1396 Ga0207703_11485294 3300026035 Unclassified 652
1397 Ga0207703_11553978 3300026035 Bacteria 637
1398 Ga0207703_11603271 3300026035 Unclassified 626
1399 Ga0207639_10022288 3300026041 Unclassified 4561
1400 Ga0207639_10029011 3300026041 Bacteria 4046
1401 Ga0207639_10067826 3300026041 Bacteria 2777
1402 Ga0207639_10120554 3300026041 Unclassified 2154
1403 Ga0207639_10212778 3300026041 Unclassified 1665
1404 Ga0207639_10381317 3300026041 Bacteria 1266
1405 Ga0207639_10736273 3300026041 Bacteria 916
1406 Ga0207639_10863911 3300026041 Unclassified 845
1407 Ga0207639_11023959 3300026041 Unclassified 774
1408 Ga0207639_11136222 3300026041 Unclassified 733
1409 Ga0207678_11540782 3300026067 Unclassified 586
1410 Ga0207708_10000043 3300026075 Bacteria 121725
1411 Ga0207708_10008562 3300026075 Bacteria 7569
1412 Ga0207708_10080486 3300026075 Bacteria 2503
1413 Ga0207708_10091884 3300026075 Bacteria 2341
1414 Ga0207708_10098786 3300026075 Unclassified 2257
1415 Ga0207708_10116230 3300026075 Bacteria 2081
1416 Ga0207708_10177441 3300026075 Bacteria 1690
1417 Ga0207708_10178691 3300026075 Bacteria 1684
1418 Ga0207708_10951789 3300026075 Unclassified 745
1419 Ga0207702_10009027 3300026078 Bacteria 8397
1420 Ga0207702_12077363 3300026078 Bacteria 558
1421 Ga0207641_10042907 3300026088 Unclassified 3796
1422 Ga0207641_10043453 3300026088 Bacteria 3774
1423 Ga0207641_10072372 3300026088 Unclassified 2968
1424 Ga0207641_10177448 3300026088 Unclassified 1949
1425 Ga0207641_10399291 3300026088 Bacteria 1320
1426 Ga0207641_10439481 3300026088 Unclassified 1259
1427 Ga0207641_10490034 3300026088 Bacteria 1192
1428 Ga0207641_10665904 3300026088 Unclassified 1023
1429 Ga0207641_10792588 3300026088 Unclassified 937
1430 Ga0207641_11085107 3300026088 Unclassified 799
1431 Ga0207641_11932658 3300026088 Unclassified 591
1432 Ga0207641_12117418 3300026088 Unclassified 563
1433 Ga0207648_10013061 3300026089 Bacteria 7744
1434 Ga0207648_10069732 3300026089 Bacteria 3063
1435 Ga0207648_10293972 3300026089 Bacteria 1455
1436 Ga0207648_10378199 3300026089 Bacteria 1280
1437 Ga0207648_10391305 3300026089 Bacteria 1258
1438 Ga0207648_10396564 3300026089 Bacteria 1250
1439 Ga0207648_10424307 3300026089 Unclassified 1208
1440 Ga0207648_10536464 3300026089 Bacteria 1073
1441 Ga0207648_10595373 3300026089 Bacteria 1019
1442 Ga0207648_10640379 3300026089 Unclassified 982
1443 Ga0207648_10667869 3300026089 Bacteria 961
1444 Ga0207648_10827179 3300026089 Unclassified 863
1445 Ga0207648_11060720 3300026089 Bacteria 760
1446 Ga0207648_11123060 3300026089 Unclassified 737
1447 Ga0207676_10002979 3300026095 Bacteria 12069
1448 Ga0207676_10005890 3300026095 Bacteria 8655
1449 Ga0207676_10008806 3300026095 Bacteria 7183
1450 Ga0207676_10022931 3300026095 Bacteria 4596
1451 Ga0207676_10044217 3300026095 Bacteria 3435
1452 Ga0207676_10062217 3300026095 Unclassified 2959
1453 Ga0207676_10080889 3300026095 Bacteria 2638
1454 Ga0207676_10137391 3300026095 Bacteria 2088
1455 Ga0207676_10179796 3300026095 Bacteria 1851
1456 Ga0207676_10429136 3300026095 Bacteria 1241
1457 Ga0207676_10567109 3300026095 Bacteria 1086
1458 Ga0207676_10607355 3300026095 Bacteria 1051
1459 Ga0207676_10724123 3300026095 Bacteria 966
1460 Ga0207676_11165434 3300026095 Unclassified 763
1461 Ga0207676_11189402 3300026095 Unclassified 755
1462 Ga0207676_11331360 3300026095 Unclassified 713
1463 Ga0207676_11401262 3300026095 Unclassified 695
1464 Ga0207676_11409525 3300026095 Bacteria 693
1465 Ga0207676_11427061 3300026095 Unclassified 688
1466 Ga0207676_12365990 3300026095 Unclassified 528
1467 Ga0207674_10005214 3300026116 Bacteria 15471
1468 Ga0207674_10036996 3300026116 Bacteria 5080
1469 Ga0207674_10119573 3300026116 Unclassified 2603
1470 Ga0207674_10119925 3300026116 Bacteria 2599
1471 Ga0207674_10237703 3300026116 Bacteria 1769
1472 Ga0207674_10238337 3300026116 Bacteria 1766
1473 Ga0207674_10284283 3300026116 Bacteria 1602
1474 Ga0207674_10750537 3300026116 Unclassified 942
1475 Ga0207674_11100217 3300026116 Unclassified 764
1476 Ga0207675_100001995 3300026118 Bacteria 20351
1477 Ga0207675_100002789 3300026118 Bacteria 17170
1478 Ga0207675_100019390 3300026118 Bacteria 6345
1479 Ga0207675_100059323 3300026118 Bacteria 3570
1480 Ga0207675_100084649 3300026118 Bacteria 2976
1481 Ga0207675_100186975 3300026118 Unclassified 1986
1482 Ga0207675_100369775 3300026118 Unclassified 1408
1483 Ga0207675_100446338 3300026118 Bacteria 1281
1484 Ga0207675_100668915 3300026118 Bacteria 1045
1485 Ga0207675_100782754 3300026118 Unclassified 966
1486 Ga0207675_100817740 3300026118 Unclassified 946
1487 Ga0207683_10032905 3300026121 Bacteria 4504
1488 Ga0207683_10232608 3300026121 Bacteria 1681
1489 Ga0207683_10243667 3300026121 Unclassified 1640
1490 Ga0207683_10468141 3300026121 Unclassified 1163
1491 Ga0207683_11229718 3300026121 Unclassified 694
1492 Ga0207698_10181654 3300026142 Bacteria 1864
1493 Ga0207698_10608367 3300026142 Bacteria 1078
1494 Ga0207698_10680470 3300026142 Bacteria 1022
1495 Ga0207698_10828684 3300026142 Bacteria 929
1496 Ga0207698_11145649 3300026142 Bacteria 791
1497 Ga0207698_11177691 3300026142 Bacteria 780
1498 Ga0207698_12464915 3300026142 Bacteria 531
1499 Ga0209588_1012747 3300027671 Bacteria 2556
1500 Ga0209998_10075284 3300027717 Unclassified 811
1501 Ga0207428_10065696 3300027907 Unclassified 2861
1502 Ga0207428_10070786 3300027907 Bacteria 2741
1503 Ga0207428_10657281 3300027907 Unclassified 752
1504 Ga0207428_10736473 3300027907 Unclassified 703
1505 Ga0207428_10910815 3300027907 Unclassified 621
1506 Ga0268266_11862810 3300028379 Unclassified 576
1507 Ga0268265_10017259 3300028380 Unclassified 4978
1508 Ga0268265_10057467 3300028380 Bacteria 2965
1509 Ga0268265_10096691 3300028380 Bacteria 2374
1510 Ga0268265_10274850 3300028380 Bacteria 1504
1511 Ga0268265_10298436 3300028380 Unclassified 1449
1512 Ga0268265_10312780 3300028380 Unclassified 1419
1513 Ga0268265_10576803 3300028380 Bacteria 1071
1514 Ga0268265_10577171 3300028380 Bacteria 1071
1515 Ga0268265_10588721 3300028380 Bacteria 1061
1516 Ga0268265_10977818 3300028380 Unclassified 835
1517 Ga0268265_11914691 3300028380 Unclassified 600
1518 Ga0268264_10043770 3300028381 Bacteria 3712
1519 Ga0268264_10050755 3300028381 Bacteria 3455
1520 Ga0268264_10082424 3300028381 Bacteria 2752
1521 Ga0268264_10090034 3300028381 Unclassified 2643
1522 Ga0268264_10094624 3300028381 Bacteria 2583
1523 Ga0268264_10127843 3300028381 Bacteria 2248
1524 Ga0268264_10132530 3300028381 Unclassified 2211
1525 Ga0268264_10153007 3300028381 Unclassified 2070
1526 Ga0268264_10424708 3300028381 Bacteria 1283
1527 Ga0268264_10529729 3300028381 Unclassified 1153
1528 Ga0268264_10630881 3300028381 Unclassified 1059
1529 Ga0268264_10756828 3300028381 Unclassified 968
1530 Ga0268264_10808951 3300028381 Unclassified 937
1531 Ga0268264_11477167 3300028381 Unclassified 690
1532 Ga0268264_11682154 3300028381 Bacteria 645
1533 Ga0307515_10538640 3300028794 Bacteria 777
1534 Ga0314311_1139834 3300030733 Bacteria 1293
1535 Ga0316178_1142882 3300030735 Bacteria 718
1536 Ga0316182_1148632 3300030745 Bacteria 879
1537 Ga0307513_10005598 3300031456 Bacteria 16565
1538 Ga0307408_100385006 3300031548 Bacteria 1200
1539 Ga0307408_100446041 3300031548 Unclassified 1121
1540 Ga0307408_101156004 3300031548 Unclassified 720
1541 Ga0307408_102520166 3300031548 Unclassified 500
1542 Ga0307405_10179549 3300031731 Unclassified 1518
1543 Ga0307405_10235300 3300031731 Bacteria 1353
1544 Ga0307405_10289468 3300031731 Bacteria 1237
1545 Ga0307405_10376675 3300031731 Bacteria 1103
1546 Ga0307405_11040058 3300031731 Unclassified 701
1547 Ga0307413_10032967 3300031824 Archaea 2942
1548 Ga0307410_10039430 3300031852 Archaea 3101
1549 Ga0307410_10164481 3300031852 Bacteria 1666
1550 Ga0307410_10235960 3300031852 Archaea 1415
1551 Ga0307410_10561925 3300031852 Unclassified 947
1552 Ga0307406_10013493 3300031901 Bacteria 4680
1553 Ga0307406_10017531 3300031901 Unclassified 4171
1554 Ga0307406_10489063 3300031901 Unclassified 995
1555 Ga0307406_10564726 3300031901 Unclassified 933
1556 Ga0307407_10026139 3300031903 Archaea 3087
1557 Ga0307407_10142309 3300031903 Bacteria 1549
1558 Ga0307407_10514336 3300031903 Unclassified 879
1559 Ga0307412_10053675 3300031911 Unclassified 2672
1560 Ga0307412_10201000 3300031911 Unclassified 1513
1561 Ga0307412_10317114 3300031911 Bacteria 1239
1562 Ga0307412_10777775 3300031911 Bacteria 829
1563 Ga0307412_10933548 3300031911 Unclassified 763
1564 Ga0307409_100058421 3300031995 Archaea 2995
1565 Ga0307409_100156791 3300031995 Bacteria 1985
1566 Ga0307409_102649159 3300031995 Unclassified 530
1567 Ga0307416_100011954 3300032002 Bacteria 5824
1568 Ga0307416_100033296 3300032002 Bacteria 3905
1569 Ga0307416_100392925 3300032002 Bacteria 1421
1570 Ga0307416_100525371 3300032002 Bacteria 1252
1571 Ga0307416_100939695 3300032002 Unclassified 966
1572 Ga0307416_101175142 3300032002 Bacteria 873
1573 Ga0307416_101435174 3300032002 Unclassified 796
1574 Ga0307416_101642387 3300032002 Unclassified 748
1575 Ga0307416_103606258 3300032002 Unclassified 518
1576 Ga0307414_10000977 3300032004 Bacteria 14587
1577 Ga0307414_10078412 3300032004 Unclassified 2408
1578 Ga0307414_10137096 3300032004 Unclassified 1910
1579 Ga0307414_10198823 3300032004 Bacteria 1628
1580 Ga0307414_11757143 3300032004 Bacteria 579
1581 Ga0307411_10074618 3300032005 Bacteria 2312
1582 Ga0307411_10233335 3300032005 Unclassified 1436
1583 Ga0307411_10244264 3300032005 Unclassified 1407
1584 Ga0307411_10907235 3300032005 Unclassified 783
1585 Ga0307411_11119931 3300032005 Unclassified 710
1586 Ga0307415_100037442 3300032126 Archaea 3188
1587 Ga0307415_100176510 3300032126 Bacteria 1672
1588 Ga0307415_100347705 3300032126 Unclassified 1247
1589 Ga0373950_0048464 3300034818 Bacteria 830
1590 Ga0373929_0251653 3300035085 Unclassified 513
1591 Ga0373940_0155622 3300035088 Bacteria 731
1592 Ga0373951_0023668 3300035091 Bacteria 1420
1593 Ga0373941_0009414 3300035115 Unclassified 2461
1594 Ga0373941_0013541 3300035115 Bacteria 2158
1595 Ga0373942_0004655 3300035207 Unclassified 3178
1596 Ga0373961_0177239 3300035241 Bacteria 741
1597 Ga0373961_0254092 3300035241 Unclassified 637
1598 Ga0373962_0378234 3300035242 Unclassified 517
1599 Ga0373931_0449195 3300035691 Bacteria 824
1600 Ga0373935_0606208 3300035692 Unclassified 801
1601 Ga0373937_0733945 3300036401 Bacteria 935
1602 Ga0373925_1349093 3300037068 Unclassified 585
1603 Ga0395900_0057486 3300037418 Unclassified 4005
1604 Ga0395900_0158741 3300037418 Bacteria 2308
1605 Ga0395900_0848922 3300037418 Unclassified 839
1606 Ga0395900_0878894 3300037418 Bacteria 821
1607 Ga0395900_1353970 3300037418 Unclassified 625
1608 Ga0395898_0153361 3300037466 Bacteria 2204
1609 Ga0395898_0942013 3300037466 Bacteria 801
1610 Ga0395898_1144769 3300037466 Unclassified 710
1611 Ga0395905_0002781 3300037471 Bacteria 19157
1612 Ga0395905_0029119 3300037471 Bacteria 5205
1613 Ga0395905_0803208 3300037471 Bacteria 844
1614 Ga0395905_1854701 3300037471 Unclassified 509
1615 Ga0436364_1177179 3300037853 Unclassified 559
1616 Ga0395901_0176126 3300038443 Bacteria 2244
1617 Ga0395901_0808868 3300038443 Bacteria 926
1618 Ga0395901_1858813 3300038443 Bacteria 550
1619 Ga0242422_02081 3300038699 Bacteria 1369
1620 Ga0242420_061324 3300038996 Unclassified 751
1621 Ga0436365_0557003 3300039437 Bacteria 48655
1622 Ga0436365_0744561 3300039437 Unclassified 1265
1623 Ga0436365_0802786 3300039437 Bacteria 54200
1624 Ga0436363_0057732 3300039450 Bacteria 916
1625 Ga0451793_1711702 3300041452 Unclassified 794
1626 Ga0451807_0635481 3300041486 Bacteria 544
1627 Ga0451807_1877268 3300041486 Unclassified 736
1628 Ga0451853_3186910 3300041512 Bacteria 1193
1629 Ga0439448_0015162 3300042005 Bacteria 2332
1630 Ga0439432_014864 3300042006 Bacteria 2632
1631 Ga0439455_0123271 3300042012 Unclassified 727
1632 Ga0439462_0193974 3300042015 Bacteria 577
1633 Ga0439446_0069853 3300042156 Bacteria 1073
1634 Ga0439458_0004943 3300042157 Unclassified 3023
1635 Ga0439458_0165737 3300042157 Unclassified 596
1636 Ga0439434_0004396 3300042435 Bacteria 4122
1637 Ga0439434_0089917 3300042435 Bacteria 981
1638 Ga0439435_0109874 3300042436 Bacteria 855
1639 Ga0439459_0222521 3300042438 Unclassified 523
1640 Ga0439464_0010763 3300042439 Bacteria 2418
1641 Ga0451577_0528632 3300042876 Bacteria 1071
1642 Ga0453683_0010562 3300044673 Bacteria 6117
1643 Ga0453683_1035877 3300044673 Unclassified 546
1644 Ga0453684_1410385 3300044712 Unclassified 722
1645 Ga0466960_0860746 3300044901 Unclassified 551
1646 Ga0451576_0005147 3300045051 Bacteria 16559
1647 Ga0451576_0311562 3300045051 Unclassified 1647
1648 Ga0451576_0407534 3300045051 Unclassified 1426
1649 Ga0451576_0902485 3300045051 Bacteria 927
1650 Ga0451576_1775920 3300045051 Bacteria 638
1651 Ga0495592_0614521 3300046454 Unclassified 662
1652 Ga0495629_0600031 3300046459 Unclassified 736
1653 Ga0495651_0445892 3300046462 Unclassified 837
1654 Ga0495580_0419989 3300046472 Unclassified 900
1655 Ga0495639_0109479 3300046475 Unclassified 1310
1656 Ga0495664_0387253 3300046477 Bacteria 840
1657 Ga0495618_0147288 3300046514 Bacteria 1505
1658 Ga0495632_0033115 3300046519 Bacteria 2656
1659 Ga0495643_0293688 3300046522 Unclassified 743
1660 Ga0495663_0218879 3300046525 Unclassified 669
1661 Ga0495586_0091430 3300046535 Bacteria 1682
1662 Ga0495598_0286926 3300046537 Unclassified 619
1663 Ga0495621_0036583 3300046539 Bacteria 1704
1664 Ga0495621_0263646 3300046539 Bacteria 706
1665 Ga0495645_0111154 3300046543 Bacteria 1939
1666 Ga0495667_0523741 3300046559 Unclassified 742
1667 Ga0495656_0033559 3300046615 Bacteria 2096
1668 Ga0495634_0319925 3300046642 Unclassified 934
1669 Ga0495635_0321269 3300046663 Bacteria 1036
1670 Ga0495659_0030422 3300046664 Bacteria 1879
1671 Ga0495599_0535317 3300046678 Unclassified 687
1672 Ga0495658_0623392 3300046683 Unclassified 691
1673 Ga0495658_0923733 3300046683 Unclassified 558
1674 Ga0495669_0112499 3300046684 Bacteria 1272
1675 Ga0495669_0556207 3300046684 Bacteria 558
1676 Ga0495613_0343003 3300046689 Unclassified 1027
1677 Ga0495613_0950394 3300046689 Unclassified 554
1678 Ga0495636_0289207 3300047318 Unclassified 765
1679 Ga0495674_0202623 3300047319 Bacteria 1646
1680 Ga0495672_0180552 3300047320 Unclassified 1069
1681 Ga0495676_0639422 3300047321 Unclassified 691
1682 Ga0495680_0304969 3300047322 Unclassified 1117
1683 Ga0495684_0238417 3300047471 Unclassified 1328
1684 Ga0496100_0179322 3300048903 Bacteria 1531
1685 Ga0496100_1157036 3300048903 Unclassified 610
1686 Ga0496102_0335442 3300048905 Bacteria 1424
1687 Ga0496103_0437785 3300048906 Unclassified 839
1688 Ga0496104_0316002 3300048907 Bacteria 1475
1689 Ga0496105_0496595 3300048908 Bacteria 958
1690 Ga0496106_0048317 3300048909 Bacteria 3205
1691 Ga0496106_0686255 3300048909 Bacteria 817
1692 Ga0496107_0542035 3300048910 Bacteria 862
1693 Ga0496107_0730513 3300048910 Bacteria 727
1694 Ga0496108_0369203 3300048911 Unclassified 1253
1695 Ga0496108_0397826 3300048911 Bacteria 1203
1696 Ga0496108_1303888 3300048911 Bacteria 611
1697 Ga0496110_1867855 3300048913 Unclassified 511
1698 Ga0496112_0127939 3300048915 Unclassified 2511
1699 Ga0496112_0887194 3300048915 Bacteria 814
1700 Ga0496112_1648897 3300048915 Unclassified 554
1701 Ga0496112_1764855 3300048915 Unclassified 531
1702 Ga0496113_0693932 3300048916 Unclassified 813
1703 Ga0496113_1188640 3300048916 Unclassified 596
1704 Ga0496113_1435599 3300048916 Bacteria 534
1705 Ga0501306_047967 3300049127 Unclassified 679
1706 Ga0501291_024043 3300049514 Unclassified 988
1707 Ga0501292_005612 3300049515 Unclassified 1756
1708 Ga0501292_109767 3300049515 Unclassified 554
1709 Ga0501296_001466 3300049519 Unclassified 2395
1710 Ga0501296_008296 3300049519 Bacteria 1201
1711 Ga0501297_000547 3300049520 Bacteria 3402
1712 Ga0501298_009494 3300049521 Bacteria 1657
1713 Ga0501299_000445 3300049522 Bacteria 4895
1714 Ga0501299_017318 3300049522 Bacteria 1284
1715 Ga0501302_006596 3300049525 Unclassified 757
1716 Ga0501031_0250921 3300049568 Bacteria 1150
1717 Ga0501038_0002264 3300049574 Bacteria 17906
1718 Ga0501040_0456466 3300049576 Bacteria 920
1719 Ga0501040_1386623 3300049576 Bacteria 510
1720 Ga0501042_1138767 3300049578 Unclassified 569
1721 Ga0501068_1119296 3300049584 Unclassified 521
1722 Ga0501071_0426168 3300049587 Bacteria 1014
1723 Ga0501071_1100341 3300049587 Unclassified 614
1724 Ga0501074_0461150 3300049590 Bacteria 901
1725 Ga0501075_0721590 3300049591 Bacteria 759
1726 Ga0501076_1702648 3300049592 Unclassified 517
1727 Ga0501202_070562 3300049652 Unclassified 804
1728 Ga0501202_082970 3300049652 Unclassified 756
1729 Ga0501206_028358 3300049653 Unclassified 823
1730 Ga0501206_092843 3300049653 Unclassified 538
1731 Ga0501207_003686 3300049654 Bacteria 2053
1732 Ga0501207_010119 3300049654 Bacteria 1387
1733 Ga0501209_261165 3300049656 Unclassified 542
1734 Ga0501216_001484 3300049660 Unclassified 3170
1735 Ga0501216_049063 3300049660 Bacteria 826
1736 Ga0501217_002716 3300049661 Unclassified 3509
1737 Ga0501217_011755 3300049661 Unclassified 1941
1738 Ga0501217_016282 3300049661 Bacteria 1702
1739 Ga0501217_030047 3300049661 Bacteria 1332
1740 Ga0501217_073356 3300049661 Bacteria 935
1741 Ga0501223_000914 3300049663 Bacteria 6978
1742 Ga0501224_008456 3300049664 Bacteria 1501
1743 Ga0501224_009480 3300049664 Unclassified 1425
1744 Ga0501224_012920 3300049664 Bacteria 1232
1745 Ga0501224_028677 3300049664 Unclassified 833
1746 Ga0501227_013007 3300049665 Bacteria 1828
1747 Ga0501227_060935 3300049665 Unclassified 967
1748 Ga0501227_108220 3300049665 Unclassified 743
1749 Ga0501227_223389 3300049665 Bacteria 536
1750 Ga0501228_000957 3300049666 Unclassified 1989
1751 Ga0501230_001733 3300049667 Unclassified 2657
1752 Ga0501230_031522 3300049667 Unclassified 989
1753 Ga0501230_107171 3300049667 Unclassified 608
1754 Ga0501233_000913 3300049668 Unclassified 4995
1755 Ga0501233_001382 3300049668 Bacteria 4150
1756 Ga0501233_010608 3300049668 Bacteria 1818
1757 Ga0501235_004859 3300049669 Bacteria 2911
1758 Ga0501235_007230 3300049669 Archaea 2422
1759 Ga0501235_024707 3300049669 Bacteria 1342
1760 Ga0501235_045912 3300049669 Bacteria 1005
1761 Ga0501235_062601 3300049669 Unclassified 873
1762 Ga0501236_070496 3300049670 Unclassified 638
1763 Ga0501238_025570 3300049671 Unclassified 846
1764 Ga0501239_018589 3300049672 Unclassified 836
1765 Ga0501242_008911 3300049674 Unclassified 1180
1766 Ga0501247_002464 3300049677 Archaea 1924
1767 Ga0501249_003205 3300049679 Archaea 3295
1768 Ga0501249_022689 3300049679 Unclassified 1375
1769 Ga0501249_086269 3300049679 Bacteria 741
1770 Ga0501255_009317 3300049684 Bacteria 1086
1771 Ga0501255_059191 3300049684 Unclassified 604
1772 Ga0501256_001685 3300049685 Bacteria 1670
1773 Ga0501256_008997 3300049685 Unclassified 937
1774 Ga0501257_010091 3300049686 Archaea 2138
1775 Ga0501257_025537 3300049686 Bacteria 1406
1776 Ga0501257_043823 3300049686 Unclassified 1103
1777 Ga0501258_013724 3300049687 Unclassified 892
1778 Ga0501259_007540 3300049688 Bacteria 1744
1779 Ga0501260_001245 3300049689 Bacteria 2083
1780 Ga0501261_002239 3300049690 Unclassified 2375
1781 Ga0501261_061670 3300049690 Unclassified 638
1782 Ga0501219_015825 3300049703 Unclassified 614
1783 Ga0501221_004377 3300049704 Unclassified 2342
1784 Ga0501221_013198 3300049704 Bacteria 1516
1785 Ga0501225_0000533 3300049705 Bacteria 11907
1786 Ga0501225_0006298 3300049705 Unclassified 3469
1787 Ga0501225_0006664 3300049705 Unclassified 3367
1788 Ga0501225_0027023 3300049705 Unclassified 1579
1789 Ga0501225_0077452 3300049705 Unclassified 951
1790 Ga0501234_000103 3300049707 Bacteria 10792
1791 Ga0501234_004496 3300049707 Bacteria 2191
1792 Ga0501234_021066 3300049707 Unclassified 1038
1793 Ga0501245_027776 3300049708 Unclassified 920
1794 Ga0501081_0568735 3300049743 Bacteria 847
1795 Ga0501241_031060 3300049758 Unclassified 1010
1796 Ga0501262_033403 3300049759 Unclassified 748
1797 Ga0501268_005132 3300049765 Unclassified 1870
1798 Ga0501268_055652 3300049765 Bacteria 774
1799 Ga0501270_001352 3300049767 Archaea 2329
1800 Ga0501270_022792 3300049767 Unclassified 970
1801 Ga0501270_069657 3300049767 Unclassified 677
1802 Ga0501272_000807 3300049769 Unclassified 2845
1803 Ga0501273_001458 3300049770 Archaea 2255
1804 Ga0501273_038118 3300049770 Unclassified 704
1805 Ga0501274_027304 3300049771 Unclassified 626
1806 Ga0501276_034898 3300049773 Unclassified 540
1807 Ga0501279_008611 3300049775 Bacteria 1364
1808 Ga0501283_003147 3300049779 Bacteria 2172
1809 Ga0501045_0462498 3300049824 Bacteria 943
1810 Ga0501204_004815 3300049850 Unclassified 1463
1811 Ga0501212_004055 3300049851 Bacteria 1869
1812 Ga0501212_012910 3300049851 Unclassified 1221
1813 Ga0501226_021370 3300049853 Unclassified 717
1814 Ga0501226_029881 3300049853 Unclassified 617
1815 nmdc:mga05p37_1326369_c1 3300050507 Unclassified 731
1816 nmdc:mga05p37_144080_c1 3300050507 Unclassified 2918
1817 nmdc:mga05p37_1550_c1 3300050507 Bacteria 26715
1818 nmdc:mga05p37_175010_c1 3300050507 Unclassified 2615
1819 nmdc:mga05p37_176287_c1 3300050507 Unclassified 2604
1820 nmdc:mga05p37_203665_c1 3300050507 Unclassified 2395
1821 nmdc:mga05p37_257432_c1 3300050507 Bacteria 2091
1822 nmdc:mga09592_105125_c1 3300050508 Bacteria 2420
1823 nmdc:mga09592_133783_c1 3300050508 Unclassified 2135
1824 nmdc:mga09592_1713037_c1 3300050508 Unclassified 506
1825 nmdc:mga09592_287578_c1 3300050508 Bacteria 1425
1826 nmdc:mga09592_448085_c1 3300050508 Bacteria 1114
1827 nmdc:mga09592_500134_c1 3300050508 Bacteria 1047
1828 nmdc:mga09592_794318_c1 3300050508 Unclassified 801
1829 nmdc:mga0qj67_119633_c1 3300050509 Bacteria 2130
1830 nmdc:mga0qj67_19703_c1 3300050509 Bacteria 5158
1831 nmdc:mga0qj67_721058_c1 3300050509 Unclassified 792
1832 nmdc:mga06r32_1421689_c1 3300050510 Unclassified 635
1833 nmdc:mga06r32_160852_c1 3300050510 Bacteria 2228
1834 nmdc:mga06r32_309702_c1 3300050510 Unclassified 1565
1835 nmdc:mga06r32_929707_c1 3300050510 Bacteria 825
1836 nmdc:mga08y16_1131534_c1 3300050511 Unclassified 757
1837 nmdc:mga08y16_1143473_c1 3300050511 Unclassified 752
1838 nmdc:mga08y16_14198_c1 3300050511 Bacteria 8381
1839 nmdc:mga08y16_21530_c1 3300050511 Bacteria 6807
1840 nmdc:mga08y16_233803_c1 3300050511 Bacteria 1901
1841 nmdc:mga08y16_91785_c1 3300050511 Bacteria 3165
1842 nmdc:mga0n895_1000796_c1 3300050512 Unclassified 817
1843 nmdc:mga0n895_1020694_c1 3300050512 Bacteria 807
1844 nmdc:mga0n895_1025419_c1 3300050512 Unclassified 805
1845 nmdc:mga0n895_1098030_c1 3300050512 Unclassified 773
1846 nmdc:mga0n895_1195966_c1 3300050512 Unclassified 734
1847 nmdc:mga0n895_1419271_c1 3300050512 Bacteria 662
1848 nmdc:mga0n895_14374_c1 3300050512 Bacteria 7186
1849 nmdc:mga0n895_146599_c1 3300050512 Bacteria 2390
1850 nmdc:mga0n895_157804_c1 3300050512 Bacteria 2300
1851 nmdc:mga0n895_190141_c1 3300050512 Bacteria 2084
1852 nmdc:mga0n895_22555_c1 3300050512 Bacteria 5904
1853 nmdc:mga0n895_268488_c1 3300050512 Unclassified 1731
1854 nmdc:mga0n895_422547_c1 3300050512 Unclassified 1347
1855 nmdc:mga0n895_547301_c1 3300050512 Bacteria 1163
1856 nmdc:mga0n895_603158_c1 3300050512 Bacteria 1100
1857 nmdc:mga0n895_916310_c1 3300050512 Unclassified 861
1858 nmdc:mga0n895_995488_c1 3300050512 Unclassified 820
1859 nmdc:mga0rr50_265436_c1 3300050513 Unclassified 1429
1860 nmdc:mga0rr50_663509_c1 3300050513 Unclassified 890
1861 nmdc:mga08x19_1934_c1 3300050514 Bacteria 4074
1862 nmdc:mga08x19_504765_c1 3300050514 Bacteria 854
1863 nmdc:mga08x19_517049_c1 3300050514 Bacteria 843
1864 nmdc:mga08x19_638733_c1 3300050514 Unclassified 755
1865 nmdc:mga0a205_104849_c1 3300050515 Unclassified 2726
1866 nmdc:mga0a205_1059515_c1 3300050515 Unclassified 658
1867 nmdc:mga0a205_162022_c1 3300050515 Bacteria 2133
1868 nmdc:mga0a205_164983_c1 3300050515 Bacteria 2111
1869 nmdc:mga0a205_39871_c1 3300050515 Unclassified 4521
1870 nmdc:mga0a205_428450_c1 3300050515 Bacteria 1184
1871 nmdc:mga0a205_438131_c1 3300050515 Bacteria 1168
1872 nmdc:mga0a205_505895_c1 3300050515 Bacteria 1065
1873 nmdc:mga0a205_5706_c1 3300050515 Bacteria 11216
1874 nmdc:mga0a205_575064_c1 3300050515 Bacteria 981
1875 nmdc:mga0a205_631495_c1 3300050515 Bacteria 923
1876 nmdc:mga0a205_648089_c1 3300050515 Unclassified 908
1877 nmdc:mga0a205_717966_c1 3300050515 Bacteria 849
1878 nmdc:mga0a205_869612_c1 3300050515 Unclassified 748
1879 Ga0495601_0587568 3300053077 Unclassified 715
1880 Ga0495619_0442099 3300053085 Unclassified 897
1881 Ga0500566_0195253 3300053094 Bacteria 1027
1882 Ga0500616_0005403 3300053153 Bacteria 8672
1883 Ga0501084_0057400 3300054114 Unclassified 3258
1884 Ga0501084_0627741 3300054114 Unclassified 907
1885 Ga0587066_072192 3300059490 Bacteria 729
1886 Ga0587083_0101657 3300059505 Unclassified 717
1887 Ga0587085_051446 3300059506 Unclassified 752
1888 Ga0587094_055174 3300059513 Unclassified 683
1889 Ga0587062_088234 3300059639 Unclassified 587
1890 Ga0587067_100281 3300059640 Bacteria 669
1891 Ga0587068_132302 3300059641 Bacteria 550
1892 Ga0587069_079635 3300059642 Bacteria 637
1893 Ga0587069_132285 3300059642 Bacteria 539
1894 Ga0587072_145355 3300059643 Unclassified 569
1895 Ga0587076_077303 3300059645 Bacteria 703
1896 Ga0587107_098115 3300059652 Bacteria 576
1897 Ga0587111_0110881 3300060346 Unclassified 695
1898 Ga0501082_0880283 3300060353 Bacteria 783
1899 Ga0157378_12371992
1900 SwRhRL3b_contig_2606832
1901 SwRhRL2b_contig_2182236
1902 SwRhRL2b_contig_2678464
1903 SwRhRL2b_contig_3329882
1904 SwRhRL2b_contig_493489
1905 MBSR1b_contig_13030068
1906 CNBas_1009198
1907 CNAas_1000026
1908 JGI24748J21848_1000007
1909 JGI24034J26672_10000002
1910 JGI24742J22300_10097535
1911 JGI24751J29686_10000017
1912 JGI25406J46586_10001585
1913 JGI25406J46586_10038246
1914 rootL2_10066759
1915 Ga0065714_10064596
1916 Ga0065714_10155715
1917 Ga0065704_10085200
1918 Ga0065704_10096907
1919 Ga0065704_10156697
1920 Ga0065704_10157323
1921 Ga0065704_10189830
1922 Ga0065704_10230677
1923 Ga0065704_10253257
1924 Ga0065704_10542488
1925 Ga0065704_10699561
1926 Ga0065712_10012497
1927 Ga0065712_10017635
1928 Ga0065712_10068446
1929 Ga0065712_10073588
1930 Ga0065712_10170628
1931 Ga0065712_10437363
1932 Ga0065712_10799569
1933 Ga0065715_10089589
1934 Ga0065715_10105571
1935 Ga0065715_10114416
1936 Ga0065715_10143814
1937 Ga0065715_10143933
1938 Ga0065715_10166621
1939 Ga0065715_10242280
1940 Ga0065715_10253488
1941 Ga0065715_10302654
1942 Ga0065715_10307704
1943 Ga0065715_10410560
1944 Ga0065715_10416639
1945 Ga0065715_10421457
1946 Ga0065715_10560110
1947 Ga0065715_10666358
1948 Ga0065707_10001863
1949 Ga0065707_10031290
1950 Ga0065707_10056378
1951 Ga0065707_10085169
1952 Ga0065707_10120297
1953 Ga0065707_10142778
1954 Ga0065707_10173065
1955 Ga0065707_10191731
1956 Ga0065707_10258876
1957 Ga0065707_10322032
1958 Ga0065707_10489315
1959 Ga0065707_10615549
1960 Ga0065707_10707242
1961 Ga0070676_10047850
1962 Ga0070676_10119856
1963 Ga0070676_11229767
1964 Ga0070676_11341115
1965 Ga0070683_100029338
1966 Ga0070690_100008280
1967 Ga0070690_100017532
1968 Ga0070690_100091789
1969 Ga0070690_100198775
1970 Ga0070690_100218282
1971 Ga0070690_100351653
1972 Ga0070690_100558567
1973 Ga0070690_100628223
1974 Ga0070670_100018951
1975 Ga0070670_100091664
1976 Ga0070670_100227248
1977 Ga0070670_100233014
1978 Ga0070670_100259548
1979 Ga0070670_100287380
1980 Ga0070670_100365621
1981 Ga0070670_100474437
1982 Ga0070670_100935932
1983 Ga0070670_101411142
1984 Ga0070677_10324477
1985 Ga0068869_100042317
1986 Ga0068869_100071714
1987 Ga0068869_100082590
1988 Ga0068869_100109200
1989 Ga0068869_100513787
1990 Ga0068869_100899213
1991 Ga0068869_100912852
1992 Ga0068869_100981376
1993 Ga0068869_101167199
1994 Ga0068869_101261364
1995 Ga0068869_101536944
1996 Ga0070666_10077380
1997 Ga0070666_10089671
1998 Ga0070666_10165588
1999 Ga0070666_10210007
2000 Ga0070666_11137559
2001 Ga0070680_100075635
2002 Ga0070680_100092736
2003 Ga0070680_100604699
2004 Ga0070680_101743412
2005 Ga0070682_100308754
2006 Ga0070682_100579655
2007 Ga0068868_100043939
2008 Ga0068868_100045354
2009 Ga0068868_100302998
2010 Ga0068868_100727430
2011 Ga0068868_101636718
2012 Ga0068868_102163695
2013 Ga0070660_100136948
2014 Ga0070660_100347076
2015 Ga0070660_100927300
2016 Ga0070689_100048155
2017 Ga0070689_100114116
2018 Ga0070689_100182392
2019 Ga0070689_100612400
2020 Ga0070689_100792098
2021 Ga0070689_100801047
2022 Ga0070689_100915224
2023 Ga0070689_100976095
2024 Ga0070689_101231086
2025 Ga0070689_101261497
2026 Ga0070689_101379984
2027 Ga0070689_101798378
2028 Ga0070691_10058073
2029 Ga0070691_10466935
2030 Ga0070687_100024091
2031 Ga0070687_100025782
2032 Ga0070687_100070835
2033 Ga0070687_100084954
2034 Ga0070687_100413834
2035 Ga0070687_100432701
2036 Ga0070687_100644176
2037 Ga0070687_101247132
2038 Ga0070661_100009109
2039 Ga0070661_100277369
2040 Ga0070661_100377622
2041 Ga0070661_100584649
2042 Ga0070661_100879594
2043 Ga0070661_100899954
2044 Ga0070661_101068651
2045 Ga0070661_101608780
2046 Ga0070692_10057713
2047 Ga0070692_10074545
2048 Ga0070692_10103987
2049 Ga0070692_10141869
2050 Ga0070692_10152704
2051 Ga0070692_10423875
2052 Ga0070692_10569979
2053 Ga0070692_11066994
2054 Ga0070668_100022818
2055 Ga0070668_100102868
2056 Ga0070668_100902224
2057 Ga0070669_100001947
2058 Ga0070669_100008114
2059 Ga0070669_100011425
2060 Ga0070669_100013610
2061 Ga0070669_100214875
2062 Ga0070669_101094149
2063 Ga0070669_101176012
2064 Ga0070669_101301904
2065 Ga0070675_100219024
2066 Ga0070675_100340379
2067 Ga0070675_100420842
2068 Ga0070675_100580437
2069 Ga0070675_100867426
2070 Ga0070675_101832422
2071 Ga0070671_100001256
2072 Ga0070671_100007418
2073 Ga0070671_100098235
2074 Ga0070671_100106170
2075 Ga0070671_100175034
2076 Ga0070671_100190022
2077 Ga0070674_100165824
2078 Ga0070674_100355874
2079 Ga0070674_101989599
2080 Ga0070673_100004450
2081 Ga0070673_100109455
2082 Ga0070673_100114359
2083 Ga0070673_100149071
2084 Ga0070673_100241304
2085 Ga0070673_100405270
2086 Ga0070673_100469880
2087 Ga0070673_101120566
2088 Ga0070673_101364789
2089 Ga0070673_101510124
2090 Ga0070673_101511025
2091 Ga0070673_101885102
2092 Ga0070673_102010185
2093 Ga0070673_102129758
2094 Ga0070688_100023832
2095 Ga0070688_100552373
2096 Ga0070688_100938862
2097 Ga0070659_100015215
2098 Ga0070659_100082434
2099 Ga0070659_100133946
2100 Ga0070659_100291319
2101 Ga0070659_100831866
2102 Ga0070667_100015535
2103 Ga0070667_100072731
2104 Ga0070703_10001368
2105 Ga0070703_10068408
2106 Ga0070703_10275264
2107 Ga0070709_11005617
2108 Ga0070709_11325766
2109 Ga0070709_11785012
2110 Ga0070710_11135714
2111 Ga0070701_10116203
2112 Ga0070701_10141915
2113 Ga0070701_10341047
2114 Ga0070705_100016905
2115 Ga0070705_100022103
2116 Ga0070705_100033199
2117 Ga0070705_100115914
2118 Ga0070705_100391981
2119 Ga0070705_100454282
2120 Ga0070705_100584473
2121 Ga0070705_100643677
2122 Ga0070705_100877628
2123 Ga0070705_100886461
2124 Ga0070705_101494769
2125 Ga0070705_101709442
2126 Ga0070705_101888888
2127 Ga0070700_100008091
2128 Ga0070700_100021298
2129 Ga0070700_100035918
2130 Ga0070700_100077203
2131 Ga0070700_100121005
2132 Ga0070700_100183930
2133 Ga0070700_100309882
2134 Ga0070700_100503396
2135 Ga0070700_100625860
2136 Ga0070700_100925504
2137 Ga0070700_101029313
2138 Ga0070694_100006114
2139 Ga0070694_100017025
2140 Ga0070694_100017068
2141 Ga0070694_100030850
2142 Ga0070694_100066429
2143 Ga0070694_100069673
2144 Ga0070694_100088638
2145 Ga0070694_100110123
2146 Ga0070694_100211432
2147 Ga0070694_100233892
2148 Ga0070694_100248390
2149 Ga0070694_100265475
2150 Ga0070694_100282232
2151 Ga0070694_100374061
2152 Ga0070694_100407346
2153 Ga0070694_100482870
2154 Ga0070694_100564772
2155 Ga0070694_100617349
2156 Ga0070694_100707529
2157 Ga0070694_100722399
2158 Ga0070694_100791916
2159 Ga0070694_100893024
2160 Ga0070694_100928613
2161 Ga0070694_101188352
2162 Ga0070708_100001683
2163 Ga0070708_100151043
2164 Ga0070708_100188649
2165 Ga0070708_100539072
2166 Ga0070708_100712104
2167 Ga0070708_100751763
2168 Ga0070663_100523728
2169 Ga0070678_100027941
2170 Ga0070678_100209385
2171 Ga0070678_100376056
2172 Ga0070678_100494588
2173 Ga0070678_101082263
2174 Ga0070662_100077443
2175 Ga0070662_100088200
2176 Ga0070662_100188953
2177 Ga0070662_100295795
2178 Ga0070662_100368913
2179 Ga0070662_100378086
2180 Ga0070662_100481658
2181 Ga0070662_100513138
2182 Ga0070662_101001034
2183 Ga0070662_101615268
2184 Ga0070681_10000417
2185 Ga0070681_10005337
2186 Ga0070681_10006520
2187 Ga0070681_10017987
2188 Ga0070681_10130732
2189 Ga0068867_100020741
2190 Ga0068867_100090267
2191 Ga0068867_100113031
2192 Ga0068867_100143720
2193 Ga0068867_100777683
2194 Ga0068867_101020617
2195 Ga0068867_101032110
2196 Ga0068867_101130278
2197 Ga0070685_10042338
2198 Ga0070685_10210118
2199 Ga0070706_100000088
2200 Ga0070706_100002494
2201 Ga0070706_100003757
2202 Ga0070706_100010028
2203 Ga0070706_100048296
2204 Ga0070706_100060959
2205 Ga0070706_100127468
2206 Ga0070706_100132548
2207 Ga0070706_100217672
2208 Ga0070706_100672474
2209 Ga0070706_100897812
2210 Ga0070706_100987091
2211 Ga0070706_101487867
2212 Ga0070706_101962829
2213 Ga0070707_100001325
2214 Ga0070707_100008179
2215 Ga0070707_100014868
2216 Ga0070707_100070878
2217 Ga0070707_100133757
2218 Ga0070707_100142361
2219 Ga0070707_100477753
2220 Ga0070707_100555056
2221 Ga0070707_100645870
2222 Ga0070707_100707100
2223 Ga0070707_100912847
2224 Ga0070698_100007026
2225 Ga0070698_100007616
2226 Ga0070698_100022051
2227 Ga0070698_100030847
2228 Ga0070698_100061585
2229 Ga0070698_100077625
2230 Ga0070698_100078648
2231 Ga0070698_100159275
2232 Ga0070698_100570912
2233 Ga0070698_100740749
2234 Ga0070698_101590068
2235 Ga0070699_100003262
2236 Ga0070699_100007628
2237 Ga0070699_100026044
2238 Ga0070699_100047431
2239 Ga0070699_100054211
2240 Ga0070699_100175910
2241 Ga0070699_100207918
2242 Ga0070699_100290595
2243 Ga0070699_100403511
2244 Ga0070699_100696042
2245 Ga0070699_100723489
2246 Ga0070679_100000797
2247 Ga0070679_100001091
2248 Ga0070679_100159214
2249 Ga0070684_100263437
2250 Ga0070684_100500613
2251 Ga0070684_100633784
2252 Ga0070684_100698411
2253 Ga0070697_100000155
2254 Ga0070697_100000205
2255 Ga0070697_100010667
2256 Ga0070697_100012364
2257 Ga0070697_100102832
2258 Ga0070697_100135478
2259 Ga0070697_100166061
2260 Ga0070697_100182354
2261 Ga0070697_100188907
2262 Ga0070697_100196973
2263 Ga0070697_100213928
2264 Ga0070697_100277376
2265 Ga0070697_100317819
2266 Ga0070697_100420130
2267 Ga0070697_100454809
2268 Ga0068853_100002482
2269 Ga0068853_100009445
2270 Ga0068853_100019123
2271 Ga0068853_100047228
2272 Ga0068853_100055959
2273 Ga0068853_100386123
2274 Ga0068853_101415176
2275 Ga0068853_101631827
2276 Ga0070672_100014398
2277 Ga0070672_100077694
2278 Ga0070672_100693715
2279 Ga0070672_100731410
2280 Ga0070672_100961588
2281 Ga0070686_100001133
2282 Ga0070686_100069827
2283 Ga0070686_100098136
2284 Ga0070686_100108160
2285 Ga0070686_100125175
2286 Ga0070686_100160897
2287 Ga0070686_100313995
2288 Ga0070686_100543088
2289 Ga0070686_100960797
2290 Ga0070695_100079556
2291 Ga0070695_100080896
2292 Ga0070695_100095384
2293 Ga0070695_100111594
2294 Ga0070695_100175514
2295 Ga0070695_100176264
2296 Ga0070695_100179168
2297 Ga0070695_100187823
2298 Ga0070695_100274574
2299 Ga0070695_100281472
2300 Ga0070695_100354240
2301 Ga0070695_101108870
2302 Ga0070695_101361126
2303 Ga0070696_100019932
2304 Ga0070696_100023964
2305 Ga0070696_100040232
2306 Ga0070696_100063781
2307 Ga0070696_100120767
2308 Ga0070696_100237954
2309 Ga0070696_100321041
2310 Ga0070696_100456591
2311 Ga0070696_100550746
2312 Ga0070696_100602912
2313 Ga0070696_100673846
2314 Ga0070696_100786969
2315 Ga0070696_101000354
2316 Ga0070696_101051317
2317 Ga0070696_101594424
2318 Ga0070693_100001027
2319 Ga0070693_100020106
2320 Ga0070693_100040618
2321 Ga0070693_100120448
2322 Ga0070693_100146133
2323 Ga0070693_100161362
2324 Ga0070693_100231616
2325 Ga0070693_100234541
2326 Ga0070693_100260436
2327 Ga0070693_100325100
2328 Ga0070693_100356585
2329 Ga0070693_100512654
2330 Ga0070693_100805751
2331 Ga0070665_102232576
2332 Ga0070665_102537069
2333 Ga0070704_100000638
2334 Ga0070704_100011390
2335 Ga0070704_100055340
2336 Ga0070704_100094157
2337 Ga0070704_100134596
2338 Ga0070704_100142336
2339 Ga0070704_100192071
2340 Ga0070704_100225477
2341 Ga0070704_100245537
2342 Ga0070704_100298268
2343 Ga0070704_100372851
2344 Ga0070704_100407869
2345 Ga0070704_100468200
2346 Ga0070704_100529797
2347 Ga0070704_101010391
2348 Ga0070704_101043703
2349 Ga0070704_101186742
2350 Ga0070704_101386499
2351 Ga0070704_101872853
2352 Ga0070704_102225550
2353 Ga0068855_100082116
2354 Ga0068855_100123812
2355 Ga0068855_101158766
2356 Ga0070664_100001593
2357 Ga0070664_100019348
2358 Ga0070664_100034374
2359 Ga0070664_100110606
2360 Ga0070664_100219134
2361 Ga0070664_100250658
2362 Ga0070664_100258816
2363 Ga0070664_100295084
2364 Ga0070664_100832186
2365 Ga0070664_100865431
2366 Ga0070664_100908978
2367 Ga0070664_101192161
2368 Ga0070664_102184821
2369 Ga0068857_100007456
2370 Ga0068857_100162531
2371 Ga0068857_100238232
2372 Ga0068857_100334645
2373 Ga0068857_100592349
2374 Ga0068857_100707492
2375 Ga0068857_100841467
2376 Ga0068857_100977441
2377 Ga0068857_100979100
2378 Ga0068857_101937024
2379 Ga0068854_100066991
2380 Ga0068854_100165762
2381 Ga0068854_100222826
2382 Ga0068854_100247555
2383 Ga0068854_100309976
2384 Ga0068854_100339251
2385 Ga0068854_100506345
2386 Ga0068854_100595120
2387 Ga0068854_100596486
2388 Ga0068854_100605661
2389 Ga0068854_100619376
2390 Ga0068854_100741171
2391 Ga0068854_100814971
2392 Ga0068854_100935980
2393 Ga0068854_101577272
2394 Ga0068854_102254851
2395 Ga0068856_100013790
2396 Ga0068856_100377881
2397 Ga0070702_100008168
2398 Ga0070702_100083104
2399 Ga0070702_100151910
2400 Ga0070702_100154024
2401 Ga0070702_100155020
2402 Ga0070702_100165177
2403 Ga0070702_100276673
2404 Ga0070702_100308442
2405 Ga0070702_100453731
2406 Ga0070702_100968627
2407 Ga0070702_100990839
2408 Ga0070702_101279812
2409 Ga0068852_100108736
2410 Ga0068852_100178412
2411 Ga0068852_101241939
2412 Ga0068852_101669583
2413 Ga0068852_102264094
2414 Ga0068852_102352623
2415 Ga0068859_100020868
2416 Ga0068859_100021421
2417 Ga0068859_100024568
2418 Ga0068859_100044736
2419 Ga0068859_100055086
2420 Ga0068859_100070562
2421 Ga0068859_100078004
2422 Ga0068859_100105980
2423 Ga0068859_100149850
2424 Ga0068859_100200803
2425 Ga0068859_100409209
2426 Ga0068859_100647282
2427 Ga0068859_100810856
2428 Ga0068859_100880916
2429 Ga0068859_101080165
2430 Ga0068859_101094391
2431 Ga0068859_101170504
2432 Ga0068859_101186725
2433 Ga0068859_101193960
2434 Ga0068859_101416941
2435 Ga0068859_101513282
2436 Ga0068859_101688571
2437 Ga0068859_102262714
2438 Ga0068859_102373410
2439 Ga0068864_100005538
2440 Ga0068864_100008111
2441 Ga0068864_100040762
2442 Ga0068864_100075005
2443 Ga0068864_100078291
2444 Ga0068864_100172601
2445 Ga0068864_100181671
2446 Ga0068864_100195558
2447 Ga0068864_100203478
2448 Ga0068864_100213940
2449 Ga0068864_100484924
2450 Ga0068864_100577812
2451 Ga0068864_100701912
2452 Ga0068864_100791383
2453 Ga0068864_100866677
2454 Ga0068864_100876566
2455 Ga0068864_101218471
2456 Ga0068864_101344206
2457 Ga0068864_101398182
2458 Ga0068864_101634005
2459 Ga0068864_102149785
2460 Ga0068864_102654219
2461 Ga0068866_10009446
2462 Ga0068866_10041764
2463 Ga0068866_10130772
2464 Ga0068866_10419960
2465 Ga0068861_100014138
2466 Ga0068861_100018961
2467 Ga0068861_100032844
2468 Ga0068861_100077072
2469 Ga0068861_100120200
2470 Ga0068861_100158909
2471 Ga0068861_100562295
2472 Ga0068861_100588512
2473 Ga0068861_100647537
2474 Ga0068861_101095075
2475 Ga0068861_101856969
2476 Ga0068861_102404359
2477 Ga0068851_10002483
2478 Ga0068851_10028961
2479 Ga0068851_10049073
2480 Ga0068851_10079733
2481 Ga0068851_10505632
2482 Ga0068851_10572181
2483 Ga0068870_10046463
2484 Ga0068870_10674555
2485 Ga0068870_10762924
2486 Ga0068870_11154119
2487 Ga0068863_100009282
2488 Ga0068863_100084843
2489 Ga0068863_100086830
2490 Ga0068863_100217664
2491 Ga0068863_100274825
2492 Ga0068863_100533521
2493 Ga0068863_100609941
2494 Ga0068863_100735823
2495 Ga0068863_101359847
2496 Ga0068863_101359910
2497 Ga0068863_101743218
2498 Ga0068863_101748588
2499 Ga0068863_101753752
2500 Ga0068863_102608383
2501 Ga0068858_100000008
2502 Ga0068858_100065422
2503 Ga0068858_100123156
2504 Ga0068858_100165722
2505 Ga0068858_100170948
2506 Ga0068858_100185912
2507 Ga0068858_100191906
2508 Ga0068858_100210695
2509 Ga0068858_100312237
2510 Ga0068858_100322088
2511 Ga0068858_100341351
2512 Ga0068858_100343091
2513 Ga0068858_100550737
2514 Ga0068858_101372634
2515 Ga0068858_101462873
2516 Ga0068858_102471235
2517 Ga0068860_100003829
2518 Ga0068860_100043301
2519 Ga0068860_100058850
2520 Ga0068860_100217941
2521 Ga0068860_100342031
2522 Ga0068860_100369436
2523 Ga0068860_100388239
2524 Ga0068860_100391879
2525 Ga0068860_100408955
2526 Ga0068860_100426055
2527 Ga0068860_100461606
2528 Ga0068860_100680614
2529 Ga0068860_100831712
2530 Ga0068860_100931421
2531 Ga0068860_101281397
2532 Ga0068860_101549482
2533 Ga0068862_100035327
2534 Ga0068862_100053564
2535 Ga0068862_100099686
2536 Ga0068862_100184254
2537 Ga0068862_100289776
2538 Ga0068862_100290383
2539 Ga0068862_100300121
2540 Ga0068862_100396312
2541 Ga0068862_100535922
2542 Ga0068862_101307084
2543 Ga0068862_101996785
2544 Ga0081455_10127815
2545 Ga0081455_10827037
2546 Ga0081455_11012794
2547 Ga0081540_1269884
2548 Ga0081539_10000043
2549 Ga0081539_10000239
2550 Ga0081539_10002560
2551 Ga0081539_10005773
2552 Ga0081539_10036660
2553 Ga0081539_10063712
2554 Ga0081539_10148326
2555 Ga0081539_10179901
2556 Ga0075432_10174576
2557 Ga0075432_10183566
2558 Ga0070715_10000031
2559 Ga0070716_100000007
2560 Ga0070716_100061133
2561 Ga0070716_100285362
2562 Ga0070716_100489502
2563 Ga0070716_100944288
2564 Ga0070716_101129837
2565 Ga0097621_100014473
2566 Ga0097621_100060925
2567 Ga0097621_100428458
2568 Ga0097621_100574052
2569 Ga0097621_100955395
2570 Ga0097621_101410234
2571 Ga0097621_101607677
2572 Ga0097621_101747823
2573 Ga0097621_101810270
2574 Ga0068871_100006157
2575 Ga0068871_100040428
2576 Ga0068871_100123033
2577 Ga0068871_100679826
2578 Ga0068871_100741079
2579 Ga0068871_100901505
2580 Ga0068871_102057804
2581 Ga0075428_100096869
2582 Ga0075428_100312649
2583 Ga0075428_100418959
2584 Ga0075428_101013906
2585 Ga0075430_100003709
2586 Ga0075430_100105376
2587 Ga0075430_101081017
2588 Ga0075431_100081177
2589 Ga0075431_100171647
2590 Ga0075431_100481551
2591 Ga0075433_10026566
2592 Ga0075433_10053141
2593 Ga0075433_10058232
2594 Ga0075433_10097408
2595 Ga0075433_10114233
2596 Ga0075433_10226243
2597 Ga0075433_10278613
2598 Ga0075433_10299111
2599 Ga0075433_10299625
2600 Ga0075433_10327671
2601 Ga0075433_11580798
2602 Ga0075433_11774185
2603 Ga0075434_100024264
2604 Ga0075434_100034748
2605 Ga0075434_100156176
2606 Ga0075434_100188880
2607 Ga0075434_100206533
2608 Ga0075434_100626936
2609 Ga0075434_100652546
2610 Ga0075434_100714577
2611 Ga0075434_100735773
2612 Ga0075434_100827760
2613 Ga0075434_101243069
2614 Ga0075434_101444314
2615 Ga0075429_100026020
2616 Ga0075429_100086629
2617 Ga0075429_100141042
2618 Ga0075429_100196712
2619 Ga0075429_100828955
2620 Ga0068865_100009576
2621 Ga0068865_100115107
2622 Ga0068865_100510628
2623 Ga0068865_100520236
2624 Ga0068865_100636443
2625 Ga0075436_100004844
2626 Ga0075436_100386245
2627 Ga0075436_100467569
2628 Ga0097620_100020867
2629 Ga0097620_100021422
2630 Ga0097620_100024569
2631 Ga0097620_100044738
2632 Ga0097620_100055085
2633 Ga0097620_100070551
2634 Ga0097620_100078008
2635 Ga0097620_100105979
2636 Ga0097620_100149849
2637 Ga0097620_100200811
2638 Ga0097620_100409196
2639 Ga0097620_100647395
2640 Ga0097620_100810747
2641 Ga0097620_100880927
2642 Ga0097620_101080110
2643 Ga0097620_101094318
2644 Ga0097620_101170489
2645 Ga0097620_101186737
2646 Ga0097620_101193644
2647 Ga0097620_101417009
2648 Ga0097620_101513451
2649 Ga0097620_101688563
2650 Ga0097620_102262809
2651 Ga0097620_102373448
2652 Ga0075435_100049727
2653 Ga0075435_100276935
2654 Ga0075435_100351385
2655 Ga0075435_100598677
2656 Ga0075435_100842691
2657 Ga0099794_10022132
2658 Ga0099794_10086451
2659 Ga0105251_10081845
2660 Ga0105250_10032491
2661 Ga0105250_10182539
2662 Ga0105250_10189845
2663 Ga0105240_10027411
2664 Ga0105240_10218903
2665 Ga0105240_10221618
2666 Ga0105240_10658693
2667 Ga0105240_10685529
2668 Ga0105240_11626371
2669 Ga0111539_10010730
2670 Ga0111539_10013968
2671 Ga0111539_10034502
2672 Ga0111539_10107492
2673 Ga0111539_10125939
2674 Ga0111539_10197686
2675 Ga0111539_10380973
2676 Ga0111539_10678434
2677 Ga0111539_10895653
2678 Ga0111539_11235102
2679 Ga0111539_12066229
2680 Ga0111539_13067422
2681 Ga0105245_10008532
2682 Ga0105245_10358338
2683 Ga0105245_10594437
2684 Ga0105245_10793083
2685 Ga0105245_10870528
2686 Ga0105245_11028032
2687 Ga0105245_11262982
2688 Ga0105245_11482143
2689 Ga0105245_11650060
2690 Ga0105245_12089003
2691 Ga0105247_10000001
2692 Ga0105247_10081690
2693 Ga0105247_10138873
2694 Ga0105247_10587115
2695 Ga0105247_10661824
2696 Ga0105247_10890298
2697 Ga0105247_11337822
2698 Ga0114129_10005476
2699 Ga0114129_10017890
2700 Ga0114129_10045834
2701 Ga0114129_10047639
2702 Ga0114129_10090358
2703 Ga0114129_10213209
2704 Ga0114129_10300892
2705 Ga0114129_10309907
2706 Ga0114129_10355984
2707 Ga0114129_10363965
2708 Ga0114129_11119729
2709 Ga0114129_11126702
2710 Ga0114129_11345260
2711 Ga0114129_11626177
2712 Ga0114129_12156744
2713 Ga0114129_13180303
2714 Ga0105243_10000119
2715 Ga0105243_10004942
2716 Ga0105243_10013322
2717 Ga0105243_10289445
2718 Ga0105243_10301522
2719 Ga0105243_10333732
2720 Ga0105243_10476201
2721 Ga0105243_10619094
2722 Ga0105243_10696301
2723 Ga0105243_11006211
2724 Ga0105243_11100562
2725 Ga0105243_11151742
2726 Ga0105243_11414661
2727 Ga0105243_12782872
2728 Ga0105243_12976424
2729 Ga0105241_10102859
2730 Ga0105241_10106832
2731 Ga0105241_10176274
2732 Ga0105241_10192225
2733 Ga0105241_10304048
2734 Ga0105241_10317024
2735 Ga0105241_10349401
2736 Ga0105241_10485403
2737 Ga0105241_10524953
2738 Ga0105241_10665552
2739 Ga0105241_10678226
2740 Ga0105241_10871033
2741 Ga0105241_11204664
2742 Ga0105241_11536491
2743 Ga0105241_11614081
2744 Ga0105241_11713988
2745 Ga0105242_10000113
2746 Ga0105242_10004299
2747 Ga0105242_10010627
2748 Ga0105242_10067704
2749 Ga0105242_10107097
2750 Ga0105242_10231377
2751 Ga0105242_10260890
2752 Ga0105242_10472962
2753 Ga0105242_10543083
2754 Ga0105242_10842674
2755 Ga0105242_11193069
2756 Ga0105242_11645709
2757 Ga0105242_11994581
2758 Ga0105242_12247748
2759 Ga0105242_13263700
2760 Ga0105248_10062642
2761 Ga0105248_10071853
2762 Ga0105248_10072593
2763 Ga0105248_10098050
2764 Ga0105248_10103880
2765 Ga0105248_10150142
2766 Ga0105248_10173620
2767 Ga0105248_10195936
2768 Ga0105248_10269984
2769 Ga0105248_10390234
2770 Ga0105248_10409461
2771 Ga0105248_10541022
2772 Ga0105248_10578011
2773 Ga0105248_10607460
2774 Ga0105248_10683283
2775 Ga0105248_10956220
2776 Ga0105248_11129214
2777 Ga0105248_11206862
2778 Ga0105248_11228766
2779 Ga0105248_11328425
2780 Ga0105248_11394873
2781 Ga0105248_11558213
2782 Ga0105248_12775589
2783 Ga0105248_12805905
2784 Ga0105237_10011061
2785 Ga0105237_10056051
2786 Ga0105237_10066585
2787 Ga0105237_10118503
2788 Ga0105237_10535835
2789 Ga0105237_11224785
2790 Ga0105237_12222892
2791 Ga0105238_10030053
2792 Ga0105238_10467445
2793 Ga0105238_10719923
2794 Ga0105238_10913464
2795 Ga0105238_12342741
2796 Ga0105249_10000028
2797 Ga0105249_10014015
2798 Ga0105249_10020461
2799 Ga0105249_10023248
2800 Ga0105249_10234655
2801 Ga0105249_10253672
2802 Ga0105249_10629744
2803 Ga0105249_10758768
2804 Ga0105249_11007524
2805 Ga0105249_11027243
2806 Ga0105249_11612003
2807 Ga0105249_11903286
2808 Ga0105249_12467153
2809 Ga0105249_13235024
2810 Ga0099796_10128767
2811 Ga0105239_10030724
2812 Ga0105239_10107358
2813 Ga0105239_10289529
2814 Ga0105239_10369153
2815 Ga0105239_10387134
2816 Ga0105239_10718499
2817 Ga0105239_10909736
2818 Ga0105239_10919300
2819 Ga0105239_11159379
2820 Ga0105239_11253958
2821 Ga0105239_11357612
2822 Ga0105239_12531326
2823 Ga0105239_12691519
2824 Ga0105239_12832121
2825 Ga0105246_10064958
2826 Ga0105246_10069042
2827 Ga0105246_10090250
2828 Ga0105246_10205060
2829 Ga0105246_10214471
2830 Ga0105246_10621912
2831 Ga0105246_10770518
2832 Ga0105246_11162328
2833 Ga0105246_12047319
2834 Ga0105246_12203546
2835 Ga0105246_12297149
2836 Ga0157373_10062746
2837 Ga0157373_10095110
2838 Ga0157373_10103340
2839 Ga0157373_10110346
2840 Ga0157373_10123296
2841 Ga0157373_10178303
2842 Ga0157373_10340319
2843 Ga0157371_10090052
2844 Ga0157371_11009403
2845 Ga0157371_11145118
2846 Ga0157371_11234129
2847 Ga0157370_10072475
2848 Ga0157370_10171697
2849 Ga0157370_10311572
2850 Ga0157369_10092662
2851 Ga0157369_10152829
2852 Ga0157369_11178088
2853 Ga0157374_10090602
2854 Ga0157374_10198619
2855 Ga0157374_10520036
2856 Ga0157374_11183740
2857 Ga0157374_12026151
2858 Ga0157378_10000163
2859 Ga0157378_10001554
2860 Ga0157378_10008355
2861 Ga0157378_10034190
2862 Ga0157378_10050951
2863 Ga0157378_10071515
2864 Ga0157378_10083656
2865 Ga0157378_10141412
2866 Ga0157378_10154516
2867 Ga0157378_10176542
2868 Ga0157378_10276191
2869 Ga0157378_10369683
2870 Ga0157378_10372735
2871 Ga0157378_10403538
2872 Ga0157378_10694019
2873 Ga0157378_10879809
2874 Ga0157378_11328606
2875 Ga0157378_11332982
2876 Ga0157378_11487946
2877 Ga0157378_11505329
2878 Ga0157378_11856754
2879 Ga0157378_13088911
2880 Ga0157378_13118554
2881 Ga0163162_10000027
2882 Ga0163162_10001557
2883 Ga0163162_10001819
2884 Ga0163162_10013469
2885 Ga0163162_10097421
2886 Ga0163162_10105237
2887 Ga0163162_10245321
2888 Ga0163162_10246809
2889 Ga0163162_10252071
2890 Ga0163162_10832755
2891 Ga0163162_11154320
2892 Ga0163162_11452240
2893 Ga0163162_11550111
2894 Ga0163162_12296345
2895 Ga0163162_12313769
2896 Ga0163162_12365236
2897 Ga0163162_12784382
2898 Ga0163162_13098200
2899 Ga0157372_10022333
2900 Ga0157372_10048333
2901 Ga0157372_10061654
2902 Ga0157372_10067477
2903 Ga0157372_10212217
2904 Ga0157372_10258165
2905 Ga0157372_10382096
2906 Ga0157372_10552124
2907 Ga0157372_10798386
2908 Ga0157372_10920488
2909 Ga0157372_11170491
2910 Ga0157372_11250813
2911 Ga0157372_11476518
2912 Ga0157372_11538492
2913 Ga0157372_11603615
2914 Ga0157372_11621976
2915 Ga0157372_12290610
2916 Ga0157375_10127326
2917 Ga0157375_10149716
2918 Ga0157375_10180319
2919 Ga0157375_10234970
2920 Ga0157375_10422077
2921 Ga0157375_10728102
2922 Ga0157375_10907609
2923 Ga0157375_11029304
2924 Ga0157375_11056874
2925 Ga0157375_11107456
2926 Ga0157375_11265361
2927 Ga0157375_11533538
2928 Ga0157375_12921044
2929 Ga0163163_10009872
2930 Ga0163163_10023334
2931 Ga0163163_10028121
2932 Ga0163163_10047001
2933 Ga0163163_10069074
2934 Ga0163163_10074742
2935 Ga0163163_10173703
2936 Ga0163163_10194128
2937 Ga0163163_10219841
2938 Ga0163163_10382573
2939 Ga0163163_10590841
2940 Ga0163163_10747604
2941 Ga0163163_10920304
2942 Ga0163163_10971526
2943 Ga0163163_11082087
2944 Ga0163163_11369727
2945 Ga0163163_11462368
2946 Ga0163163_11576416
2947 Ga0163163_12025065
2948 Ga0163163_12197803
2949 Ga0163163_12896893
2950 Ga0157380_10001451
2951 Ga0157380_10002205
2952 Ga0157380_10024802
2953 Ga0157380_10043883
2954 Ga0157380_10097636
2955 Ga0157380_10111079
2956 Ga0157380_10318596
2957 Ga0157380_10416654
2958 Ga0157380_11106312
2959 Ga0157380_11325256
2960 Ga0157380_12370458
2961 Ga0157380_12649011
2962 Ga0157380_12728529
2963 Ga0157380_13484822
2964 Ga0182008_10194375
2965 Ga0182008_10215041
2966 Ga0157377_10084179
2967 Ga0157377_10136532
2968 Ga0157377_10158760
2969 Ga0157377_10278711
2970 Ga0157377_10283269
2971 Ga0157377_10342555
2972 Ga0157377_10876027
2973 Ga0157377_11193498
2974 Ga0157379_10042678
2975 Ga0157379_10073922
2976 Ga0157379_10077774
2977 Ga0157379_10451939
2978 Ga0157379_10769566
2979 Ga0157379_10858370
2980 Ga0157379_10935016
2981 Ga0157379_11183837
2982 Ga0157379_11387027
2983 Ga0157379_11865313
2984 Ga0157376_10011187
2985 Ga0157376_10406943
2986 Ga0157376_10474687
2987 Ga0182005_1041260
2988 Ga0163161_10005583
2989 Ga0163161_10010405
2990 Ga0163161_10025611
2991 Ga0163161_10231932
2992 Ga0163161_10446788
2993 Ga0163161_10516072
2994 Ga0163161_11219518
2995 Ga0213876_10000102
2996 Ga0213876_10000277
2997 Ga0207697_10009354
2998 Ga0207697_10037174
2999 Ga0207656_10016582
3000 Ga0207656_10155106
3001 Ga0207713_1142031
3002 Ga0207653_10000948
3003 Ga0207682_10049097
3004 Ga0207682_10169765
3005 Ga0207642_10002306
3006 Ga0207642_10022160
3007 Ga0207642_10272013
3008 Ga0207710_10000003
3009 Ga0207710_10024784
3010 Ga0207710_10048922
3011 Ga0207710_10112482
3012 Ga0207710_10180533
3013 Ga0207710_10352063
3014 Ga0207710_10475166
3015 Ga0207688_10266886
3016 Ga0207680_10067934
3017 Ga0207680_10069536
3018 Ga0207647_10001815
3019 Ga0207647_10094662
3020 Ga0207647_10107490
3021 Ga0207685_10000007
3022 Ga0207699_10855810
3023 Ga0207699_11338716
3024 Ga0207645_10064242
3025 Ga0207645_10176216
3026 Ga0207645_10830273
3027 Ga0207643_10009763
3028 Ga0207643_10057712
3029 Ga0207643_10101088
3030 Ga0207643_10109604
3031 Ga0207643_10436908
3032 Ga0207643_10787016
3033 Ga0207643_10868303
3034 Ga0207684_10000170
3035 Ga0207684_10019633
3036 Ga0207684_10036958
3037 Ga0207684_10086334
3038 Ga0207684_10093579
3039 Ga0207684_10103112
3040 Ga0207684_10200233
3041 Ga0207684_10259931
3042 Ga0207684_10419270
3043 Ga0207654_10005182
3044 Ga0207654_10110418
3045 Ga0207654_10190310
3046 Ga0207654_10218601
3047 Ga0207654_10340484
3048 Ga0207654_10410130
3049 Ga0207654_10781507
3050 Ga0207654_10977504
3051 Ga0207654_11223755
3052 Ga0207707_10000015
3053 Ga0207707_10008748
3054 Ga0207707_10015435
3055 Ga0207707_10113718
3056 Ga0207707_10178413
3057 Ga0207695_10224757
3058 Ga0207695_10534985
3059 Ga0207695_10569196
3060 Ga0207695_10894480
3061 Ga0207695_10959196
3062 Ga0207695_11230326
3063 Ga0207671_10000958
3064 Ga0207671_10210336
3065 Ga0207671_10413585
3066 Ga0207671_10440118
3067 Ga0207663_11207957
3068 Ga0207660_10001103
3069 Ga0207660_10010882
3070 Ga0207660_10079617
3071 Ga0207660_10772129
3072 Ga0207662_10002814
3073 Ga0207662_10033436
3074 Ga0207662_10043959
3075 Ga0207662_10059477
3076 Ga0207662_10104004
3077 Ga0207662_10195794
3078 Ga0207662_10284955
3079 Ga0207662_10334641
3080 Ga0207662_10364492
3081 Ga0207662_10380098
3082 Ga0207662_10698942
3083 Ga0207657_10546050
3084 Ga0207657_10689536
3085 Ga0207649_10040447
3086 Ga0207649_10044914
3087 Ga0207649_10143064
3088 Ga0207649_10316372
3089 Ga0207649_10560789
3090 Ga0207649_11120229
3091 Ga0207649_11470604
3092 Ga0207652_10000252
3093 Ga0207652_10988215
3094 Ga0207646_10003914
3095 Ga0207646_10049029
3096 Ga0207646_10063422
3097 Ga0207646_10079652
3098 Ga0207646_10124291
3099 Ga0207646_10584162
3100 Ga0207646_10854790
3101 Ga0207681_10005772
3102 Ga0207681_10006488
3103 Ga0207681_10022095
3104 Ga0207681_10036809
3105 Ga0207681_10113375
3106 Ga0207681_10563264
3107 Ga0207681_10694335
3108 Ga0207681_10800936
3109 Ga0207681_11069120
3110 Ga0207681_11238412
3111 Ga0207681_11304117
3112 Ga0207694_10004960
3113 Ga0207694_10068494
3114 Ga0207650_10000005
3115 Ga0207650_10001694
3116 Ga0207650_10047533
3117 Ga0207650_10114046
3118 Ga0207650_10118649
3119 Ga0207650_10180046
3120 Ga0207650_10257644
3121 Ga0207650_10316409
3122 Ga0207650_10403790
3123 Ga0207650_10498050
3124 Ga0207650_10543558
3125 Ga0207650_10633926
3126 Ga0207650_10775976
3127 Ga0207659_10373815
3128 Ga0207659_10459101
3129 Ga0207659_10568740
3130 Ga0207659_11032480
3131 Ga0207659_11083540
3132 Ga0207687_10133222
3133 Ga0207687_10841384
3134 Ga0207687_10886191
3135 Ga0207687_11317472
3136 Ga0207644_10000209
3137 Ga0207644_10007515
3138 Ga0207644_10018688
3139 Ga0207644_10077140
3140 Ga0207644_10224780
3141 Ga0207644_10330400
3142 Ga0207690_10094122
3143 Ga0207690_10165270
3144 Ga0207690_10202760
3145 Ga0207690_11130193
3146 Ga0207690_11469818
3147 Ga0207706_10068958
3148 Ga0207706_10089618
3149 Ga0207706_10240155
3150 Ga0207706_10319637
3151 Ga0207706_10409390
3152 Ga0207706_11365577
3153 Ga0207686_10000114
3154 Ga0207686_10000400
3155 Ga0207686_10006928
3156 Ga0207686_10019085
3157 Ga0207686_10026180
3158 Ga0207686_10031105
3159 Ga0207686_10075397
3160 Ga0207686_10450241
3161 Ga0207686_10662521
3162 Ga0207686_11257672
3163 Ga0207709_10000162
3164 Ga0207709_10002929
3165 Ga0207709_10058798
3166 Ga0207709_10334193
3167 Ga0207709_10398188
3168 Ga0207709_10427051
3169 Ga0207709_10787701
3170 Ga0207709_10821343
3171 Ga0207670_10036048
3172 Ga0207670_10070067
3173 Ga0207670_10393594
3174 Ga0207670_10396242
3175 Ga0207670_10603808
3176 Ga0207670_10738278
3177 Ga0207670_11443971
3178 Ga0207670_11836590
3179 Ga0207669_10284224
3180 Ga0207669_11581955
3181 Ga0207704_10080963
3182 Ga0207704_10444825
3183 Ga0207704_10519736
3184 Ga0207704_10744986
3185 Ga0207665_10000018
3186 Ga0207665_10047602
3187 Ga0207665_10126614
3188 Ga0207665_10182251
3189 Ga0207665_10265017
3190 Ga0207665_10478505
3191 Ga0207665_10958669
3192 Ga0207691_10005480
3193 Ga0207691_10011710
3194 Ga0207691_10221603
3195 Ga0207691_10283457
3196 Ga0207691_11035407
3197 Ga0207691_11065415
3198 Ga0207711_10004919
3199 Ga0207711_10044927
3200 Ga0207711_10054983
3201 Ga0207711_10101440
3202 Ga0207711_10108714
3203 Ga0207711_10192914
3204 Ga0207711_10365493
3205 Ga0207711_10436521
3206 Ga0207711_10475339
3207 Ga0207711_10523454
3208 Ga0207711_10828604
3209 Ga0207711_11959275
3210 Ga0207689_10004566
3211 Ga0207689_10037086
3212 Ga0207689_10057085
3213 Ga0207689_10065176
3214 Ga0207689_10251785
3215 Ga0207689_10262503
3216 Ga0207689_10556010
3217 Ga0207689_10680662
3218 Ga0207689_10767911
3219 Ga0207689_10818446
3220 Ga0207689_10894665
3221 Ga0207689_11066735
3222 Ga0207661_10431236
3223 Ga0207679_10007735
3224 Ga0207679_10049367
3225 Ga0207679_10068310
3226 Ga0207679_10095263
3227 Ga0207679_10587018
3228 Ga0207679_10647977
3229 Ga0207679_10716643
3230 Ga0207679_11034252
3231 Ga0207679_11060397
3232 Ga0207679_11256571
3233 Ga0207679_11792415
3234 Ga0207667_10036979
3235 Ga0207667_10150953
3236 Ga0207667_10543477
3237 Ga0207667_10574190
3238 Ga0207667_11021183
3239 Ga0207651_10012707
3240 Ga0207651_10030462
3241 Ga0207651_10108245
3242 Ga0207651_10145698
3243 Ga0207651_10260360
3244 Ga0207651_10326001
3245 Ga0207651_10331965
3246 Ga0207651_10410654
3247 Ga0207651_10710345
3248 Ga0207651_10986522
3249 Ga0207651_11793364
3250 Ga0207651_11837560
3251 Ga0207712_10000110
3252 Ga0207712_10012290
3253 Ga0207712_10017368
3254 Ga0207712_10021709
3255 Ga0207712_10121896
3256 Ga0207712_10238367
3257 Ga0207712_10257828
3258 Ga0207712_10523236
3259 Ga0207712_10538632
3260 Ga0207712_10622259
3261 Ga0207712_10922584
3262 Ga0207668_10015518
3263 Ga0207668_10483142
3264 Ga0207640_10209869
3265 Ga0207640_10227447
3266 Ga0207640_10391746
3267 Ga0207640_10422111
3268 Ga0207640_10439666
3269 Ga0207640_10581708
3270 Ga0207640_11244336
3271 Ga0207640_11990223
3272 Ga0207658_10196267
3273 Ga0207658_10808428
3274 Ga0207677_10030542
3275 Ga0207677_10144422
3276 Ga0207677_10221622
3277 Ga0207677_10410939
3278 Ga0207677_10614925
3279 Ga0207677_11572603
3280 Ga0207677_12081629
3281 Ga0207703_10000354
3282 Ga0207703_10030675
3283 Ga0207703_10045085
3284 Ga0207703_10057479
3285 Ga0207703_10105027
3286 Ga0207703_10280311
3287 Ga0207703_10468992
3288 Ga0207703_10884731
3289 Ga0207703_10950271
3290 Ga0207703_10958384
3291 Ga0207703_10972656
3292 Ga0207703_11296928
3293 Ga0207703_11304613
3294 Ga0207703_11485294
3295 Ga0207703_11553978
3296 Ga0207703_11603271
3297 Ga0207639_10022288
3298 Ga0207639_10029011
3299 Ga0207639_10067826
3300 Ga0207639_10120554
3301 Ga0207639_10212778
3302 Ga0207639_10381317
3303 Ga0207639_10736273
3304 Ga0207639_10863911
3305 Ga0207639_11023959
3306 Ga0207639_11136222
3307 Ga0207678_11540782
3308 Ga0207708_10000043
3309 Ga0207708_10008562
3310 Ga0207708_10080486
3311 Ga0207708_10091884
3312 Ga0207708_10098786
3313 Ga0207708_10116230
3314 Ga0207708_10177441
3315 Ga0207708_10178691
3316 Ga0207708_10951789
3317 Ga0207702_10009027
3318 Ga0207702_12077363
3319 Ga0207641_10042907
3320 Ga0207641_10043453
3321 Ga0207641_10072372
3322 Ga0207641_10177448
3323 Ga0207641_10399291
3324 Ga0207641_10439481
3325 Ga0207641_10490034
3326 Ga0207641_10665904
3327 Ga0207641_10792588
3328 Ga0207641_11085107
3329 Ga0207641_11932658
3330 Ga0207641_12117418
3331 Ga0207648_10013061
3332 Ga0207648_10069732
3333 Ga0207648_10293972
3334 Ga0207648_10378199
3335 Ga0207648_10391305
3336 Ga0207648_10396564
3337 Ga0207648_10424307
3338 Ga0207648_10536464
3339 Ga0207648_10595373
3340 Ga0207648_10640379
3341 Ga0207648_10667869
3342 Ga0207648_10827179
3343 Ga0207648_11060720
3344 Ga0207648_11123060
3345 Ga0207676_10002979
3346 Ga0207676_10005890
3347 Ga0207676_10008806
3348 Ga0207676_10022931
3349 Ga0207676_10044217
3350 Ga0207676_10062217
3351 Ga0207676_10080889
3352 Ga0207676_10137391
3353 Ga0207676_10179796
3354 Ga0207676_10429136
3355 Ga0207676_10567109
3356 Ga0207676_10607355
3357 Ga0207676_10724123
3358 Ga0207676_11165434
3359 Ga0207676_11189402
3360 Ga0207676_11331360
3361 Ga0207676_11401262
3362 Ga0207676_11409525
3363 Ga0207676_11427061
3364 Ga0207676_12365990
3365 Ga0207674_10005214
3366 Ga0207674_10036996
3367 Ga0207674_10119573
3368 Ga0207674_10119925
3369 Ga0207674_10237703
3370 Ga0207674_10238337
3371 Ga0207674_10284283
3372 Ga0207674_10750537
3373 Ga0207674_11100217
3374 Ga0207675_100001995
3375 Ga0207675_100002789
3376 Ga0207675_100019390
3377 Ga0207675_100059323
3378 Ga0207675_100084649
3379 Ga0207675_100186975
3380 Ga0207675_100369775
3381 Ga0207675_100446338
3382 Ga0207675_100668915
3383 Ga0207675_100782754
3384 Ga0207675_100817740
3385 Ga0207683_10032905
3386 Ga0207683_10232608
3387 Ga0207683_10243667
3388 Ga0207683_10468141
3389 Ga0207683_11229718
3390 Ga0207698_10181654
3391 Ga0207698_10608367
3392 Ga0207698_10680470
3393 Ga0207698_10828684
3394 Ga0207698_11145649
3395 Ga0207698_11177691
3396 Ga0207698_12464915
3397 Ga0209588_1012747
3398 Ga0209998_10075284
3399 Ga0207428_10065696
3400 Ga0207428_10070786
3401 Ga0207428_10657281
3402 Ga0207428_10736473
3403 Ga0207428_10910815
3404 Ga0268266_11862810
3405 Ga0268265_10017259
3406 Ga0268265_10057467
3407 Ga0268265_10096691
3408 Ga0268265_10274850
3409 Ga0268265_10298436
3410 Ga0268265_10312780
3411 Ga0268265_10576803
3412 Ga0268265_10577171
3413 Ga0268265_10588721
3414 Ga0268265_10977818
3415 Ga0268265_11914691
3416 Ga0268264_10043770
3417 Ga0268264_10050755
3418 Ga0268264_10082424
3419 Ga0268264_10090034
3420 Ga0268264_10094624
3421 Ga0268264_10127843
3422 Ga0268264_10132530
3423 Ga0268264_10153007
3424 Ga0268264_10424708
3425 Ga0268264_10529729
3426 Ga0268264_10630881
3427 Ga0268264_10756828
3428 Ga0268264_10808951
3429 Ga0268264_11477167
3430 Ga0268264_11682154
3431 Ga0307515_10538640
3432 Ga0314311_1139834
3433 Ga0316178_1142882
3434 Ga0316182_1148632
3435 Ga0307513_10005598
3436 Ga0307408_100385006
3437 Ga0307408_100446041
3438 Ga0307408_101156004
3439 Ga0307408_102520166
3440 Ga0307405_10179549
3441 Ga0307405_10235300
3442 Ga0307405_10289468
3443 Ga0307405_10376675
3444 Ga0307405_11040058
3445 Ga0307413_10032967
3446 Ga0307410_10039430
3447 Ga0307410_10164481
3448 Ga0307410_10235960
3449 Ga0307410_10561925
3450 Ga0307406_10013493
3451 Ga0307406_10017531
3452 Ga0307406_10489063
3453 Ga0307406_10564726
3454 Ga0307407_10026139
3455 Ga0307407_10142309
3456 Ga0307407_10514336
3457 Ga0307412_10053675
3458 Ga0307412_10201000
3459 Ga0307412_10317114
3460 Ga0307412_10777775
3461 Ga0307412_10933548
3462 Ga0307409_100058421
3463 Ga0307409_100156791
3464 Ga0307409_102649159
3465 Ga0307416_100011954
3466 Ga0307416_100033296
3467 Ga0307416_100392925
3468 Ga0307416_100525371
3469 Ga0307416_100939695
3470 Ga0307416_101175142
3471 Ga0307416_101435174
3472 Ga0307416_101642387
3473 Ga0307416_103606258
3474 Ga0307414_10000977
3475 Ga0307414_10078412
3476 Ga0307414_10137096
3477 Ga0307414_10198823
3478 Ga0307414_11757143
3479 Ga0307411_10074618
3480 Ga0307411_10233335
3481 Ga0307411_10244264
3482 Ga0307411_10907235
3483 Ga0307411_11119931
3484 Ga0307415_100037442
3485 Ga0307415_100176510
3486 Ga0307415_100347705
3487 Ga0373950_0048464
3488 Ga0373929_0251653
3489 Ga0373940_0155622
3490 Ga0373951_0023668
3491 Ga0373941_0009414
3492 Ga0373941_0013541
3493 Ga0373942_0004655
3494 Ga0373961_0177239
3495 Ga0373961_0254092
3496 Ga0373962_0378234
3497 Ga0373931_0449195
3498 Ga0373935_0606208
3499 Ga0373937_0733945
3500 Ga0373925_1349093
3501 Ga0395900_0057486
3502 Ga0395900_0158741
3503 Ga0395900_0848922
3504 Ga0395900_0878894
3505 Ga0395900_1353970
3506 Ga0395898_0153361
3507 Ga0395898_0942013
3508 Ga0395898_1144769
3509 Ga0395905_0002781
3510 Ga0395905_0029119
3511 Ga0395905_0803208
3512 Ga0395905_1854701
3513 Ga0436364_1177179
3514 Ga0395901_0176126
3515 Ga0395901_0808868
3516 Ga0395901_1858813
3517 Ga0242422_02081
3518 Ga0242420_061324
3519 Ga0436365_0557003
3520 Ga0436365_0744561
3521 Ga0436365_0802786
3522 Ga0436363_0057732
3523 Ga0451793_1711702
3524 Ga0451807_0635481
3525 Ga0451807_1877268
3526 Ga0451853_3186910
3527 Ga0439448_0015162
3528 Ga0439432_014864
3529 Ga0439455_0123271
3530 Ga0439462_0193974
3531 Ga0439446_0069853
3532 Ga0439458_0004943
3533 Ga0439458_0165737
3534 Ga0439434_0004396
3535 Ga0439434_0089917
3536 Ga0439435_0109874
3537 Ga0439459_0222521
3538 Ga0439464_0010763
3539 Ga0451577_0528632
3540 Ga0453683_0010562
3541 Ga0453683_1035877
3542 Ga0453684_1410385
3543 Ga0466960_0860746
3544 Ga0451576_0005147
3545 Ga0451576_0311562
3546 Ga0451576_0407534
3547 Ga0451576_0902485
3548 Ga0451576_1775920
3549 Ga0495592_0614521
3550 Ga0495629_0600031
3551 Ga0495651_0445892
3552 Ga0495580_0419989
3553 Ga0495639_0109479
3554 Ga0495664_0387253
3555 Ga0495618_0147288
3556 Ga0495632_0033115
3557 Ga0495643_0293688
3558 Ga0495663_0218879
3559 Ga0495586_0091430
3560 Ga0495598_0286926
3561 Ga0495621_0036583
3562 Ga0495621_0263646
3563 Ga0495645_0111154
3564 Ga0495667_0523741
3565 Ga0495656_0033559
3566 Ga0495634_0319925
3567 Ga0495635_0321269
3568 Ga0495659_0030422
3569 Ga0495599_0535317
3570 Ga0495658_0623392
3571 Ga0495658_0923733
3572 Ga0495669_0112499
3573 Ga0495669_0556207
3574 Ga0495613_0343003
3575 Ga0495613_0950394
3576 Ga0495636_0289207
3577 Ga0495674_0202623
3578 Ga0495672_0180552
3579 Ga0495676_0639422
3580 Ga0495680_0304969
3581 Ga0495684_0238417
3582 Ga0496100_0179322
3583 Ga0496100_1157036
3584 Ga0496102_0335442
3585 Ga0496103_0437785
3586 Ga0496104_0316002
3587 Ga0496105_0496595
3588 Ga0496106_0048317
3589 Ga0496106_0686255
3590 Ga0496107_0542035
3591 Ga0496107_0730513
3592 Ga0496108_0369203
3593 Ga0496108_0397826
3594 Ga0496108_1303888
3595 Ga0496110_1867855
3596 Ga0496112_0127939
3597 Ga0496112_0887194
3598 Ga0496112_1648897
3599 Ga0496112_1764855
3600 Ga0496113_0693932
3601 Ga0496113_1188640
3602 Ga0496113_1435599
3603 Ga0501306_047967
3604 Ga0501291_024043
3605 Ga0501292_005612
3606 Ga0501292_109767
3607 Ga0501296_001466
3608 Ga0501296_008296
3609 Ga0501297_000547
3610 Ga0501298_009494
3611 Ga0501299_000445
3612 Ga0501299_017318
3613 Ga0501302_006596
3614 Ga0501031_0250921
3615 Ga0501038_0002264
3616 Ga0501040_0456466
3617 Ga0501040_1386623
3618 Ga0501042_1138767
3619 Ga0501068_1119296
3620 Ga0501071_0426168
3621 Ga0501071_1100341
3622 Ga0501074_0461150
3623 Ga0501075_0721590
3624 Ga0501076_1702648
3625 Ga0501202_070562
3626 Ga0501202_082970
3627 Ga0501206_028358
3628 Ga0501206_092843
3629 Ga0501207_003686
3630 Ga0501207_010119
3631 Ga0501209_261165
3632 Ga0501216_001484
3633 Ga0501216_049063
3634 Ga0501217_002716
3635 Ga0501217_011755
3636 Ga0501217_016282
3637 Ga0501217_030047
3638 Ga0501217_073356
3639 Ga0501223_000914
3640 Ga0501224_008456
3641 Ga0501224_009480
3642 Ga0501224_012920
3643 Ga0501224_028677
3644 Ga0501227_013007
3645 Ga0501227_060935
3646 Ga0501227_108220
3647 Ga0501227_223389
3648 Ga0501228_000957
3649 Ga0501230_001733
3650 Ga0501230_031522
3651 Ga0501230_107171
3652 Ga0501233_000913
3653 Ga0501233_001382
3654 Ga0501233_010608
3655 Ga0501235_004859
3656 Ga0501235_007230
3657 Ga0501235_024707
3658 Ga0501235_045912
3659 Ga0501235_062601
3660 Ga0501236_070496
3661 Ga0501238_025570
3662 Ga0501239_018589
3663 Ga0501242_008911
3664 Ga0501247_002464
3665 Ga0501249_003205
3666 Ga0501249_022689
3667 Ga0501249_086269
3668 Ga0501255_009317
3669 Ga0501255_059191
3670 Ga0501256_001685
3671 Ga0501256_008997
3672 Ga0501257_010091
3673 Ga0501257_025537
3674 Ga0501257_043823
3675 Ga0501258_013724
3676 Ga0501259_007540
3677 Ga0501260_001245
3678 Ga0501261_002239
3679 Ga0501261_061670
3680 Ga0501219_015825
3681 Ga0501221_004377
3682 Ga0501221_013198
3683 Ga0501225_0000533
3684 Ga0501225_0006298
3685 Ga0501225_0006664
3686 Ga0501225_0027023
3687 Ga0501225_0077452
3688 Ga0501234_000103
3689 Ga0501234_004496
3690 Ga0501234_021066
3691 Ga0501245_027776
3692 Ga0501081_0568735
3693 Ga0501241_031060
3694 Ga0501262_033403
3695 Ga0501268_005132
3696 Ga0501268_055652
3697 Ga0501270_001352
3698 Ga0501270_022792
3699 Ga0501270_069657
3700 Ga0501272_000807
3701 Ga0501273_001458
3702 Ga0501273_038118
3703 Ga0501274_027304
3704 Ga0501276_034898
3705 Ga0501279_008611
3706 Ga0501283_003147
3707 Ga0501045_0462498
3708 Ga0501204_004815
3709 Ga0501212_004055
3710 Ga0501212_012910
3711 Ga0501226_021370
3712 Ga0501226_029881
3713 nmdc:mga05p37_1326369_c1
3714 nmdc:mga05p37_144080_c1
3715 nmdc:mga05p37_1550_c1
3716 nmdc:mga05p37_175010_c1
3717 nmdc:mga05p37_176287_c1
3718 nmdc:mga05p37_203665_c1
3719 nmdc:mga05p37_257432_c1
3720 nmdc:mga09592_105125_c1
3721 nmdc:mga09592_133783_c1
3722 nmdc:mga09592_1713037_c1
3723 nmdc:mga09592_287578_c1
3724 nmdc:mga09592_448085_c1
3725 nmdc:mga09592_500134_c1
3726 nmdc:mga09592_794318_c1
3727 nmdc:mga0qj67_119633_c1
3728 nmdc:mga0qj67_19703_c1
3729 nmdc:mga0qj67_721058_c1
3730 nmdc:mga06r32_1421689_c1
3731 nmdc:mga06r32_160852_c1
3732 nmdc:mga06r32_309702_c1
3733 nmdc:mga06r32_929707_c1
3734 nmdc:mga08y16_1131534_c1
3735 nmdc:mga08y16_1143473_c1
3736 nmdc:mga08y16_14198_c1
3737 nmdc:mga08y16_21530_c1
3738 nmdc:mga08y16_233803_c1
3739 nmdc:mga08y16_91785_c1
3740 nmdc:mga0n895_1000796_c1
3741 nmdc:mga0n895_1020694_c1
3742 nmdc:mga0n895_1025419_c1
3743 nmdc:mga0n895_1098030_c1
3744 nmdc:mga0n895_1195966_c1
3745 nmdc:mga0n895_1419271_c1
3746 nmdc:mga0n895_14374_c1
3747 nmdc:mga0n895_146599_c1
3748 nmdc:mga0n895_157804_c1
3749 nmdc:mga0n895_190141_c1
3750 nmdc:mga0n895_22555_c1
3751 nmdc:mga0n895_268488_c1
3752 nmdc:mga0n895_422547_c1
3753 nmdc:mga0n895_547301_c1
3754 nmdc:mga0n895_603158_c1
3755 nmdc:mga0n895_916310_c1
3756 nmdc:mga0n895_995488_c1
3757 nmdc:mga0rr50_265436_c1
3758 nmdc:mga0rr50_663509_c1
3759 nmdc:mga08x19_1934_c1
3760 nmdc:mga08x19_504765_c1
3761 nmdc:mga08x19_517049_c1
3762 nmdc:mga08x19_638733_c1
3763 nmdc:mga0a205_104849_c1
3764 nmdc:mga0a205_1059515_c1
3765 nmdc:mga0a205_162022_c1
3766 nmdc:mga0a205_164983_c1
3767 nmdc:mga0a205_39871_c1
3768 nmdc:mga0a205_428450_c1
3769 nmdc:mga0a205_438131_c1
3770 nmdc:mga0a205_505895_c1
3771 nmdc:mga0a205_5706_c1
3772 nmdc:mga0a205_575064_c1
3773 nmdc:mga0a205_631495_c1
3774 nmdc:mga0a205_648089_c1
3775 nmdc:mga0a205_717966_c1
3776 nmdc:mga0a205_869612_c1
3777 Ga0495601_0587568
3778 Ga0495619_0442099
3779 Ga0500566_0195253
3780 Ga0500616_0005403
3781 Ga0501084_0057400
3782 Ga0501084_0627741
3783 Ga0587066_072192
3784 Ga0587083_0101657
3785 Ga0587085_051446
3786 Ga0587094_055174
3787 Ga0587062_088234
3788 Ga0587067_100281
3789 Ga0587068_132302
3790 Ga0587069_079635
3791 Ga0587069_132285
3792 Ga0587072_145355
3793 Ga0587076_077303
3794 Ga0587107_098115
3795 Ga0587111_0110881
3796 Ga0501082_0880283

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05164

ZapA

Cell division protein ZapA

39

132

0.88

Map