F496001

General Info

Members Datasets Scaffolds Average Seq Length
1896 833 3792 249

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10020694|JGI25404J52841_100206942
Length 273
Sequence MAFSLQNSGLAAGVFANGXNDRGXIVTDRVVVITGASRGIGRAAAIAAAERGFRVVVGYASNQAAADEVVDQIERKNGKAIAVXCDVAHEKDILALFKAADEFGXLGALVNNAGIVGPSVRVEDMSAERVQRMMAVNVTGSLLCAREAVKRMSTRRGGKGGVIVNLSSVASRLGSANTYVDYAASKGAVDSFTIGLGHEVAAEGIRVAAIRPGLIDTEIHASGGEPDRAHRLAPMVPMKRVGTAQEIANAIVWLISDEASYVTSAILDVSGGR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
101 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
137 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
138 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
139 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
140 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
141 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
142 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
145 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
146 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
233 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
236 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
237 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
245 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
246 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
247 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
248 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
249 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
250 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
251 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
254 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
255 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
256 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
269 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
270 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
271 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
272 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
273 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
276 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
279 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
280 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
281 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
282 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
283 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
284 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
289 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
290 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
291 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
292 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
293 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
319 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
320 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
321 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
322 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
323 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
324 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
325 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
326 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
327 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
328 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
329 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
330 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
338 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
339 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
340 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
352 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
353 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
362 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
374 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
375 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
380 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
381 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
387 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
388 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
389 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
390 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
391 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
392 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
393 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
394 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
395 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
396 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
399 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
400 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
401 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
404 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
412 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
413 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
423 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
424 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
429 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
430 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
431 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
441 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
448 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
449 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
450 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
451 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
452 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
453 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
454 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
455 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
456 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
457 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
458 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
459 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
460 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
461 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
476 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
477 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
480 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
481 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
482 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
483 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
485 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
486 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
487 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
488 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
489 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
490 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
491 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
492 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
493 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
494 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
497 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
498 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
499 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
500 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
501 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
502 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
503 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
504 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
505 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
506 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
507 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
508 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
509 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
510 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
511 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
512 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
513 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
514 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
515 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
516 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
517 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
518 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
519 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
520 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
521 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
522 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
523 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
524 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
525 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
526 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
527 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
528 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
529 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
530 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
531 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
532 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
533 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
534 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
535 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
536 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
537 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
538 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
539 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
540 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
541 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
542 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
543 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
544 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
545 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
546 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
547 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
548 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
549 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
550 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
551 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
552 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
553 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
554 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
555 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
556 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
557 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
558 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
559 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
560 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
561 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
562 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
563 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
564 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
565 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
566 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
567 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
568 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
569 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
570 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
571 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
572 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
573 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
574 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
575 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
576 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
577 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
578 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
579 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
580 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
581 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
582 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
583 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
584 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
585 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
586 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
587 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
588 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
589 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
590 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
591 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
592 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
593 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
594 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
595 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
596 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
597 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
598 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
599 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
600 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
601 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
602 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
603 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
604 2643221651 Afipia sp. Root123D2 Isolate Unclassified
605 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
606 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
607 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
608 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
609 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
610 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
611 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
612 2791355199
613 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
614 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
615 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
616 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
617 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
618 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
619 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
620 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
621 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
622 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
623 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
624 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
625 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
626 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
627 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
628 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
629 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
630 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
631 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
632 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
633 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
634 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
635 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
636 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
637 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
638 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
639 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
640 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
641 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
642 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
643 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
644 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
645 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
646 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
647 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
648 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
649 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
650 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
651 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
652 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
653 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
654 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
655 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
656 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
657 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
658 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
659 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
660 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
661 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
662 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
663 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
664 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
665 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
666 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
667 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
668 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
669 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
670 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
671 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
672 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
673 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
674 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
675 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
676 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
677 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
678 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
679 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
680 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
681 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
682 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
683 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
684 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
685 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
686 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
687 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
688 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
689 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
690 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
691 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
692 2904699407
693 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
694 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
695 2906610324
696 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
697 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
698 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
699 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
700 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
701 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
702 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
703 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
704 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
705 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
706 2922368715
707 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
708 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
709 2922425934
710 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
711 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
712 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
713 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
714 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
715 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
716 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
717 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
718 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
719 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
720 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
721 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
722 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
723 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
724 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
725 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
726 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
727 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
728 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
729 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
730 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
731 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
732 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
733 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
734 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
735 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
736 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
737 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
738 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
739 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
740 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
741 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
742 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
743 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
744 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
745 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
746 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
747 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
748 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
749 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
750 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
751 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
752 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
753 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
754 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
755 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
756 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
757 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
758 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
759 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
760 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
761 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
762 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
763 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
764 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
765 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
766 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
767 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
768 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
769 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
770 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
771 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
772 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
773 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
774 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
775 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
776 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
777 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
778 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
779 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
780 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
781 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
782 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
783 641522639 Methylobacterium sp. 4-46 Isolate Nodule
784 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
785 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
786 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
787 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
788 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
789 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
790 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
791 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
792 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
793 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
794 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
795 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
796 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
797 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
798 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
799 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
800 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
801 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
802 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
803 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
804 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
805 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
806 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
807 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
808 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
809 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
810 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
811 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
812 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
813 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
814 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
815 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
816 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
817 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
818 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
819 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
820 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
821 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
822 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
823 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
824 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
825 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
826 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
827 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
828 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
829 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
830 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
831 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
832 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
833 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.83
Metatranscriptomes 0.21
Isolates 13.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.14
Nodule 10.86
Rhizoplane 5.59
Rhizosphere 57.33
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10020694 3300003659 Bacteria 1424
2 JGI25155J39150_1000010 3300002704 Bacteria 207717
3 JGI25156J39149_1000033 3300002705 Bacteria 114688
4 JGI25156J39149_1000461 3300002705 Bacteria 24707
5 JGI25156J39149_1000930 3300002705 Bacteria 14239
6 JGI25162J39368_1000607 3300002737 Bacteria 25795
7 JGI25154J39366_1000058 3300002738 Bacteria 107363
8 JGI25154J39366_1000761 3300002738 Bacteria 14332
9 JGI25154J39366_1002142 3300002738 Bacteria 5522
10 JGI25157J39369_1000009 3300002741 Bacteria 207868
11 JGI25157J39369_1000045 3300002741 Bacteria 122406
12 JGI25159J45721_1001420 3300002987 Bacteria 9950
13 JGI25406J46586_10000881 3300003203 Bacteria 14141
14 JGI25406J46586_10009349 3300003203 Bacteria 4391
15 JGI25165J46597_1001489 3300003214 Bacteria 12008
16 JGI25165J46597_1002089 3300003214 Bacteria 7361
17 JGI25153J46596_10005387 3300003215 Bacteria 6720
18 JGI25153J46596_10006271 3300003215 Bacteria 6074
19 JGI25153J46596_10006385 3300003215 Bacteria 5976
20 JGI25153J46596_10011204 3300003215 Bacteria 3982
21 JGI25153J46596_10014578 3300003215 Bacteria 3256
22 JGI25153J46596_10052728 3300003215 Bacteria 1155
23 JGI25153J46596_10055018 3300003215 Bacteria 1116
24 rootL2_10022138 3300003322 Bacteria 4256
25 JGI25160J50197_1000402 3300003354 Bacteria 27817
26 JGI25160J50197_1005378 3300003354 Bacteria 5340
27 JGI25160J50197_1031032 3300003354 Bacteria 1383
28 JGI25161J50226_1000324 3300003374 Bacteria 26148
29 JGI25404J52841_10000873 3300003659 Bacteria 4879
30 JGI25404J52841_10025159 3300003659 Bacteria 1282
31 Ga0055539_1004125 3300003752 Bacteria 1957
32 Ga0055542_1006050 3300003762 Bacteria 2638
33 Ga0055526_1021210 3300003771 Bacteria 2270
34 Ga0055524_1015899 3300003775 Bacteria 2725
35 Ga0055524_1016642 3300003775 Bacteria 2627
36 Ga0055536_1000652 3300003781 Bacteria 23432
37 Ga0055536_1014230 3300003781 Bacteria 2811
38 Ga0055530_10000735 3300003791 Bacteria 27312
39 Ga0055531_10004632 3300003794 Bacteria 8262
40 Ga0055531_10021366 3300003794 Bacteria 2513
41 Ga0055531_10034300 3300003794 Bacteria 1613
42 Ga0055543_1000099 3300004625 Bacteria 74883
43 Ga0055543_1011753 3300004625 Bacteria 1781
44 Ga0065165_1001848 3300005262 Bacteria 20620
45 Ga0065165_1003775 3300005262 Bacteria 10150
46 Ga0065165_1003886 3300005262 Bacteria 9897
47 Ga0065165_1025064 3300005262 Bacteria 1992
48 Ga0070658_10012453 3300005327 Bacteria 6823
49 Ga0070658_10207299 3300005327 Bacteria 1655
50 Ga0070658_10298078 3300005327 Bacteria 1374
51 Ga0070658_10505911 3300005327 Bacteria 1044
52 Ga0070683_100006653 3300005329 Bacteria 9707
53 Ga0070683_100135402 3300005329 Bacteria 2332
54 Ga0070683_100494235 3300005329 Bacteria 1169
55 Ga0070683_100769576 3300005329 Bacteria 922
56 Ga0070690_100087960 3300005330 Bacteria 2042
57 Ga0070677_10027314 3300005333 Bacteria 2148
58 Ga0068869_100031930 3300005334 Bacteria 3708
59 Ga0068869_100065052 3300005334 Bacteria 2684
60 Ga0068869_100234518 3300005334 Bacteria 1459
61 Ga0068869_100434449 3300005334 Bacteria 1085
62 Ga0068869_100702473 3300005334 Bacteria 862
63 Ga0070680_100041662 3300005336 Bacteria 3723
64 Ga0070680_100044841 3300005336 Bacteria 3594
65 Ga0070680_100343000 3300005336 Bacteria 1269
66 Ga0070680_100590832 3300005336 Bacteria 953
67 Ga0068868_100048998 3300005338 Bacteria 3315
68 Ga0070660_100037559 3300005339 Bacteria 3671
69 Ga0070660_100483715 3300005339 Bacteria 1029
70 Ga0070691_10220480 3300005341 Bacteria 1005
71 Ga0070668_100052173 3300005347 Bacteria 3152
72 Ga0070668_100140537 3300005347 Bacteria 1945
73 Ga0070668_100382903 3300005347 Bacteria 1197
74 Ga0070668_100485257 3300005347 Bacteria 1068
75 Ga0070668_100823275 3300005347 Bacteria 826
76 Ga0070669_100196450 3300005353 Bacteria 1585
77 Ga0070669_100346758 3300005353 Bacteria 1204
78 Ga0070669_100391208 3300005353 Bacteria 1136
79 Ga0070671_100198173 3300005355 Bacteria 1702
80 Ga0070671_100236190 3300005355 Bacteria 1551
81 Ga0070671_100450287 3300005355 Bacteria 1104
82 Ga0070671_100469477 3300005355 Bacteria 1080
83 Ga0070673_100136304 3300005364 Bacteria 2066
84 Ga0070673_100535313 3300005364 Bacteria 1063
85 Ga0070688_100151913 3300005365 Bacteria 1584
86 Ga0070688_100263101 3300005365 Bacteria 1232
87 Ga0070659_100338838 3300005366 Bacteria 1259
88 Ga0070659_100368734 3300005366 Bacteria 1207
89 Ga0070659_100428373 3300005366 Bacteria 1120
90 Ga0070659_100598793 3300005366 Bacteria 947
91 Ga0070667_100573038 3300005367 Bacteria 1039
92 Ga0070709_10000164 3300005434 Bacteria 42124
93 Ga0070709_10017700 3300005434 Bacteria 4092
94 Ga0070709_10055190 3300005434 Bacteria 2507
95 Ga0070709_10086525 3300005434 Bacteria 2058
96 Ga0070714_100030119 3300005435 Bacteria 4515
97 Ga0070714_100062614 3300005435 Bacteria 3197
98 Ga0070714_100104098 3300005435 Bacteria 2504
99 Ga0070714_100117957 3300005435 Bacteria 2358
100 Ga0070714_100123063 3300005435 Bacteria 2309
101 Ga0070714_100249189 3300005435 Bacteria 1642
102 Ga0070713_100004014 3300005436 Bacteria 9799
103 Ga0070713_100029341 3300005436 Bacteria 4356
104 Ga0070713_100054336 3300005436 Bacteria 3322
105 Ga0070713_100081484 3300005436 Bacteria 2761
106 Ga0070713_100131019 3300005436 Bacteria 2211
107 Ga0070713_100205029 3300005436 Bacteria 1783
108 Ga0070710_10000283 3300005437 Bacteria 24031
109 Ga0070710_10053256 3300005437 Bacteria 2278
110 Ga0070710_10069267 3300005437 Bacteria 2029
111 Ga0070701_10240533 3300005438 Bacteria 1089
112 Ga0070711_100005189 3300005439 Bacteria 7768
113 Ga0070711_100013134 3300005439 Bacteria 5194
114 Ga0070711_100025376 3300005439 Bacteria 3877
115 Ga0070711_100089685 3300005439 Bacteria 2212
116 Ga0070711_100165225 3300005439 Bacteria 1682
117 Ga0070711_100179445 3300005439 Bacteria 1620
118 Ga0070700_100044957 3300005441 Bacteria 2722
119 Ga0070708_100066262 3300005445 Bacteria 3241
120 Ga0070708_100096501 3300005445 Bacteria 2700
121 Ga0070663_100041632 3300005455 Bacteria 3224
122 Ga0070663_100139944 3300005455 Bacteria 1846
123 Ga0070663_100147094 3300005455 Bacteria 1803
124 Ga0070663_100212729 3300005455 Bacteria 1514
125 Ga0070663_100274288 3300005455 Bacteria 1342
126 Ga0070663_100296625 3300005455 Bacteria 1292
127 Ga0070663_100393317 3300005455 Bacteria 1131
128 Ga0070678_100092031 3300005456 Bacteria 2329
129 Ga0070678_100137508 3300005456 Bacteria 1950
130 Ga0070678_100256558 3300005456 Bacteria 1468
131 Ga0070678_100373035 3300005456 Bacteria 1232
132 Ga0070662_100183639 3300005457 Bacteria 1650
133 Ga0070662_100515585 3300005457 Bacteria 998
134 Ga0070662_100687996 3300005457 Bacteria 864
135 Ga0070681_10017254 3300005458 Bacteria 7216
136 Ga0070681_10093484 3300005458 Bacteria 2956
137 Ga0070681_10094766 3300005458 Bacteria 2933
138 Ga0070681_10299056 3300005458 Bacteria 1519
139 Ga0070681_10374239 3300005458 Bacteria 1335
140 Ga0070681_10505724 3300005458 Bacteria 1121
141 Ga0068867_100000132 3300005459 Bacteria 47944
142 Ga0068867_100181797 3300005459 Bacteria 1672
143 Ga0068867_100229924 3300005459 Bacteria 1499
144 Ga0070685_10285882 3300005466 Bacteria 1106
145 Ga0070706_100277642 3300005467 Bacteria 1563
146 Ga0070706_100520330 3300005467 Bacteria 1107
147 Ga0070707_100028781 3300005468 Bacteria 5288
148 Ga0070679_100023030 3300005530 Bacteria 6093
149 Ga0070679_100216359 3300005530 Bacteria 1878
150 Ga0070679_100251738 3300005530 Bacteria 1722
151 Ga0070679_100262151 3300005530 Bacteria 1683
152 Ga0070679_100496499 3300005530 Bacteria 1164
153 Ga0070684_100006976 3300005535 Bacteria 8773
154 Ga0070684_100026892 3300005535 Bacteria 4850
155 Ga0070684_100185707 3300005535 Bacteria 1891
156 Ga0068853_100000920 3300005539 Bacteria 20589
157 Ga0068853_100070306 3300005539 Bacteria 3046
158 Ga0068853_100311796 3300005539 Bacteria 1457
159 Ga0068853_100637155 3300005539 Bacteria 1014
160 Ga0068853_100661748 3300005539 Bacteria 995
161 Ga0070672_100500904 3300005543 Bacteria 1051
162 Ga0070693_100144964 3300005547 Bacteria 1499
163 Ga0070693_100580223 3300005547 Bacteria 807
164 Ga0070665_100024388 3300005548 Bacteria 6091
165 Ga0070665_100101283 3300005548 Bacteria 2884
166 Ga0070665_100211868 3300005548 Bacteria 1938
167 Ga0070665_100270689 3300005548 Bacteria 1700
168 Ga0070665_100308556 3300005548 Bacteria 1586
169 Ga0070665_100346113 3300005548 Bacteria 1491
170 Ga0070665_100422675 3300005548 Bacteria 1341
171 Ga0070665_100545562 3300005548 Bacteria 1171
172 Ga0070665_100592664 3300005548 Bacteria 1121
173 Ga0068855_100028007 3300005563 Bacteria 6741
174 Ga0068855_100098102 3300005563 Bacteria 3376
175 Ga0068855_100105596 3300005563 Bacteria 3238
176 Ga0068855_100233801 3300005563 Bacteria 2056
177 Ga0068855_100298791 3300005563 Bacteria 1784
178 Ga0068855_100455996 3300005563 Bacteria 1394
179 Ga0068855_100674179 3300005563 Bacteria 1108
180 Ga0068857_100028526 3300005577 Bacteria 4925
181 Ga0068857_100035276 3300005577 Bacteria 4429
182 Ga0068857_100208760 3300005577 Bacteria 1782
183 Ga0068857_100311339 3300005577 Bacteria 1453
184 Ga0068854_100062569 3300005578 Bacteria 2699
185 Ga0068854_100092598 3300005578 Bacteria 2252
186 Ga0068854_100191523 3300005578 Bacteria 1603
187 Ga0068854_100255310 3300005578 Bacteria 1401
188 Ga0068854_100431450 3300005578 Bacteria 1096
189 Ga0068856_100004492 3300005614 Bacteria 13873
190 Ga0068856_100292845 3300005614 Bacteria 1645
191 Ga0068856_100349754 3300005614 Bacteria 1496
192 Ga0068856_100363149 3300005614 Bacteria 1466
193 Ga0068856_100822091 3300005614 Bacteria 948
194 Ga0068852_100010275 3300005616 Bacteria 6983
195 Ga0068852_100040281 3300005616 Bacteria 3940
196 Ga0068852_100098915 3300005616 Bacteria 2628
197 Ga0068852_100125731 3300005616 Bacteria 2354
198 Ga0068852_100225110 3300005616 Bacteria 1785
199 Ga0068852_100311084 3300005616 Bacteria 1527
200 Ga0068852_100413880 3300005616 Bacteria 1328
201 Ga0068852_100434126 3300005616 Bacteria 1297
202 Ga0068852_100508440 3300005616 Bacteria 1200
203 Ga0068859_100258476 3300005617 Bacteria 1832
204 Ga0068859_100681946 3300005617 Bacteria 1119
205 Ga0068864_100514833 3300005618 Bacteria 1153
206 Ga0068866_10041018 3300005718 Bacteria 2294
207 Ga0068861_100050132 3300005719 Bacteria 3164
208 Ga0068861_100074402 3300005719 Bacteria 2641
209 Ga0068861_100147213 3300005719 Bacteria 1928
210 Ga0068861_100315152 3300005719 Bacteria 1360
211 Ga0068851_10168405 3300005834 Bacteria 1207
212 Ga0068863_100293033 3300005841 Bacteria 1577
213 Ga0068858_100147750 3300005842 Bacteria 2208
214 Ga0068858_100555483 3300005842 Bacteria 1112
215 Ga0068858_100592646 3300005842 Bacteria 1075
216 Ga0068858_100897382 3300005842 Bacteria 867
217 Ga0068860_100017741 3300005843 Bacteria 6934
218 Ga0068860_100057499 3300005843 Bacteria 3697
219 Ga0068860_100097070 3300005843 Bacteria 2809
220 Ga0068862_100107085 3300005844 Bacteria 2451
221 Ga0068862_100170312 3300005844 Bacteria 1949
222 Ga0068862_100339805 3300005844 Bacteria 1390
223 Ga0068862_100635015 3300005844 Bacteria 1028
224 Ga0068862_100753490 3300005844 Bacteria 948
225 Ga0081455_10016293 3300005937 Bacteria 7181
226 Ga0081455_10027264 3300005937 Bacteria 5236
227 Ga0081455_10089378 3300005937 Bacteria 2500
228 Ga0081455_10141870 3300005937 Bacteria 1865
229 Ga0081455_10338688 3300005937 Bacteria 1065
230 Ga0081540_1002717 3300005983 Bacteria 14394
231 Ga0081540_1003025 3300005983 Bacteria 13470
232 Ga0081540_1004243 3300005983 Bacteria 11008
233 Ga0081540_1004583 3300005983 Bacteria 10468
234 Ga0081540_1005857 3300005983 Bacteria 9090
235 Ga0081540_1014469 3300005983 Bacteria 5053
236 Ga0081540_1018885 3300005983 Bacteria 4211
237 Ga0081540_1115847 3300005983 Bacteria 1123
238 Ga0081539_10000048 3300005985 Bacteria 272906
239 Ga0081539_10000371 3300005985 Bacteria 98455
240 Ga0081539_10027283 3300005985 Bacteria 3621
241 Ga0081539_10039012 3300005985 Bacteria 2808
242 Ga0070717_10038762 3300006028 Bacteria 3874
243 Ga0070717_10304845 3300006028 Bacteria 1416
244 Ga0075365_10004924 3300006038 Bacteria 7142
245 Ga0075365_10007177 3300006038 Bacteria 6219
246 Ga0075365_10130855 3300006038 Bacteria 1736
247 Ga0075365_10162096 3300006038 Bacteria 1558
248 Ga0075365_10173348 3300006038 Bacteria 1506
249 Ga0075365_10282347 3300006038 Bacteria 1168
250 Ga0075365_10286354 3300006038 Bacteria 1159
251 Ga0075365_10355630 3300006038 Bacteria 1032
252 Ga0075365_10398776 3300006038 Bacteria 971
253 Ga0075368_10007084 3300006042 Bacteria 3949
254 Ga0075368_10057299 3300006042 Bacteria 1555
255 Ga0075363_100000382 3300006048 Bacteria 13428
256 Ga0075363_100005846 3300006048 Bacteria 5531
257 Ga0075363_100009480 3300006048 Bacteria 4577
258 Ga0075363_100126110 3300006048 Bacteria 1433
259 Ga0075364_10000195 3300006051 Bacteria 28057
260 Ga0075364_10049442 3300006051 Bacteria 2742
261 Ga0075364_10086211 3300006051 Bacteria 2080
262 Ga0075364_10150150 3300006051 Bacteria 1570
263 Ga0075364_10162804 3300006051 Bacteria 1506
264 Ga0075364_10174044 3300006051 Bacteria 1455
265 Ga0075364_10335348 3300006051 Bacteria 1030
266 Ga0070716_100008198 3300006173 Bacteria 5178
267 Ga0070716_100009333 3300006173 Bacteria 4887
268 Ga0070716_100032839 3300006173 Bacteria 2835
269 Ga0070716_100199137 3300006173 Bacteria 1330
270 Ga0070712_100023970 3300006175 Bacteria 4038
271 Ga0070712_100027147 3300006175 Bacteria 3820
272 Ga0070712_100096550 3300006175 Bacteria 2176
273 Ga0075362_10035287 3300006177 Bacteria 2182
274 Ga0075367_10080527 3300006178 Bacteria 1970
275 Ga0075367_10097099 3300006178 Bacteria 1797
276 Ga0075367_10171907 3300006178 Bacteria 1350
277 Ga0075367_10177025 3300006178 Bacteria 1329
278 Ga0075367_10298190 3300006178 Bacteria 1014
279 Ga0075367_10312096 3300006178 Bacteria 990
280 Ga0075367_10431034 3300006178 Bacteria 835
281 Ga0075369_10038939 3300006186 Bacteria 2029
282 Ga0075369_10118264 3300006186 Bacteria 1198
283 Ga0075366_10012656 3300006195 Bacteria 4791
284 Ga0075366_10055656 3300006195 Bacteria 2349
285 Ga0075366_10179064 3300006195 Bacteria 1287
286 Ga0097621_100021414 3300006237 Bacteria 5000
287 Ga0097621_100338574 3300006237 Bacteria 1336
288 Ga0097621_100397341 3300006237 Bacteria 1234
289 Ga0075370_10018863 3300006353 Bacteria 3746
290 Ga0075370_10059152 3300006353 Bacteria 2180
291 Ga0075370_10181566 3300006353 Bacteria 1239
292 Ga0068871_100040788 3300006358 Bacteria 3719
293 Ga0068871_100048194 3300006358 Bacteria 3438
294 Ga0068871_100562738 3300006358 Bacteria 1034
295 Ga0075428_100438771 3300006844 Bacteria 1399
296 Ga0075430_100026357 3300006846 Bacteria 4946
297 Ga0075430_100105658 3300006846 Bacteria 2350
298 Ga0075431_100428391 3300006847 Bacteria 1321
299 Ga0075434_100047268 3300006871 Bacteria 4271
300 Ga0075434_100459994 3300006871 Bacteria 1294
301 Ga0068865_100178984 3300006881 Bacteria 1631
302 Ga0068865_100179000 3300006881 Bacteria 1631
303 Ga0068865_100269681 3300006881 Bacteria 1351
304 Ga0097620_100258488 3300006931 Bacteria 1832
305 Ga0097620_100681901 3300006931 Bacteria 1119
306 Ga0099825_1017392 3300006941 Bacteria 5890
307 Ga0099824_1007180 3300006942 Bacteria 14887
308 Ga0099824_1027556 3300006942 Bacteria 2723
309 Ga0099822_1002271 3300006943 Bacteria 23789
310 Ga0099823_1023214 3300006944 Bacteria 5693
311 Ga0075435_100380488 3300007076 Bacteria 1212
312 Ga0099794_10047333 3300007265 Bacteria 2062
313 Ga0099795_10037802 3300007788 Bacteria 1701
314 Ga0105250_10165893 3300009092 Bacteria 923
315 Ga0105240_10000013 3300009093 Bacteria 483458
316 Ga0105240_10012727 3300009093 Bacteria 11593
317 Ga0105240_10020094 3300009093 Bacteria 8915
318 Ga0105240_10022735 3300009093 Bacteria 8306
319 Ga0105240_10055770 3300009093 Bacteria 4947
320 Ga0105240_10332844 3300009093 Bacteria 1727
321 Ga0105240_10719140 3300009093 Bacteria 1088
322 Ga0105240_10734820 3300009093 Bacteria 1074
323 Ga0105245_10226247 3300009098 Bacteria 1807
324 Ga0105247_10023886 3300009101 Bacteria 3683
325 Ga0105247_10057618 3300009101 Bacteria 2403
326 Ga0105247_10182009 3300009101 Bacteria 1403
327 Ga0105247_10293768 3300009101 Bacteria 1125
328 Ga0105243_10263184 3300009148 Bacteria 1545
329 Ga0105243_10271879 3300009148 Bacteria 1522
330 Ga0105243_10430073 3300009148 Bacteria 1234
331 Ga0105243_10553103 3300009148 Bacteria 1100
332 Ga0105243_10562392 3300009148 Bacteria 1091
333 Ga0105241_10049205 3300009174 Bacteria 3209
334 Ga0105241_10339602 3300009174 Bacteria 1301
335 Ga0105241_10391324 3300009174 Bacteria 1217
336 Ga0105248_10120731 3300009177 Bacteria 2957
337 Ga0105248_10635602 3300009177 Bacteria 1204
338 Ga0105248_10689155 3300009177 Bacteria 1153
339 Ga0105248_10898060 3300009177 Bacteria 1000
340 Ga0105237_10002598 3300009545 Bacteria 22276
341 Ga0105237_10017536 3300009545 Bacteria 7421
342 Ga0105237_10091115 3300009545 Bacteria 3038
343 Ga0105237_10221142 3300009545 Bacteria 1894
344 Ga0105237_10240258 3300009545 Bacteria 1812
345 Ga0105237_10247679 3300009545 Bacteria 1784
346 Ga0105237_10301126 3300009545 Bacteria 1606
347 Ga0105237_10352310 3300009545 Bacteria 1476
348 Ga0105237_10475520 3300009545 Bacteria 1256
349 Ga0105237_10595280 3300009545 Bacteria 1113
350 Ga0105237_10689385 3300009545 Bacteria 1028
351 Ga0105238_10009549 3300009551 Bacteria 9706
352 Ga0105238_10025758 3300009551 Bacteria 5997
353 Ga0105238_10069644 3300009551 Bacteria 3518
354 Ga0105238_10104060 3300009551 Bacteria 2820
355 Ga0105238_10338890 3300009551 Bacteria 1491
356 Ga0105238_10436104 3300009551 Bacteria 1306
357 Ga0105238_10468490 3300009551 Bacteria 1258
358 Ga0105238_10523078 3300009551 Bacteria 1189
359 Ga0105249_10280767 3300009553 Bacteria 1663
360 Ga0105249_10967360 3300009553 Bacteria 919
361 Ga0099796_10013549 3300010159 Bacteria 2332
362 Ga0105239_10001552 3300010375 Bacteria 30352
363 Ga0105239_10029609 3300010375 Bacteria 6020
364 Ga0105239_10049028 3300010375 Bacteria 4630
365 Ga0105239_10066302 3300010375 Bacteria 3966
366 Ga0105239_10098964 3300010375 Bacteria 3224
367 Ga0105239_10322873 3300010375 Bacteria 1741
368 Ga0105239_10367445 3300010375 Bacteria 1625
369 Ga0105239_10420512 3300010375 Bacteria 1514
370 Ga0105239_10818285 3300010375 Bacteria 1067
371 Ga0105239_11237692 3300010375 Bacteria 860
372 Ga0105246_10151091 3300011119 Bacteria 1758
373 Ga0157373_10143046 3300013100 Bacteria 1682
374 Ga0157370_10002466 3300013104 Bacteria 22319
375 Ga0157370_10049322 3300013104 Bacteria 4029
376 Ga0157370_10365195 3300013104 Bacteria 1330
377 Ga0157370_10436693 3300013104 Bacteria 1204
378 Ga0157369_10011256 3300013105 Bacteria 10165
379 Ga0157369_10030438 3300013105 Bacteria 5952
380 Ga0157369_10343414 3300013105 Bacteria 1551
381 Ga0157369_10429996 3300013105 Bacteria 1368
382 Ga0157369_10576917 3300013105 Bacteria 1162
383 Ga0157369_10778104 3300013105 Bacteria 984
384 Ga0157369_10955390 3300013105 Bacteria 878
385 Ga0157374_10141827 3300013296 Bacteria 2333
386 Ga0157374_10284100 3300013296 Bacteria 1634
387 Ga0157374_10319696 3300013296 Bacteria 1538
388 Ga0157374_10868258 3300013296 Bacteria 919
389 Ga0157378_10020915 3300013297 Bacteria 5757
390 Ga0157378_10288653 3300013297 Bacteria 1584
391 Ga0157378_10463998 3300013297 Bacteria 1259
392 Ga0157378_10499372 3300013297 Bacteria 1215
393 Ga0157378_10837462 3300013297 Bacteria 947
394 Ga0163162_10021854 3300013306 Bacteria 6304
395 Ga0163162_10065364 3300013306 Bacteria 3684
396 Ga0163162_10139830 3300013306 Bacteria 2534
397 Ga0163162_10425837 3300013306 Bacteria 1459
398 Ga0163162_10465549 3300013306 Bacteria 1396
399 Ga0163162_10927317 3300013306 Bacteria 983
400 Ga0157372_10140987 3300013307 Bacteria 2777
401 Ga0157375_10126812 3300013308 Bacteria 2668
402 Ga0157375_10444794 3300013308 Bacteria 1461
403 Ga0157375_10481067 3300013308 Bacteria 1407
404 Ga0157375_10745912 3300013308 Bacteria 1131
405 Ga0163163_10002309 3300014325 Bacteria 16099
406 Ga0163163_10090473 3300014325 Bacteria 3073
407 Ga0163163_10289488 3300014325 Bacteria 1690
408 Ga0163163_10479801 3300014325 Bacteria 1304
409 Ga0163163_10947428 3300014325 Bacteria 924
410 Ga0157380_10179675 3300014326 Bacteria 1858
411 Ga0157380_10264590 3300014326 Bacteria 1564
412 Ga0157380_10350881 3300014326 Bacteria 1380
413 Ga0182008_10048597 3300014497 Bacteria 2107
414 Ga0182008_10119980 3300014497 Bacteria 1307
415 Ga0157377_10063879 3300014745 Bacteria 2110
416 Ga0157377_10078346 3300014745 Bacteria 1926
417 Ga0157379_10397168 3300014968 Bacteria 1267
418 Ga0157379_10480485 3300014968 Bacteria 1150
419 Ga0157379_10555022 3300014968 Bacteria 1069
420 Ga0157376_10444440 3300014969 Bacteria 1263
421 Ga0182007_10002170 3300015262 Bacteria 9963
422 Ga0182005_1001931 3300015265 Bacteria 7840
423 Ga0206356_11507318 3300020070 Bacteria 1011
424 Ga0206353_10766002 3300020082 Bacteria 1065
425 Ga0214544_1000665 3300021320 Bacteria 65630
426 Ga0214542_1000486 3300021321 Bacteria 71884
427 Ga0214545_1000307 3300021324 Bacteria 71884
428 Ga0214543_1006816 3300021327 Bacteria 20069
429 Ga0213873_10003722 3300021358 Bacteria 2780
430 Ga0213872_10005811 3300021361 Bacteria 6268
431 Ga0213874_10035729 3300021377 Bacteria 1461
432 Ga0213874_10077232 3300021377 Bacteria 1073
433 Ga0213874_10107495 3300021377 Bacteria 934
434 Ga0213876_10005727 3300021384 Bacteria 6809
435 Ga0213876_10140100 3300021384 Bacteria 1286
436 Ga0213871_10011628 3300021441 Bacteria 2026
437 Ga0209435_100009 3300025206 Bacteria 476614
438 Ga0209760_102134 3300025207 Bacteria 1897
439 Ga0209563_102071 3300025230 Bacteria 4752
440 Ga0209437_100107 3300025233 Bacteria 218656
441 Ga0209258_100603 3300025242 Bacteria 29333
442 Ga0209646_1000012 3300025246 Bacteria 573300
443 Ga0209646_1000018 3300025246 Bacteria 476716
444 Ga0209026_1000004 3300025250 Bacteria 949012
445 Ga0209026_1000068 3300025250 Bacteria 207601
446 Ga0209677_100543 3300025253 Bacteria 21018
447 Ga0209677_102252 3300025253 Bacteria 7467
448 Ga0209677_108510 3300025253 Bacteria 1981
449 Ga0209148_1000295 3300025254 Bacteria 73660
450 Ga0209148_1009014 3300025254 Bacteria 1971
451 Ga0209148_1009972 3300025254 Bacteria 1822
452 Ga0209759_1000003 3300025256 Bacteria 792130
453 Ga0209759_1000007 3300025256 Bacteria 476614
454 Ga0209233_1000072 3300025261 Bacteria 363074
455 Ga0209233_1000331 3300025261 Bacteria 48397
456 Ga0209233_1001838 3300025261 Bacteria 8147
457 Ga0209233_1003799 3300025261 Bacteria 5269
458 Ga0209233_1026225 3300025261 Bacteria 1428
459 Ga0209455_1006515 3300025272 Bacteria 3434
460 Ga0209673_1017234 3300025273 Bacteria 2668
461 Ga0209130_1000132 3300025284 Bacteria 119765
462 Ga0209675_1003067 3300025291 Bacteria 8191
463 Ga0209675_1012970 3300025291 Bacteria 2644
464 Ga0209676_1001214 3300025292 Bacteria 27415
465 Ga0209676_1014191 3300025292 Bacteria 3010
466 Ga0209676_1020233 3300025292 Bacteria 2266
467 Ga0209025_1004676 3300025294 Bacteria 11701
468 Ga0209025_1061552 3300025294 Bacteria 1400
469 Ga0209564_1001079 3300025295 Bacteria 32728
470 Ga0209564_1006939 3300025295 Bacteria 5955
471 Ga0209564_1007238 3300025295 Bacteria 5772
472 Ga0209564_1011458 3300025295 Bacteria 3970
473 Ga0209758_1000069 3300025297 Bacteria 286161
474 Ga0209758_1001816 3300025297 Bacteria 23562
475 Ga0209758_1001900 3300025297 Bacteria 22801
476 Ga0209758_1002809 3300025297 Bacteria 16970
477 Ga0209758_1003717 3300025297 Bacteria 13525
478 Ga0209758_1007298 3300025297 Bacteria 7579
479 Ga0209758_1008809 3300025297 Bacteria 6426
480 Ga0209758_1021604 3300025297 Bacteria 2993
481 Ga0209758_1040930 3300025297 Bacteria 1740
482 Ga0209758_1052380 3300025297 Bacteria 1412
483 Ga0209758_1067323 3300025297 Bacteria 1146
484 Ga0209050_1001391 3300025298 Bacteria 26316
485 Ga0209256_1002256 3300025299 Bacteria 16362
486 Ga0209256_1003770 3300025299 Bacteria 10211
487 Ga0209256_1005844 3300025299 Bacteria 6836
488 Ga0209256_1024062 3300025299 Bacteria 1801
489 Ga0207426_1000246 3300025302 Bacteria 119765
490 Ga0207426_1001802 3300025302 Bacteria 15949
491 Ga0207426_1004864 3300025302 Bacteria 6361
492 Ga0207426_1015528 3300025302 Bacteria 2758
493 Ga0209051_1010403 3300025303 Bacteria 4702
494 Ga0209051_1032751 3300025303 Bacteria 1977
495 Ga0209257_1000861 3300025304 Bacteria 43224
496 Ga0209257_1001693 3300025304 Bacteria 24766
497 Ga0209257_1004375 3300025304 Bacteria 10990
498 Ga0209257_1007230 3300025304 Bacteria 6791
499 Ga0209257_1044554 3300025304 Bacteria 1294
500 Ga0207697_10057289 3300025315 Bacteria 1617
501 Ga0207656_10047104 3300025321 Bacteria 1852
502 Ga0207656_10237828 3300025321 Bacteria 889
503 Ga0207696_1029161 3300025711 Bacteria 1687
504 Ga0207682_10123497 3300025893 Bacteria 1150
505 Ga0207692_10000528 3300025898 Bacteria 13562
506 Ga0207692_10118118 3300025898 Bacteria 1481
507 Ga0207692_10295086 3300025898 Bacteria 985
508 Ga0207642_10078666 3300025899 Bacteria 1594
509 Ga0207710_10111278 3300025900 Bacteria 1300
510 Ga0207710_10196426 3300025900 Bacteria 995
511 Ga0207647_10166237 3300025904 Bacteria 1286
512 Ga0207685_10015765 3300025905 Bacteria 2402
513 Ga0207699_10000514 3300025906 Bacteria 19239
514 Ga0207699_10008188 3300025906 Bacteria 5146
515 Ga0207699_10010527 3300025906 Bacteria 4646
516 Ga0207699_10041934 3300025906 Bacteria 2647
517 Ga0207699_10214747 3300025906 Bacteria 1310
518 Ga0207699_10373520 3300025906 Bacteria 1011
519 Ga0207645_10041038 3300025907 Bacteria 2963
520 Ga0207645_10257501 3300025907 Bacteria 1155
521 Ga0207643_10070380 3300025908 Bacteria 2012
522 Ga0207643_10078747 3300025908 Bacteria 1907
523 Ga0207643_10199373 3300025908 Bacteria 1218
524 Ga0207705_10131879 3300025909 Bacteria 1860
525 Ga0207684_10160331 3300025910 Bacteria 1937
526 Ga0207654_10236159 3300025911 Bacteria 1219
527 Ga0207707_10001310 3300025912 Bacteria 23197
528 Ga0207707_10001402 3300025912 Bacteria 22333
529 Ga0207707_10051217 3300025912 Bacteria 3596
530 Ga0207707_10095278 3300025912 Bacteria 2601
531 Ga0207707_10131454 3300025912 Bacteria 2189
532 Ga0207707_10364834 3300025912 Bacteria 1243
533 Ga0207695_10000044 3300025913 Bacteria 440819
534 Ga0207695_10000148 3300025913 Bacteria 208344
535 Ga0207695_10003993 3300025913 Bacteria 20356
536 Ga0207695_10129811 3300025913 Bacteria 2478
537 Ga0207695_10355538 3300025913 Bacteria 1351
538 Ga0207695_10372267 3300025913 Bacteria 1315
539 Ga0207671_10000226 3300025914 Bacteria 84886
540 Ga0207671_10020952 3300025914 Bacteria 4970
541 Ga0207671_10048383 3300025914 Bacteria 3147
542 Ga0207671_10221193 3300025914 Bacteria 1483
543 Ga0207671_10498463 3300025914 Bacteria 971
544 Ga0207693_10208915 3300025915 Bacteria 1535
545 Ga0207693_10231153 3300025915 Bacteria 1452
546 Ga0207663_10000375 3300025916 Bacteria 19499
547 Ga0207663_10055118 3300025916 Bacteria 2493
548 Ga0207663_10137563 3300025916 Bacteria 1697
549 Ga0207663_10231549 3300025916 Bacteria 1350
550 Ga0207663_10412634 3300025916 Bacteria 1035
551 Ga0207660_10047438 3300025917 Bacteria 3037
552 Ga0207660_10058358 3300025917 Bacteria 2767
553 Ga0207660_10138790 3300025917 Bacteria 1857
554 Ga0207660_10148215 3300025917 Bacteria 1800
555 Ga0207660_10220462 3300025917 Bacteria 1488
556 Ga0207660_10251525 3300025917 Bacteria 1395
557 Ga0207662_10211110 3300025918 Bacteria 1260
558 Ga0207657_10042668 3300025919 Bacteria 4000
559 Ga0207657_10049757 3300025919 Bacteria 3649
560 Ga0207657_10291162 3300025919 Bacteria 1295
561 Ga0207657_10357314 3300025919 Bacteria 1152
562 Ga0207649_10040379 3300025920 Bacteria 2836
563 Ga0207649_10301725 3300025920 Bacteria 1171
564 Ga0207649_10349453 3300025920 Bacteria 1094
565 Ga0207652_10001370 3300025921 Bacteria 21663
566 Ga0207652_10016073 3300025921 Bacteria 6104
567 Ga0207652_10276187 3300025921 Bacteria 1516
568 Ga0207646_10105621 3300025922 Bacteria 2526
569 Ga0207681_10288869 3300025923 Bacteria 1294
570 Ga0207694_10030854 3300025924 Bacteria 4092
571 Ga0207694_10059035 3300025924 Bacteria 2984
572 Ga0207694_10439491 3300025924 Bacteria 1088
573 Ga0207694_10494651 3300025924 Bacteria 1024
574 Ga0207650_10256799 3300025925 Bacteria 1416
575 Ga0207687_10002193 3300025927 Bacteria 13332
576 Ga0207700_10004601 3300025928 Bacteria 8166
577 Ga0207700_10062122 3300025928 Bacteria 2836
578 Ga0207700_10072990 3300025928 Bacteria 2648
579 Ga0207700_10091578 3300025928 Bacteria 2402
580 Ga0207700_10115402 3300025928 Bacteria 2168
581 Ga0207700_10158564 3300025928 Bacteria 1877
582 Ga0207700_10219356 3300025928 Bacteria 1612
583 Ga0207664_10004078 3300025929 Bacteria 9847
584 Ga0207664_10027086 3300025929 Bacteria 4341
585 Ga0207664_10041295 3300025929 Bacteria 3593
586 Ga0207664_10245334 3300025929 Bacteria 1561
587 Ga0207644_10072932 3300025931 Bacteria 2516
588 Ga0207690_10166497 3300025932 Bacteria 1648
589 Ga0207690_10471515 3300025932 Bacteria 1012
590 Ga0207706_10138351 3300025933 Bacteria 2142
591 Ga0207709_10247931 3300025935 Bacteria 1299
592 Ga0207709_10281180 3300025935 Bacteria 1229
593 Ga0207669_10011353 3300025937 Bacteria 4330
594 Ga0207669_10027226 3300025937 Bacteria 3126
595 Ga0207669_10257188 3300025937 Bacteria 1304
596 Ga0207704_10240201 3300025938 Bacteria 1353
597 Ga0207665_10016516 3300025939 Bacteria 4848
598 Ga0207665_10035202 3300025939 Bacteria 3322
599 Ga0207665_10054050 3300025939 Bacteria 2707
600 Ga0207665_10146904 3300025939 Bacteria 1685
601 Ga0207665_10267605 3300025939 Bacteria 1268
602 Ga0207665_10355207 3300025939 Bacteria 1107
603 Ga0207691_10175248 3300025940 Bacteria 1876
604 Ga0207691_10310873 3300025940 Bacteria 1352
605 Ga0207711_10333200 3300025941 Bacteria 1404
606 Ga0207711_10442796 3300025941 Bacteria 1209
607 Ga0207689_10012963 3300025942 Bacteria 7118
608 Ga0207689_10058572 3300025942 Bacteria 3168
609 Ga0207689_10157738 3300025942 Bacteria 1870
610 Ga0207689_10253696 3300025942 Bacteria 1455
611 Ga0207689_10351545 3300025942 Bacteria 1225
612 Ga0207661_10000878 3300025944 Bacteria 19794
613 Ga0207661_10026373 3300025944 Bacteria 4427
614 Ga0207661_10154480 3300025944 Bacteria 1986
615 Ga0207661_10666776 3300025944 Bacteria 956
616 Ga0207679_10049493 3300025945 Bacteria 3066
617 Ga0207667_10002941 3300025949 Bacteria 21147
618 Ga0207667_10051535 3300025949 Bacteria 4339
619 Ga0207667_10224638 3300025949 Bacteria 1924
620 Ga0207667_10350671 3300025949 Bacteria 1505
621 Ga0207667_10381571 3300025949 Bacteria 1436
622 Ga0207667_10387579 3300025949 Bacteria 1423
623 Ga0207651_10799949 3300025960 Bacteria 836
624 Ga0207712_10412499 3300025961 Bacteria 1138
625 Ga0207668_10293540 3300025972 Bacteria 1338
626 Ga0207668_10360208 3300025972 Bacteria 1218
627 Ga0207668_10372735 3300025972 Bacteria 1199
628 Ga0207668_10462947 3300025972 Bacteria 1084
629 Ga0207640_10004118 3300025981 Bacteria 7859
630 Ga0207640_10018861 3300025981 Bacteria 4062
631 Ga0207640_10280025 3300025981 Bacteria 1309
632 Ga0207640_10468153 3300025981 Bacteria 1042
633 Ga0207640_10710820 3300025981 Bacteria 862
634 Ga0207658_10109156 3300025986 Bacteria 2184
635 Ga0207658_10531026 3300025986 Bacteria 1051
636 Ga0207677_10006274 3300026023 Bacteria 6505
637 Ga0207677_10064251 3300026023 Bacteria 2555
638 Ga0207677_10290760 3300026023 Bacteria 1346
639 Ga0207677_10490919 3300026023 Bacteria 1060
640 Ga0207703_10194914 3300026035 Bacteria 1797
641 Ga0207703_10209416 3300026035 Bacteria 1737
642 Ga0207703_10272804 3300026035 Bacteria 1533
643 Ga0207703_10711359 3300026035 Bacteria 956
644 Ga0207639_10191284 3300026041 Bacteria 1748
645 Ga0207639_10343545 3300026041 Bacteria 1331
646 Ga0207639_10425442 3300026041 Bacteria 1201
647 Ga0207639_10476951 3300026041 Bacteria 1136
648 Ga0207639_10777349 3300026041 Bacteria 891
649 Ga0207678_10073898 3300026067 Bacteria 2921
650 Ga0207678_10075876 3300026067 Bacteria 2879
651 Ga0207678_10173331 3300026067 Bacteria 1842
652 Ga0207678_10210337 3300026067 Bacteria 1664
653 Ga0207678_10244235 3300026067 Bacteria 1538
654 Ga0207678_10264609 3300026067 Bacteria 1474
655 Ga0207678_10267737 3300026067 Bacteria 1465
656 Ga0207678_10283635 3300026067 Bacteria 1422
657 Ga0207678_10293874 3300026067 Bacteria 1396
658 Ga0207678_10349488 3300026067 Bacteria 1275
659 Ga0207708_10035100 3300026075 Bacteria 3816
660 Ga0207708_10326432 3300026075 Bacteria 1253
661 Ga0207702_10000253 3300026078 Bacteria 62073
662 Ga0207702_10000318 3300026078 Bacteria 55209
663 Ga0207702_10231624 3300026078 Bacteria 1727
664 Ga0207702_10329654 3300026078 Bacteria 1456
665 Ga0207702_10486013 3300026078 Bacteria 1202
666 Ga0207641_10349703 3300026088 Bacteria 1408
667 Ga0207641_10764809 3300026088 Bacteria 954
668 Ga0207648_10509839 3300026089 Bacteria 1101
669 Ga0207676_10129529 3300026095 Bacteria 2143
670 Ga0207674_10028915 3300026116 Bacteria 5842
671 Ga0207674_10042170 3300026116 Bacteria 4715
672 Ga0207674_10311069 3300026116 Bacteria 1524
673 Ga0207674_10580713 3300026116 Bacteria 1083
674 Ga0207675_100149906 3300026118 Bacteria 2219
675 Ga0207675_100154963 3300026118 Bacteria 2183
676 Ga0207675_100248454 3300026118 Bacteria 1721
677 Ga0207675_100454123 3300026118 Bacteria 1270
678 Ga0207675_100542946 3300026118 Bacteria 1161
679 Ga0207683_10120309 3300026121 Bacteria 2357
680 Ga0207683_10130661 3300026121 Bacteria 2259
681 Ga0207683_10142206 3300026121 Bacteria 2163
682 Ga0207683_10231116 3300026121 Bacteria 1687
683 Ga0207683_10246688 3300026121 Bacteria 1629
684 Ga0207683_10301546 3300026121 Bacteria 1466
685 Ga0207683_10577699 3300026121 Bacteria 1040
686 Ga0207698_10024892 3300026142 Bacteria 4207
687 Ga0207698_10126294 3300026142 Bacteria 2176
688 Ga0207698_10300921 3300026142 Bacteria 1493
689 Ga0207698_10307333 3300026142 Bacteria 1479
690 Ga0207698_10399309 3300026142 Bacteria 1313
691 Ga0207698_10426604 3300026142 Bacteria 1274
692 Ga0207698_10493304 3300026142 Bacteria 1190
693 Ga0209389_1000102 3300027296 Bacteria 78475
694 Ga0209389_1000142 3300027296 Bacteria 62072
695 Ga0209371_1001938 3300027312 Bacteria 12623
696 Ga0209589_1000035 3300027357 Bacteria 134091
697 Ga0209589_1000331 3300027357 Bacteria 62072
698 Ga0209489_100079 3300027361 Bacteria 134091
699 Ga0209489_100404 3300027361 Bacteria 78473
700 Ga0209489_100818 3300027361 Bacteria 62070
701 Ga0209700_100077 3300027363 Bacteria 134091
702 Ga0209700_100408 3300027363 Bacteria 78496
703 Ga0209179_1001374 3300027512 Bacteria 2956
704 Ga0209588_1001357 3300027671 Bacteria 6375
705 Ga0209813_10009317 3300027866 Bacteria 2508
706 Ga0209813_10031457 3300027866 Bacteria 1567
707 Ga0207428_10243821 3300027907 Bacteria 1342
708 Ga0268266_10008616 3300028379 Bacteria 9058
709 Ga0268266_10048797 3300028379 Bacteria 3629
710 Ga0268266_10060781 3300028379 Bacteria 3257
711 Ga0268266_10247167 3300028379 Bacteria 1649
712 Ga0268266_10275692 3300028379 Bacteria 1562
713 Ga0268266_10370293 3300028379 Bacteria 1349
714 Ga0268266_10391596 3300028379 Bacteria 1312
715 Ga0268266_10518135 3300028379 Bacteria 1140
716 Ga0268265_10014031 3300028380 Bacteria 5457
717 Ga0268265_10275630 3300028380 Bacteria 1502
718 Ga0268264_10000062 3300028381 Bacteria 302110
719 Ga0268264_10234589 3300028381 Bacteria 1696
720 Ga0268264_10392478 3300028381 Bacteria 1332
721 Ga0268264_10448204 3300028381 Bacteria 1250
722 Ga0268264_10490861 3300028381 Bacteria 1196
723 Ga0265319_1017352 3300028563 Bacteria 2738
724 Ga0265334_10046153 3300028573 Bacteria 1685
725 Ga0265318_10012602 3300028577 Bacteria 3592
726 Ga0265323_10002871 3300028653 Bacteria 7739
727 Ga0265322_10020639 3300028654 Bacteria 1887
728 Ga0265336_10000032 3300028666 Bacteria 167925
729 Ga0265336_10002816 3300028666 Bacteria 7027
730 Ga0307517_10000232 3300028786 Bacteria 94332
731 Ga0307517_10195851 3300028786 Bacteria 1273
732 Ga0307515_10072079 3300028794 Bacteria 4670
733 Ga0307515_10314675 3300028794 Bacteria 1237
734 Ga0307515_10423249 3300028794 Bacteria 952
735 Ga0265338_10000422 3300028800 Bacteria 75820
736 Ga0265324_10006919 3300029957 Bacteria 4673
737 Ga0265324_10015991 3300029957 Bacteria 2751
738 Ga0268256_1001682 3300030500 Bacteria 12623
739 Ga0307511_10125475 3300030521 Bacteria 1568
740 Ga0265760_10000096 3300031090 Bacteria 22944
741 Ga0265330_10011940 3300031235 Bacteria 4065
742 Ga0265330_10043394 3300031235 Bacteria 1989
743 Ga0265332_10010082 3300031238 Bacteria 4206
744 Ga0265332_10030416 3300031238 Bacteria 2359
745 Ga0265325_10008852 3300031241 Bacteria 5914
746 Ga0265329_10011836 3300031242 Unclassified 3160
747 Ga0265340_10010992 3300031247 Bacteria 4826
748 Ga0265339_10001248 3300031249 Bacteria 19138
749 Ga0265339_10010315 3300031249 Bacteria 5810
750 Ga0265331_10026374 3300031250 Bacteria 2922
751 Ga0265331_10052921 3300031250 Unclassified 1938
752 Ga0265331_10060809 3300031250 Bacteria 1784
753 Ga0265316_10170223 3300031344 Bacteria 1625
754 Ga0307513_10316548 3300031456 Bacteria 1320
755 Ga0307513_10361326 3300031456 Bacteria 1197
756 Ga0307513_10518950 3300031456 Bacteria 907
757 Ga0307509_10056747 3300031507 Bacteria 4155
758 Ga0307509_10147247 3300031507 Bacteria 2277
759 Ga0307509_10267919 3300031507 Bacteria 1478
760 Ga0307509_10429862 3300031507 Bacteria 1019
761 Ga0307408_100047045 3300031548 Bacteria 3087
762 Ga0307508_10000045 3300031616 Bacteria 142824
763 Ga0307508_10022102 3300031616 Bacteria 5783
764 Ga0307508_10208054 3300031616 Bacteria 1557
765 Ga0307508_10381219 3300031616 Bacteria 1001
766 Ga0307508_10445253 3300031616 Bacteria 887
767 Ga0265314_10005054 3300031711 Bacteria 12021
768 Ga0265314_10036026 3300031711 Bacteria 3600
769 Ga0265342_10000026 3300031712 Bacteria 166610
770 Ga0265342_10015623 3300031712 Bacteria 4989
771 Ga0265342_10040808 3300031712 Bacteria 2813
772 Ga0307516_10080981 3300031730 Bacteria 3090
773 Ga0307516_10107884 3300031730 Bacteria 2592
774 Ga0307413_10153592 3300031824 Bacteria 1607
775 Ga0307413_10381996 3300031824 Bacteria 1098
776 Ga0307407_10138680 3300031903 Bacteria 1566
777 Ga0307412_10190428 3300031911 Bacteria 1550
778 Ga0307412_10320291 3300031911 Bacteria 1233
779 Ga0307409_100387605 3300031995 Bacteria 1330
780 Ga0307416_100432738 3300032002 Bacteria 1363
781 Ga0307411_10489071 3300032005 Bacteria 1038
782 Ga0307415_100331735 3300032126 Bacteria 1273
783 Ga0307415_100525348 3300032126 Bacteria 1039
784 Ga0307415_100694017 3300032126 Bacteria 918
785 Ga0307507_10063749 3300033179 Bacteria 3408
786 Ga0307510_10005192 3300033180 Bacteria 15482
787 Ga0307510_10010957 3300033180 Bacteria 10775
788 Ga0307510_10154095 3300033180 Bacteria 1909
789 Ga0315911_1000008 3300033442 Bacteria 381285
790 Ga0373930_0063062 3300034816 Bacteria 830
791 Ga0373926_0018000 3300035083 Bacteria 2428
792 Ga0373929_0023418 3300035085 Bacteria 1269
793 Ga0373929_0030064 3300035085 Bacteria 1156
794 Ga0373934_0023131 3300035086 Bacteria 2400
795 Ga0373934_0048927 3300035086 Bacteria 1674
796 Ga0373934_0075890 3300035086 Bacteria 1348
797 Ga0373923_0007245 3300035111 Bacteria 3890
798 Ga0373923_0067787 3300035111 Bacteria 1527
799 Ga0373936_0007829 3300035113 Bacteria 4014
800 Ga0373936_0010431 3300035113 Bacteria 3505
801 Ga0373936_0240563 3300035113 Bacteria 807
802 Ga0373941_0056801 3300035115 Bacteria 1262
803 Ga0373945_0033473 3300035116 Bacteria 1827
804 Ga0373945_0034697 3300035116 Bacteria 1799
805 Ga0373953_0002766 3300035117 Bacteria 5330
806 Ga0373953_0029830 3300035117 Bacteria 2111
807 Ga0373954_0007515 3300035118 Bacteria 4768
808 Ga0373954_0041652 3300035118 Bacteria 2142
809 Ga0373954_0072568 3300035118 Bacteria 1637
810 Ga0373956_0063075 3300035119 Bacteria 1680
811 Ga0373957_0017724 3300035120 Bacteria 2485
812 Ga0373957_0183188 3300035120 Bacteria 869
813 Ga0373943_0003229 3300035170 Bacteria 7401
814 Ga0373943_0066803 3300035170 Bacteria 1812
815 Ga0373943_0230672 3300035170 Bacteria 1034
816 Ga0373946_0036453 3300035171 Bacteria 1994
817 Ga0373955_0011290 3300035172 Bacteria 4250
818 Ga0373955_0036661 3300035172 Bacteria 2603
819 Ga0373942_0029275 3300035207 Bacteria 1444
820 Ga0373962_0042191 3300035242 Bacteria 1289
821 Ga0373924_0035386 3300035410 Bacteria 2025
822 Ga0373924_0071228 3300035410 Bacteria 1467
823 Ga0373931_0013496 3300035691 Bacteria 3979
824 Ga0373931_0026163 3300035691 Bacteria 2966
825 Ga0373931_0114920 3300035691 Bacteria 1531
826 Ga0373935_0004301 3300035692 Bacteria 8357
827 Ga0373935_0025334 3300035692 Bacteria 3655
828 Ga0373927_0000766 3300035695 Bacteria 24573
829 Ga0373927_0002321 3300035695 Bacteria 13895
830 Ga0373927_0011298 3300035695 Bacteria 5943
831 Ga0373927_0018485 3300035695 Bacteria 4580
832 Ga0373927_0036330 3300035695 Bacteria 3204
833 Ga0373927_0052279 3300035695 Bacteria 2642
834 Ga0373927_0148385 3300035695 Bacteria 1535
835 Ga0373927_0478362 3300035695 Bacteria 823
836 Ga0373933_0000218 3300035724 Bacteria 37928
837 Ga0373933_0133740 3300035724 Bacteria 1561
838 Ga0373933_0223100 3300035724 Bacteria 1209
839 Ga0373933_0284996 3300035724 Bacteria 1068
840 Ga0373947_0000310 3300035725 Bacteria 27577
841 Ga0373947_0008207 3300035725 Bacteria 6023
842 Ga0373947_0051170 3300035725 Bacteria 2485
843 Ga0373947_0064613 3300035725 Bacteria 2231
844 Ga0373937_0007978 3300036401 Bacteria 9177
845 Ga0373937_0080516 3300036401 Bacteria 3012
846 Ga0373937_0220533 3300036401 Bacteria 1785
847 Ga0373937_0312494 3300036401 Bacteria 1486
848 Ga0372808_018578 3300036459 Bacteria 999
849 Ga0373925_0008418 3300037068 Bacteria 7511
850 Ga0373925_0016057 3300037068 Bacteria 5421
851 Ga0373925_0016895 3300037068 Bacteria 5283
852 Ga0373925_0034756 3300037068 Bacteria 3716
853 Ga0373925_0044131 3300037068 Bacteria 3310
854 Ga0373925_0133593 3300037068 Bacteria 1937
855 Ga0373925_0138946 3300037068 Bacteria 1900
856 Ga0373925_0250483 3300037068 Bacteria 1420
857 Ga0395899_0164845 3300037312 Bacteria 1564
858 Ga0395900_0000423 3300037418 Bacteria 60773
859 Ga0395900_0364696 3300037418 Bacteria 1415
860 Ga0395900_0366141 3300037418 Bacteria 1412
861 Ga0395898_0010460 3300037466 Bacteria 9699
862 Ga0395898_0016086 3300037466 Bacteria 7664
863 Ga0395898_0037142 3300037466 Bacteria 4834
864 Ga0395898_0129821 3300037466 Bacteria 2414
865 Ga0395898_0358162 3300037466 Bacteria 1391
866 Ga0395905_0017321 3300037471 Bacteria 6841
867 Ga0395905_0182703 3300037471 Bacteria 1969
868 Ga0395905_0471650 3300037471 Bacteria 1154
869 Ga0436364_0114057 3300037853 Bacteria 1238
870 Ga0395901_0010143 3300038443 Bacteria 9543
871 Ga0395901_0129559 3300038443 Bacteria 2651
872 Ga0395901_0611625 3300038443 Bacteria 1098
873 Ga0436365_1493424 3300039437 Bacteria 3701
874 Ga0436365_1890248 3300039437 Bacteria 1903
875 Ga0436360_0380405 3300039438 Bacteria 1842
876 Ga0436360_0734498 3300039438 Bacteria 2136
877 Ga0436360_1352967 3300039438 Bacteria 1099
878 Ga0436361_0609024 3300039447 Bacteria 7275
879 Ga0436361_0908871 3300039447 Bacteria 1454
880 Ga0436361_1023454 3300039447 Bacteria 1072
881 Ga0436363_0110349 3300039450 Bacteria 1472
882 Ga0436363_0462270 3300039450 Bacteria 1064
883 Ga0436363_0797587 3300039450 Bacteria 1873
884 Ga0436363_1120086 3300039450 Bacteria 1613
885 Ga0436363_1361193 3300039450 Bacteria 1177
886 Ga0436362_1092046 3300039453 Bacteria 1557
887 Ga0439466_0056963 3300041411 Bacteria 1267
888 Ga0451787_291164 3300041441 Bacteria 822
889 Ga0451795_0554965 3300041456 Bacteria 1234
890 Ga0451807_1265636 3300041486 Bacteria 1058
891 Ga0451841_0604624 3300041498 Bacteria 1329
892 Ga0439433_0026008 3300041999 Bacteria 1324
893 Ga0439445_0080725 3300042004 Bacteria 908
894 Ga0439455_0065575 3300042012 Bacteria 969
895 Ga0450920_026140 3300042122 Bacteria 1138
896 Ga0439458_0009214 3300042157 Bacteria 2199
897 Ga0450909_012001 3300042185 Bacteria 1269
898 Ga0439459_0035005 3300042438 Bacteria 1041
899 Ga0466969_0091111 3300044656 Bacteria 1445
900 Ga0466972_0000941 3300044658 Bacteria 14002
901 Ga0466972_0040720 3300044658 Bacteria 2262
902 Ga0466965_0027939 3300044683 Bacteria 2739
903 Ga0466965_0125696 3300044683 Bacteria 1327
904 Ga0466966_0000628 3300044684 Bacteria 22447
905 Ga0466966_0023968 3300044684 Bacteria 3994
906 Ga0466966_0028575 3300044684 Bacteria 3631
907 Ga0466961_0002516 3300044693 Bacteria 11373
908 Ga0466961_0203646 3300044693 Bacteria 1223
909 Ga0466963_0125500 3300044694 Bacteria 1769
910 Ga0466963_0157186 3300044694 Bacteria 1581
911 Ga0466964_0128426 3300044706 Bacteria 1151
912 Ga0466968_0004491 3300044735 Bacteria 5217
913 Ga0466968_0177168 3300044735 Bacteria 990
914 Ga0466970_0189366 3300044765 Bacteria 1143
915 Ga0466957_0073406 3300044842 Bacteria 2120
916 Ga0466957_0302860 3300044842 Bacteria 1074
917 Ga0466959_0012945 3300045049 Bacteria 6039
918 Ga0466959_0331979 3300045049 Bacteria 1038
919 Ga0466958_0171777 3300045836 Bacteria 1373
920 Ga0466958_0237807 3300045836 Bacteria 1163
921 Ga0466967_0282433 3300045976 Bacteria 1593
922 Ga0466967_0367727 3300045976 Bacteria 1394
923 Ga0466967_0492415 3300045976 Bacteria 1202
924 Ga0466967_0504934 3300045976 Bacteria 1187
925 Ga0466967_0566847 3300045976 Bacteria 1118
926 Ga0495617_026570 3300046452 Bacteria 1949
927 Ga0495592_0004461 3300046454 Bacteria 10242
928 Ga0495592_0029657 3300046454 Bacteria 4142
929 Ga0495592_0050389 3300046454 Bacteria 3093
930 Ga0495592_0126857 3300046454 Bacteria 1789
931 Ga0495603_0000936 3300046455 Bacteria 16788
932 Ga0495603_0002927 3300046455 Bacteria 10095
933 Ga0495603_0017727 3300046455 Bacteria 4310
934 Ga0495603_0025404 3300046455 Bacteria 3582
935 Ga0495603_0066165 3300046455 Bacteria 2129
936 Ga0495603_0103707 3300046455 Bacteria 1660
937 Ga0495603_0140937 3300046455 Bacteria 1402
938 Ga0495590_0125429 3300046457 Bacteria 921
939 Ga0495629_0001416 3300046459 Bacteria 18913
940 Ga0495629_0002247 3300046459 Bacteria 14887
941 Ga0495629_0003103 3300046459 Bacteria 12597
942 Ga0495638_0005979 3300046460 Bacteria 8929
943 Ga0495638_0028219 3300046460 Bacteria 3625
944 Ga0495638_0190125 3300046460 Bacteria 1165
945 Ga0495638_0206597 3300046460 Bacteria 1105
946 Ga0495641_0005002 3300046461 Bacteria 9142
947 Ga0495641_0049859 3300046461 Bacteria 1915
948 Ga0495641_0082044 3300046461 Bacteria 1444
949 Ga0495651_0008730 3300046462 Bacteria 7772
950 Ga0495651_0038241 3300046462 Bacteria 3736
951 Ga0495651_0064839 3300046462 Bacteria 2791
952 Ga0495651_0080456 3300046462 Bacteria 2461
953 Ga0495651_0102687 3300046462 Bacteria 2126
954 Ga0495651_0131493 3300046462 Bacteria 1826
955 Ga0495653_0015924 3300046463 Bacteria 6129
956 Ga0495653_0050804 3300046463 Bacteria 3187
957 Ga0495653_0065737 3300046463 Bacteria 2729
958 Ga0495653_0196583 3300046463 Bacteria 1372
959 Ga0495650_0059049 3300046471 Bacteria 1546
960 Ga0495580_0002805 3300046472 Bacteria 14983
961 Ga0495580_0028806 3300046472 Bacteria 4035
962 Ga0495582_0000302 3300046473 Bacteria 27218
963 Ga0495582_0051892 3300046473 Bacteria 2262
964 Ga0495582_0144541 3300046473 Bacteria 1349
965 Ga0495605_0154640 3300046474 Bacteria 1021
966 Ga0495639_0000072 3300046475 Bacteria 46904
967 Ga0495639_0013510 3300046475 Bacteria 3527
968 Ga0495662_0001578 3300046476 Bacteria 11325
969 Ga0495664_0015202 3300046477 Bacteria 4374
970 Ga0495664_0027071 3300046477 Bacteria 3342
971 Ga0495664_0031919 3300046477 Bacteria 3088
972 Ga0495664_0054635 3300046477 Bacteria 2374
973 Ga0495664_0168217 3300046477 Bacteria 1330
974 Ga0495664_0190528 3300046477 Bacteria 1243
975 Ga0495594_0000046 3300046499 Bacteria 53822
976 Ga0495596_0121237 3300046500 Bacteria 1015
977 Ga0495607_0232150 3300046501 Bacteria 897
978 Ga0495583_0062080 3300046506 Bacteria 1665
979 Ga0495583_0067954 3300046506 Bacteria 1573
980 Ga0495606_0057727 3300046507 Bacteria 2498
981 Ga0495606_0072504 3300046507 Bacteria 2163
982 Ga0495606_0195138 3300046507 Bacteria 1158
983 Ga0495606_0286839 3300046507 Bacteria 897
984 Ga0495608_0005612 3300046511 Bacteria 8964
985 Ga0495608_0168369 3300046511 Bacteria 1390
986 Ga0495608_0193797 3300046511 Bacteria 1282
987 Ga0495608_0275066 3300046511 Bacteria 1046
988 Ga0495610_0015265 3300046512 Bacteria 4471
989 Ga0495610_0141767 3300046512 Bacteria 1034
990 Ga0495616_0036090 3300046513 Bacteria 2553
991 Ga0495618_0073627 3300046514 Bacteria 2175
992 Ga0495618_0344058 3300046514 Bacteria 920
993 Ga0495620_0054100 3300046515 Bacteria 1697
994 Ga0495620_0087184 3300046515 Bacteria 1256
995 Ga0495628_0015500 3300046516 Bacteria 6365
996 Ga0495628_0040083 3300046516 Bacteria 3744
997 Ga0495628_0053908 3300046516 Bacteria 3172
998 Ga0495628_0073940 3300046516 Bacteria 2655
999 Ga0495630_0005610 3300046517 Bacteria 8864
1000 Ga0495632_0108600 3300046519 Bacteria 1304
1001 Ga0495632_0168497 3300046519 Bacteria 1007
1002 Ga0495637_0011891 3300046520 Bacteria 4172
1003 Ga0495637_0096500 3300046520 Bacteria 1160
1004 Ga0495643_0052988 3300046522 Bacteria 2176
1005 Ga0495643_0091710 3300046522 Bacteria 1566
1006 Ga0495643_0254870 3300046522 Bacteria 817
1007 Ga0495644_0049422 3300046523 Bacteria 1578
1008 Ga0495644_0071701 3300046523 Bacteria 1302
1009 Ga0495648_0001071 3300046524 Bacteria 27799
1010 Ga0495648_0027838 3300046524 Bacteria 3776
1011 Ga0495648_0088063 3300046524 Bacteria 1746
1012 Ga0495648_0100171 3300046524 Bacteria 1601
1013 Ga0495648_0120396 3300046524 Bacteria 1412
1014 Ga0495648_0163379 3300046524 Bacteria 1148
1015 Ga0495663_0040889 3300046525 Bacteria 1409
1016 Ga0495663_0049035 3300046525 Bacteria 1303
1017 Ga0495666_0031720 3300046526 Bacteria 2589
1018 Ga0495652_0003554 3300046529 Bacteria 15313
1019 Ga0495652_0020755 3300046529 Bacteria 5838
1020 Ga0495652_0044098 3300046529 Bacteria 3842
1021 Ga0495652_0423585 3300046529 Bacteria 937
1022 Ga0495654_0016336 3300046530 Bacteria 3927
1023 Ga0495665_0000335 3300046531 Bacteria 23811
1024 Ga0495665_0011584 3300046531 Bacteria 4775
1025 Ga0495640_0002138 3300046533 Bacteria 15789
1026 Ga0495640_0017069 3300046533 Bacteria 5417
1027 Ga0495640_0019627 3300046533 Bacteria 4985
1028 Ga0495586_0131867 3300046535 Bacteria 1399
1029 Ga0495587_0044776 3300046536 Bacteria 2631
1030 Ga0495609_0072166 3300046538 Bacteria 1516
1031 Ga0495621_0051105 3300046539 Bacteria 1478
1032 Ga0495621_0112377 3300046539 Bacteria 1046
1033 Ga0495645_0008238 3300046543 Bacteria 7269
1034 Ga0495645_0023376 3300046543 Bacteria 4476
1035 Ga0495645_0131357 3300046543 Bacteria 1754
1036 Ga0495622_0001664 3300046557 Bacteria 11001
1037 Ga0495622_0026583 3300046557 Bacteria 2701
1038 Ga0495622_0043995 3300046557 Bacteria 2075
1039 Ga0495622_0058451 3300046557 Bacteria 1786
1040 Ga0495622_0132518 3300046557 Bacteria 1134
1041 Ga0495633_0194887 3300046558 Bacteria 931
1042 Ga0495667_0003584 3300046559 Bacteria 10443
1043 Ga0495667_0008501 3300046559 Bacteria 6968
1044 Ga0495667_0014435 3300046559 Bacteria 5337
1045 Ga0495667_0150550 3300046559 Bacteria 1498
1046 Ga0495656_0033066 3300046615 Bacteria 2108
1047 Ga0495656_0134608 3300046615 Bacteria 1179
1048 Ga0495656_0287827 3300046615 Bacteria 839
1049 Ga0495668_0049581 3300046616 Bacteria 2328
1050 Ga0495668_0169620 3300046616 Bacteria 1196
1051 Ga0495668_0216571 3300046616 Bacteria 1048
1052 Ga0495634_0004622 3300046642 Bacteria 10742
1053 Ga0495634_0023263 3300046642 Bacteria 4356
1054 Ga0495634_0091597 3300046642 Bacteria 1973
1055 Ga0495634_0219195 3300046642 Bacteria 1175
1056 Ga0495625_0071714 3300046660 Bacteria 2430
1057 Ga0495625_0074874 3300046660 Bacteria 2370
1058 Ga0495625_0162314 3300046660 Bacteria 1496
1059 Ga0495625_0244074 3300046660 Bacteria 1168
1060 Ga0495635_0000518 3300046663 Bacteria 24462
1061 Ga0495635_0006671 3300046663 Bacteria 8062
1062 Ga0495635_0008383 3300046663 Bacteria 7215
1063 Ga0495635_0026959 3300046663 Bacteria 3997
1064 Ga0495635_0098620 3300046663 Bacteria 1997
1065 Ga0495659_0162006 3300046664 Bacteria 904
1066 Ga0495661_0034212 3300046665 Bacteria 3198
1067 Ga0495661_0220566 3300046665 Bacteria 983
1068 Ga0495588_0002579 3300046674 Bacteria 7753
1069 Ga0495588_0016851 3300046674 Bacteria 3538
1070 Ga0495588_0023873 3300046674 Bacteria 3032
1071 Ga0495588_0057929 3300046674 Bacteria 2002
1072 Ga0495657_0005477 3300046675 Bacteria 10046
1073 Ga0495657_0032801 3300046675 Bacteria 3621
1074 Ga0495657_0214613 3300046675 Bacteria 1168
1075 Ga0495599_0000864 3300046678 Bacteria 16965
1076 Ga0495599_0084142 3300046678 Bacteria 1987
1077 Ga0495599_0186043 3300046678 Bacteria 1279
1078 Ga0495599_0207791 3300046678 Bacteria 1201
1079 Ga0495599_0392995 3300046678 Bacteria 827
1080 Ga0495623_0010119 3300046679 Bacteria 6105
1081 Ga0495646_0026987 3300046680 Bacteria 3605
1082 Ga0495646_0134232 3300046680 Bacteria 1390
1083 Ga0495646_0174338 3300046680 Bacteria 1183
1084 Ga0495647_0104011 3300046681 Bacteria 1178
1085 Ga0495658_0023228 3300046683 Bacteria 3289
1086 Ga0495658_0214841 3300046683 Bacteria 1202
1087 Ga0495669_0015902 3300046684 Bacteria 3221
1088 Ga0495669_0098046 3300046684 Bacteria 1359
1089 Ga0495669_0168331 3300046684 Bacteria 1042
1090 Ga0495613_0004485 3300046689 Bacteria 10464
1091 Ga0495613_0145701 3300046689 Bacteria 1690
1092 Ga0495613_0204897 3300046689 Bacteria 1389
1093 Ga0495613_0333511 3300046689 Bacteria 1045
1094 Ga0495613_0357636 3300046689 Bacteria 1002
1095 Ga0495624_0000795 3300046690 Bacteria 24919
1096 Ga0495624_0041749 3300046690 Bacteria 2933
1097 Ga0495624_0315221 3300046690 Bacteria 942
1098 Ga0495624_0363769 3300046690 Bacteria 870
1099 Ga0495670_0007575 3300046691 Bacteria 5335
1100 Ga0495671_0046554 3300046692 Bacteria 2168
1101 Ga0495671_0082614 3300046692 Bacteria 1574
1102 Ga0495671_0107523 3300046692 Bacteria 1362
1103 Ga0495649_0086287 3300046694 Bacteria 1675
1104 Ga0495649_0152812 3300046694 Bacteria 1212
1105 Ga0495649_0186305 3300046694 Bacteria 1081
1106 Ga0495649_0297462 3300046694 Bacteria 822
1107 Ga0495589_0178129 3300046794 Bacteria 1009
1108 Ga0495600_0002373 3300046809 Bacteria 10764
1109 Ga0495600_0017875 3300046809 Bacteria 4513
1110 Ga0495600_0067504 3300046809 Bacteria 2337
1111 Ga0495600_0087808 3300046809 Bacteria 2028
1112 Ga0495600_0240833 3300046809 Bacteria 1153
1113 Ga0495600_0294526 3300046809 Bacteria 1025
1114 Ga0495660_0245563 3300046810 Bacteria 833
1115 Ga0495581_0000030 3300047315 Bacteria 53487
1116 Ga0495581_0028132 3300047315 Bacteria 3259
1117 Ga0495581_0047237 3300047315 Bacteria 2488
1118 Ga0495581_0181574 3300047315 Bacteria 1231
1119 Ga0495581_0237488 3300047315 Bacteria 1066
1120 Ga0495581_0251946 3300047315 Bacteria 1033
1121 Ga0495604_0005369 3300047317 Bacteria 10163
1122 Ga0495604_0014589 3300047317 Bacteria 6262
1123 Ga0495604_0025392 3300047317 Bacteria 4721
1124 Ga0495604_0184578 3300047317 Bacteria 1457
1125 Ga0495636_0060744 3300047318 Bacteria 1597
1126 Ga0495636_0135694 3300047318 Bacteria 1096
1127 Ga0495674_0004821 3300047319 Bacteria 12972
1128 Ga0495674_0029980 3300047319 Bacteria 4949
1129 Ga0495674_0045408 3300047319 Bacteria 3901
1130 Ga0495674_0182566 3300047319 Bacteria 1747
1131 Ga0495672_0176406 3300047320 Bacteria 1086
1132 Ga0495676_0033174 3300047321 Bacteria 4351
1133 Ga0495676_0164043 3300047321 Bacteria 1569
1134 Ga0495676_0168826 3300047321 Bacteria 1541
1135 Ga0495676_0248673 3300047321 Bacteria 1214
1136 Ga0495676_0318899 3300047321 Bacteria 1044
1137 Ga0495680_0008881 3300047322 Bacteria 9087
1138 Ga0495683_0132660 3300047323 Bacteria 1173
1139 Ga0495687_007148 3300047443 Bacteria 6649
1140 Ga0495675_0020892 3300047444 Bacteria 4167
1141 Ga0495675_0099624 3300047444 Bacteria 1820
1142 Ga0495675_0214036 3300047444 Bacteria 1168
1143 Ga0495677_0077709 3300047445 Bacteria 1242
1144 Ga0495673_0127904 3300047469 Bacteria 1000
1145 Ga0495684_0004051 3300047471 Bacteria 11430
1146 Ga0495684_0024023 3300047471 Bacteria 4690
1147 Ga0495686_0064143 3300047472 Bacteria 2274
1148 Ga0495686_0078201 3300047472 Bacteria 2025
1149 Ga0495686_0092376 3300047472 Bacteria 1835
1150 Ga0495686_0146969 3300047472 Bacteria 1387
1151 Ga0495686_0157627 3300047472 Bacteria 1329
1152 Ga0495593_0000398 3300047673 Bacteria 24218
1153 Ga0495593_0009398 3300047673 Bacteria 5674
1154 Ga0495593_0017768 3300047673 Bacteria 4005
1155 Ga0495593_0061511 3300047673 Bacteria 1964
1156 Ga0495602_0010323 3300048088 Bacteria 9695
1157 Ga0495602_0023058 3300048088 Bacteria 6075
1158 Ga0495602_0047488 3300048088 Bacteria 3868
1159 Ga0495602_0230322 3300048088 Bacteria 1393
1160 Ga0495602_0268477 3300048088 Bacteria 1262
1161 Ga0495614_0142115 3300048089 Bacteria 1067
1162 Ga0495615_0089412 3300048090 Bacteria 856
1163 Ga0496100_0005479 3300048903 Bacteria 6840
1164 Ga0496100_0015556 3300048903 Bacteria 4445
1165 Ga0496100_0020557 3300048903 Bacteria 3960
1166 Ga0496100_0304159 3300048903 Bacteria 1194
1167 Ga0496100_0645194 3300048903 Bacteria 824
1168 Ga0496101_0021366 3300048904 Bacteria 4447
1169 Ga0496101_0057108 3300048904 Bacteria 2822
1170 Ga0496101_0101438 3300048904 Bacteria 2155
1171 Ga0496101_0267795 3300048904 Bacteria 1333
1172 Ga0496101_0408868 3300048904 Bacteria 1069
1173 Ga0496102_0025855 3300048905 Bacteria 5229
1174 Ga0496102_0069619 3300048905 Bacteria 3230
1175 Ga0496102_0071540 3300048905 Bacteria 3184
1176 Ga0496102_0074603 3300048905 Bacteria 3118
1177 Ga0496102_0098901 3300048905 Bacteria 2707
1178 Ga0496102_0196265 3300048905 Bacteria 1902
1179 Ga0496102_0231653 3300048905 Bacteria 1741
1180 Ga0496102_0250719 3300048905 Bacteria 1669
1181 Ga0496102_0256331 3300048905 Bacteria 1649
1182 Ga0496102_0396110 3300048905 Bacteria 1298
1183 Ga0496102_0431627 3300048905 Bacteria 1237
1184 Ga0496103_0010891 3300048906 Bacteria 5381
1185 Ga0496103_0021472 3300048906 Bacteria 3885
1186 Ga0496103_0123848 3300048906 Bacteria 1648
1187 Ga0496104_0013200 3300048907 Bacteria 7446
1188 Ga0496104_0021253 3300048907 Bacteria 5955
1189 Ga0496104_0023224 3300048907 Bacteria 5702
1190 Ga0496104_0081567 3300048907 Bacteria 3084
1191 Ga0496104_0109572 3300048907 Bacteria 2646
1192 Ga0496104_0122100 3300048907 Bacteria 2501
1193 Ga0496104_0181592 3300048907 Bacteria 2014
1194 Ga0496105_0002119 3300048908 Bacteria 14370
1195 Ga0496105_0004271 3300048908 Bacteria 10750
1196 Ga0496105_0049541 3300048908 Bacteria 3468
1197 Ga0496105_0108810 3300048908 Bacteria 2288
1198 Ga0496105_0270131 3300048908 Bacteria 1373
1199 Ga0496105_0435082 3300048908 Bacteria 1037
1200 Ga0496106_0000418 3300048909 Bacteria 30181
1201 Ga0496106_0005807 3300048909 Bacteria 9124
1202 Ga0496106_0008160 3300048909 Bacteria 7737
1203 Ga0496106_0012607 3300048909 Bacteria 6243
1204 Ga0496106_0021313 3300048909 Bacteria 4811
1205 Ga0496106_0206036 3300048909 Bacteria 1566
1206 Ga0496106_0266793 3300048909 Bacteria 1370
1207 Ga0496106_0423139 3300048909 Bacteria 1070
1208 Ga0496106_0451929 3300048909 Bacteria 1032
1209 Ga0496106_0591381 3300048909 Bacteria 889
1210 Ga0496107_0005061 3300048910 Bacteria 8984
1211 Ga0496107_0021428 3300048910 Bacteria 4567
1212 Ga0496107_0071285 3300048910 Bacteria 2524
1213 Ga0496107_0104479 3300048910 Bacteria 2079
1214 Ga0496107_0179311 3300048910 Bacteria 1573
1215 Ga0496108_0000160 3300048911 Bacteria 64120
1216 Ga0496108_0020758 3300048911 Bacteria 5399
1217 Ga0496108_0025207 3300048911 Bacteria 4900
1218 Ga0496108_0071623 3300048911 Bacteria 2925
1219 Ga0496108_0217264 3300048911 Bacteria 1660
1220 Ga0496108_0310990 3300048911 Bacteria 1373
1221 Ga0496109_0000245 3300048912 Bacteria 52201
1222 Ga0496109_0021697 3300048912 Bacteria 5683
1223 Ga0496109_0089282 3300048912 Bacteria 2849
1224 Ga0496109_0102308 3300048912 Bacteria 2659
1225 Ga0496109_0183229 3300048912 Bacteria 1967
1226 Ga0496109_0430333 3300048912 Bacteria 1246
1227 Ga0496109_0497795 3300048912 Bacteria 1150
1228 Ga0496110_0014329 3300048913 Bacteria 6578
1229 Ga0496110_0024193 3300048913 Bacteria 5173
1230 Ga0496110_0051735 3300048913 Bacteria 3609
1231 Ga0496110_0233120 3300048913 Bacteria 1674
1232 Ga0496110_0238542 3300048913 Bacteria 1654
1233 Ga0496110_0487144 3300048913 Bacteria 1123
1234 Ga0496111_0047295 3300048914 Bacteria 3098
1235 Ga0496111_0065286 3300048914 Bacteria 2642
1236 Ga0496112_0000018 3300048915 Bacteria 188820
1237 Ga0496112_0002354 3300048915 Bacteria 15178
1238 Ga0496112_0004127 3300048915 Bacteria 12219
1239 Ga0496112_0004136 3300048915 Bacteria 12210
1240 Ga0496112_0007772 3300048915 Bacteria 9542
1241 Ga0496112_0035285 3300048915 Bacteria 4871
1242 Ga0496112_0123482 3300048915 Bacteria 2560
1243 Ga0496112_0136598 3300048915 Bacteria 2422
1244 Ga0496112_0145156 3300048915 Bacteria 2341
1245 Ga0496112_0159966 3300048915 Bacteria 2218
1246 Ga0496113_0038433 3300048916 Bacteria 3519
1247 Ga0496113_0053535 3300048916 Bacteria 3018
1248 Ga0496113_0074927 3300048916 Bacteria 2581
1249 Ga0496113_0122095 3300048916 Bacteria 2037
1250 Ga0496113_0539875 3300048916 Bacteria 935
1251 Ga0496114_0140628 3300048917 Bacteria 2089
1252 Ga0496114_0245698 3300048917 Bacteria 1574
1253 Ga0496114_0294835 3300048917 Bacteria 1431
1254 Ga0496114_0323477 3300048917 Bacteria 1363
1255 Ga0496114_0622413 3300048917 Bacteria 951
1256 Ga0496115_0005337 3300048918 Bacteria 9350
1257 Ga0496115_0014614 3300048918 Bacteria 5945
1258 Ga0496115_0051731 3300048918 Bacteria 3293
1259 Ga0496115_0089905 3300048918 Bacteria 2508
1260 Ga0496115_0097833 3300048918 Bacteria 2403
1261 Ga0496115_0398601 3300048918 Bacteria 1117
1262 Ga0496115_0418234 3300048918 Bacteria 1086
1263 Ga0496115_0499375 3300048918 Bacteria 978
1264 Ga0496116_0012269 3300048919 Bacteria 7007
1265 Ga0496116_0014117 3300048919 Bacteria 6396
1266 Ga0496116_0102458 3300048919 Bacteria 1707
1267 Ga0496117_0015483 3300048920 Bacteria 6497
1268 Ga0496117_0032990 3300048920 Bacteria 3922
1269 Ga0496117_0051718 3300048920 Bacteria 2901
1270 Ga0496117_0149101 3300048920 Bacteria 1387
1271 Ga0496117_0215742 3300048920 Bacteria 1072
1272 Ga0496118_0005692 3300048921 Bacteria 14039
1273 Ga0496118_0017056 3300048921 Bacteria 6630
1274 Ga0496118_0028806 3300048921 Bacteria 4669
1275 Ga0496118_0037135 3300048921 Bacteria 3926
1276 Ga0496118_0121818 3300048921 Bacteria 1698
1277 Ga0496118_0272520 3300048921 Bacteria 947
1278 Ga0496118_0339636 3300048921 Bacteria 806
1279 Ga0496119_0002669 3300048922 Bacteria 19295
1280 Ga0496119_0014075 3300048922 Bacteria 6295
1281 Ga0496119_0017374 3300048922 Bacteria 5411
1282 Ga0496119_0023249 3300048922 Bacteria 4405
1283 Ga0496119_0035864 3300048922 Bacteria 3243
1284 Ga0496119_0072531 3300048922 Bacteria 2011
1285 Ga0496119_0197550 3300048922 Bacteria 1043
1286 Ga0496119_0201578 3300048922 Bacteria 1029
1287 Ga0496120_0014496 3300048923 Bacteria 5251
1288 Ga0496120_0054397 3300048923 Bacteria 2268
1289 Ga0496120_0069860 3300048923 Bacteria 1933
1290 Ga0496120_0162416 3300048923 Bacteria 1112
1291 Ga0496121_0000278 3300048924 Bacteria 106838
1292 Ga0496121_0000870 3300048924 Bacteria 54546
1293 Ga0496121_0010173 3300048924 Bacteria 10650
1294 Ga0496121_0014331 3300048924 Bacteria 8424
1295 Ga0496121_0015878 3300048924 Bacteria 7828
1296 Ga0496121_0021331 3300048924 Bacteria 6350
1297 Ga0496121_0023995 3300048924 Bacteria 5849
1298 Ga0496121_0030800 3300048924 Bacteria 4920
1299 Ga0496121_0034826 3300048924 Bacteria 4524
1300 Ga0496121_0089621 3300048924 Bacteria 2407
1301 Ga0496121_0095356 3300048924 Bacteria 2312
1302 Ga0496121_0095552 3300048924 Bacteria 2309
1303 Ga0496121_0130086 3300048924 Bacteria 1886
1304 Ga0496121_0145227 3300048924 Bacteria 1754
1305 Ga0496121_0170692 3300048924 Bacteria 1580
1306 Ga0496121_0177781 3300048924 Bacteria 1539
1307 Ga0496121_0213940 3300048924 Bacteria 1363
1308 Ga0496121_0219163 3300048924 Bacteria 1341
1309 Ga0496121_0234101 3300048924 Bacteria 1284
1310 Ga0496121_0240078 3300048924 Bacteria 1263
1311 Ga0496121_0391485 3300048924 Bacteria 913
1312 Ga0496122_0020531 3300048925 Bacteria 5960
1313 Ga0496122_0038047 3300048925 Bacteria 3861
1314 Ga0496122_0050025 3300048925 Bacteria 3191
1315 Ga0496122_0205099 3300048925 Bacteria 1148
1316 Ga0496122_0232738 3300048925 Bacteria 1046
1317 Ga0496123_0003029 3300048926 Bacteria 19369
1318 Ga0496123_0031679 3300048926 Bacteria 3843
1319 Ga0496123_0110437 3300048926 Bacteria 1573
1320 Ga0496123_0164249 3300048926 Bacteria 1180
1321 Ga0496124_0000123 3300048927 Bacteria 161106
1322 Ga0496124_0084753 3300048927 Bacteria 2597
1323 Ga0496124_0115893 3300048927 Bacteria 2149
1324 Ga0496124_0247269 3300048927 Bacteria 1322
1325 Ga0496124_0296982 3300048927 Bacteria 1169
1326 Ga0496125_0000207 3300048928 Bacteria 122897
1327 Ga0496125_0011562 3300048928 Bacteria 8817
1328 Ga0496125_0012916 3300048928 Bacteria 8246
1329 Ga0496125_0139009 3300048928 Bacteria 1692
1330 Ga0496126_0008213 3300048929 Bacteria 11288
1331 Ga0496126_0010103 3300048929 Bacteria 9956
1332 Ga0496126_0036335 3300048929 Bacteria 4606
1333 Ga0496126_0056692 3300048929 Bacteria 3540
1334 Ga0496126_0062529 3300048929 Bacteria 3340
1335 Ga0496126_0095928 3300048929 Bacteria 2600
1336 Ga0496126_0128201 3300048929 Bacteria 2194
1337 Ga0496126_0132407 3300048929 Bacteria 2153
1338 Ga0496126_0171147 3300048929 Bacteria 1850
1339 Ga0496126_0233078 3300048929 Bacteria 1541
1340 Ga0496126_0248727 3300048929 Bacteria 1482
1341 Ga0496126_0263494 3300048929 Bacteria 1432
1342 Ga0496126_0285765 3300048929 Bacteria 1365
1343 Ga0496126_0311100 3300048929 Bacteria 1297
1344 Ga0496126_0406211 3300048929 Bacteria 1103
1345 Ga0496126_0463884 3300048929 Bacteria 1017
1346 Ga0496126_0468481 3300048929 Bacteria 1011
1347 Ga0496126_0472107 3300048929 Bacteria 1006
1348 Ga0496126_0497807 3300048929 Bacteria 974
1349 Ga0495678_078556 3300049459 Bacteria 1191
1350 Ga0495682_0131917 3300049460 Bacteria 893
1351 Ga0501031_0049312 3300049568 Bacteria 2744
1352 Ga0501032_0011231 3300049569 Bacteria 6433
1353 Ga0501032_0071162 3300049569 Bacteria 2318
1354 Ga0501032_0101572 3300049569 Bacteria 1905
1355 Ga0501032_0240969 3300049569 Bacteria 1175
1356 Ga0501033_0001064 3300049570 Bacteria 25051
1357 Ga0501033_0012046 3300049570 Bacteria 6602
1358 Ga0501033_0049770 3300049570 Bacteria 3111
1359 Ga0501034_0130679 3300049571 Bacteria 2494
1360 Ga0501034_0313086 3300049571 Bacteria 1504
1361 Ga0501034_0632690 3300049571 Bacteria 973
1362 Ga0501036_0124749 3300049572 Bacteria 2174
1363 Ga0501036_0570881 3300049572 Bacteria 939
1364 Ga0501036_0571133 3300049572 Bacteria 939
1365 Ga0501036_0701638 3300049572 Bacteria 836
1366 Ga0501037_0000242 3300049573 Bacteria 46822
1367 Ga0501037_0064561 3300049573 Bacteria 2668
1368 Ga0501038_0016237 3300049574 Bacteria 6751
1369 Ga0501038_0218189 3300049574 Bacteria 1523
1370 Ga0501038_0377896 3300049574 Bacteria 1099
1371 Ga0501039_0153933 3300049575 Bacteria 1806
1372 Ga0501043_0000440 3300049579 Bacteria 37461
1373 Ga0501043_0033129 3300049579 Bacteria 4064
1374 Ga0501043_0090716 3300049579 Bacteria 2403
1375 Ga0501043_0131751 3300049579 Bacteria 1959
1376 Ga0501046_0237224 3300049580 Bacteria 1346
1377 Ga0501047_0006953 3300049581 Bacteria 10627
1378 Ga0501047_0008580 3300049581 Bacteria 9645
1379 Ga0501047_0011808 3300049581 Bacteria 8261
1380 Ga0501047_0027351 3300049581 Bacteria 5494
1381 Ga0501047_0056233 3300049581 Bacteria 3804
1382 Ga0501047_0069493 3300049581 Bacteria 3391
1383 Ga0501047_0190762 3300049581 Bacteria 1913
1384 Ga0501047_0238252 3300049581 Bacteria 1671
1385 Ga0501047_0459276 3300049581 Bacteria 1102
1386 Ga0501047_0469766 3300049581 Bacteria 1086
1387 Ga0501048_0131505 3300049582 Bacteria 1769
1388 Ga0501048_0238046 3300049582 Bacteria 1292
1389 Ga0501067_0055415 3300049583 Bacteria 2197
1390 Ga0501067_0106097 3300049583 Bacteria 1561
1391 Ga0501068_0005571 3300049584 Bacteria 6898
1392 Ga0501068_0222044 3300049584 Bacteria 1201
1393 Ga0501069_0000017 3300049585 Bacteria 141492
1394 Ga0501069_0024997 3300049585 Bacteria 3261
1395 Ga0501069_0330006 3300049585 Bacteria 897
1396 Ga0501070_0000236 3300049586 Bacteria 52046
1397 Ga0501070_0000356 3300049586 Bacteria 41599
1398 Ga0501070_0007635 3300049586 Bacteria 9182
1399 Ga0501070_0025934 3300049586 Bacteria 4918
1400 Ga0501070_0062784 3300049586 Bacteria 3077
1401 Ga0501071_0143147 3300049587 Bacteria 1781
1402 Ga0501071_0229123 3300049587 Bacteria 1399
1403 Ga0501071_0384309 3300049587 Bacteria 1071
1404 Ga0501071_0582316 3300049587 Bacteria 860
1405 Ga0501073_0000531 3300049589 Bacteria 26762
1406 Ga0501073_0032679 3300049589 Bacteria 3709
1407 Ga0501074_0000610 3300049590 Bacteria 22218
1408 Ga0501074_0000660 3300049590 Bacteria 21527
1409 Ga0501074_0011565 3300049590 Bacteria 6419
1410 Ga0501074_0031296 3300049590 Bacteria 3855
1411 Ga0501074_0090123 3300049590 Bacteria 2196
1412 Ga0501079_0006439 3300049741 Bacteria 8817
1413 Ga0501080_0001422 3300049742 Bacteria 20085
1414 Ga0501080_0005983 3300049742 Bacteria 10902
1415 Ga0501080_0009701 3300049742 Bacteria 8791
1416 Ga0501080_0023297 3300049742 Bacteria 5740
1417 Ga0501080_0068569 3300049742 Bacteria 3299
1418 Ga0501080_0159418 3300049742 Bacteria 2084
1419 Ga0501080_0210494 3300049742 Bacteria 1782
1420 Ga0501083_0002788 3300049744 Bacteria 12084
1421 Ga0501083_0003168 3300049744 Bacteria 11450
1422 Ga0501083_0092651 3300049744 Bacteria 1995
1423 Ga0501035_0000101 3300049822 Bacteria 106949
1424 Ga0501035_0000686 3300049822 Bacteria 36991
1425 Ga0501035_0009055 3300049822 Bacteria 9258
1426 Ga0501035_0020710 3300049822 Bacteria 6044
1427 Ga0501035_0028068 3300049822 Bacteria 5139
1428 Ga0501035_0059620 3300049822 Bacteria 3399
1429 Ga0501035_0230946 3300049822 Bacteria 1577
1430 Ga0501035_0324512 3300049822 Bacteria 1293
1431 Ga0501035_0558963 3300049822 Bacteria 936
1432 Ga0501035_0619810 3300049822 Bacteria 880
1433 Ga0501044_0000010 3300049823 Bacteria 260121
1434 Ga0501044_0016129 3300049823 Bacteria 8031
1435 Ga0501044_0029369 3300049823 Bacteria 5798
1436 Ga0501044_0036505 3300049823 Bacteria 5142
1437 Ga0501044_0060354 3300049823 Bacteria 3883
1438 Ga0501044_0099050 3300049823 Bacteria 2934
1439 Ga0501044_0107251 3300049823 Bacteria 2805
1440 Ga0501044_0112268 3300049823 Bacteria 2733
1441 Ga0501044_0117767 3300049823 Bacteria 2660
1442 Ga0501044_0182100 3300049823 Bacteria 2067
1443 Ga0501044_0282669 3300049823 Bacteria 1592
1444 Ga0501044_0313976 3300049823 Bacteria 1493
1445 Ga0501044_0423901 3300049823 Bacteria 1240
1446 Ga0501044_0668268 3300049823 Bacteria 926
1447 nmdc:mga03683_118016_c1 3300050489 Bacteria 1177
1448 nmdc:mga03683_43980_c1 3300050489 Bacteria 1844
1449 nmdc:mga03683_9417_c2 3300050489 Bacteria 2323
1450 nmdc:mga03n38_107513_c1 3300050490 Bacteria 1354
1451 nmdc:mga03n38_124019_c1 3300050490 Bacteria 1273
1452 nmdc:mga03n38_1251_c1 3300050490 Bacteria 7145
1453 nmdc:mga03n38_2538_c1 3300050490 Bacteria 5665
1454 nmdc:mga03n38_73656_c1 3300050490 Bacteria 1586
1455 nmdc:mga00v17_15267_c1 3300050491 Bacteria 4308
1456 nmdc:mga00v17_18256_c1 3300050491 Bacteria 2428
1457 nmdc:mga00v17_19009_c1 3300050491 Bacteria 3914
1458 nmdc:mga00v17_375472_c1 3300050491 Bacteria 924
1459 nmdc:mga0yw44_140517_c1 3300050492 Bacteria 1569
1460 nmdc:mga0yw44_152810_c1 3300050492 Bacteria 1507
1461 nmdc:mga0yw44_20636_c1 3300050492 Bacteria 3661
1462 nmdc:mga0yw44_235615_c1 3300050492 Bacteria 1216
1463 nmdc:mga0yw44_2638_c1 3300050492 Bacteria 7724
1464 nmdc:mga0yw44_338082_c1 3300050492 Bacteria 1012
1465 nmdc:mga0yw44_387333_c1 3300050492 Bacteria 944
1466 nmdc:mga0yw44_4136_c1 3300050492 Bacteria 6589
1467 nmdc:mga0k408_105305_c1 3300050493 Bacteria 1665
1468 nmdc:mga0k408_126963_c1 3300050493 Bacteria 1513
1469 nmdc:mga0k408_42070_c1 3300050493 Bacteria 2632
1470 nmdc:mga0k408_76158_c1 3300050493 Bacteria 1961
1471 nmdc:mga06z11_110192_c1 3300050494 Bacteria 1523
1472 nmdc:mga06z11_143381_c1 3300050494 Bacteria 1352
1473 nmdc:mga06z11_88873_c1 3300050494 Bacteria 1674
1474 nmdc:mga04h51_4594_c1 3300050495 Bacteria 3452
1475 nmdc:mga04h51_50591_c1 3300050495 Bacteria 1393
1476 nmdc:mga07m45_145085_c1 3300050496 Bacteria 1376
1477 nmdc:mga07m45_23218_c2 3300050496 Bacteria 3062
1478 nmdc:mga07m45_278714_c1 3300050496 Bacteria 973
1479 nmdc:mga07m45_71999_c1 3300050496 Bacteria 1967
1480 nmdc:mga0qj67_35930_c1 3300050509 Bacteria 3875
1481 nmdc:mga0qj67_384036_c1 3300050509 Bacteria 1134
1482 nmdc:mga06r32_139219_c1 3300050510 Bacteria 2403
1483 nmdc:mga0n895_33749_c1 3300050512 Bacteria 4919
1484 nmdc:mga0n895_55593_c1 3300050512 Bacteria 3895
1485 nmdc:mga0n895_59184_c1 3300050512 Bacteria 3780
1486 nmdc:mga0rr50_357987_c1 3300050513 Bacteria 1228
1487 nmdc:mga0sz30_44073_c1 3300050516 Bacteria 1879
1488 nmdc:mga0sz30_6129_c1 3300050516 Bacteria 4451
1489 Ga0495601_0049033 3300053077 Bacteria 2661
1490 Ga0495601_0128447 3300053077 Bacteria 1650
1491 Ga0495601_0280710 3300053077 Bacteria 1086
1492 Ga0495601_0309266 3300053077 Bacteria 1029
1493 Ga0495612_0026224 3300053078 Bacteria 2342
1494 Ga0495612_0132654 3300053078 Bacteria 1077
1495 Ga0500635_0001019 3300053080 Bacteria 6708
1496 Ga0500635_0001112 3300053080 Bacteria 6426
1497 Ga0495619_0018218 3300053085 Bacteria 4453
1498 Ga0495619_0164486 3300053085 Bacteria 1533
1499 Ga0495619_0450951 3300053085 Bacteria 887
1500 Ga0500578_0117180 3300053086 Bacteria 1676
1501 Ga0500578_0211209 3300053086 Bacteria 1184
1502 Ga0500643_000112 3300053087 Bacteria 84793
1503 Ga0500581_019218 3300053089 Bacteria 3444
1504 Ga0500646_0014413 3300053090 Bacteria 2052
1505 Ga0500647_0034776 3300053091 Bacteria 2407
1506 Ga0500647_0043672 3300053091 Bacteria 2151
1507 Ga0500583_0197130 3300053092 Bacteria 1001
1508 Ga0500651_0013790 3300053093 Bacteria 4932
1509 Ga0500651_0076655 3300053093 Bacteria 2076
1510 Ga0500651_0096067 3300053093 Bacteria 1821
1511 Ga0500566_0001605 3300053094 Bacteria 13308
1512 Ga0500566_0002244 3300053094 Bacteria 11418
1513 Ga0500566_0003837 3300053094 Bacteria 8959
1514 Ga0500566_0023627 3300053094 Bacteria 3609
1515 Ga0500640_003743 3300053095 Bacteria 5388
1516 Ga0500640_043327 3300053095 Bacteria 1976
1517 Ga0500641_0007867 3300053096 Bacteria 3801
1518 Ga0500641_0028023 3300053096 Bacteria 2197
1519 Ga0500641_0077090 3300053096 Bacteria 1410
1520 Ga0500641_0100679 3300053096 Bacteria 1239
1521 Ga0500648_141887 3300053097 Bacteria 1289
1522 Ga0500650_0026074 3300053098 Bacteria 2619
1523 Ga0500650_0111933 3300053098 Bacteria 1274
1524 Ga0500554_067508 3300053102 Bacteria 1158
1525 Ga0500555_026873 3300053103 Bacteria 1643
1526 Ga0500556_0000006 3300053104 Bacteria 453982
1527 Ga0500556_0000068 3300053104 Bacteria 103123
1528 Ga0500557_000021 3300053105 Bacteria 89662
1529 Ga0500558_079488 3300053106 Bacteria 1339
1530 Ga0500562_032400 3300053108 Bacteria 1379
1531 Ga0500562_036162 3300053108 Bacteria 1309
1532 Ga0500562_068551 3300053108 Bacteria 956
1533 Ga0500569_028550 3300053109 Bacteria 1547
1534 Ga0500572_002049 3300053111 Bacteria 5008
1535 Ga0500572_016650 3300053111 Bacteria 1876
1536 Ga0500591_068096 3300053115 Bacteria 1621
1537 Ga0500592_000490 3300053116 Bacteria 6558
1538 Ga0500594_0015285 3300053118 Bacteria 1850
1539 Ga0500594_0038557 3300053118 Bacteria 1295
1540 Ga0500594_0043459 3300053118 Bacteria 1239
1541 Ga0500595_003616 3300053119 Bacteria 7168
1542 Ga0500595_009845 3300053119 Bacteria 3836
1543 Ga0500595_020341 3300053119 Bacteria 2391
1544 Ga0500595_021228 3300053119 Bacteria 2321
1545 Ga0500595_023440 3300053119 Bacteria 2169
1546 Ga0500595_043599 3300053119 Bacteria 1427
1547 Ga0500595_068784 3300053119 Bacteria 1054
1548 Ga0500607_052394 3300053121 Bacteria 2166
1549 Ga0500608_000852 3300053122 Bacteria 11037
1550 Ga0500608_087150 3300053122 Bacteria 1465
1551 Ga0500608_183439 3300053122 Bacteria 883
1552 Ga0500614_050622 3300053123 Bacteria 1089
1553 Ga0500618_008819 3300053125 Bacteria 2787
1554 Ga0500642_0000004 3300053130 Bacteria 433122
1555 Ga0500642_0000362 3300053130 Bacteria 15284
1556 Ga0500642_0006861 3300053130 Bacteria 3785
1557 Ga0500652_000342 3300053131 Bacteria 16756
1558 Ga0500655_022733 3300053133 Bacteria 1181
1559 Ga0500559_0002074 3300053136 Bacteria 10720
1560 Ga0500559_0007492 3300053136 Bacteria 4829
1561 Ga0500559_0026405 3300053136 Bacteria 2473
1562 Ga0500559_0045996 3300053136 Bacteria 1912
1563 Ga0500559_0079650 3300053136 Bacteria 1487
1564 Ga0500559_0204801 3300053136 Bacteria 930
1565 Ga0500559_0236854 3300053136 Bacteria 860
1566 Ga0500561_0047971 3300053137 Bacteria 1155
1567 Ga0500568_0006964 3300053139 Bacteria 5604
1568 Ga0500568_0011399 3300053139 Bacteria 4130
1569 Ga0500568_0013697 3300053139 Bacteria 3687
1570 Ga0500568_0015941 3300053139 Bacteria 3352
1571 Ga0500573_0007614 3300053140 Bacteria 5917
1572 Ga0500577_0001442 3300053142 Bacteria 6084
1573 Ga0500586_000200 3300053145 Bacteria 11589
1574 Ga0500588_0013721 3300053146 Bacteria 2038
1575 Ga0500588_0034702 3300053146 Bacteria 1479
1576 Ga0500588_0067142 3300053146 Bacteria 1166
1577 Ga0500589_074989 3300053147 Bacteria 1522
1578 Ga0500590_049874 3300053148 Bacteria 2130
1579 Ga0500603_002052 3300053150 Bacteria 4448
1580 Ga0500603_003463 3300053150 Bacteria 3386
1581 Ga0500604_0119111 3300053151 Bacteria 882
1582 Ga0500604_0152707 3300053151 Bacteria 784
1583 Ga0500616_0000022 3300053153 Bacteria 460463
1584 Ga0500616_0060673 3300053153 Bacteria 1960
1585 Ga0500616_0125865 3300053153 Bacteria 1217
1586 Ga0500619_089556 3300053154 Bacteria 1039
1587 Ga0500622_0002538 3300053156 Bacteria 13099
1588 Ga0500622_0005248 3300053156 Bacteria 7825
1589 Ga0500627_0031943 3300053158 Bacteria 2215
1590 Ga0500627_0092111 3300053158 Bacteria 1357
1591 Ga0500630_021324 3300053159 Bacteria 3201
1592 Ga0500633_0079526 3300053160 Bacteria 1184
1593 Ga0500634_0037765 3300053161 Bacteria 2626
1594 Ga0500634_0144020 3300053161 Bacteria 1124
1595 Ga0500638_054063 3300053162 Bacteria 1937
1596 Ga0500638_084193 3300053162 Bacteria 1506
1597 Ga0500638_087400 3300053162 Bacteria 1472
1598 Ga0500639_004505 3300053163 Bacteria 7083
1599 Ga0500639_140306 3300053163 Bacteria 1131
1600 Ga0500639_161158 3300053163 Bacteria 1020
1601 Ga0500636_0000834 3300053177 Bacteria 16602
1602 Ga0500636_0037800 3300053177 Bacteria 2855
1603 Ga0500636_0044447 3300053177 Bacteria 2619
1604 Ga0500636_0055552 3300053177 Bacteria 2320
1605 Ga0500636_0070418 3300053177 Bacteria 2029
1606 Ga0500636_0152749 3300053177 Bacteria 1266
1607 Ga0500637_0000585 3300053178 Bacteria 14328
1608 Ga0500637_0003666 3300053178 Bacteria 7146
1609 Ga0500637_0045191 3300053178 Bacteria 2497
1610 Ga0500637_0051363 3300053178 Bacteria 2349
1611 Ga0500637_0059418 3300053178 Bacteria 2189
1612 Ga0500576_131296 3300053725 Bacteria 969
1613 Ga0500625_123222 3300053729 Bacteria 1036
1614 Ga0500645_020104 3300053730 Bacteria 2071
1615 Ga0500645_023572 3300053730 Bacteria 1886
1616 Ga0500596_003436 3300053735 Bacteria 3013
1617 Ga0500596_004728 3300053735 Bacteria 2471
1618 Ga0500601_000419 3300053737 Bacteria 7101
1619 Ga0500601_008099 3300053737 Bacteria 1167
1620 Ga0501084_0443335 3300054114 Bacteria 1098
1621 Ga0500661_001372 3300055283 Bacteria 4539
1622 Ga0500661_024396 3300055283 Bacteria 1069
1623 Ga0501082_0072371 3300060353 Bacteria 2969
1624 Ga0501082_0134170 3300060353 Bacteria 2148
1625 Ga0501082_0581604 3300060353 Bacteria 980
1626 Ga0466962_0015531 3300061719 Bacteria 3673
1627 Ga0530510_0524100 3300061734 Bacteria 899
1628 2507505454 2507262055 Bacteria 8048963
1629 2508539339 2508501009 Bacteria 7784016
1630 2508695668 2508501042 Bacteria 8719808
1631 2509152183 2508501128 Bacteria 8613869
1632 2511395680 2511231028 Bacteria 8046582
1633 2513623922 2513237092 Bacteria 8341956
1634 2513642196 2513237094 Bacteria 8789602
1635 2513651330 2513237095 Bacteria 8976980
1636 2513659513 2513237096 Bacteria 8722461
1637 2513676319 2513237098 Bacteria 9902361
1638 2513695291 2513237101 Bacteria 7952346
1639 2513700715 2513237102 Bacteria 7703324
1640 2513718244 2513237104 Bacteria 10034502
1641 2513859380 2513237137 Bacteria 9558895
1642 2513873343 2513237139 Bacteria 8737671
1643 2513888576 2513237141 Bacteria 8496279
1644 2513921554 2513237145 Bacteria 8979722
1645 2513998566 2513237159 Bacteria 6810126
1646 2514014673 2513237161 Bacteria 8871253
1647 2515627649 2515154112 Bacteria 8294334
1648 2517106276 2517093001 Bacteria 9002274
1649 2517889054 2517572143 Bacteria 9484767
1650 2524441445 2524023205 Bacteria 8918781
1651 2524458386 2524023209 Bacteria 6679728
1652 2524467223 2524023210 Bacteria 9029266
1653 2524537489 2524023228 Bacteria 10118060
1654 2528853314 2528768022 Bacteria 10457665
1655 2545678091 2545555834 Bacteria 8130841
1656 2585280649 2582581308 Bacteria 7413247
1657 2585326435 2582581315 Bacteria 7318924
1658 2585395986 2582581866 Bacteria 6859583
1659 2585531583 2585427527 Bacteria 7273426
1660 2585551470 2585427530 Bacteria 7383882
1661 2603858613 2602042107 Bacteria 6226103
1662 2616306806 2615840626 Bacteria 7921970
1663 2616557657 2615840698 Bacteria 7319877
1664 2617352057 2617270735 Bacteria 9163226
1665 2617373525 2617270741 Bacteria 8201522
1666 2617383325 2617270742 Bacteria 6808054
1667 2644291742 2643221651 Bacteria 4798932
1668 2671124043 2667528175 Bacteria 7532676
1669 2723841825 2721755755 Bacteria 8322773
1670 2728748428 2728368998 Bacteria 8720350
1671 2745077579 2744054633 Bacteria 8678936
1672 2778173676 2775507266 Bacteria 7392367
1673 2793062241 2791355196 Bacteria 7323613
1674 2793072707 2791355197 Bacteria 8420563
1675 2793078301
1676 2805920691 2802429603 Bacteria 8777136
1677 2818237860 2816332527 Bacteria 8933356
1678 2819244737 2818991272 Bacteria 4622173
1679 2819611167 2818991448 Bacteria 6772224
1680 2819638900 2818991453 Bacteria 7181617
1681 2824604419 2824600985 Bacteria 8488197
1682 2824614851 2824609381 Bacteria 8672835
1683 2824624168 2824617872 Bacteria 8814715
1684 2824632848 2824626560 Bacteria 8813858
1685 2824643753 2824635225 Bacteria 8785348
1686 2824652408 2824644064 Bacteria 8743947
1687 2824656297 2824653114 Bacteria 8493680
1688 2824669887 2824661429 Bacteria 9877870
1689 2824671753 2824671348 Bacteria 8369588
1690 2824684804 2824679649 Bacteria 8248951
1691 2824695782 2824687955 Bacteria 8360029
1692 2824701663 2824696289 Bacteria 8335049
1693 2824710871 2824704595 Bacteria 9667483
1694 2824722892 2824714736 Bacteria 8717648
1695 2824729494 2824723954 Bacteria 8758240
1696 2824740221 2824732956 Bacteria 7810675
1697 2824751144 2824746037 Bacteria 7911610
1698 2824760654 2824753945 Bacteria 9787441
1699 2824768458 2824763712 Bacteria 9792355
1700 2824781372 2824773399 Bacteria 8360218
1701 2838030858 2838029111 Bacteria 6603031
1702 2838124703 2838122688 Bacteria 8803140
1703 2841945394 2841941048 Bacteria 8688029
1704 2841952180 2841949485 Bacteria 8680857
1705 2841965342 2841957949 Bacteria 8652217
1706 2841970433 2841966195 Bacteria 8673214
1707 2841981681 2841974524 Bacteria 8931498
1708 2841984961 2841983080 Bacteria 8395090
1709 2842043316 2842038055 Bacteria 8002051
1710 2842052694 2842045827 Bacteria 8006841
1711 2842300358 2842298080 Bacteria 6123127
1712 2842361125 2842357229 Bacteria 6485165
1713 2842477590 2842475841 Bacteria 6603183
1714 2842487970 2842482326 Bacteria 7212537
1715 2842504537 2842502639 Bacteria 6604161
1716 2842511787 2842509118 Bacteria 6850950
1717 2842524403 2842521101 Bacteria 6569494
1718 2844315549 2844315083 Bacteria 8138177
1719 2847931252 2847930680 Bacteria 9342022
1720 2847942345 2847939898 Bacteria 8606328
1721 2849083217 2849076700 Bacteria 7039503
1722 2852391620 2852387548 Bacteria 8025568
1723 2857516350 2857509624 Bacteria 7472071
1724 2857526262 2857524615 Bacteria 6615449
1725 2874592545 2874590934 Bacteria 8299676
1726 2874607882 2874604998 Bacteria 7834745
1727 2874617976 2874612657 Bacteria 8252029
1728 2874621199 2874620515 Bacteria 8290088
1729 2874628598 2874628541 Bacteria 8630250
1730 2874647164 2874645413 Bacteria 8214782
1731 2876769645 2876761206 Bacteria 10111113
1732 2876772548 2876771140 Bacteria 8287509
1733 2876819809 2876818435 Bacteria 8274608
1734 2879076315 2879074833 Bacteria 8279565
1735 2879083774 2879083081 Bacteria 8587928
1736 2879100443 2879099564 Bacteria 10442239
1737 2879113309 2879110137 Bacteria 8907982
1738 2879128799 2879127579 Bacteria 8294491
1739 2879143620 2879142872 Bacteria 8267021
1740 2881368930 2881364244 Bacteria 7710352
1741 2881673213 2881665667 Bacteria 8175609
1742 2885369331 2885366525 Bacteria 8326213
1743 2885377558 2885374607 Bacteria 8927485
1744 2885386722 2885383462 Bacteria 9473874
1745 2885415194 2885409591 Bacteria 9235467
1746 2888390497 2888388044 Bacteria 7304136
1747 2888420118 2888419890 Bacteria 7857137
1748 2889035298 2889033259 Bacteria 9099371
1749 2893067466 2893066018 Bacteria 6158120
1750 2903733542 2903727486 Bacteria 8281579
1751 2903758793 2903748898 Bacteria 9972761
1752 2903777915 2903768456 Bacteria 9749579
1753 2904667744 2904666416 Bacteria 8226587
1754 2904691001 2904690495 Bacteria 9412302
1755 2904708398
1756 2904716326 2904711408 Bacteria 9771557
1757 2906608896 2906602504 Bacteria 8295279
1758 2906613570
1759 2906631672 2906626472 Bacteria 8826946
1760 2906636574 2906635258 Bacteria 8601019
1761 2906648338 2906643746 Bacteria 8722424
1762 2906668104 2906660503 Bacteria 8595048
1763 2908747657 2908739725 Bacteria 8628932
1764 2908757059 2908756301 Bacteria 8864324
1765 2908775996 2908775508 Bacteria 8092255
1766 2919073885 2919073203 Bacteria 6531949
1767 2919453274 2919450847 Bacteria 5631160
1768 2922363211 2922361189 Bacteria 7436256
1769 2922369384
1770 2922388484 2922386360 Bacteria 7017218
1771 2922396580 2922393267 Bacteria 8285685
1772 2922434007
1773 2929618787 2929615660 Bacteria 9193770
1774 2929628528 2929624759 Bacteria 9339455
1775 2932790969 2932784394 Bacteria 9704911
1776 2932794138 2932794094 Bacteria 7915132
1777 2932809214 2932801729 Bacteria 7987968
1778 2932811977 2932809354 Bacteria 9135765
1779 2932825572 2932818245 Bacteria 9955613
1780 2932833685 2932828146 Bacteria 9745859
1781 2933580503 2933577622 Bacteria 9116884
1782 2935615516 2935608549 Bacteria 8203142
1783 2935623211 2935616580 Bacteria 9032984
1784 2935636034 2935630451 Bacteria 8169952
1785 2935644286 2935638405 Bacteria 10015038
1786 2935654445 2935648319 Bacteria 8801166
1787 2935663325 2935656913 Bacteria 8965014
1788 2935672132 2935665750 Bacteria 9571747
1789 2935679348 2935675223 Bacteria 9928132
1790 2935686590 2935684952 Bacteria 9590419
1791 2935700371 2935694250 Bacteria 9291695
1792 2935710319 2935703347 Bacteria 10242284
1793 2935716278 2935713505 Bacteria 9608509
1794 2935723598 2935722832 Bacteria 9608746
1795 2935735153 2935732158 Bacteria 9706831
1796 2935744056 2935741537 Bacteria 9707219
1797 2935752556 2935750917 Bacteria 9590372
1798 2935763311 2935760218 Bacteria 9817913
1799 2935774284 2935769743 Bacteria 7878163
1800 2935783350 2935777560 Bacteria 8077691
1801 2935789001 2935785616 Bacteria 7962367
1802 2935796751 2935793552 Bacteria 8012592
1803 2935808310 2935801545 Bacteria 9301974
1804 2935816076 2935810662 Bacteria 9401221
1805 2935825683 2935819856 Bacteria 8261050
1806 2935833470 2935827899 Bacteria 10038562
1807 2935845972 2935837841 Bacteria 9454360
1808 2935853447 2935847175 Bacteria 8228321
1809 2935861459 2935855204 Bacteria 9035059
1810 2935869578 2935864058 Bacteria 9784707
1811 2935879907 2935873716 Bacteria 9632195
1812 2935889165 2935883170 Bacteria 7964738
1813 2935915049 2935908558 Bacteria 8568796
1814 2935918897 2935916978 Bacteria 9113783
1815 2935931386 2935926038 Bacteria 8601059
1816 2935939983 2935934488 Bacteria 8602579
1817 2935947670 2935942939 Bacteria 8599779
1818 2935956441 2935951376 Bacteria 8602333
1819 2935966713 2935959822 Bacteria 7869783
1820 2935973235 2935967501 Bacteria 8603075
1821 2935980522 2935975950 Bacteria 8347125
1822 2935990128 2935984226 Bacteria 8302647
1823 2935997870 2935992306 Bacteria 9802711
1824 2936008865 2936002035 Bacteria 9362176
1825 2936017516 2936011229 Bacteria 8801034
1826 2936025983 2936019824 Bacteria 8804134
1827 2936034825 2936028420 Bacteria 8965941
1828 2936041081 2936037263 Bacteria 9446081
1829 2936052917 2936046547 Bacteria 8903709
1830 2936060224 2936055302 Bacteria 8785755
1831 2940558469 2940556831 Bacteria 9590747
1832 2941512662 2941507105 Bacteria 8166816
1833 2941520500 2941515067 Bacteria 8166720
1834 2941528514 2941523033 Bacteria 8169134
1835 2941535339 2941531003 Bacteria 7653939
1836 2941547141 2941538514 Bacteria 9402094
1837 2977865575 2977864932 Bacteria 7534097
1838 3005421699 3005416602 Bacteria 7064308
1839 3005475278 3005474847 Bacteria 9259049
1840 3005486670 3005483717 Bacteria 7877331
1841 3005508976 3005506211 Bacteria 6943378
1842 3005594141 3005587118 Bacteria 7794411
1843 3005595239 3005594810 Bacteria 8716512
1844 3005711182 3005710791 Bacteria 7622528
1845 3005718477 3005718088 Bacteria 8283608
1846 641642395 641522639 Bacteria 7737025
1847 8001847186 8001845381 Bacteria 5804942
1848 8003017859 8003014200 Bacteria 4059994
1849 8005319597 8005314921 Bacteria 7072929
1850 8005490220 8005484373 Bacteria 6297373
1851 8005646877 8005645114 Bacteria 6950293
1852 8005688062 8005682033 Bacteria 6726518
1853 8006927252 8006926726 Bacteria 6749210
1854 8006935999 8006933436 Bacteria 10410654
1855 8006975877 8006973647 Bacteria 10679141
1856 8006991110 8006984368 Bacteria 9651211
1857 8007000439 8006994254 Bacteria 8309700
1858 8016517987 8016511872 Bacteria 9921665
1859 8016526332 8016522445 Bacteria 8156687
1860 8016531396 8016530956 Bacteria 8155261
1861 8016544608 8016539877 Bacteria 8155419
1862 8016557466 8016548790 Bacteria 8155074
1863 8016565824 8016557553 Bacteria 8154380
1864 8016569663 8016566248 Bacteria 8158151
1865 8016582270 8016575299 Bacteria 8154085
1866 8016586145 8016583857 Bacteria 10421953
1867 8016603424 8016595262 Bacteria 8149947
1868 8016606359 8016603502 Bacteria 8731218
1869 8016618266 8016613128 Bacteria 8794220
1870 8016622917 8016622563 Bacteria 7999408
1871 8016635421 8016630954 Bacteria 9217207
1872 8017058653 8017057580 Bacteria 10023680
1873 8019531229 8019530166 Bacteria 8155624
1874 8019540323 8019538911 Bacteria 7872763
1875 8019549915 8019547302 Bacteria 7996444
1876 8019562658 8019555841 Bacteria 9642137
1877 8019572735 8019565922 Bacteria 9639779
1878 8019577004 8019576017 Bacteria 10049540
1879 8019595071 8019586578 Bacteria 10212056
1880 8019606673 8019597564 Bacteria 10041141
1881 8019611840 8019608314 Bacteria 10042931
1882 8019623167 8019619141 Bacteria 9218857
1883 8019629931 8019629233 Bacteria 8687553
1884 8019640675 8019638758 Bacteria 9062356
1885 8019652278 8019648815 Bacteria 10014479
1886 8019666768 8019659431 Bacteria 8577854
1887 8019676528 8019668869 Bacteria 8791617
1888 8019679460 8019678201 Bacteria 8863603
1889 8019696043 8019687851 Bacteria 8712826
1890 8024490777 8024486573 Bacteria 6540512
1891 8055742636 8055742211 Bacteria 9226248
1892 8056676145 8056673599 Bacteria 7871253
1893 8056682944 8056681323 Bacteria 8472857
1894 8056693785 8056689827 Bacteria 6712655
1895 8056971497 8056967851 Bacteria 9038162
1896 8057581535 8057575449 Bacteria 7367519
1897 JGI25404J52841_10020694
1898 JGI25155J39150_1000010
1899 JGI25156J39149_1000033
1900 JGI25156J39149_1000461
1901 JGI25156J39149_1000930
1902 JGI25162J39368_1000607
1903 JGI25154J39366_1000058
1904 JGI25154J39366_1000761
1905 JGI25154J39366_1002142
1906 JGI25157J39369_1000009
1907 JGI25157J39369_1000045
1908 JGI25159J45721_1001420
1909 JGI25406J46586_10000881
1910 JGI25406J46586_10009349
1911 JGI25165J46597_1001489
1912 JGI25165J46597_1002089
1913 JGI25153J46596_10005387
1914 JGI25153J46596_10006271
1915 JGI25153J46596_10006385
1916 JGI25153J46596_10011204
1917 JGI25153J46596_10014578
1918 JGI25153J46596_10052728
1919 JGI25153J46596_10055018
1920 rootL2_10022138
1921 JGI25160J50197_1000402
1922 JGI25160J50197_1005378
1923 JGI25160J50197_1031032
1924 JGI25161J50226_1000324
1925 JGI25404J52841_10000873
1926 JGI25404J52841_10025159
1927 Ga0055539_1004125
1928 Ga0055542_1006050
1929 Ga0055526_1021210
1930 Ga0055524_1015899
1931 Ga0055524_1016642
1932 Ga0055536_1000652
1933 Ga0055536_1014230
1934 Ga0055530_10000735
1935 Ga0055531_10004632
1936 Ga0055531_10021366
1937 Ga0055531_10034300
1938 Ga0055543_1000099
1939 Ga0055543_1011753
1940 Ga0065165_1001848
1941 Ga0065165_1003775
1942 Ga0065165_1003886
1943 Ga0065165_1025064
1944 Ga0070658_10012453
1945 Ga0070658_10207299
1946 Ga0070658_10298078
1947 Ga0070658_10505911
1948 Ga0070683_100006653
1949 Ga0070683_100135402
1950 Ga0070683_100494235
1951 Ga0070683_100769576
1952 Ga0070690_100087960
1953 Ga0070677_10027314
1954 Ga0068869_100031930
1955 Ga0068869_100065052
1956 Ga0068869_100234518
1957 Ga0068869_100434449
1958 Ga0068869_100702473
1959 Ga0070680_100041662
1960 Ga0070680_100044841
1961 Ga0070680_100343000
1962 Ga0070680_100590832
1963 Ga0068868_100048998
1964 Ga0070660_100037559
1965 Ga0070660_100483715
1966 Ga0070691_10220480
1967 Ga0070668_100052173
1968 Ga0070668_100140537
1969 Ga0070668_100382903
1970 Ga0070668_100485257
1971 Ga0070668_100823275
1972 Ga0070669_100196450
1973 Ga0070669_100346758
1974 Ga0070669_100391208
1975 Ga0070671_100198173
1976 Ga0070671_100236190
1977 Ga0070671_100450287
1978 Ga0070671_100469477
1979 Ga0070673_100136304
1980 Ga0070673_100535313
1981 Ga0070688_100151913
1982 Ga0070688_100263101
1983 Ga0070659_100338838
1984 Ga0070659_100368734
1985 Ga0070659_100428373
1986 Ga0070659_100598793
1987 Ga0070667_100573038
1988 Ga0070709_10000164
1989 Ga0070709_10017700
1990 Ga0070709_10055190
1991 Ga0070709_10086525
1992 Ga0070714_100030119
1993 Ga0070714_100062614
1994 Ga0070714_100104098
1995 Ga0070714_100117957
1996 Ga0070714_100123063
1997 Ga0070714_100249189
1998 Ga0070713_100004014
1999 Ga0070713_100029341
2000 Ga0070713_100054336
2001 Ga0070713_100081484
2002 Ga0070713_100131019
2003 Ga0070713_100205029
2004 Ga0070710_10000283
2005 Ga0070710_10053256
2006 Ga0070710_10069267
2007 Ga0070701_10240533
2008 Ga0070711_100005189
2009 Ga0070711_100013134
2010 Ga0070711_100025376
2011 Ga0070711_100089685
2012 Ga0070711_100165225
2013 Ga0070711_100179445
2014 Ga0070700_100044957
2015 Ga0070708_100066262
2016 Ga0070708_100096501
2017 Ga0070663_100041632
2018 Ga0070663_100139944
2019 Ga0070663_100147094
2020 Ga0070663_100212729
2021 Ga0070663_100274288
2022 Ga0070663_100296625
2023 Ga0070663_100393317
2024 Ga0070678_100092031
2025 Ga0070678_100137508
2026 Ga0070678_100256558
2027 Ga0070678_100373035
2028 Ga0070662_100183639
2029 Ga0070662_100515585
2030 Ga0070662_100687996
2031 Ga0070681_10017254
2032 Ga0070681_10093484
2033 Ga0070681_10094766
2034 Ga0070681_10299056
2035 Ga0070681_10374239
2036 Ga0070681_10505724
2037 Ga0068867_100000132
2038 Ga0068867_100181797
2039 Ga0068867_100229924
2040 Ga0070685_10285882
2041 Ga0070706_100277642
2042 Ga0070706_100520330
2043 Ga0070707_100028781
2044 Ga0070679_100023030
2045 Ga0070679_100216359
2046 Ga0070679_100251738
2047 Ga0070679_100262151
2048 Ga0070679_100496499
2049 Ga0070684_100006976
2050 Ga0070684_100026892
2051 Ga0070684_100185707
2052 Ga0068853_100000920
2053 Ga0068853_100070306
2054 Ga0068853_100311796
2055 Ga0068853_100637155
2056 Ga0068853_100661748
2057 Ga0070672_100500904
2058 Ga0070693_100144964
2059 Ga0070693_100580223
2060 Ga0070665_100024388
2061 Ga0070665_100101283
2062 Ga0070665_100211868
2063 Ga0070665_100270689
2064 Ga0070665_100308556
2065 Ga0070665_100346113
2066 Ga0070665_100422675
2067 Ga0070665_100545562
2068 Ga0070665_100592664
2069 Ga0068855_100028007
2070 Ga0068855_100098102
2071 Ga0068855_100105596
2072 Ga0068855_100233801
2073 Ga0068855_100298791
2074 Ga0068855_100455996
2075 Ga0068855_100674179
2076 Ga0068857_100028526
2077 Ga0068857_100035276
2078 Ga0068857_100208760
2079 Ga0068857_100311339
2080 Ga0068854_100062569
2081 Ga0068854_100092598
2082 Ga0068854_100191523
2083 Ga0068854_100255310
2084 Ga0068854_100431450
2085 Ga0068856_100004492
2086 Ga0068856_100292845
2087 Ga0068856_100349754
2088 Ga0068856_100363149
2089 Ga0068856_100822091
2090 Ga0068852_100010275
2091 Ga0068852_100040281
2092 Ga0068852_100098915
2093 Ga0068852_100125731
2094 Ga0068852_100225110
2095 Ga0068852_100311084
2096 Ga0068852_100413880
2097 Ga0068852_100434126
2098 Ga0068852_100508440
2099 Ga0068859_100258476
2100 Ga0068859_100681946
2101 Ga0068864_100514833
2102 Ga0068866_10041018
2103 Ga0068861_100050132
2104 Ga0068861_100074402
2105 Ga0068861_100147213
2106 Ga0068861_100315152
2107 Ga0068851_10168405
2108 Ga0068863_100293033
2109 Ga0068858_100147750
2110 Ga0068858_100555483
2111 Ga0068858_100592646
2112 Ga0068858_100897382
2113 Ga0068860_100017741
2114 Ga0068860_100057499
2115 Ga0068860_100097070
2116 Ga0068862_100107085
2117 Ga0068862_100170312
2118 Ga0068862_100339805
2119 Ga0068862_100635015
2120 Ga0068862_100753490
2121 Ga0081455_10016293
2122 Ga0081455_10027264
2123 Ga0081455_10089378
2124 Ga0081455_10141870
2125 Ga0081455_10338688
2126 Ga0081540_1002717
2127 Ga0081540_1003025
2128 Ga0081540_1004243
2129 Ga0081540_1004583
2130 Ga0081540_1005857
2131 Ga0081540_1014469
2132 Ga0081540_1018885
2133 Ga0081540_1115847
2134 Ga0081539_10000048
2135 Ga0081539_10000371
2136 Ga0081539_10027283
2137 Ga0081539_10039012
2138 Ga0070717_10038762
2139 Ga0070717_10304845
2140 Ga0075365_10004924
2141 Ga0075365_10007177
2142 Ga0075365_10130855
2143 Ga0075365_10162096
2144 Ga0075365_10173348
2145 Ga0075365_10282347
2146 Ga0075365_10286354
2147 Ga0075365_10355630
2148 Ga0075365_10398776
2149 Ga0075368_10007084
2150 Ga0075368_10057299
2151 Ga0075363_100000382
2152 Ga0075363_100005846
2153 Ga0075363_100009480
2154 Ga0075363_100126110
2155 Ga0075364_10000195
2156 Ga0075364_10049442
2157 Ga0075364_10086211
2158 Ga0075364_10150150
2159 Ga0075364_10162804
2160 Ga0075364_10174044
2161 Ga0075364_10335348
2162 Ga0070716_100008198
2163 Ga0070716_100009333
2164 Ga0070716_100032839
2165 Ga0070716_100199137
2166 Ga0070712_100023970
2167 Ga0070712_100027147
2168 Ga0070712_100096550
2169 Ga0075362_10035287
2170 Ga0075367_10080527
2171 Ga0075367_10097099
2172 Ga0075367_10171907
2173 Ga0075367_10177025
2174 Ga0075367_10298190
2175 Ga0075367_10312096
2176 Ga0075367_10431034
2177 Ga0075369_10038939
2178 Ga0075369_10118264
2179 Ga0075366_10012656
2180 Ga0075366_10055656
2181 Ga0075366_10179064
2182 Ga0097621_100021414
2183 Ga0097621_100338574
2184 Ga0097621_100397341
2185 Ga0075370_10018863
2186 Ga0075370_10059152
2187 Ga0075370_10181566
2188 Ga0068871_100040788
2189 Ga0068871_100048194
2190 Ga0068871_100562738
2191 Ga0075428_100438771
2192 Ga0075430_100026357
2193 Ga0075430_100105658
2194 Ga0075431_100428391
2195 Ga0075434_100047268
2196 Ga0075434_100459994
2197 Ga0068865_100178984
2198 Ga0068865_100179000
2199 Ga0068865_100269681
2200 Ga0097620_100258488
2201 Ga0097620_100681901
2202 Ga0099825_1017392
2203 Ga0099824_1007180
2204 Ga0099824_1027556
2205 Ga0099822_1002271
2206 Ga0099823_1023214
2207 Ga0075435_100380488
2208 Ga0099794_10047333
2209 Ga0099795_10037802
2210 Ga0105250_10165893
2211 Ga0105240_10000013
2212 Ga0105240_10012727
2213 Ga0105240_10020094
2214 Ga0105240_10022735
2215 Ga0105240_10055770
2216 Ga0105240_10332844
2217 Ga0105240_10719140
2218 Ga0105240_10734820
2219 Ga0105245_10226247
2220 Ga0105247_10023886
2221 Ga0105247_10057618
2222 Ga0105247_10182009
2223 Ga0105247_10293768
2224 Ga0105243_10263184
2225 Ga0105243_10271879
2226 Ga0105243_10430073
2227 Ga0105243_10553103
2228 Ga0105243_10562392
2229 Ga0105241_10049205
2230 Ga0105241_10339602
2231 Ga0105241_10391324
2232 Ga0105248_10120731
2233 Ga0105248_10635602
2234 Ga0105248_10689155
2235 Ga0105248_10898060
2236 Ga0105237_10002598
2237 Ga0105237_10017536
2238 Ga0105237_10091115
2239 Ga0105237_10221142
2240 Ga0105237_10240258
2241 Ga0105237_10247679
2242 Ga0105237_10301126
2243 Ga0105237_10352310
2244 Ga0105237_10475520
2245 Ga0105237_10595280
2246 Ga0105237_10689385
2247 Ga0105238_10009549
2248 Ga0105238_10025758
2249 Ga0105238_10069644
2250 Ga0105238_10104060
2251 Ga0105238_10338890
2252 Ga0105238_10436104
2253 Ga0105238_10468490
2254 Ga0105238_10523078
2255 Ga0105249_10280767
2256 Ga0105249_10967360
2257 Ga0099796_10013549
2258 Ga0105239_10001552
2259 Ga0105239_10029609
2260 Ga0105239_10049028
2261 Ga0105239_10066302
2262 Ga0105239_10098964
2263 Ga0105239_10322873
2264 Ga0105239_10367445
2265 Ga0105239_10420512
2266 Ga0105239_10818285
2267 Ga0105239_11237692
2268 Ga0105246_10151091
2269 Ga0157373_10143046
2270 Ga0157370_10002466
2271 Ga0157370_10049322
2272 Ga0157370_10365195
2273 Ga0157370_10436693
2274 Ga0157369_10011256
2275 Ga0157369_10030438
2276 Ga0157369_10343414
2277 Ga0157369_10429996
2278 Ga0157369_10576917
2279 Ga0157369_10778104
2280 Ga0157369_10955390
2281 Ga0157374_10141827
2282 Ga0157374_10284100
2283 Ga0157374_10319696
2284 Ga0157374_10868258
2285 Ga0157378_10020915
2286 Ga0157378_10288653
2287 Ga0157378_10463998
2288 Ga0157378_10499372
2289 Ga0157378_10837462
2290 Ga0163162_10021854
2291 Ga0163162_10065364
2292 Ga0163162_10139830
2293 Ga0163162_10425837
2294 Ga0163162_10465549
2295 Ga0163162_10927317
2296 Ga0157372_10140987
2297 Ga0157375_10126812
2298 Ga0157375_10444794
2299 Ga0157375_10481067
2300 Ga0157375_10745912
2301 Ga0163163_10002309
2302 Ga0163163_10090473
2303 Ga0163163_10289488
2304 Ga0163163_10479801
2305 Ga0163163_10947428
2306 Ga0157380_10179675
2307 Ga0157380_10264590
2308 Ga0157380_10350881
2309 Ga0182008_10048597
2310 Ga0182008_10119980
2311 Ga0157377_10063879
2312 Ga0157377_10078346
2313 Ga0157379_10397168
2314 Ga0157379_10480485
2315 Ga0157379_10555022
2316 Ga0157376_10444440
2317 Ga0182007_10002170
2318 Ga0182005_1001931
2319 Ga0206356_11507318
2320 Ga0206353_10766002
2321 Ga0214544_1000665
2322 Ga0214542_1000486
2323 Ga0214545_1000307
2324 Ga0214543_1006816
2325 Ga0213873_10003722
2326 Ga0213872_10005811
2327 Ga0213874_10035729
2328 Ga0213874_10077232
2329 Ga0213874_10107495
2330 Ga0213876_10005727
2331 Ga0213876_10140100
2332 Ga0213871_10011628
2333 Ga0209435_100009
2334 Ga0209760_102134
2335 Ga0209563_102071
2336 Ga0209437_100107
2337 Ga0209258_100603
2338 Ga0209646_1000012
2339 Ga0209646_1000018
2340 Ga0209026_1000004
2341 Ga0209026_1000068
2342 Ga0209677_100543
2343 Ga0209677_102252
2344 Ga0209677_108510
2345 Ga0209148_1000295
2346 Ga0209148_1009014
2347 Ga0209148_1009972
2348 Ga0209759_1000003
2349 Ga0209759_1000007
2350 Ga0209233_1000072
2351 Ga0209233_1000331
2352 Ga0209233_1001838
2353 Ga0209233_1003799
2354 Ga0209233_1026225
2355 Ga0209455_1006515
2356 Ga0209673_1017234
2357 Ga0209130_1000132
2358 Ga0209675_1003067
2359 Ga0209675_1012970
2360 Ga0209676_1001214
2361 Ga0209676_1014191
2362 Ga0209676_1020233
2363 Ga0209025_1004676
2364 Ga0209025_1061552
2365 Ga0209564_1001079
2366 Ga0209564_1006939
2367 Ga0209564_1007238
2368 Ga0209564_1011458
2369 Ga0209758_1000069
2370 Ga0209758_1001816
2371 Ga0209758_1001900
2372 Ga0209758_1002809
2373 Ga0209758_1003717
2374 Ga0209758_1007298
2375 Ga0209758_1008809
2376 Ga0209758_1021604
2377 Ga0209758_1040930
2378 Ga0209758_1052380
2379 Ga0209758_1067323
2380 Ga0209050_1001391
2381 Ga0209256_1002256
2382 Ga0209256_1003770
2383 Ga0209256_1005844
2384 Ga0209256_1024062
2385 Ga0207426_1000246
2386 Ga0207426_1001802
2387 Ga0207426_1004864
2388 Ga0207426_1015528
2389 Ga0209051_1010403
2390 Ga0209051_1032751
2391 Ga0209257_1000861
2392 Ga0209257_1001693
2393 Ga0209257_1004375
2394 Ga0209257_1007230
2395 Ga0209257_1044554
2396 Ga0207697_10057289
2397 Ga0207656_10047104
2398 Ga0207656_10237828
2399 Ga0207696_1029161
2400 Ga0207682_10123497
2401 Ga0207692_10000528
2402 Ga0207692_10118118
2403 Ga0207692_10295086
2404 Ga0207642_10078666
2405 Ga0207710_10111278
2406 Ga0207710_10196426
2407 Ga0207647_10166237
2408 Ga0207685_10015765
2409 Ga0207699_10000514
2410 Ga0207699_10008188
2411 Ga0207699_10010527
2412 Ga0207699_10041934
2413 Ga0207699_10214747
2414 Ga0207699_10373520
2415 Ga0207645_10041038
2416 Ga0207645_10257501
2417 Ga0207643_10070380
2418 Ga0207643_10078747
2419 Ga0207643_10199373
2420 Ga0207705_10131879
2421 Ga0207684_10160331
2422 Ga0207654_10236159
2423 Ga0207707_10001310
2424 Ga0207707_10001402
2425 Ga0207707_10051217
2426 Ga0207707_10095278
2427 Ga0207707_10131454
2428 Ga0207707_10364834
2429 Ga0207695_10000044
2430 Ga0207695_10000148
2431 Ga0207695_10003993
2432 Ga0207695_10129811
2433 Ga0207695_10355538
2434 Ga0207695_10372267
2435 Ga0207671_10000226
2436 Ga0207671_10020952
2437 Ga0207671_10048383
2438 Ga0207671_10221193
2439 Ga0207671_10498463
2440 Ga0207693_10208915
2441 Ga0207693_10231153
2442 Ga0207663_10000375
2443 Ga0207663_10055118
2444 Ga0207663_10137563
2445 Ga0207663_10231549
2446 Ga0207663_10412634
2447 Ga0207660_10047438
2448 Ga0207660_10058358
2449 Ga0207660_10138790
2450 Ga0207660_10148215
2451 Ga0207660_10220462
2452 Ga0207660_10251525
2453 Ga0207662_10211110
2454 Ga0207657_10042668
2455 Ga0207657_10049757
2456 Ga0207657_10291162
2457 Ga0207657_10357314
2458 Ga0207649_10040379
2459 Ga0207649_10301725
2460 Ga0207649_10349453
2461 Ga0207652_10001370
2462 Ga0207652_10016073
2463 Ga0207652_10276187
2464 Ga0207646_10105621
2465 Ga0207681_10288869
2466 Ga0207694_10030854
2467 Ga0207694_10059035
2468 Ga0207694_10439491
2469 Ga0207694_10494651
2470 Ga0207650_10256799
2471 Ga0207687_10002193
2472 Ga0207700_10004601
2473 Ga0207700_10062122
2474 Ga0207700_10072990
2475 Ga0207700_10091578
2476 Ga0207700_10115402
2477 Ga0207700_10158564
2478 Ga0207700_10219356
2479 Ga0207664_10004078
2480 Ga0207664_10027086
2481 Ga0207664_10041295
2482 Ga0207664_10245334
2483 Ga0207644_10072932
2484 Ga0207690_10166497
2485 Ga0207690_10471515
2486 Ga0207706_10138351
2487 Ga0207709_10247931
2488 Ga0207709_10281180
2489 Ga0207669_10011353
2490 Ga0207669_10027226
2491 Ga0207669_10257188
2492 Ga0207704_10240201
2493 Ga0207665_10016516
2494 Ga0207665_10035202
2495 Ga0207665_10054050
2496 Ga0207665_10146904
2497 Ga0207665_10267605
2498 Ga0207665_10355207
2499 Ga0207691_10175248
2500 Ga0207691_10310873
2501 Ga0207711_10333200
2502 Ga0207711_10442796
2503 Ga0207689_10012963
2504 Ga0207689_10058572
2505 Ga0207689_10157738
2506 Ga0207689_10253696
2507 Ga0207689_10351545
2508 Ga0207661_10000878
2509 Ga0207661_10026373
2510 Ga0207661_10154480
2511 Ga0207661_10666776
2512 Ga0207679_10049493
2513 Ga0207667_10002941
2514 Ga0207667_10051535
2515 Ga0207667_10224638
2516 Ga0207667_10350671
2517 Ga0207667_10381571
2518 Ga0207667_10387579
2519 Ga0207651_10799949
2520 Ga0207712_10412499
2521 Ga0207668_10293540
2522 Ga0207668_10360208
2523 Ga0207668_10372735
2524 Ga0207668_10462947
2525 Ga0207640_10004118
2526 Ga0207640_10018861
2527 Ga0207640_10280025
2528 Ga0207640_10468153
2529 Ga0207640_10710820
2530 Ga0207658_10109156
2531 Ga0207658_10531026
2532 Ga0207677_10006274
2533 Ga0207677_10064251
2534 Ga0207677_10290760
2535 Ga0207677_10490919
2536 Ga0207703_10194914
2537 Ga0207703_10209416
2538 Ga0207703_10272804
2539 Ga0207703_10711359
2540 Ga0207639_10191284
2541 Ga0207639_10343545
2542 Ga0207639_10425442
2543 Ga0207639_10476951
2544 Ga0207639_10777349
2545 Ga0207678_10073898
2546 Ga0207678_10075876
2547 Ga0207678_10173331
2548 Ga0207678_10210337
2549 Ga0207678_10244235
2550 Ga0207678_10264609
2551 Ga0207678_10267737
2552 Ga0207678_10283635
2553 Ga0207678_10293874
2554 Ga0207678_10349488
2555 Ga0207708_10035100
2556 Ga0207708_10326432
2557 Ga0207702_10000253
2558 Ga0207702_10000318
2559 Ga0207702_10231624
2560 Ga0207702_10329654
2561 Ga0207702_10486013
2562 Ga0207641_10349703
2563 Ga0207641_10764809
2564 Ga0207648_10509839
2565 Ga0207676_10129529
2566 Ga0207674_10028915
2567 Ga0207674_10042170
2568 Ga0207674_10311069
2569 Ga0207674_10580713
2570 Ga0207675_100149906
2571 Ga0207675_100154963
2572 Ga0207675_100248454
2573 Ga0207675_100454123
2574 Ga0207675_100542946
2575 Ga0207683_10120309
2576 Ga0207683_10130661
2577 Ga0207683_10142206
2578 Ga0207683_10231116
2579 Ga0207683_10246688
2580 Ga0207683_10301546
2581 Ga0207683_10577699
2582 Ga0207698_10024892
2583 Ga0207698_10126294
2584 Ga0207698_10300921
2585 Ga0207698_10307333
2586 Ga0207698_10399309
2587 Ga0207698_10426604
2588 Ga0207698_10493304
2589 Ga0209389_1000102
2590 Ga0209389_1000142
2591 Ga0209371_1001938
2592 Ga0209589_1000035
2593 Ga0209589_1000331
2594 Ga0209489_100079
2595 Ga0209489_100404
2596 Ga0209489_100818
2597 Ga0209700_100077
2598 Ga0209700_100408
2599 Ga0209179_1001374
2600 Ga0209588_1001357
2601 Ga0209813_10009317
2602 Ga0209813_10031457
2603 Ga0207428_10243821
2604 Ga0268266_10008616
2605 Ga0268266_10048797
2606 Ga0268266_10060781
2607 Ga0268266_10247167
2608 Ga0268266_10275692
2609 Ga0268266_10370293
2610 Ga0268266_10391596
2611 Ga0268266_10518135
2612 Ga0268265_10014031
2613 Ga0268265_10275630
2614 Ga0268264_10000062
2615 Ga0268264_10234589
2616 Ga0268264_10392478
2617 Ga0268264_10448204
2618 Ga0268264_10490861
2619 Ga0265319_1017352
2620 Ga0265334_10046153
2621 Ga0265318_10012602
2622 Ga0265323_10002871
2623 Ga0265322_10020639
2624 Ga0265336_10000032
2625 Ga0265336_10002816
2626 Ga0307517_10000232
2627 Ga0307517_10195851
2628 Ga0307515_10072079
2629 Ga0307515_10314675
2630 Ga0307515_10423249
2631 Ga0265338_10000422
2632 Ga0265324_10006919
2633 Ga0265324_10015991
2634 Ga0268256_1001682
2635 Ga0307511_10125475
2636 Ga0265760_10000096
2637 Ga0265330_10011940
2638 Ga0265330_10043394
2639 Ga0265332_10010082
2640 Ga0265332_10030416
2641 Ga0265325_10008852
2642 Ga0265329_10011836
2643 Ga0265340_10010992
2644 Ga0265339_10001248
2645 Ga0265339_10010315
2646 Ga0265331_10026374
2647 Ga0265331_10052921
2648 Ga0265331_10060809
2649 Ga0265316_10170223
2650 Ga0307513_10316548
2651 Ga0307513_10361326
2652 Ga0307513_10518950
2653 Ga0307509_10056747
2654 Ga0307509_10147247
2655 Ga0307509_10267919
2656 Ga0307509_10429862
2657 Ga0307408_100047045
2658 Ga0307508_10000045
2659 Ga0307508_10022102
2660 Ga0307508_10208054
2661 Ga0307508_10381219
2662 Ga0307508_10445253
2663 Ga0265314_10005054
2664 Ga0265314_10036026
2665 Ga0265342_10000026
2666 Ga0265342_10015623
2667 Ga0265342_10040808
2668 Ga0307516_10080981
2669 Ga0307516_10107884
2670 Ga0307413_10153592
2671 Ga0307413_10381996
2672 Ga0307407_10138680
2673 Ga0307412_10190428
2674 Ga0307412_10320291
2675 Ga0307409_100387605
2676 Ga0307416_100432738
2677 Ga0307411_10489071
2678 Ga0307415_100331735
2679 Ga0307415_100525348
2680 Ga0307415_100694017
2681 Ga0307507_10063749
2682 Ga0307510_10005192
2683 Ga0307510_10010957
2684 Ga0307510_10154095
2685 Ga0315911_1000008
2686 Ga0373930_0063062
2687 Ga0373926_0018000
2688 Ga0373929_0023418
2689 Ga0373929_0030064
2690 Ga0373934_0023131
2691 Ga0373934_0048927
2692 Ga0373934_0075890
2693 Ga0373923_0007245
2694 Ga0373923_0067787
2695 Ga0373936_0007829
2696 Ga0373936_0010431
2697 Ga0373936_0240563
2698 Ga0373941_0056801
2699 Ga0373945_0033473
2700 Ga0373945_0034697
2701 Ga0373953_0002766
2702 Ga0373953_0029830
2703 Ga0373954_0007515
2704 Ga0373954_0041652
2705 Ga0373954_0072568
2706 Ga0373956_0063075
2707 Ga0373957_0017724
2708 Ga0373957_0183188
2709 Ga0373943_0003229
2710 Ga0373943_0066803
2711 Ga0373943_0230672
2712 Ga0373946_0036453
2713 Ga0373955_0011290
2714 Ga0373955_0036661
2715 Ga0373942_0029275
2716 Ga0373962_0042191
2717 Ga0373924_0035386
2718 Ga0373924_0071228
2719 Ga0373931_0013496
2720 Ga0373931_0026163
2721 Ga0373931_0114920
2722 Ga0373935_0004301
2723 Ga0373935_0025334
2724 Ga0373927_0000766
2725 Ga0373927_0002321
2726 Ga0373927_0011298
2727 Ga0373927_0018485
2728 Ga0373927_0036330
2729 Ga0373927_0052279
2730 Ga0373927_0148385
2731 Ga0373927_0478362
2732 Ga0373933_0000218
2733 Ga0373933_0133740
2734 Ga0373933_0223100
2735 Ga0373933_0284996
2736 Ga0373947_0000310
2737 Ga0373947_0008207
2738 Ga0373947_0051170
2739 Ga0373947_0064613
2740 Ga0373937_0007978
2741 Ga0373937_0080516
2742 Ga0373937_0220533
2743 Ga0373937_0312494
2744 Ga0372808_018578
2745 Ga0373925_0008418
2746 Ga0373925_0016057
2747 Ga0373925_0016895
2748 Ga0373925_0034756
2749 Ga0373925_0044131
2750 Ga0373925_0133593
2751 Ga0373925_0138946
2752 Ga0373925_0250483
2753 Ga0395899_0164845
2754 Ga0395900_0000423
2755 Ga0395900_0364696
2756 Ga0395900_0366141
2757 Ga0395898_0010460
2758 Ga0395898_0016086
2759 Ga0395898_0037142
2760 Ga0395898_0129821
2761 Ga0395898_0358162
2762 Ga0395905_0017321
2763 Ga0395905_0182703
2764 Ga0395905_0471650
2765 Ga0436364_0114057
2766 Ga0395901_0010143
2767 Ga0395901_0129559
2768 Ga0395901_0611625
2769 Ga0436365_1493424
2770 Ga0436365_1890248
2771 Ga0436360_0380405
2772 Ga0436360_0734498
2773 Ga0436360_1352967
2774 Ga0436361_0609024
2775 Ga0436361_0908871
2776 Ga0436361_1023454
2777 Ga0436363_0110349
2778 Ga0436363_0462270
2779 Ga0436363_0797587
2780 Ga0436363_1120086
2781 Ga0436363_1361193
2782 Ga0436362_1092046
2783 Ga0439466_0056963
2784 Ga0451787_291164
2785 Ga0451795_0554965
2786 Ga0451807_1265636
2787 Ga0451841_0604624
2788 Ga0439433_0026008
2789 Ga0439445_0080725
2790 Ga0439455_0065575
2791 Ga0450920_026140
2792 Ga0439458_0009214
2793 Ga0450909_012001
2794 Ga0439459_0035005
2795 Ga0466969_0091111
2796 Ga0466972_0000941
2797 Ga0466972_0040720
2798 Ga0466965_0027939
2799 Ga0466965_0125696
2800 Ga0466966_0000628
2801 Ga0466966_0023968
2802 Ga0466966_0028575
2803 Ga0466961_0002516
2804 Ga0466961_0203646
2805 Ga0466963_0125500
2806 Ga0466963_0157186
2807 Ga0466964_0128426
2808 Ga0466968_0004491
2809 Ga0466968_0177168
2810 Ga0466970_0189366
2811 Ga0466957_0073406
2812 Ga0466957_0302860
2813 Ga0466959_0012945
2814 Ga0466959_0331979
2815 Ga0466958_0171777
2816 Ga0466958_0237807
2817 Ga0466967_0282433
2818 Ga0466967_0367727
2819 Ga0466967_0492415
2820 Ga0466967_0504934
2821 Ga0466967_0566847
2822 Ga0495617_026570
2823 Ga0495592_0004461
2824 Ga0495592_0029657
2825 Ga0495592_0050389
2826 Ga0495592_0126857
2827 Ga0495603_0000936
2828 Ga0495603_0002927
2829 Ga0495603_0017727
2830 Ga0495603_0025404
2831 Ga0495603_0066165
2832 Ga0495603_0103707
2833 Ga0495603_0140937
2834 Ga0495590_0125429
2835 Ga0495629_0001416
2836 Ga0495629_0002247
2837 Ga0495629_0003103
2838 Ga0495638_0005979
2839 Ga0495638_0028219
2840 Ga0495638_0190125
2841 Ga0495638_0206597
2842 Ga0495641_0005002
2843 Ga0495641_0049859
2844 Ga0495641_0082044
2845 Ga0495651_0008730
2846 Ga0495651_0038241
2847 Ga0495651_0064839
2848 Ga0495651_0080456
2849 Ga0495651_0102687
2850 Ga0495651_0131493
2851 Ga0495653_0015924
2852 Ga0495653_0050804
2853 Ga0495653_0065737
2854 Ga0495653_0196583
2855 Ga0495650_0059049
2856 Ga0495580_0002805
2857 Ga0495580_0028806
2858 Ga0495582_0000302
2859 Ga0495582_0051892
2860 Ga0495582_0144541
2861 Ga0495605_0154640
2862 Ga0495639_0000072
2863 Ga0495639_0013510
2864 Ga0495662_0001578
2865 Ga0495664_0015202
2866 Ga0495664_0027071
2867 Ga0495664_0031919
2868 Ga0495664_0054635
2869 Ga0495664_0168217
2870 Ga0495664_0190528
2871 Ga0495594_0000046
2872 Ga0495596_0121237
2873 Ga0495607_0232150
2874 Ga0495583_0062080
2875 Ga0495583_0067954
2876 Ga0495606_0057727
2877 Ga0495606_0072504
2878 Ga0495606_0195138
2879 Ga0495606_0286839
2880 Ga0495608_0005612
2881 Ga0495608_0168369
2882 Ga0495608_0193797
2883 Ga0495608_0275066
2884 Ga0495610_0015265
2885 Ga0495610_0141767
2886 Ga0495616_0036090
2887 Ga0495618_0073627
2888 Ga0495618_0344058
2889 Ga0495620_0054100
2890 Ga0495620_0087184
2891 Ga0495628_0015500
2892 Ga0495628_0040083
2893 Ga0495628_0053908
2894 Ga0495628_0073940
2895 Ga0495630_0005610
2896 Ga0495632_0108600
2897 Ga0495632_0168497
2898 Ga0495637_0011891
2899 Ga0495637_0096500
2900 Ga0495643_0052988
2901 Ga0495643_0091710
2902 Ga0495643_0254870
2903 Ga0495644_0049422
2904 Ga0495644_0071701
2905 Ga0495648_0001071
2906 Ga0495648_0027838
2907 Ga0495648_0088063
2908 Ga0495648_0100171
2909 Ga0495648_0120396
2910 Ga0495648_0163379
2911 Ga0495663_0040889
2912 Ga0495663_0049035
2913 Ga0495666_0031720
2914 Ga0495652_0003554
2915 Ga0495652_0020755
2916 Ga0495652_0044098
2917 Ga0495652_0423585
2918 Ga0495654_0016336
2919 Ga0495665_0000335
2920 Ga0495665_0011584
2921 Ga0495640_0002138
2922 Ga0495640_0017069
2923 Ga0495640_0019627
2924 Ga0495586_0131867
2925 Ga0495587_0044776
2926 Ga0495609_0072166
2927 Ga0495621_0051105
2928 Ga0495621_0112377
2929 Ga0495645_0008238
2930 Ga0495645_0023376
2931 Ga0495645_0131357
2932 Ga0495622_0001664
2933 Ga0495622_0026583
2934 Ga0495622_0043995
2935 Ga0495622_0058451
2936 Ga0495622_0132518
2937 Ga0495633_0194887
2938 Ga0495667_0003584
2939 Ga0495667_0008501
2940 Ga0495667_0014435
2941 Ga0495667_0150550
2942 Ga0495656_0033066
2943 Ga0495656_0134608
2944 Ga0495656_0287827
2945 Ga0495668_0049581
2946 Ga0495668_0169620
2947 Ga0495668_0216571
2948 Ga0495634_0004622
2949 Ga0495634_0023263
2950 Ga0495634_0091597
2951 Ga0495634_0219195
2952 Ga0495625_0071714
2953 Ga0495625_0074874
2954 Ga0495625_0162314
2955 Ga0495625_0244074
2956 Ga0495635_0000518
2957 Ga0495635_0006671
2958 Ga0495635_0008383
2959 Ga0495635_0026959
2960 Ga0495635_0098620
2961 Ga0495659_0162006
2962 Ga0495661_0034212
2963 Ga0495661_0220566
2964 Ga0495588_0002579
2965 Ga0495588_0016851
2966 Ga0495588_0023873
2967 Ga0495588_0057929
2968 Ga0495657_0005477
2969 Ga0495657_0032801
2970 Ga0495657_0214613
2971 Ga0495599_0000864
2972 Ga0495599_0084142
2973 Ga0495599_0186043
2974 Ga0495599_0207791
2975 Ga0495599_0392995
2976 Ga0495623_0010119
2977 Ga0495646_0026987
2978 Ga0495646_0134232
2979 Ga0495646_0174338
2980 Ga0495647_0104011
2981 Ga0495658_0023228
2982 Ga0495658_0214841
2983 Ga0495669_0015902
2984 Ga0495669_0098046
2985 Ga0495669_0168331
2986 Ga0495613_0004485
2987 Ga0495613_0145701
2988 Ga0495613_0204897
2989 Ga0495613_0333511
2990 Ga0495613_0357636
2991 Ga0495624_0000795
2992 Ga0495624_0041749
2993 Ga0495624_0315221
2994 Ga0495624_0363769
2995 Ga0495670_0007575
2996 Ga0495671_0046554
2997 Ga0495671_0082614
2998 Ga0495671_0107523
2999 Ga0495649_0086287
3000 Ga0495649_0152812
3001 Ga0495649_0186305
3002 Ga0495649_0297462
3003 Ga0495589_0178129
3004 Ga0495600_0002373
3005 Ga0495600_0017875
3006 Ga0495600_0067504
3007 Ga0495600_0087808
3008 Ga0495600_0240833
3009 Ga0495600_0294526
3010 Ga0495660_0245563
3011 Ga0495581_0000030
3012 Ga0495581_0028132
3013 Ga0495581_0047237
3014 Ga0495581_0181574
3015 Ga0495581_0237488
3016 Ga0495581_0251946
3017 Ga0495604_0005369
3018 Ga0495604_0014589
3019 Ga0495604_0025392
3020 Ga0495604_0184578
3021 Ga0495636_0060744
3022 Ga0495636_0135694
3023 Ga0495674_0004821
3024 Ga0495674_0029980
3025 Ga0495674_0045408
3026 Ga0495674_0182566
3027 Ga0495672_0176406
3028 Ga0495676_0033174
3029 Ga0495676_0164043
3030 Ga0495676_0168826
3031 Ga0495676_0248673
3032 Ga0495676_0318899
3033 Ga0495680_0008881
3034 Ga0495683_0132660
3035 Ga0495687_007148
3036 Ga0495675_0020892
3037 Ga0495675_0099624
3038 Ga0495675_0214036
3039 Ga0495677_0077709
3040 Ga0495673_0127904
3041 Ga0495684_0004051
3042 Ga0495684_0024023
3043 Ga0495686_0064143
3044 Ga0495686_0078201
3045 Ga0495686_0092376
3046 Ga0495686_0146969
3047 Ga0495686_0157627
3048 Ga0495593_0000398
3049 Ga0495593_0009398
3050 Ga0495593_0017768
3051 Ga0495593_0061511
3052 Ga0495602_0010323
3053 Ga0495602_0023058
3054 Ga0495602_0047488
3055 Ga0495602_0230322
3056 Ga0495602_0268477
3057 Ga0495614_0142115
3058 Ga0495615_0089412
3059 Ga0496100_0005479
3060 Ga0496100_0015556
3061 Ga0496100_0020557
3062 Ga0496100_0304159
3063 Ga0496100_0645194
3064 Ga0496101_0021366
3065 Ga0496101_0057108
3066 Ga0496101_0101438
3067 Ga0496101_0267795
3068 Ga0496101_0408868
3069 Ga0496102_0025855
3070 Ga0496102_0069619
3071 Ga0496102_0071540
3072 Ga0496102_0074603
3073 Ga0496102_0098901
3074 Ga0496102_0196265
3075 Ga0496102_0231653
3076 Ga0496102_0250719
3077 Ga0496102_0256331
3078 Ga0496102_0396110
3079 Ga0496102_0431627
3080 Ga0496103_0010891
3081 Ga0496103_0021472
3082 Ga0496103_0123848
3083 Ga0496104_0013200
3084 Ga0496104_0021253
3085 Ga0496104_0023224
3086 Ga0496104_0081567
3087 Ga0496104_0109572
3088 Ga0496104_0122100
3089 Ga0496104_0181592
3090 Ga0496105_0002119
3091 Ga0496105_0004271
3092 Ga0496105_0049541
3093 Ga0496105_0108810
3094 Ga0496105_0270131
3095 Ga0496105_0435082
3096 Ga0496106_0000418
3097 Ga0496106_0005807
3098 Ga0496106_0008160
3099 Ga0496106_0012607
3100 Ga0496106_0021313
3101 Ga0496106_0206036
3102 Ga0496106_0266793
3103 Ga0496106_0423139
3104 Ga0496106_0451929
3105 Ga0496106_0591381
3106 Ga0496107_0005061
3107 Ga0496107_0021428
3108 Ga0496107_0071285
3109 Ga0496107_0104479
3110 Ga0496107_0179311
3111 Ga0496108_0000160
3112 Ga0496108_0020758
3113 Ga0496108_0025207
3114 Ga0496108_0071623
3115 Ga0496108_0217264
3116 Ga0496108_0310990
3117 Ga0496109_0000245
3118 Ga0496109_0021697
3119 Ga0496109_0089282
3120 Ga0496109_0102308
3121 Ga0496109_0183229
3122 Ga0496109_0430333
3123 Ga0496109_0497795
3124 Ga0496110_0014329
3125 Ga0496110_0024193
3126 Ga0496110_0051735
3127 Ga0496110_0233120
3128 Ga0496110_0238542
3129 Ga0496110_0487144
3130 Ga0496111_0047295
3131 Ga0496111_0065286
3132 Ga0496112_0000018
3133 Ga0496112_0002354
3134 Ga0496112_0004127
3135 Ga0496112_0004136
3136 Ga0496112_0007772
3137 Ga0496112_0035285
3138 Ga0496112_0123482
3139 Ga0496112_0136598
3140 Ga0496112_0145156
3141 Ga0496112_0159966
3142 Ga0496113_0038433
3143 Ga0496113_0053535
3144 Ga0496113_0074927
3145 Ga0496113_0122095
3146 Ga0496113_0539875
3147 Ga0496114_0140628
3148 Ga0496114_0245698
3149 Ga0496114_0294835
3150 Ga0496114_0323477
3151 Ga0496114_0622413
3152 Ga0496115_0005337
3153 Ga0496115_0014614
3154 Ga0496115_0051731
3155 Ga0496115_0089905
3156 Ga0496115_0097833
3157 Ga0496115_0398601
3158 Ga0496115_0418234
3159 Ga0496115_0499375
3160 Ga0496116_0012269
3161 Ga0496116_0014117
3162 Ga0496116_0102458
3163 Ga0496117_0015483
3164 Ga0496117_0032990
3165 Ga0496117_0051718
3166 Ga0496117_0149101
3167 Ga0496117_0215742
3168 Ga0496118_0005692
3169 Ga0496118_0017056
3170 Ga0496118_0028806
3171 Ga0496118_0037135
3172 Ga0496118_0121818
3173 Ga0496118_0272520
3174 Ga0496118_0339636
3175 Ga0496119_0002669
3176 Ga0496119_0014075
3177 Ga0496119_0017374
3178 Ga0496119_0023249
3179 Ga0496119_0035864
3180 Ga0496119_0072531
3181 Ga0496119_0197550
3182 Ga0496119_0201578
3183 Ga0496120_0014496
3184 Ga0496120_0054397
3185 Ga0496120_0069860
3186 Ga0496120_0162416
3187 Ga0496121_0000278
3188 Ga0496121_0000870
3189 Ga0496121_0010173
3190 Ga0496121_0014331
3191 Ga0496121_0015878
3192 Ga0496121_0021331
3193 Ga0496121_0023995
3194 Ga0496121_0030800
3195 Ga0496121_0034826
3196 Ga0496121_0089621
3197 Ga0496121_0095356
3198 Ga0496121_0095552
3199 Ga0496121_0130086
3200 Ga0496121_0145227
3201 Ga0496121_0170692
3202 Ga0496121_0177781
3203 Ga0496121_0213940
3204 Ga0496121_0219163
3205 Ga0496121_0234101
3206 Ga0496121_0240078
3207 Ga0496121_0391485
3208 Ga0496122_0020531
3209 Ga0496122_0038047
3210 Ga0496122_0050025
3211 Ga0496122_0205099
3212 Ga0496122_0232738
3213 Ga0496123_0003029
3214 Ga0496123_0031679
3215 Ga0496123_0110437
3216 Ga0496123_0164249
3217 Ga0496124_0000123
3218 Ga0496124_0084753
3219 Ga0496124_0115893
3220 Ga0496124_0247269
3221 Ga0496124_0296982
3222 Ga0496125_0000207
3223 Ga0496125_0011562
3224 Ga0496125_0012916
3225 Ga0496125_0139009
3226 Ga0496126_0008213
3227 Ga0496126_0010103
3228 Ga0496126_0036335
3229 Ga0496126_0056692
3230 Ga0496126_0062529
3231 Ga0496126_0095928
3232 Ga0496126_0128201
3233 Ga0496126_0132407
3234 Ga0496126_0171147
3235 Ga0496126_0233078
3236 Ga0496126_0248727
3237 Ga0496126_0263494
3238 Ga0496126_0285765
3239 Ga0496126_0311100
3240 Ga0496126_0406211
3241 Ga0496126_0463884
3242 Ga0496126_0468481
3243 Ga0496126_0472107
3244 Ga0496126_0497807
3245 Ga0495678_078556
3246 Ga0495682_0131917
3247 Ga0501031_0049312
3248 Ga0501032_0011231
3249 Ga0501032_0071162
3250 Ga0501032_0101572
3251 Ga0501032_0240969
3252 Ga0501033_0001064
3253 Ga0501033_0012046
3254 Ga0501033_0049770
3255 Ga0501034_0130679
3256 Ga0501034_0313086
3257 Ga0501034_0632690
3258 Ga0501036_0124749
3259 Ga0501036_0570881
3260 Ga0501036_0571133
3261 Ga0501036_0701638
3262 Ga0501037_0000242
3263 Ga0501037_0064561
3264 Ga0501038_0016237
3265 Ga0501038_0218189
3266 Ga0501038_0377896
3267 Ga0501039_0153933
3268 Ga0501043_0000440
3269 Ga0501043_0033129
3270 Ga0501043_0090716
3271 Ga0501043_0131751
3272 Ga0501046_0237224
3273 Ga0501047_0006953
3274 Ga0501047_0008580
3275 Ga0501047_0011808
3276 Ga0501047_0027351
3277 Ga0501047_0056233
3278 Ga0501047_0069493
3279 Ga0501047_0190762
3280 Ga0501047_0238252
3281 Ga0501047_0459276
3282 Ga0501047_0469766
3283 Ga0501048_0131505
3284 Ga0501048_0238046
3285 Ga0501067_0055415
3286 Ga0501067_0106097
3287 Ga0501068_0005571
3288 Ga0501068_0222044
3289 Ga0501069_0000017
3290 Ga0501069_0024997
3291 Ga0501069_0330006
3292 Ga0501070_0000236
3293 Ga0501070_0000356
3294 Ga0501070_0007635
3295 Ga0501070_0025934
3296 Ga0501070_0062784
3297 Ga0501071_0143147
3298 Ga0501071_0229123
3299 Ga0501071_0384309
3300 Ga0501071_0582316
3301 Ga0501073_0000531
3302 Ga0501073_0032679
3303 Ga0501074_0000610
3304 Ga0501074_0000660
3305 Ga0501074_0011565
3306 Ga0501074_0031296
3307 Ga0501074_0090123
3308 Ga0501079_0006439
3309 Ga0501080_0001422
3310 Ga0501080_0005983
3311 Ga0501080_0009701
3312 Ga0501080_0023297
3313 Ga0501080_0068569
3314 Ga0501080_0159418
3315 Ga0501080_0210494
3316 Ga0501083_0002788
3317 Ga0501083_0003168
3318 Ga0501083_0092651
3319 Ga0501035_0000101
3320 Ga0501035_0000686
3321 Ga0501035_0009055
3322 Ga0501035_0020710
3323 Ga0501035_0028068
3324 Ga0501035_0059620
3325 Ga0501035_0230946
3326 Ga0501035_0324512
3327 Ga0501035_0558963
3328 Ga0501035_0619810
3329 Ga0501044_0000010
3330 Ga0501044_0016129
3331 Ga0501044_0029369
3332 Ga0501044_0036505
3333 Ga0501044_0060354
3334 Ga0501044_0099050
3335 Ga0501044_0107251
3336 Ga0501044_0112268
3337 Ga0501044_0117767
3338 Ga0501044_0182100
3339 Ga0501044_0282669
3340 Ga0501044_0313976
3341 Ga0501044_0423901
3342 Ga0501044_0668268
3343 nmdc:mga03683_118016_c1
3344 nmdc:mga03683_43980_c1
3345 nmdc:mga03683_9417_c2
3346 nmdc:mga03n38_107513_c1
3347 nmdc:mga03n38_124019_c1
3348 nmdc:mga03n38_1251_c1
3349 nmdc:mga03n38_2538_c1
3350 nmdc:mga03n38_73656_c1
3351 nmdc:mga00v17_15267_c1
3352 nmdc:mga00v17_18256_c1
3353 nmdc:mga00v17_19009_c1
3354 nmdc:mga00v17_375472_c1
3355 nmdc:mga0yw44_140517_c1
3356 nmdc:mga0yw44_152810_c1
3357 nmdc:mga0yw44_20636_c1
3358 nmdc:mga0yw44_235615_c1
3359 nmdc:mga0yw44_2638_c1
3360 nmdc:mga0yw44_338082_c1
3361 nmdc:mga0yw44_387333_c1
3362 nmdc:mga0yw44_4136_c1
3363 nmdc:mga0k408_105305_c1
3364 nmdc:mga0k408_126963_c1
3365 nmdc:mga0k408_42070_c1
3366 nmdc:mga0k408_76158_c1
3367 nmdc:mga06z11_110192_c1
3368 nmdc:mga06z11_143381_c1
3369 nmdc:mga06z11_88873_c1
3370 nmdc:mga04h51_4594_c1
3371 nmdc:mga04h51_50591_c1
3372 nmdc:mga07m45_145085_c1
3373 nmdc:mga07m45_23218_c2
3374 nmdc:mga07m45_278714_c1
3375 nmdc:mga07m45_71999_c1
3376 nmdc:mga0qj67_35930_c1
3377 nmdc:mga0qj67_384036_c1
3378 nmdc:mga06r32_139219_c1
3379 nmdc:mga0n895_33749_c1
3380 nmdc:mga0n895_55593_c1
3381 nmdc:mga0n895_59184_c1
3382 nmdc:mga0rr50_357987_c1
3383 nmdc:mga0sz30_44073_c1
3384 nmdc:mga0sz30_6129_c1
3385 Ga0495601_0049033
3386 Ga0495601_0128447
3387 Ga0495601_0280710
3388 Ga0495601_0309266
3389 Ga0495612_0026224
3390 Ga0495612_0132654
3391 Ga0500635_0001019
3392 Ga0500635_0001112
3393 Ga0495619_0018218
3394 Ga0495619_0164486
3395 Ga0495619_0450951
3396 Ga0500578_0117180
3397 Ga0500578_0211209
3398 Ga0500643_000112
3399 Ga0500581_019218
3400 Ga0500646_0014413
3401 Ga0500647_0034776
3402 Ga0500647_0043672
3403 Ga0500583_0197130
3404 Ga0500651_0013790
3405 Ga0500651_0076655
3406 Ga0500651_0096067
3407 Ga0500566_0001605
3408 Ga0500566_0002244
3409 Ga0500566_0003837
3410 Ga0500566_0023627
3411 Ga0500640_003743
3412 Ga0500640_043327
3413 Ga0500641_0007867
3414 Ga0500641_0028023
3415 Ga0500641_0077090
3416 Ga0500641_0100679
3417 Ga0500648_141887
3418 Ga0500650_0026074
3419 Ga0500650_0111933
3420 Ga0500554_067508
3421 Ga0500555_026873
3422 Ga0500556_0000006
3423 Ga0500556_0000068
3424 Ga0500557_000021
3425 Ga0500558_079488
3426 Ga0500562_032400
3427 Ga0500562_036162
3428 Ga0500562_068551
3429 Ga0500569_028550
3430 Ga0500572_002049
3431 Ga0500572_016650
3432 Ga0500591_068096
3433 Ga0500592_000490
3434 Ga0500594_0015285
3435 Ga0500594_0038557
3436 Ga0500594_0043459
3437 Ga0500595_003616
3438 Ga0500595_009845
3439 Ga0500595_020341
3440 Ga0500595_021228
3441 Ga0500595_023440
3442 Ga0500595_043599
3443 Ga0500595_068784
3444 Ga0500607_052394
3445 Ga0500608_000852
3446 Ga0500608_087150
3447 Ga0500608_183439
3448 Ga0500614_050622
3449 Ga0500618_008819
3450 Ga0500642_0000004
3451 Ga0500642_0000362
3452 Ga0500642_0006861
3453 Ga0500652_000342
3454 Ga0500655_022733
3455 Ga0500559_0002074
3456 Ga0500559_0007492
3457 Ga0500559_0026405
3458 Ga0500559_0045996
3459 Ga0500559_0079650
3460 Ga0500559_0204801
3461 Ga0500559_0236854
3462 Ga0500561_0047971
3463 Ga0500568_0006964
3464 Ga0500568_0011399
3465 Ga0500568_0013697
3466 Ga0500568_0015941
3467 Ga0500573_0007614
3468 Ga0500577_0001442
3469 Ga0500586_000200
3470 Ga0500588_0013721
3471 Ga0500588_0034702
3472 Ga0500588_0067142
3473 Ga0500589_074989
3474 Ga0500590_049874
3475 Ga0500603_002052
3476 Ga0500603_003463
3477 Ga0500604_0119111
3478 Ga0500604_0152707
3479 Ga0500616_0000022
3480 Ga0500616_0060673
3481 Ga0500616_0125865
3482 Ga0500619_089556
3483 Ga0500622_0002538
3484 Ga0500622_0005248
3485 Ga0500627_0031943
3486 Ga0500627_0092111
3487 Ga0500630_021324
3488 Ga0500633_0079526
3489 Ga0500634_0037765
3490 Ga0500634_0144020
3491 Ga0500638_054063
3492 Ga0500638_084193
3493 Ga0500638_087400
3494 Ga0500639_004505
3495 Ga0500639_140306
3496 Ga0500639_161158
3497 Ga0500636_0000834
3498 Ga0500636_0037800
3499 Ga0500636_0044447
3500 Ga0500636_0055552
3501 Ga0500636_0070418
3502 Ga0500636_0152749
3503 Ga0500637_0000585
3504 Ga0500637_0003666
3505 Ga0500637_0045191
3506 Ga0500637_0051363
3507 Ga0500637_0059418
3508 Ga0500576_131296
3509 Ga0500625_123222
3510 Ga0500645_020104
3511 Ga0500645_023572
3512 Ga0500596_003436
3513 Ga0500596_004728
3514 Ga0500601_000419
3515 Ga0500601_008099
3516 Ga0501084_0443335
3517 Ga0500661_001372
3518 Ga0500661_024396
3519 Ga0501082_0072371
3520 Ga0501082_0134170
3521 Ga0501082_0581604
3522 Ga0466962_0015531
3523 Ga0530510_0524100
3524 2507505454
3525 2508539339
3526 2508695668
3527 2509152183
3528 2511395680
3529 2513623922
3530 2513642196
3531 2513651330
3532 2513659513
3533 2513676319
3534 2513695291
3535 2513700715
3536 2513718244
3537 2513859380
3538 2513873343
3539 2513888576
3540 2513921554
3541 2513998566
3542 2514014673
3543 2515627649
3544 2517106276
3545 2517889054
3546 2524441445
3547 2524458386
3548 2524467223
3549 2524537489
3550 2528853314
3551 2545678091
3552 2585280649
3553 2585326435
3554 2585395986
3555 2585531583
3556 2585551470
3557 2603858613
3558 2616306806
3559 2616557657
3560 2617352057
3561 2617373525
3562 2617383325
3563 2644291742
3564 2671124043
3565 2723841825
3566 2728748428
3567 2745077579
3568 2778173676
3569 2793062241
3570 2793072707
3571 2793078301
3572 2805920691
3573 2818237860
3574 2819244737
3575 2819611167
3576 2819638900
3577 2824604419
3578 2824614851
3579 2824624168
3580 2824632848
3581 2824643753
3582 2824652408
3583 2824656297
3584 2824669887
3585 2824671753
3586 2824684804
3587 2824695782
3588 2824701663
3589 2824710871
3590 2824722892
3591 2824729494
3592 2824740221
3593 2824751144
3594 2824760654
3595 2824768458
3596 2824781372
3597 2838030858
3598 2838124703
3599 2841945394
3600 2841952180
3601 2841965342
3602 2841970433
3603 2841981681
3604 2841984961
3605 2842043316
3606 2842052694
3607 2842300358
3608 2842361125
3609 2842477590
3610 2842487970
3611 2842504537
3612 2842511787
3613 2842524403
3614 2844315549
3615 2847931252
3616 2847942345
3617 2849083217
3618 2852391620
3619 2857516350
3620 2857526262
3621 2874592545
3622 2874607882
3623 2874617976
3624 2874621199
3625 2874628598
3626 2874647164
3627 2876769645
3628 2876772548
3629 2876819809
3630 2879076315
3631 2879083774
3632 2879100443
3633 2879113309
3634 2879128799
3635 2879143620
3636 2881368930
3637 2881673213
3638 2885369331
3639 2885377558
3640 2885386722
3641 2885415194
3642 2888390497
3643 2888420118
3644 2889035298
3645 2893067466
3646 2903733542
3647 2903758793
3648 2903777915
3649 2904667744
3650 2904691001
3651 2904708398
3652 2904716326
3653 2906608896
3654 2906613570
3655 2906631672
3656 2906636574
3657 2906648338
3658 2906668104
3659 2908747657
3660 2908757059
3661 2908775996
3662 2919073885
3663 2919453274
3664 2922363211
3665 2922369384
3666 2922388484
3667 2922396580
3668 2922434007
3669 2929618787
3670 2929628528
3671 2932790969
3672 2932794138
3673 2932809214
3674 2932811977
3675 2932825572
3676 2932833685
3677 2933580503
3678 2935615516
3679 2935623211
3680 2935636034
3681 2935644286
3682 2935654445
3683 2935663325
3684 2935672132
3685 2935679348
3686 2935686590
3687 2935700371
3688 2935710319
3689 2935716278
3690 2935723598
3691 2935735153
3692 2935744056
3693 2935752556
3694 2935763311
3695 2935774284
3696 2935783350
3697 2935789001
3698 2935796751
3699 2935808310
3700 2935816076
3701 2935825683
3702 2935833470
3703 2935845972
3704 2935853447
3705 2935861459
3706 2935869578
3707 2935879907
3708 2935889165
3709 2935915049
3710 2935918897
3711 2935931386
3712 2935939983
3713 2935947670
3714 2935956441
3715 2935966713
3716 2935973235
3717 2935980522
3718 2935990128
3719 2935997870
3720 2936008865
3721 2936017516
3722 2936025983
3723 2936034825
3724 2936041081
3725 2936052917
3726 2936060224
3727 2940558469
3728 2941512662
3729 2941520500
3730 2941528514
3731 2941535339
3732 2941547141
3733 2977865575
3734 3005421699
3735 3005475278
3736 3005486670
3737 3005508976
3738 3005594141
3739 3005595239
3740 3005711182
3741 3005718477
3742 641642395
3743 8001847186
3744 8003017859
3745 8005319597
3746 8005490220
3747 8005646877
3748 8005688062
3749 8006927252
3750 8006935999
3751 8006975877
3752 8006991110
3753 8007000439
3754 8016517987
3755 8016526332
3756 8016531396
3757 8016544608
3758 8016557466
3759 8016565824
3760 8016569663
3761 8016582270
3762 8016586145
3763 8016603424
3764 8016606359
3765 8016618266
3766 8016622917
3767 8016635421
3768 8017058653
3769 8019531229
3770 8019540323
3771 8019549915
3772 8019562658
3773 8019572735
3774 8019577004
3775 8019595071
3776 8019606673
3777 8019611840
3778 8019623167
3779 8019629931
3780 8019640675
3781 8019652278
3782 8019666768
3783 8019676528
3784 8019679460
3785 8019696043
3786 8024490777
3787 8055742636
3788 8056676145
3789 8056682944
3790 8056693785
3791 8056971497
3792 8057581535

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

29

227

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

35

273

0.92

PF08659

KR

KR domain

30

217

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iqg-assembly1.cif.gz_B crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form 0.9872 5 251
8bci-assembly2.cif.gz_C crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 0.9866 6 251
8bcj-assembly2.cif.gz_D crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ 0.9857 5 251
4e3z-assembly1.cif.gz_B crystal structure of a oxidoreductase from rhizobium etli cfn 42 0.9839 6 251
8bci-assembly2.cif.gz_D crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 0.9833 5 251
ID Description Score Start End Superfamily
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9721 2 251 3.40.50.720
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.968 2 251 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 6 250 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 6 251 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.962 6 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2M6VJ76-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9894 2 251 GO:0016614
AF-A0A317PHF8-F1-model_v4 Glucose 1-dehydrogenase 0.9894 5 251 GO:0016614
AF-A0A2N4YNE3-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9888 109 251 GO:0016614
AF-A0A1S1NS57-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9886 5 251 GO:0047936
AF-A0A420WTP5-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9885 5 251 GO:0016491

Map