F496001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1896 | 833 | 3792 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10020694|JGI25404J52841_100206942 |
| Length | 273 |
| Sequence | MAFSLQNSGLAAGVFANGXNDRGXIVTDRVVVITGASRGIGRAAAIAAAERGFRVVVGYASNQAAADEVVDQIERKNGKAIAVXCDVAHEKDILALFKAADEFGXLGALVNNAGIVGPSVRVEDMSAERVQRMMAVNVTGSLLCAREAVKRMSTRRGGKGGVIVNLSSVASRLGSANTYVDYAASKGAVDSFTIGLGHEVAAEGIRVAAIRPGLIDTEIHASGGEPDRAHRLAPMVPMKRVGTAQEIANAIVWLISDEASYVTSAILDVSGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 99 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 100 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 101 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 137 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 138 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 139 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 140 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 141 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 142 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 145 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 251 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 252 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 256 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 266 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 267 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 268 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 269 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 271 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 272 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 273 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 274 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 276 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 277 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 278 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 279 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 280 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 281 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 282 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 284 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 285 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 303 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 304 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 305 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 309 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 315 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 319 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 320 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 324 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 325 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 326 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 327 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 328 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 329 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 330 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 338 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 339 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 340 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 341 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 342 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 447 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 448 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 449 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 450 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 451 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 452 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 453 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 454 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 455 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 456 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 457 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 458 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 459 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 486 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 487 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 488 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 489 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 490 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 491 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 492 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 493 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 498 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 501 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 504 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 505 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 506 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 507 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 508 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 509 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 510 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 511 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 513 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 515 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 516 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 518 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 519 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 520 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 521 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 523 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 524 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 525 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 526 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 527 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 528 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 529 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 531 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 532 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 533 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 534 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 535 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 536 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 537 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 538 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 539 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 540 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 541 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 542 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 543 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 544 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 545 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 546 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 547 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 548 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 549 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 550 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 551 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 552 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 553 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 554 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 555 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 556 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 557 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 558 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 559 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 560 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 562 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 564 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 565 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 566 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 567 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 568 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 569 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 570 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 571 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 572 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 573 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 574 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 575 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 576 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 577 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 578 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 579 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 580 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 581 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 582 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 583 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 584 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 585 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 586 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 587 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 588 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 589 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 590 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 591 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 592 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 593 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 594 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 595 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 596 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 597 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 598 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 599 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 600 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 601 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 602 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 603 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 604 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 605 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 606 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 607 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 608 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 609 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 610 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 611 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 612 | 2791355199 | |||
| 613 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 614 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 615 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 616 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 617 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 618 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 619 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 620 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 621 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 622 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 623 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 624 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 625 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 626 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 627 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 628 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 629 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 630 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 631 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 632 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 633 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 634 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 635 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 636 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 637 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 638 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 639 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 640 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 641 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 642 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 643 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 644 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 645 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 646 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 647 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 648 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 649 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 650 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 651 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 652 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 653 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 654 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 655 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 656 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 657 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 658 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 659 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 660 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 661 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 662 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 663 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 664 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 665 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 666 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 667 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 668 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 669 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 670 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 671 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 672 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 673 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 674 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 675 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 676 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 677 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 678 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 679 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 680 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 681 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 682 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 683 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 684 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 685 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 686 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 687 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 688 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 689 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 690 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 691 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 692 | 2904699407 | |||
| 693 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 694 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 695 | 2906610324 | |||
| 696 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 697 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 698 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 699 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 700 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 701 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 702 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 703 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 704 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 705 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 706 | 2922368715 | |||
| 707 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 708 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 709 | 2922425934 | |||
| 710 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 711 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 712 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 713 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 714 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 715 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 716 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 717 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 718 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 719 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 720 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 721 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 722 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 723 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 724 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 725 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 726 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 727 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 728 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 729 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 730 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 731 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 732 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 733 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 734 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 735 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 736 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 737 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 738 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 739 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 740 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 741 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 742 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 743 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 744 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 745 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 746 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 747 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 748 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 749 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 750 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 751 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 752 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 753 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 754 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 755 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 756 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 757 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 758 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 759 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 760 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 761 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 762 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 763 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 764 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 765 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 766 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 767 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 768 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 769 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 770 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 771 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 772 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 773 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 774 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 775 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 776 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 777 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 778 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 779 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 780 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 781 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 782 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 783 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 784 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 785 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 786 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 787 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 788 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 789 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 790 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 791 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 792 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 793 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 794 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 795 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 796 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 797 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 798 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 799 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 800 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 801 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 802 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 803 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 804 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 805 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 806 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 807 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 808 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 809 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 810 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 811 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 812 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 813 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 814 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 815 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 816 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 817 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 818 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 819 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 820 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 821 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 822 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 823 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 824 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 825 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 826 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 827 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 828 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 829 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 830 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 831 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 832 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 833 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.83 |
| Metatranscriptomes | 0.21 |
| Isolates | 13.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.14 |
| Nodule | 10.86 |
| Rhizoplane | 5.59 |
| Rhizosphere | 57.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10020694 | 3300003659 | Bacteria | 1424 |
| 2 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 3 | JGI25156J39149_1000033 | 3300002705 | Bacteria | 114688 |
| 4 | JGI25156J39149_1000461 | 3300002705 | Bacteria | 24707 |
| 5 | JGI25156J39149_1000930 | 3300002705 | Bacteria | 14239 |
| 6 | JGI25162J39368_1000607 | 3300002737 | Bacteria | 25795 |
| 7 | JGI25154J39366_1000058 | 3300002738 | Bacteria | 107363 |
| 8 | JGI25154J39366_1000761 | 3300002738 | Bacteria | 14332 |
| 9 | JGI25154J39366_1002142 | 3300002738 | Bacteria | 5522 |
| 10 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 11 | JGI25157J39369_1000045 | 3300002741 | Bacteria | 122406 |
| 12 | JGI25159J45721_1001420 | 3300002987 | Bacteria | 9950 |
| 13 | JGI25406J46586_10000881 | 3300003203 | Bacteria | 14141 |
| 14 | JGI25406J46586_10009349 | 3300003203 | Bacteria | 4391 |
| 15 | JGI25165J46597_1001489 | 3300003214 | Bacteria | 12008 |
| 16 | JGI25165J46597_1002089 | 3300003214 | Bacteria | 7361 |
| 17 | JGI25153J46596_10005387 | 3300003215 | Bacteria | 6720 |
| 18 | JGI25153J46596_10006271 | 3300003215 | Bacteria | 6074 |
| 19 | JGI25153J46596_10006385 | 3300003215 | Bacteria | 5976 |
| 20 | JGI25153J46596_10011204 | 3300003215 | Bacteria | 3982 |
| 21 | JGI25153J46596_10014578 | 3300003215 | Bacteria | 3256 |
| 22 | JGI25153J46596_10052728 | 3300003215 | Bacteria | 1155 |
| 23 | JGI25153J46596_10055018 | 3300003215 | Bacteria | 1116 |
| 24 | rootL2_10022138 | 3300003322 | Bacteria | 4256 |
| 25 | JGI25160J50197_1000402 | 3300003354 | Bacteria | 27817 |
| 26 | JGI25160J50197_1005378 | 3300003354 | Bacteria | 5340 |
| 27 | JGI25160J50197_1031032 | 3300003354 | Bacteria | 1383 |
| 28 | JGI25161J50226_1000324 | 3300003374 | Bacteria | 26148 |
| 29 | JGI25404J52841_10000873 | 3300003659 | Bacteria | 4879 |
| 30 | JGI25404J52841_10025159 | 3300003659 | Bacteria | 1282 |
| 31 | Ga0055539_1004125 | 3300003752 | Bacteria | 1957 |
| 32 | Ga0055542_1006050 | 3300003762 | Bacteria | 2638 |
| 33 | Ga0055526_1021210 | 3300003771 | Bacteria | 2270 |
| 34 | Ga0055524_1015899 | 3300003775 | Bacteria | 2725 |
| 35 | Ga0055524_1016642 | 3300003775 | Bacteria | 2627 |
| 36 | Ga0055536_1000652 | 3300003781 | Bacteria | 23432 |
| 37 | Ga0055536_1014230 | 3300003781 | Bacteria | 2811 |
| 38 | Ga0055530_10000735 | 3300003791 | Bacteria | 27312 |
| 39 | Ga0055531_10004632 | 3300003794 | Bacteria | 8262 |
| 40 | Ga0055531_10021366 | 3300003794 | Bacteria | 2513 |
| 41 | Ga0055531_10034300 | 3300003794 | Bacteria | 1613 |
| 42 | Ga0055543_1000099 | 3300004625 | Bacteria | 74883 |
| 43 | Ga0055543_1011753 | 3300004625 | Bacteria | 1781 |
| 44 | Ga0065165_1001848 | 3300005262 | Bacteria | 20620 |
| 45 | Ga0065165_1003775 | 3300005262 | Bacteria | 10150 |
| 46 | Ga0065165_1003886 | 3300005262 | Bacteria | 9897 |
| 47 | Ga0065165_1025064 | 3300005262 | Bacteria | 1992 |
| 48 | Ga0070658_10012453 | 3300005327 | Bacteria | 6823 |
| 49 | Ga0070658_10207299 | 3300005327 | Bacteria | 1655 |
| 50 | Ga0070658_10298078 | 3300005327 | Bacteria | 1374 |
| 51 | Ga0070658_10505911 | 3300005327 | Bacteria | 1044 |
| 52 | Ga0070683_100006653 | 3300005329 | Bacteria | 9707 |
| 53 | Ga0070683_100135402 | 3300005329 | Bacteria | 2332 |
| 54 | Ga0070683_100494235 | 3300005329 | Bacteria | 1169 |
| 55 | Ga0070683_100769576 | 3300005329 | Bacteria | 922 |
| 56 | Ga0070690_100087960 | 3300005330 | Bacteria | 2042 |
| 57 | Ga0070677_10027314 | 3300005333 | Bacteria | 2148 |
| 58 | Ga0068869_100031930 | 3300005334 | Bacteria | 3708 |
| 59 | Ga0068869_100065052 | 3300005334 | Bacteria | 2684 |
| 60 | Ga0068869_100234518 | 3300005334 | Bacteria | 1459 |
| 61 | Ga0068869_100434449 | 3300005334 | Bacteria | 1085 |
| 62 | Ga0068869_100702473 | 3300005334 | Bacteria | 862 |
| 63 | Ga0070680_100041662 | 3300005336 | Bacteria | 3723 |
| 64 | Ga0070680_100044841 | 3300005336 | Bacteria | 3594 |
| 65 | Ga0070680_100343000 | 3300005336 | Bacteria | 1269 |
| 66 | Ga0070680_100590832 | 3300005336 | Bacteria | 953 |
| 67 | Ga0068868_100048998 | 3300005338 | Bacteria | 3315 |
| 68 | Ga0070660_100037559 | 3300005339 | Bacteria | 3671 |
| 69 | Ga0070660_100483715 | 3300005339 | Bacteria | 1029 |
| 70 | Ga0070691_10220480 | 3300005341 | Bacteria | 1005 |
| 71 | Ga0070668_100052173 | 3300005347 | Bacteria | 3152 |
| 72 | Ga0070668_100140537 | 3300005347 | Bacteria | 1945 |
| 73 | Ga0070668_100382903 | 3300005347 | Bacteria | 1197 |
| 74 | Ga0070668_100485257 | 3300005347 | Bacteria | 1068 |
| 75 | Ga0070668_100823275 | 3300005347 | Bacteria | 826 |
| 76 | Ga0070669_100196450 | 3300005353 | Bacteria | 1585 |
| 77 | Ga0070669_100346758 | 3300005353 | Bacteria | 1204 |
| 78 | Ga0070669_100391208 | 3300005353 | Bacteria | 1136 |
| 79 | Ga0070671_100198173 | 3300005355 | Bacteria | 1702 |
| 80 | Ga0070671_100236190 | 3300005355 | Bacteria | 1551 |
| 81 | Ga0070671_100450287 | 3300005355 | Bacteria | 1104 |
| 82 | Ga0070671_100469477 | 3300005355 | Bacteria | 1080 |
| 83 | Ga0070673_100136304 | 3300005364 | Bacteria | 2066 |
| 84 | Ga0070673_100535313 | 3300005364 | Bacteria | 1063 |
| 85 | Ga0070688_100151913 | 3300005365 | Bacteria | 1584 |
| 86 | Ga0070688_100263101 | 3300005365 | Bacteria | 1232 |
| 87 | Ga0070659_100338838 | 3300005366 | Bacteria | 1259 |
| 88 | Ga0070659_100368734 | 3300005366 | Bacteria | 1207 |
| 89 | Ga0070659_100428373 | 3300005366 | Bacteria | 1120 |
| 90 | Ga0070659_100598793 | 3300005366 | Bacteria | 947 |
| 91 | Ga0070667_100573038 | 3300005367 | Bacteria | 1039 |
| 92 | Ga0070709_10000164 | 3300005434 | Bacteria | 42124 |
| 93 | Ga0070709_10017700 | 3300005434 | Bacteria | 4092 |
| 94 | Ga0070709_10055190 | 3300005434 | Bacteria | 2507 |
| 95 | Ga0070709_10086525 | 3300005434 | Bacteria | 2058 |
| 96 | Ga0070714_100030119 | 3300005435 | Bacteria | 4515 |
| 97 | Ga0070714_100062614 | 3300005435 | Bacteria | 3197 |
| 98 | Ga0070714_100104098 | 3300005435 | Bacteria | 2504 |
| 99 | Ga0070714_100117957 | 3300005435 | Bacteria | 2358 |
| 100 | Ga0070714_100123063 | 3300005435 | Bacteria | 2309 |
| 101 | Ga0070714_100249189 | 3300005435 | Bacteria | 1642 |
| 102 | Ga0070713_100004014 | 3300005436 | Bacteria | 9799 |
| 103 | Ga0070713_100029341 | 3300005436 | Bacteria | 4356 |
| 104 | Ga0070713_100054336 | 3300005436 | Bacteria | 3322 |
| 105 | Ga0070713_100081484 | 3300005436 | Bacteria | 2761 |
| 106 | Ga0070713_100131019 | 3300005436 | Bacteria | 2211 |
| 107 | Ga0070713_100205029 | 3300005436 | Bacteria | 1783 |
| 108 | Ga0070710_10000283 | 3300005437 | Bacteria | 24031 |
| 109 | Ga0070710_10053256 | 3300005437 | Bacteria | 2278 |
| 110 | Ga0070710_10069267 | 3300005437 | Bacteria | 2029 |
| 111 | Ga0070701_10240533 | 3300005438 | Bacteria | 1089 |
| 112 | Ga0070711_100005189 | 3300005439 | Bacteria | 7768 |
| 113 | Ga0070711_100013134 | 3300005439 | Bacteria | 5194 |
| 114 | Ga0070711_100025376 | 3300005439 | Bacteria | 3877 |
| 115 | Ga0070711_100089685 | 3300005439 | Bacteria | 2212 |
| 116 | Ga0070711_100165225 | 3300005439 | Bacteria | 1682 |
| 117 | Ga0070711_100179445 | 3300005439 | Bacteria | 1620 |
| 118 | Ga0070700_100044957 | 3300005441 | Bacteria | 2722 |
| 119 | Ga0070708_100066262 | 3300005445 | Bacteria | 3241 |
| 120 | Ga0070708_100096501 | 3300005445 | Bacteria | 2700 |
| 121 | Ga0070663_100041632 | 3300005455 | Bacteria | 3224 |
| 122 | Ga0070663_100139944 | 3300005455 | Bacteria | 1846 |
| 123 | Ga0070663_100147094 | 3300005455 | Bacteria | 1803 |
| 124 | Ga0070663_100212729 | 3300005455 | Bacteria | 1514 |
| 125 | Ga0070663_100274288 | 3300005455 | Bacteria | 1342 |
| 126 | Ga0070663_100296625 | 3300005455 | Bacteria | 1292 |
| 127 | Ga0070663_100393317 | 3300005455 | Bacteria | 1131 |
| 128 | Ga0070678_100092031 | 3300005456 | Bacteria | 2329 |
| 129 | Ga0070678_100137508 | 3300005456 | Bacteria | 1950 |
| 130 | Ga0070678_100256558 | 3300005456 | Bacteria | 1468 |
| 131 | Ga0070678_100373035 | 3300005456 | Bacteria | 1232 |
| 132 | Ga0070662_100183639 | 3300005457 | Bacteria | 1650 |
| 133 | Ga0070662_100515585 | 3300005457 | Bacteria | 998 |
| 134 | Ga0070662_100687996 | 3300005457 | Bacteria | 864 |
| 135 | Ga0070681_10017254 | 3300005458 | Bacteria | 7216 |
| 136 | Ga0070681_10093484 | 3300005458 | Bacteria | 2956 |
| 137 | Ga0070681_10094766 | 3300005458 | Bacteria | 2933 |
| 138 | Ga0070681_10299056 | 3300005458 | Bacteria | 1519 |
| 139 | Ga0070681_10374239 | 3300005458 | Bacteria | 1335 |
| 140 | Ga0070681_10505724 | 3300005458 | Bacteria | 1121 |
| 141 | Ga0068867_100000132 | 3300005459 | Bacteria | 47944 |
| 142 | Ga0068867_100181797 | 3300005459 | Bacteria | 1672 |
| 143 | Ga0068867_100229924 | 3300005459 | Bacteria | 1499 |
| 144 | Ga0070685_10285882 | 3300005466 | Bacteria | 1106 |
| 145 | Ga0070706_100277642 | 3300005467 | Bacteria | 1563 |
| 146 | Ga0070706_100520330 | 3300005467 | Bacteria | 1107 |
| 147 | Ga0070707_100028781 | 3300005468 | Bacteria | 5288 |
| 148 | Ga0070679_100023030 | 3300005530 | Bacteria | 6093 |
| 149 | Ga0070679_100216359 | 3300005530 | Bacteria | 1878 |
| 150 | Ga0070679_100251738 | 3300005530 | Bacteria | 1722 |
| 151 | Ga0070679_100262151 | 3300005530 | Bacteria | 1683 |
| 152 | Ga0070679_100496499 | 3300005530 | Bacteria | 1164 |
| 153 | Ga0070684_100006976 | 3300005535 | Bacteria | 8773 |
| 154 | Ga0070684_100026892 | 3300005535 | Bacteria | 4850 |
| 155 | Ga0070684_100185707 | 3300005535 | Bacteria | 1891 |
| 156 | Ga0068853_100000920 | 3300005539 | Bacteria | 20589 |
| 157 | Ga0068853_100070306 | 3300005539 | Bacteria | 3046 |
| 158 | Ga0068853_100311796 | 3300005539 | Bacteria | 1457 |
| 159 | Ga0068853_100637155 | 3300005539 | Bacteria | 1014 |
| 160 | Ga0068853_100661748 | 3300005539 | Bacteria | 995 |
| 161 | Ga0070672_100500904 | 3300005543 | Bacteria | 1051 |
| 162 | Ga0070693_100144964 | 3300005547 | Bacteria | 1499 |
| 163 | Ga0070693_100580223 | 3300005547 | Bacteria | 807 |
| 164 | Ga0070665_100024388 | 3300005548 | Bacteria | 6091 |
| 165 | Ga0070665_100101283 | 3300005548 | Bacteria | 2884 |
| 166 | Ga0070665_100211868 | 3300005548 | Bacteria | 1938 |
| 167 | Ga0070665_100270689 | 3300005548 | Bacteria | 1700 |
| 168 | Ga0070665_100308556 | 3300005548 | Bacteria | 1586 |
| 169 | Ga0070665_100346113 | 3300005548 | Bacteria | 1491 |
| 170 | Ga0070665_100422675 | 3300005548 | Bacteria | 1341 |
| 171 | Ga0070665_100545562 | 3300005548 | Bacteria | 1171 |
| 172 | Ga0070665_100592664 | 3300005548 | Bacteria | 1121 |
| 173 | Ga0068855_100028007 | 3300005563 | Bacteria | 6741 |
| 174 | Ga0068855_100098102 | 3300005563 | Bacteria | 3376 |
| 175 | Ga0068855_100105596 | 3300005563 | Bacteria | 3238 |
| 176 | Ga0068855_100233801 | 3300005563 | Bacteria | 2056 |
| 177 | Ga0068855_100298791 | 3300005563 | Bacteria | 1784 |
| 178 | Ga0068855_100455996 | 3300005563 | Bacteria | 1394 |
| 179 | Ga0068855_100674179 | 3300005563 | Bacteria | 1108 |
| 180 | Ga0068857_100028526 | 3300005577 | Bacteria | 4925 |
| 181 | Ga0068857_100035276 | 3300005577 | Bacteria | 4429 |
| 182 | Ga0068857_100208760 | 3300005577 | Bacteria | 1782 |
| 183 | Ga0068857_100311339 | 3300005577 | Bacteria | 1453 |
| 184 | Ga0068854_100062569 | 3300005578 | Bacteria | 2699 |
| 185 | Ga0068854_100092598 | 3300005578 | Bacteria | 2252 |
| 186 | Ga0068854_100191523 | 3300005578 | Bacteria | 1603 |
| 187 | Ga0068854_100255310 | 3300005578 | Bacteria | 1401 |
| 188 | Ga0068854_100431450 | 3300005578 | Bacteria | 1096 |
| 189 | Ga0068856_100004492 | 3300005614 | Bacteria | 13873 |
| 190 | Ga0068856_100292845 | 3300005614 | Bacteria | 1645 |
| 191 | Ga0068856_100349754 | 3300005614 | Bacteria | 1496 |
| 192 | Ga0068856_100363149 | 3300005614 | Bacteria | 1466 |
| 193 | Ga0068856_100822091 | 3300005614 | Bacteria | 948 |
| 194 | Ga0068852_100010275 | 3300005616 | Bacteria | 6983 |
| 195 | Ga0068852_100040281 | 3300005616 | Bacteria | 3940 |
| 196 | Ga0068852_100098915 | 3300005616 | Bacteria | 2628 |
| 197 | Ga0068852_100125731 | 3300005616 | Bacteria | 2354 |
| 198 | Ga0068852_100225110 | 3300005616 | Bacteria | 1785 |
| 199 | Ga0068852_100311084 | 3300005616 | Bacteria | 1527 |
| 200 | Ga0068852_100413880 | 3300005616 | Bacteria | 1328 |
| 201 | Ga0068852_100434126 | 3300005616 | Bacteria | 1297 |
| 202 | Ga0068852_100508440 | 3300005616 | Bacteria | 1200 |
| 203 | Ga0068859_100258476 | 3300005617 | Bacteria | 1832 |
| 204 | Ga0068859_100681946 | 3300005617 | Bacteria | 1119 |
| 205 | Ga0068864_100514833 | 3300005618 | Bacteria | 1153 |
| 206 | Ga0068866_10041018 | 3300005718 | Bacteria | 2294 |
| 207 | Ga0068861_100050132 | 3300005719 | Bacteria | 3164 |
| 208 | Ga0068861_100074402 | 3300005719 | Bacteria | 2641 |
| 209 | Ga0068861_100147213 | 3300005719 | Bacteria | 1928 |
| 210 | Ga0068861_100315152 | 3300005719 | Bacteria | 1360 |
| 211 | Ga0068851_10168405 | 3300005834 | Bacteria | 1207 |
| 212 | Ga0068863_100293033 | 3300005841 | Bacteria | 1577 |
| 213 | Ga0068858_100147750 | 3300005842 | Bacteria | 2208 |
| 214 | Ga0068858_100555483 | 3300005842 | Bacteria | 1112 |
| 215 | Ga0068858_100592646 | 3300005842 | Bacteria | 1075 |
| 216 | Ga0068858_100897382 | 3300005842 | Bacteria | 867 |
| 217 | Ga0068860_100017741 | 3300005843 | Bacteria | 6934 |
| 218 | Ga0068860_100057499 | 3300005843 | Bacteria | 3697 |
| 219 | Ga0068860_100097070 | 3300005843 | Bacteria | 2809 |
| 220 | Ga0068862_100107085 | 3300005844 | Bacteria | 2451 |
| 221 | Ga0068862_100170312 | 3300005844 | Bacteria | 1949 |
| 222 | Ga0068862_100339805 | 3300005844 | Bacteria | 1390 |
| 223 | Ga0068862_100635015 | 3300005844 | Bacteria | 1028 |
| 224 | Ga0068862_100753490 | 3300005844 | Bacteria | 948 |
| 225 | Ga0081455_10016293 | 3300005937 | Bacteria | 7181 |
| 226 | Ga0081455_10027264 | 3300005937 | Bacteria | 5236 |
| 227 | Ga0081455_10089378 | 3300005937 | Bacteria | 2500 |
| 228 | Ga0081455_10141870 | 3300005937 | Bacteria | 1865 |
| 229 | Ga0081455_10338688 | 3300005937 | Bacteria | 1065 |
| 230 | Ga0081540_1002717 | 3300005983 | Bacteria | 14394 |
| 231 | Ga0081540_1003025 | 3300005983 | Bacteria | 13470 |
| 232 | Ga0081540_1004243 | 3300005983 | Bacteria | 11008 |
| 233 | Ga0081540_1004583 | 3300005983 | Bacteria | 10468 |
| 234 | Ga0081540_1005857 | 3300005983 | Bacteria | 9090 |
| 235 | Ga0081540_1014469 | 3300005983 | Bacteria | 5053 |
| 236 | Ga0081540_1018885 | 3300005983 | Bacteria | 4211 |
| 237 | Ga0081540_1115847 | 3300005983 | Bacteria | 1123 |
| 238 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 239 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 240 | Ga0081539_10027283 | 3300005985 | Bacteria | 3621 |
| 241 | Ga0081539_10039012 | 3300005985 | Bacteria | 2808 |
| 242 | Ga0070717_10038762 | 3300006028 | Bacteria | 3874 |
| 243 | Ga0070717_10304845 | 3300006028 | Bacteria | 1416 |
| 244 | Ga0075365_10004924 | 3300006038 | Bacteria | 7142 |
| 245 | Ga0075365_10007177 | 3300006038 | Bacteria | 6219 |
| 246 | Ga0075365_10130855 | 3300006038 | Bacteria | 1736 |
| 247 | Ga0075365_10162096 | 3300006038 | Bacteria | 1558 |
| 248 | Ga0075365_10173348 | 3300006038 | Bacteria | 1506 |
| 249 | Ga0075365_10282347 | 3300006038 | Bacteria | 1168 |
| 250 | Ga0075365_10286354 | 3300006038 | Bacteria | 1159 |
| 251 | Ga0075365_10355630 | 3300006038 | Bacteria | 1032 |
| 252 | Ga0075365_10398776 | 3300006038 | Bacteria | 971 |
| 253 | Ga0075368_10007084 | 3300006042 | Bacteria | 3949 |
| 254 | Ga0075368_10057299 | 3300006042 | Bacteria | 1555 |
| 255 | Ga0075363_100000382 | 3300006048 | Bacteria | 13428 |
| 256 | Ga0075363_100005846 | 3300006048 | Bacteria | 5531 |
| 257 | Ga0075363_100009480 | 3300006048 | Bacteria | 4577 |
| 258 | Ga0075363_100126110 | 3300006048 | Bacteria | 1433 |
| 259 | Ga0075364_10000195 | 3300006051 | Bacteria | 28057 |
| 260 | Ga0075364_10049442 | 3300006051 | Bacteria | 2742 |
| 261 | Ga0075364_10086211 | 3300006051 | Bacteria | 2080 |
| 262 | Ga0075364_10150150 | 3300006051 | Bacteria | 1570 |
| 263 | Ga0075364_10162804 | 3300006051 | Bacteria | 1506 |
| 264 | Ga0075364_10174044 | 3300006051 | Bacteria | 1455 |
| 265 | Ga0075364_10335348 | 3300006051 | Bacteria | 1030 |
| 266 | Ga0070716_100008198 | 3300006173 | Bacteria | 5178 |
| 267 | Ga0070716_100009333 | 3300006173 | Bacteria | 4887 |
| 268 | Ga0070716_100032839 | 3300006173 | Bacteria | 2835 |
| 269 | Ga0070716_100199137 | 3300006173 | Bacteria | 1330 |
| 270 | Ga0070712_100023970 | 3300006175 | Bacteria | 4038 |
| 271 | Ga0070712_100027147 | 3300006175 | Bacteria | 3820 |
| 272 | Ga0070712_100096550 | 3300006175 | Bacteria | 2176 |
| 273 | Ga0075362_10035287 | 3300006177 | Bacteria | 2182 |
| 274 | Ga0075367_10080527 | 3300006178 | Bacteria | 1970 |
| 275 | Ga0075367_10097099 | 3300006178 | Bacteria | 1797 |
| 276 | Ga0075367_10171907 | 3300006178 | Bacteria | 1350 |
| 277 | Ga0075367_10177025 | 3300006178 | Bacteria | 1329 |
| 278 | Ga0075367_10298190 | 3300006178 | Bacteria | 1014 |
| 279 | Ga0075367_10312096 | 3300006178 | Bacteria | 990 |
| 280 | Ga0075367_10431034 | 3300006178 | Bacteria | 835 |
| 281 | Ga0075369_10038939 | 3300006186 | Bacteria | 2029 |
| 282 | Ga0075369_10118264 | 3300006186 | Bacteria | 1198 |
| 283 | Ga0075366_10012656 | 3300006195 | Bacteria | 4791 |
| 284 | Ga0075366_10055656 | 3300006195 | Bacteria | 2349 |
| 285 | Ga0075366_10179064 | 3300006195 | Bacteria | 1287 |
| 286 | Ga0097621_100021414 | 3300006237 | Bacteria | 5000 |
| 287 | Ga0097621_100338574 | 3300006237 | Bacteria | 1336 |
| 288 | Ga0097621_100397341 | 3300006237 | Bacteria | 1234 |
| 289 | Ga0075370_10018863 | 3300006353 | Bacteria | 3746 |
| 290 | Ga0075370_10059152 | 3300006353 | Bacteria | 2180 |
| 291 | Ga0075370_10181566 | 3300006353 | Bacteria | 1239 |
| 292 | Ga0068871_100040788 | 3300006358 | Bacteria | 3719 |
| 293 | Ga0068871_100048194 | 3300006358 | Bacteria | 3438 |
| 294 | Ga0068871_100562738 | 3300006358 | Bacteria | 1034 |
| 295 | Ga0075428_100438771 | 3300006844 | Bacteria | 1399 |
| 296 | Ga0075430_100026357 | 3300006846 | Bacteria | 4946 |
| 297 | Ga0075430_100105658 | 3300006846 | Bacteria | 2350 |
| 298 | Ga0075431_100428391 | 3300006847 | Bacteria | 1321 |
| 299 | Ga0075434_100047268 | 3300006871 | Bacteria | 4271 |
| 300 | Ga0075434_100459994 | 3300006871 | Bacteria | 1294 |
| 301 | Ga0068865_100178984 | 3300006881 | Bacteria | 1631 |
| 302 | Ga0068865_100179000 | 3300006881 | Bacteria | 1631 |
| 303 | Ga0068865_100269681 | 3300006881 | Bacteria | 1351 |
| 304 | Ga0097620_100258488 | 3300006931 | Bacteria | 1832 |
| 305 | Ga0097620_100681901 | 3300006931 | Bacteria | 1119 |
| 306 | Ga0099825_1017392 | 3300006941 | Bacteria | 5890 |
| 307 | Ga0099824_1007180 | 3300006942 | Bacteria | 14887 |
| 308 | Ga0099824_1027556 | 3300006942 | Bacteria | 2723 |
| 309 | Ga0099822_1002271 | 3300006943 | Bacteria | 23789 |
| 310 | Ga0099823_1023214 | 3300006944 | Bacteria | 5693 |
| 311 | Ga0075435_100380488 | 3300007076 | Bacteria | 1212 |
| 312 | Ga0099794_10047333 | 3300007265 | Bacteria | 2062 |
| 313 | Ga0099795_10037802 | 3300007788 | Bacteria | 1701 |
| 314 | Ga0105250_10165893 | 3300009092 | Bacteria | 923 |
| 315 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 316 | Ga0105240_10012727 | 3300009093 | Bacteria | 11593 |
| 317 | Ga0105240_10020094 | 3300009093 | Bacteria | 8915 |
| 318 | Ga0105240_10022735 | 3300009093 | Bacteria | 8306 |
| 319 | Ga0105240_10055770 | 3300009093 | Bacteria | 4947 |
| 320 | Ga0105240_10332844 | 3300009093 | Bacteria | 1727 |
| 321 | Ga0105240_10719140 | 3300009093 | Bacteria | 1088 |
| 322 | Ga0105240_10734820 | 3300009093 | Bacteria | 1074 |
| 323 | Ga0105245_10226247 | 3300009098 | Bacteria | 1807 |
| 324 | Ga0105247_10023886 | 3300009101 | Bacteria | 3683 |
| 325 | Ga0105247_10057618 | 3300009101 | Bacteria | 2403 |
| 326 | Ga0105247_10182009 | 3300009101 | Bacteria | 1403 |
| 327 | Ga0105247_10293768 | 3300009101 | Bacteria | 1125 |
| 328 | Ga0105243_10263184 | 3300009148 | Bacteria | 1545 |
| 329 | Ga0105243_10271879 | 3300009148 | Bacteria | 1522 |
| 330 | Ga0105243_10430073 | 3300009148 | Bacteria | 1234 |
| 331 | Ga0105243_10553103 | 3300009148 | Bacteria | 1100 |
| 332 | Ga0105243_10562392 | 3300009148 | Bacteria | 1091 |
| 333 | Ga0105241_10049205 | 3300009174 | Bacteria | 3209 |
| 334 | Ga0105241_10339602 | 3300009174 | Bacteria | 1301 |
| 335 | Ga0105241_10391324 | 3300009174 | Bacteria | 1217 |
| 336 | Ga0105248_10120731 | 3300009177 | Bacteria | 2957 |
| 337 | Ga0105248_10635602 | 3300009177 | Bacteria | 1204 |
| 338 | Ga0105248_10689155 | 3300009177 | Bacteria | 1153 |
| 339 | Ga0105248_10898060 | 3300009177 | Bacteria | 1000 |
| 340 | Ga0105237_10002598 | 3300009545 | Bacteria | 22276 |
| 341 | Ga0105237_10017536 | 3300009545 | Bacteria | 7421 |
| 342 | Ga0105237_10091115 | 3300009545 | Bacteria | 3038 |
| 343 | Ga0105237_10221142 | 3300009545 | Bacteria | 1894 |
| 344 | Ga0105237_10240258 | 3300009545 | Bacteria | 1812 |
| 345 | Ga0105237_10247679 | 3300009545 | Bacteria | 1784 |
| 346 | Ga0105237_10301126 | 3300009545 | Bacteria | 1606 |
| 347 | Ga0105237_10352310 | 3300009545 | Bacteria | 1476 |
| 348 | Ga0105237_10475520 | 3300009545 | Bacteria | 1256 |
| 349 | Ga0105237_10595280 | 3300009545 | Bacteria | 1113 |
| 350 | Ga0105237_10689385 | 3300009545 | Bacteria | 1028 |
| 351 | Ga0105238_10009549 | 3300009551 | Bacteria | 9706 |
| 352 | Ga0105238_10025758 | 3300009551 | Bacteria | 5997 |
| 353 | Ga0105238_10069644 | 3300009551 | Bacteria | 3518 |
| 354 | Ga0105238_10104060 | 3300009551 | Bacteria | 2820 |
| 355 | Ga0105238_10338890 | 3300009551 | Bacteria | 1491 |
| 356 | Ga0105238_10436104 | 3300009551 | Bacteria | 1306 |
| 357 | Ga0105238_10468490 | 3300009551 | Bacteria | 1258 |
| 358 | Ga0105238_10523078 | 3300009551 | Bacteria | 1189 |
| 359 | Ga0105249_10280767 | 3300009553 | Bacteria | 1663 |
| 360 | Ga0105249_10967360 | 3300009553 | Bacteria | 919 |
| 361 | Ga0099796_10013549 | 3300010159 | Bacteria | 2332 |
| 362 | Ga0105239_10001552 | 3300010375 | Bacteria | 30352 |
| 363 | Ga0105239_10029609 | 3300010375 | Bacteria | 6020 |
| 364 | Ga0105239_10049028 | 3300010375 | Bacteria | 4630 |
| 365 | Ga0105239_10066302 | 3300010375 | Bacteria | 3966 |
| 366 | Ga0105239_10098964 | 3300010375 | Bacteria | 3224 |
| 367 | Ga0105239_10322873 | 3300010375 | Bacteria | 1741 |
| 368 | Ga0105239_10367445 | 3300010375 | Bacteria | 1625 |
| 369 | Ga0105239_10420512 | 3300010375 | Bacteria | 1514 |
| 370 | Ga0105239_10818285 | 3300010375 | Bacteria | 1067 |
| 371 | Ga0105239_11237692 | 3300010375 | Bacteria | 860 |
| 372 | Ga0105246_10151091 | 3300011119 | Bacteria | 1758 |
| 373 | Ga0157373_10143046 | 3300013100 | Bacteria | 1682 |
| 374 | Ga0157370_10002466 | 3300013104 | Bacteria | 22319 |
| 375 | Ga0157370_10049322 | 3300013104 | Bacteria | 4029 |
| 376 | Ga0157370_10365195 | 3300013104 | Bacteria | 1330 |
| 377 | Ga0157370_10436693 | 3300013104 | Bacteria | 1204 |
| 378 | Ga0157369_10011256 | 3300013105 | Bacteria | 10165 |
| 379 | Ga0157369_10030438 | 3300013105 | Bacteria | 5952 |
| 380 | Ga0157369_10343414 | 3300013105 | Bacteria | 1551 |
| 381 | Ga0157369_10429996 | 3300013105 | Bacteria | 1368 |
| 382 | Ga0157369_10576917 | 3300013105 | Bacteria | 1162 |
| 383 | Ga0157369_10778104 | 3300013105 | Bacteria | 984 |
| 384 | Ga0157369_10955390 | 3300013105 | Bacteria | 878 |
| 385 | Ga0157374_10141827 | 3300013296 | Bacteria | 2333 |
| 386 | Ga0157374_10284100 | 3300013296 | Bacteria | 1634 |
| 387 | Ga0157374_10319696 | 3300013296 | Bacteria | 1538 |
| 388 | Ga0157374_10868258 | 3300013296 | Bacteria | 919 |
| 389 | Ga0157378_10020915 | 3300013297 | Bacteria | 5757 |
| 390 | Ga0157378_10288653 | 3300013297 | Bacteria | 1584 |
| 391 | Ga0157378_10463998 | 3300013297 | Bacteria | 1259 |
| 392 | Ga0157378_10499372 | 3300013297 | Bacteria | 1215 |
| 393 | Ga0157378_10837462 | 3300013297 | Bacteria | 947 |
| 394 | Ga0163162_10021854 | 3300013306 | Bacteria | 6304 |
| 395 | Ga0163162_10065364 | 3300013306 | Bacteria | 3684 |
| 396 | Ga0163162_10139830 | 3300013306 | Bacteria | 2534 |
| 397 | Ga0163162_10425837 | 3300013306 | Bacteria | 1459 |
| 398 | Ga0163162_10465549 | 3300013306 | Bacteria | 1396 |
| 399 | Ga0163162_10927317 | 3300013306 | Bacteria | 983 |
| 400 | Ga0157372_10140987 | 3300013307 | Bacteria | 2777 |
| 401 | Ga0157375_10126812 | 3300013308 | Bacteria | 2668 |
| 402 | Ga0157375_10444794 | 3300013308 | Bacteria | 1461 |
| 403 | Ga0157375_10481067 | 3300013308 | Bacteria | 1407 |
| 404 | Ga0157375_10745912 | 3300013308 | Bacteria | 1131 |
| 405 | Ga0163163_10002309 | 3300014325 | Bacteria | 16099 |
| 406 | Ga0163163_10090473 | 3300014325 | Bacteria | 3073 |
| 407 | Ga0163163_10289488 | 3300014325 | Bacteria | 1690 |
| 408 | Ga0163163_10479801 | 3300014325 | Bacteria | 1304 |
| 409 | Ga0163163_10947428 | 3300014325 | Bacteria | 924 |
| 410 | Ga0157380_10179675 | 3300014326 | Bacteria | 1858 |
| 411 | Ga0157380_10264590 | 3300014326 | Bacteria | 1564 |
| 412 | Ga0157380_10350881 | 3300014326 | Bacteria | 1380 |
| 413 | Ga0182008_10048597 | 3300014497 | Bacteria | 2107 |
| 414 | Ga0182008_10119980 | 3300014497 | Bacteria | 1307 |
| 415 | Ga0157377_10063879 | 3300014745 | Bacteria | 2110 |
| 416 | Ga0157377_10078346 | 3300014745 | Bacteria | 1926 |
| 417 | Ga0157379_10397168 | 3300014968 | Bacteria | 1267 |
| 418 | Ga0157379_10480485 | 3300014968 | Bacteria | 1150 |
| 419 | Ga0157379_10555022 | 3300014968 | Bacteria | 1069 |
| 420 | Ga0157376_10444440 | 3300014969 | Bacteria | 1263 |
| 421 | Ga0182007_10002170 | 3300015262 | Bacteria | 9963 |
| 422 | Ga0182005_1001931 | 3300015265 | Bacteria | 7840 |
| 423 | Ga0206356_11507318 | 3300020070 | Bacteria | 1011 |
| 424 | Ga0206353_10766002 | 3300020082 | Bacteria | 1065 |
| 425 | Ga0214544_1000665 | 3300021320 | Bacteria | 65630 |
| 426 | Ga0214542_1000486 | 3300021321 | Bacteria | 71884 |
| 427 | Ga0214545_1000307 | 3300021324 | Bacteria | 71884 |
| 428 | Ga0214543_1006816 | 3300021327 | Bacteria | 20069 |
| 429 | Ga0213873_10003722 | 3300021358 | Bacteria | 2780 |
| 430 | Ga0213872_10005811 | 3300021361 | Bacteria | 6268 |
| 431 | Ga0213874_10035729 | 3300021377 | Bacteria | 1461 |
| 432 | Ga0213874_10077232 | 3300021377 | Bacteria | 1073 |
| 433 | Ga0213874_10107495 | 3300021377 | Bacteria | 934 |
| 434 | Ga0213876_10005727 | 3300021384 | Bacteria | 6809 |
| 435 | Ga0213876_10140100 | 3300021384 | Bacteria | 1286 |
| 436 | Ga0213871_10011628 | 3300021441 | Bacteria | 2026 |
| 437 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 438 | Ga0209760_102134 | 3300025207 | Bacteria | 1897 |
| 439 | Ga0209563_102071 | 3300025230 | Bacteria | 4752 |
| 440 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 441 | Ga0209258_100603 | 3300025242 | Bacteria | 29333 |
| 442 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 443 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 444 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 445 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 446 | Ga0209677_100543 | 3300025253 | Bacteria | 21018 |
| 447 | Ga0209677_102252 | 3300025253 | Bacteria | 7467 |
| 448 | Ga0209677_108510 | 3300025253 | Bacteria | 1981 |
| 449 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 450 | Ga0209148_1009014 | 3300025254 | Bacteria | 1971 |
| 451 | Ga0209148_1009972 | 3300025254 | Bacteria | 1822 |
| 452 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 453 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 454 | Ga0209233_1000072 | 3300025261 | Bacteria | 363074 |
| 455 | Ga0209233_1000331 | 3300025261 | Bacteria | 48397 |
| 456 | Ga0209233_1001838 | 3300025261 | Bacteria | 8147 |
| 457 | Ga0209233_1003799 | 3300025261 | Bacteria | 5269 |
| 458 | Ga0209233_1026225 | 3300025261 | Bacteria | 1428 |
| 459 | Ga0209455_1006515 | 3300025272 | Bacteria | 3434 |
| 460 | Ga0209673_1017234 | 3300025273 | Bacteria | 2668 |
| 461 | Ga0209130_1000132 | 3300025284 | Bacteria | 119765 |
| 462 | Ga0209675_1003067 | 3300025291 | Bacteria | 8191 |
| 463 | Ga0209675_1012970 | 3300025291 | Bacteria | 2644 |
| 464 | Ga0209676_1001214 | 3300025292 | Bacteria | 27415 |
| 465 | Ga0209676_1014191 | 3300025292 | Bacteria | 3010 |
| 466 | Ga0209676_1020233 | 3300025292 | Bacteria | 2266 |
| 467 | Ga0209025_1004676 | 3300025294 | Bacteria | 11701 |
| 468 | Ga0209025_1061552 | 3300025294 | Bacteria | 1400 |
| 469 | Ga0209564_1001079 | 3300025295 | Bacteria | 32728 |
| 470 | Ga0209564_1006939 | 3300025295 | Bacteria | 5955 |
| 471 | Ga0209564_1007238 | 3300025295 | Bacteria | 5772 |
| 472 | Ga0209564_1011458 | 3300025295 | Bacteria | 3970 |
| 473 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 474 | Ga0209758_1001816 | 3300025297 | Bacteria | 23562 |
| 475 | Ga0209758_1001900 | 3300025297 | Bacteria | 22801 |
| 476 | Ga0209758_1002809 | 3300025297 | Bacteria | 16970 |
| 477 | Ga0209758_1003717 | 3300025297 | Bacteria | 13525 |
| 478 | Ga0209758_1007298 | 3300025297 | Bacteria | 7579 |
| 479 | Ga0209758_1008809 | 3300025297 | Bacteria | 6426 |
| 480 | Ga0209758_1021604 | 3300025297 | Bacteria | 2993 |
| 481 | Ga0209758_1040930 | 3300025297 | Bacteria | 1740 |
| 482 | Ga0209758_1052380 | 3300025297 | Bacteria | 1412 |
| 483 | Ga0209758_1067323 | 3300025297 | Bacteria | 1146 |
| 484 | Ga0209050_1001391 | 3300025298 | Bacteria | 26316 |
| 485 | Ga0209256_1002256 | 3300025299 | Bacteria | 16362 |
| 486 | Ga0209256_1003770 | 3300025299 | Bacteria | 10211 |
| 487 | Ga0209256_1005844 | 3300025299 | Bacteria | 6836 |
| 488 | Ga0209256_1024062 | 3300025299 | Bacteria | 1801 |
| 489 | Ga0207426_1000246 | 3300025302 | Bacteria | 119765 |
| 490 | Ga0207426_1001802 | 3300025302 | Bacteria | 15949 |
| 491 | Ga0207426_1004864 | 3300025302 | Bacteria | 6361 |
| 492 | Ga0207426_1015528 | 3300025302 | Bacteria | 2758 |
| 493 | Ga0209051_1010403 | 3300025303 | Bacteria | 4702 |
| 494 | Ga0209051_1032751 | 3300025303 | Bacteria | 1977 |
| 495 | Ga0209257_1000861 | 3300025304 | Bacteria | 43224 |
| 496 | Ga0209257_1001693 | 3300025304 | Bacteria | 24766 |
| 497 | Ga0209257_1004375 | 3300025304 | Bacteria | 10990 |
| 498 | Ga0209257_1007230 | 3300025304 | Bacteria | 6791 |
| 499 | Ga0209257_1044554 | 3300025304 | Bacteria | 1294 |
| 500 | Ga0207697_10057289 | 3300025315 | Bacteria | 1617 |
| 501 | Ga0207656_10047104 | 3300025321 | Bacteria | 1852 |
| 502 | Ga0207656_10237828 | 3300025321 | Bacteria | 889 |
| 503 | Ga0207696_1029161 | 3300025711 | Bacteria | 1687 |
| 504 | Ga0207682_10123497 | 3300025893 | Bacteria | 1150 |
| 505 | Ga0207692_10000528 | 3300025898 | Bacteria | 13562 |
| 506 | Ga0207692_10118118 | 3300025898 | Bacteria | 1481 |
| 507 | Ga0207692_10295086 | 3300025898 | Bacteria | 985 |
| 508 | Ga0207642_10078666 | 3300025899 | Bacteria | 1594 |
| 509 | Ga0207710_10111278 | 3300025900 | Bacteria | 1300 |
| 510 | Ga0207710_10196426 | 3300025900 | Bacteria | 995 |
| 511 | Ga0207647_10166237 | 3300025904 | Bacteria | 1286 |
| 512 | Ga0207685_10015765 | 3300025905 | Bacteria | 2402 |
| 513 | Ga0207699_10000514 | 3300025906 | Bacteria | 19239 |
| 514 | Ga0207699_10008188 | 3300025906 | Bacteria | 5146 |
| 515 | Ga0207699_10010527 | 3300025906 | Bacteria | 4646 |
| 516 | Ga0207699_10041934 | 3300025906 | Bacteria | 2647 |
| 517 | Ga0207699_10214747 | 3300025906 | Bacteria | 1310 |
| 518 | Ga0207699_10373520 | 3300025906 | Bacteria | 1011 |
| 519 | Ga0207645_10041038 | 3300025907 | Bacteria | 2963 |
| 520 | Ga0207645_10257501 | 3300025907 | Bacteria | 1155 |
| 521 | Ga0207643_10070380 | 3300025908 | Bacteria | 2012 |
| 522 | Ga0207643_10078747 | 3300025908 | Bacteria | 1907 |
| 523 | Ga0207643_10199373 | 3300025908 | Bacteria | 1218 |
| 524 | Ga0207705_10131879 | 3300025909 | Bacteria | 1860 |
| 525 | Ga0207684_10160331 | 3300025910 | Bacteria | 1937 |
| 526 | Ga0207654_10236159 | 3300025911 | Bacteria | 1219 |
| 527 | Ga0207707_10001310 | 3300025912 | Bacteria | 23197 |
| 528 | Ga0207707_10001402 | 3300025912 | Bacteria | 22333 |
| 529 | Ga0207707_10051217 | 3300025912 | Bacteria | 3596 |
| 530 | Ga0207707_10095278 | 3300025912 | Bacteria | 2601 |
| 531 | Ga0207707_10131454 | 3300025912 | Bacteria | 2189 |
| 532 | Ga0207707_10364834 | 3300025912 | Bacteria | 1243 |
| 533 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 534 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 535 | Ga0207695_10003993 | 3300025913 | Bacteria | 20356 |
| 536 | Ga0207695_10129811 | 3300025913 | Bacteria | 2478 |
| 537 | Ga0207695_10355538 | 3300025913 | Bacteria | 1351 |
| 538 | Ga0207695_10372267 | 3300025913 | Bacteria | 1315 |
| 539 | Ga0207671_10000226 | 3300025914 | Bacteria | 84886 |
| 540 | Ga0207671_10020952 | 3300025914 | Bacteria | 4970 |
| 541 | Ga0207671_10048383 | 3300025914 | Bacteria | 3147 |
| 542 | Ga0207671_10221193 | 3300025914 | Bacteria | 1483 |
| 543 | Ga0207671_10498463 | 3300025914 | Bacteria | 971 |
| 544 | Ga0207693_10208915 | 3300025915 | Bacteria | 1535 |
| 545 | Ga0207693_10231153 | 3300025915 | Bacteria | 1452 |
| 546 | Ga0207663_10000375 | 3300025916 | Bacteria | 19499 |
| 547 | Ga0207663_10055118 | 3300025916 | Bacteria | 2493 |
| 548 | Ga0207663_10137563 | 3300025916 | Bacteria | 1697 |
| 549 | Ga0207663_10231549 | 3300025916 | Bacteria | 1350 |
| 550 | Ga0207663_10412634 | 3300025916 | Bacteria | 1035 |
| 551 | Ga0207660_10047438 | 3300025917 | Bacteria | 3037 |
| 552 | Ga0207660_10058358 | 3300025917 | Bacteria | 2767 |
| 553 | Ga0207660_10138790 | 3300025917 | Bacteria | 1857 |
| 554 | Ga0207660_10148215 | 3300025917 | Bacteria | 1800 |
| 555 | Ga0207660_10220462 | 3300025917 | Bacteria | 1488 |
| 556 | Ga0207660_10251525 | 3300025917 | Bacteria | 1395 |
| 557 | Ga0207662_10211110 | 3300025918 | Bacteria | 1260 |
| 558 | Ga0207657_10042668 | 3300025919 | Bacteria | 4000 |
| 559 | Ga0207657_10049757 | 3300025919 | Bacteria | 3649 |
| 560 | Ga0207657_10291162 | 3300025919 | Bacteria | 1295 |
| 561 | Ga0207657_10357314 | 3300025919 | Bacteria | 1152 |
| 562 | Ga0207649_10040379 | 3300025920 | Bacteria | 2836 |
| 563 | Ga0207649_10301725 | 3300025920 | Bacteria | 1171 |
| 564 | Ga0207649_10349453 | 3300025920 | Bacteria | 1094 |
| 565 | Ga0207652_10001370 | 3300025921 | Bacteria | 21663 |
| 566 | Ga0207652_10016073 | 3300025921 | Bacteria | 6104 |
| 567 | Ga0207652_10276187 | 3300025921 | Bacteria | 1516 |
| 568 | Ga0207646_10105621 | 3300025922 | Bacteria | 2526 |
| 569 | Ga0207681_10288869 | 3300025923 | Bacteria | 1294 |
| 570 | Ga0207694_10030854 | 3300025924 | Bacteria | 4092 |
| 571 | Ga0207694_10059035 | 3300025924 | Bacteria | 2984 |
| 572 | Ga0207694_10439491 | 3300025924 | Bacteria | 1088 |
| 573 | Ga0207694_10494651 | 3300025924 | Bacteria | 1024 |
| 574 | Ga0207650_10256799 | 3300025925 | Bacteria | 1416 |
| 575 | Ga0207687_10002193 | 3300025927 | Bacteria | 13332 |
| 576 | Ga0207700_10004601 | 3300025928 | Bacteria | 8166 |
| 577 | Ga0207700_10062122 | 3300025928 | Bacteria | 2836 |
| 578 | Ga0207700_10072990 | 3300025928 | Bacteria | 2648 |
| 579 | Ga0207700_10091578 | 3300025928 | Bacteria | 2402 |
| 580 | Ga0207700_10115402 | 3300025928 | Bacteria | 2168 |
| 581 | Ga0207700_10158564 | 3300025928 | Bacteria | 1877 |
| 582 | Ga0207700_10219356 | 3300025928 | Bacteria | 1612 |
| 583 | Ga0207664_10004078 | 3300025929 | Bacteria | 9847 |
| 584 | Ga0207664_10027086 | 3300025929 | Bacteria | 4341 |
| 585 | Ga0207664_10041295 | 3300025929 | Bacteria | 3593 |
| 586 | Ga0207664_10245334 | 3300025929 | Bacteria | 1561 |
| 587 | Ga0207644_10072932 | 3300025931 | Bacteria | 2516 |
| 588 | Ga0207690_10166497 | 3300025932 | Bacteria | 1648 |
| 589 | Ga0207690_10471515 | 3300025932 | Bacteria | 1012 |
| 590 | Ga0207706_10138351 | 3300025933 | Bacteria | 2142 |
| 591 | Ga0207709_10247931 | 3300025935 | Bacteria | 1299 |
| 592 | Ga0207709_10281180 | 3300025935 | Bacteria | 1229 |
| 593 | Ga0207669_10011353 | 3300025937 | Bacteria | 4330 |
| 594 | Ga0207669_10027226 | 3300025937 | Bacteria | 3126 |
| 595 | Ga0207669_10257188 | 3300025937 | Bacteria | 1304 |
| 596 | Ga0207704_10240201 | 3300025938 | Bacteria | 1353 |
| 597 | Ga0207665_10016516 | 3300025939 | Bacteria | 4848 |
| 598 | Ga0207665_10035202 | 3300025939 | Bacteria | 3322 |
| 599 | Ga0207665_10054050 | 3300025939 | Bacteria | 2707 |
| 600 | Ga0207665_10146904 | 3300025939 | Bacteria | 1685 |
| 601 | Ga0207665_10267605 | 3300025939 | Bacteria | 1268 |
| 602 | Ga0207665_10355207 | 3300025939 | Bacteria | 1107 |
| 603 | Ga0207691_10175248 | 3300025940 | Bacteria | 1876 |
| 604 | Ga0207691_10310873 | 3300025940 | Bacteria | 1352 |
| 605 | Ga0207711_10333200 | 3300025941 | Bacteria | 1404 |
| 606 | Ga0207711_10442796 | 3300025941 | Bacteria | 1209 |
| 607 | Ga0207689_10012963 | 3300025942 | Bacteria | 7118 |
| 608 | Ga0207689_10058572 | 3300025942 | Bacteria | 3168 |
| 609 | Ga0207689_10157738 | 3300025942 | Bacteria | 1870 |
| 610 | Ga0207689_10253696 | 3300025942 | Bacteria | 1455 |
| 611 | Ga0207689_10351545 | 3300025942 | Bacteria | 1225 |
| 612 | Ga0207661_10000878 | 3300025944 | Bacteria | 19794 |
| 613 | Ga0207661_10026373 | 3300025944 | Bacteria | 4427 |
| 614 | Ga0207661_10154480 | 3300025944 | Bacteria | 1986 |
| 615 | Ga0207661_10666776 | 3300025944 | Bacteria | 956 |
| 616 | Ga0207679_10049493 | 3300025945 | Bacteria | 3066 |
| 617 | Ga0207667_10002941 | 3300025949 | Bacteria | 21147 |
| 618 | Ga0207667_10051535 | 3300025949 | Bacteria | 4339 |
| 619 | Ga0207667_10224638 | 3300025949 | Bacteria | 1924 |
| 620 | Ga0207667_10350671 | 3300025949 | Bacteria | 1505 |
| 621 | Ga0207667_10381571 | 3300025949 | Bacteria | 1436 |
| 622 | Ga0207667_10387579 | 3300025949 | Bacteria | 1423 |
| 623 | Ga0207651_10799949 | 3300025960 | Bacteria | 836 |
| 624 | Ga0207712_10412499 | 3300025961 | Bacteria | 1138 |
| 625 | Ga0207668_10293540 | 3300025972 | Bacteria | 1338 |
| 626 | Ga0207668_10360208 | 3300025972 | Bacteria | 1218 |
| 627 | Ga0207668_10372735 | 3300025972 | Bacteria | 1199 |
| 628 | Ga0207668_10462947 | 3300025972 | Bacteria | 1084 |
| 629 | Ga0207640_10004118 | 3300025981 | Bacteria | 7859 |
| 630 | Ga0207640_10018861 | 3300025981 | Bacteria | 4062 |
| 631 | Ga0207640_10280025 | 3300025981 | Bacteria | 1309 |
| 632 | Ga0207640_10468153 | 3300025981 | Bacteria | 1042 |
| 633 | Ga0207640_10710820 | 3300025981 | Bacteria | 862 |
| 634 | Ga0207658_10109156 | 3300025986 | Bacteria | 2184 |
| 635 | Ga0207658_10531026 | 3300025986 | Bacteria | 1051 |
| 636 | Ga0207677_10006274 | 3300026023 | Bacteria | 6505 |
| 637 | Ga0207677_10064251 | 3300026023 | Bacteria | 2555 |
| 638 | Ga0207677_10290760 | 3300026023 | Bacteria | 1346 |
| 639 | Ga0207677_10490919 | 3300026023 | Bacteria | 1060 |
| 640 | Ga0207703_10194914 | 3300026035 | Bacteria | 1797 |
| 641 | Ga0207703_10209416 | 3300026035 | Bacteria | 1737 |
| 642 | Ga0207703_10272804 | 3300026035 | Bacteria | 1533 |
| 643 | Ga0207703_10711359 | 3300026035 | Bacteria | 956 |
| 644 | Ga0207639_10191284 | 3300026041 | Bacteria | 1748 |
| 645 | Ga0207639_10343545 | 3300026041 | Bacteria | 1331 |
| 646 | Ga0207639_10425442 | 3300026041 | Bacteria | 1201 |
| 647 | Ga0207639_10476951 | 3300026041 | Bacteria | 1136 |
| 648 | Ga0207639_10777349 | 3300026041 | Bacteria | 891 |
| 649 | Ga0207678_10073898 | 3300026067 | Bacteria | 2921 |
| 650 | Ga0207678_10075876 | 3300026067 | Bacteria | 2879 |
| 651 | Ga0207678_10173331 | 3300026067 | Bacteria | 1842 |
| 652 | Ga0207678_10210337 | 3300026067 | Bacteria | 1664 |
| 653 | Ga0207678_10244235 | 3300026067 | Bacteria | 1538 |
| 654 | Ga0207678_10264609 | 3300026067 | Bacteria | 1474 |
| 655 | Ga0207678_10267737 | 3300026067 | Bacteria | 1465 |
| 656 | Ga0207678_10283635 | 3300026067 | Bacteria | 1422 |
| 657 | Ga0207678_10293874 | 3300026067 | Bacteria | 1396 |
| 658 | Ga0207678_10349488 | 3300026067 | Bacteria | 1275 |
| 659 | Ga0207708_10035100 | 3300026075 | Bacteria | 3816 |
| 660 | Ga0207708_10326432 | 3300026075 | Bacteria | 1253 |
| 661 | Ga0207702_10000253 | 3300026078 | Bacteria | 62073 |
| 662 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 663 | Ga0207702_10231624 | 3300026078 | Bacteria | 1727 |
| 664 | Ga0207702_10329654 | 3300026078 | Bacteria | 1456 |
| 665 | Ga0207702_10486013 | 3300026078 | Bacteria | 1202 |
| 666 | Ga0207641_10349703 | 3300026088 | Bacteria | 1408 |
| 667 | Ga0207641_10764809 | 3300026088 | Bacteria | 954 |
| 668 | Ga0207648_10509839 | 3300026089 | Bacteria | 1101 |
| 669 | Ga0207676_10129529 | 3300026095 | Bacteria | 2143 |
| 670 | Ga0207674_10028915 | 3300026116 | Bacteria | 5842 |
| 671 | Ga0207674_10042170 | 3300026116 | Bacteria | 4715 |
| 672 | Ga0207674_10311069 | 3300026116 | Bacteria | 1524 |
| 673 | Ga0207674_10580713 | 3300026116 | Bacteria | 1083 |
| 674 | Ga0207675_100149906 | 3300026118 | Bacteria | 2219 |
| 675 | Ga0207675_100154963 | 3300026118 | Bacteria | 2183 |
| 676 | Ga0207675_100248454 | 3300026118 | Bacteria | 1721 |
| 677 | Ga0207675_100454123 | 3300026118 | Bacteria | 1270 |
| 678 | Ga0207675_100542946 | 3300026118 | Bacteria | 1161 |
| 679 | Ga0207683_10120309 | 3300026121 | Bacteria | 2357 |
| 680 | Ga0207683_10130661 | 3300026121 | Bacteria | 2259 |
| 681 | Ga0207683_10142206 | 3300026121 | Bacteria | 2163 |
| 682 | Ga0207683_10231116 | 3300026121 | Bacteria | 1687 |
| 683 | Ga0207683_10246688 | 3300026121 | Bacteria | 1629 |
| 684 | Ga0207683_10301546 | 3300026121 | Bacteria | 1466 |
| 685 | Ga0207683_10577699 | 3300026121 | Bacteria | 1040 |
| 686 | Ga0207698_10024892 | 3300026142 | Bacteria | 4207 |
| 687 | Ga0207698_10126294 | 3300026142 | Bacteria | 2176 |
| 688 | Ga0207698_10300921 | 3300026142 | Bacteria | 1493 |
| 689 | Ga0207698_10307333 | 3300026142 | Bacteria | 1479 |
| 690 | Ga0207698_10399309 | 3300026142 | Bacteria | 1313 |
| 691 | Ga0207698_10426604 | 3300026142 | Bacteria | 1274 |
| 692 | Ga0207698_10493304 | 3300026142 | Bacteria | 1190 |
| 693 | Ga0209389_1000102 | 3300027296 | Bacteria | 78475 |
| 694 | Ga0209389_1000142 | 3300027296 | Bacteria | 62072 |
| 695 | Ga0209371_1001938 | 3300027312 | Bacteria | 12623 |
| 696 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 697 | Ga0209589_1000331 | 3300027357 | Bacteria | 62072 |
| 698 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 699 | Ga0209489_100404 | 3300027361 | Bacteria | 78473 |
| 700 | Ga0209489_100818 | 3300027361 | Bacteria | 62070 |
| 701 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 702 | Ga0209700_100408 | 3300027363 | Bacteria | 78496 |
| 703 | Ga0209179_1001374 | 3300027512 | Bacteria | 2956 |
| 704 | Ga0209588_1001357 | 3300027671 | Bacteria | 6375 |
| 705 | Ga0209813_10009317 | 3300027866 | Bacteria | 2508 |
| 706 | Ga0209813_10031457 | 3300027866 | Bacteria | 1567 |
| 707 | Ga0207428_10243821 | 3300027907 | Bacteria | 1342 |
| 708 | Ga0268266_10008616 | 3300028379 | Bacteria | 9058 |
| 709 | Ga0268266_10048797 | 3300028379 | Bacteria | 3629 |
| 710 | Ga0268266_10060781 | 3300028379 | Bacteria | 3257 |
| 711 | Ga0268266_10247167 | 3300028379 | Bacteria | 1649 |
| 712 | Ga0268266_10275692 | 3300028379 | Bacteria | 1562 |
| 713 | Ga0268266_10370293 | 3300028379 | Bacteria | 1349 |
| 714 | Ga0268266_10391596 | 3300028379 | Bacteria | 1312 |
| 715 | Ga0268266_10518135 | 3300028379 | Bacteria | 1140 |
| 716 | Ga0268265_10014031 | 3300028380 | Bacteria | 5457 |
| 717 | Ga0268265_10275630 | 3300028380 | Bacteria | 1502 |
| 718 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 719 | Ga0268264_10234589 | 3300028381 | Bacteria | 1696 |
| 720 | Ga0268264_10392478 | 3300028381 | Bacteria | 1332 |
| 721 | Ga0268264_10448204 | 3300028381 | Bacteria | 1250 |
| 722 | Ga0268264_10490861 | 3300028381 | Bacteria | 1196 |
| 723 | Ga0265319_1017352 | 3300028563 | Bacteria | 2738 |
| 724 | Ga0265334_10046153 | 3300028573 | Bacteria | 1685 |
| 725 | Ga0265318_10012602 | 3300028577 | Bacteria | 3592 |
| 726 | Ga0265323_10002871 | 3300028653 | Bacteria | 7739 |
| 727 | Ga0265322_10020639 | 3300028654 | Bacteria | 1887 |
| 728 | Ga0265336_10000032 | 3300028666 | Bacteria | 167925 |
| 729 | Ga0265336_10002816 | 3300028666 | Bacteria | 7027 |
| 730 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 731 | Ga0307517_10195851 | 3300028786 | Bacteria | 1273 |
| 732 | Ga0307515_10072079 | 3300028794 | Bacteria | 4670 |
| 733 | Ga0307515_10314675 | 3300028794 | Bacteria | 1237 |
| 734 | Ga0307515_10423249 | 3300028794 | Bacteria | 952 |
| 735 | Ga0265338_10000422 | 3300028800 | Bacteria | 75820 |
| 736 | Ga0265324_10006919 | 3300029957 | Bacteria | 4673 |
| 737 | Ga0265324_10015991 | 3300029957 | Bacteria | 2751 |
| 738 | Ga0268256_1001682 | 3300030500 | Bacteria | 12623 |
| 739 | Ga0307511_10125475 | 3300030521 | Bacteria | 1568 |
| 740 | Ga0265760_10000096 | 3300031090 | Bacteria | 22944 |
| 741 | Ga0265330_10011940 | 3300031235 | Bacteria | 4065 |
| 742 | Ga0265330_10043394 | 3300031235 | Bacteria | 1989 |
| 743 | Ga0265332_10010082 | 3300031238 | Bacteria | 4206 |
| 744 | Ga0265332_10030416 | 3300031238 | Bacteria | 2359 |
| 745 | Ga0265325_10008852 | 3300031241 | Bacteria | 5914 |
| 746 | Ga0265329_10011836 | 3300031242 | Unclassified | 3160 |
| 747 | Ga0265340_10010992 | 3300031247 | Bacteria | 4826 |
| 748 | Ga0265339_10001248 | 3300031249 | Bacteria | 19138 |
| 749 | Ga0265339_10010315 | 3300031249 | Bacteria | 5810 |
| 750 | Ga0265331_10026374 | 3300031250 | Bacteria | 2922 |
| 751 | Ga0265331_10052921 | 3300031250 | Unclassified | 1938 |
| 752 | Ga0265331_10060809 | 3300031250 | Bacteria | 1784 |
| 753 | Ga0265316_10170223 | 3300031344 | Bacteria | 1625 |
| 754 | Ga0307513_10316548 | 3300031456 | Bacteria | 1320 |
| 755 | Ga0307513_10361326 | 3300031456 | Bacteria | 1197 |
| 756 | Ga0307513_10518950 | 3300031456 | Bacteria | 907 |
| 757 | Ga0307509_10056747 | 3300031507 | Bacteria | 4155 |
| 758 | Ga0307509_10147247 | 3300031507 | Bacteria | 2277 |
| 759 | Ga0307509_10267919 | 3300031507 | Bacteria | 1478 |
| 760 | Ga0307509_10429862 | 3300031507 | Bacteria | 1019 |
| 761 | Ga0307408_100047045 | 3300031548 | Bacteria | 3087 |
| 762 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 763 | Ga0307508_10022102 | 3300031616 | Bacteria | 5783 |
| 764 | Ga0307508_10208054 | 3300031616 | Bacteria | 1557 |
| 765 | Ga0307508_10381219 | 3300031616 | Bacteria | 1001 |
| 766 | Ga0307508_10445253 | 3300031616 | Bacteria | 887 |
| 767 | Ga0265314_10005054 | 3300031711 | Bacteria | 12021 |
| 768 | Ga0265314_10036026 | 3300031711 | Bacteria | 3600 |
| 769 | Ga0265342_10000026 | 3300031712 | Bacteria | 166610 |
| 770 | Ga0265342_10015623 | 3300031712 | Bacteria | 4989 |
| 771 | Ga0265342_10040808 | 3300031712 | Bacteria | 2813 |
| 772 | Ga0307516_10080981 | 3300031730 | Bacteria | 3090 |
| 773 | Ga0307516_10107884 | 3300031730 | Bacteria | 2592 |
| 774 | Ga0307413_10153592 | 3300031824 | Bacteria | 1607 |
| 775 | Ga0307413_10381996 | 3300031824 | Bacteria | 1098 |
| 776 | Ga0307407_10138680 | 3300031903 | Bacteria | 1566 |
| 777 | Ga0307412_10190428 | 3300031911 | Bacteria | 1550 |
| 778 | Ga0307412_10320291 | 3300031911 | Bacteria | 1233 |
| 779 | Ga0307409_100387605 | 3300031995 | Bacteria | 1330 |
| 780 | Ga0307416_100432738 | 3300032002 | Bacteria | 1363 |
| 781 | Ga0307411_10489071 | 3300032005 | Bacteria | 1038 |
| 782 | Ga0307415_100331735 | 3300032126 | Bacteria | 1273 |
| 783 | Ga0307415_100525348 | 3300032126 | Bacteria | 1039 |
| 784 | Ga0307415_100694017 | 3300032126 | Bacteria | 918 |
| 785 | Ga0307507_10063749 | 3300033179 | Bacteria | 3408 |
| 786 | Ga0307510_10005192 | 3300033180 | Bacteria | 15482 |
| 787 | Ga0307510_10010957 | 3300033180 | Bacteria | 10775 |
| 788 | Ga0307510_10154095 | 3300033180 | Bacteria | 1909 |
| 789 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 790 | Ga0373930_0063062 | 3300034816 | Bacteria | 830 |
| 791 | Ga0373926_0018000 | 3300035083 | Bacteria | 2428 |
| 792 | Ga0373929_0023418 | 3300035085 | Bacteria | 1269 |
| 793 | Ga0373929_0030064 | 3300035085 | Bacteria | 1156 |
| 794 | Ga0373934_0023131 | 3300035086 | Bacteria | 2400 |
| 795 | Ga0373934_0048927 | 3300035086 | Bacteria | 1674 |
| 796 | Ga0373934_0075890 | 3300035086 | Bacteria | 1348 |
| 797 | Ga0373923_0007245 | 3300035111 | Bacteria | 3890 |
| 798 | Ga0373923_0067787 | 3300035111 | Bacteria | 1527 |
| 799 | Ga0373936_0007829 | 3300035113 | Bacteria | 4014 |
| 800 | Ga0373936_0010431 | 3300035113 | Bacteria | 3505 |
| 801 | Ga0373936_0240563 | 3300035113 | Bacteria | 807 |
| 802 | Ga0373941_0056801 | 3300035115 | Bacteria | 1262 |
| 803 | Ga0373945_0033473 | 3300035116 | Bacteria | 1827 |
| 804 | Ga0373945_0034697 | 3300035116 | Bacteria | 1799 |
| 805 | Ga0373953_0002766 | 3300035117 | Bacteria | 5330 |
| 806 | Ga0373953_0029830 | 3300035117 | Bacteria | 2111 |
| 807 | Ga0373954_0007515 | 3300035118 | Bacteria | 4768 |
| 808 | Ga0373954_0041652 | 3300035118 | Bacteria | 2142 |
| 809 | Ga0373954_0072568 | 3300035118 | Bacteria | 1637 |
| 810 | Ga0373956_0063075 | 3300035119 | Bacteria | 1680 |
| 811 | Ga0373957_0017724 | 3300035120 | Bacteria | 2485 |
| 812 | Ga0373957_0183188 | 3300035120 | Bacteria | 869 |
| 813 | Ga0373943_0003229 | 3300035170 | Bacteria | 7401 |
| 814 | Ga0373943_0066803 | 3300035170 | Bacteria | 1812 |
| 815 | Ga0373943_0230672 | 3300035170 | Bacteria | 1034 |
| 816 | Ga0373946_0036453 | 3300035171 | Bacteria | 1994 |
| 817 | Ga0373955_0011290 | 3300035172 | Bacteria | 4250 |
| 818 | Ga0373955_0036661 | 3300035172 | Bacteria | 2603 |
| 819 | Ga0373942_0029275 | 3300035207 | Bacteria | 1444 |
| 820 | Ga0373962_0042191 | 3300035242 | Bacteria | 1289 |
| 821 | Ga0373924_0035386 | 3300035410 | Bacteria | 2025 |
| 822 | Ga0373924_0071228 | 3300035410 | Bacteria | 1467 |
| 823 | Ga0373931_0013496 | 3300035691 | Bacteria | 3979 |
| 824 | Ga0373931_0026163 | 3300035691 | Bacteria | 2966 |
| 825 | Ga0373931_0114920 | 3300035691 | Bacteria | 1531 |
| 826 | Ga0373935_0004301 | 3300035692 | Bacteria | 8357 |
| 827 | Ga0373935_0025334 | 3300035692 | Bacteria | 3655 |
| 828 | Ga0373927_0000766 | 3300035695 | Bacteria | 24573 |
| 829 | Ga0373927_0002321 | 3300035695 | Bacteria | 13895 |
| 830 | Ga0373927_0011298 | 3300035695 | Bacteria | 5943 |
| 831 | Ga0373927_0018485 | 3300035695 | Bacteria | 4580 |
| 832 | Ga0373927_0036330 | 3300035695 | Bacteria | 3204 |
| 833 | Ga0373927_0052279 | 3300035695 | Bacteria | 2642 |
| 834 | Ga0373927_0148385 | 3300035695 | Bacteria | 1535 |
| 835 | Ga0373927_0478362 | 3300035695 | Bacteria | 823 |
| 836 | Ga0373933_0000218 | 3300035724 | Bacteria | 37928 |
| 837 | Ga0373933_0133740 | 3300035724 | Bacteria | 1561 |
| 838 | Ga0373933_0223100 | 3300035724 | Bacteria | 1209 |
| 839 | Ga0373933_0284996 | 3300035724 | Bacteria | 1068 |
| 840 | Ga0373947_0000310 | 3300035725 | Bacteria | 27577 |
| 841 | Ga0373947_0008207 | 3300035725 | Bacteria | 6023 |
| 842 | Ga0373947_0051170 | 3300035725 | Bacteria | 2485 |
| 843 | Ga0373947_0064613 | 3300035725 | Bacteria | 2231 |
| 844 | Ga0373937_0007978 | 3300036401 | Bacteria | 9177 |
| 845 | Ga0373937_0080516 | 3300036401 | Bacteria | 3012 |
| 846 | Ga0373937_0220533 | 3300036401 | Bacteria | 1785 |
| 847 | Ga0373937_0312494 | 3300036401 | Bacteria | 1486 |
| 848 | Ga0372808_018578 | 3300036459 | Bacteria | 999 |
| 849 | Ga0373925_0008418 | 3300037068 | Bacteria | 7511 |
| 850 | Ga0373925_0016057 | 3300037068 | Bacteria | 5421 |
| 851 | Ga0373925_0016895 | 3300037068 | Bacteria | 5283 |
| 852 | Ga0373925_0034756 | 3300037068 | Bacteria | 3716 |
| 853 | Ga0373925_0044131 | 3300037068 | Bacteria | 3310 |
| 854 | Ga0373925_0133593 | 3300037068 | Bacteria | 1937 |
| 855 | Ga0373925_0138946 | 3300037068 | Bacteria | 1900 |
| 856 | Ga0373925_0250483 | 3300037068 | Bacteria | 1420 |
| 857 | Ga0395899_0164845 | 3300037312 | Bacteria | 1564 |
| 858 | Ga0395900_0000423 | 3300037418 | Bacteria | 60773 |
| 859 | Ga0395900_0364696 | 3300037418 | Bacteria | 1415 |
| 860 | Ga0395900_0366141 | 3300037418 | Bacteria | 1412 |
| 861 | Ga0395898_0010460 | 3300037466 | Bacteria | 9699 |
| 862 | Ga0395898_0016086 | 3300037466 | Bacteria | 7664 |
| 863 | Ga0395898_0037142 | 3300037466 | Bacteria | 4834 |
| 864 | Ga0395898_0129821 | 3300037466 | Bacteria | 2414 |
| 865 | Ga0395898_0358162 | 3300037466 | Bacteria | 1391 |
| 866 | Ga0395905_0017321 | 3300037471 | Bacteria | 6841 |
| 867 | Ga0395905_0182703 | 3300037471 | Bacteria | 1969 |
| 868 | Ga0395905_0471650 | 3300037471 | Bacteria | 1154 |
| 869 | Ga0436364_0114057 | 3300037853 | Bacteria | 1238 |
| 870 | Ga0395901_0010143 | 3300038443 | Bacteria | 9543 |
| 871 | Ga0395901_0129559 | 3300038443 | Bacteria | 2651 |
| 872 | Ga0395901_0611625 | 3300038443 | Bacteria | 1098 |
| 873 | Ga0436365_1493424 | 3300039437 | Bacteria | 3701 |
| 874 | Ga0436365_1890248 | 3300039437 | Bacteria | 1903 |
| 875 | Ga0436360_0380405 | 3300039438 | Bacteria | 1842 |
| 876 | Ga0436360_0734498 | 3300039438 | Bacteria | 2136 |
| 877 | Ga0436360_1352967 | 3300039438 | Bacteria | 1099 |
| 878 | Ga0436361_0609024 | 3300039447 | Bacteria | 7275 |
| 879 | Ga0436361_0908871 | 3300039447 | Bacteria | 1454 |
| 880 | Ga0436361_1023454 | 3300039447 | Bacteria | 1072 |
| 881 | Ga0436363_0110349 | 3300039450 | Bacteria | 1472 |
| 882 | Ga0436363_0462270 | 3300039450 | Bacteria | 1064 |
| 883 | Ga0436363_0797587 | 3300039450 | Bacteria | 1873 |
| 884 | Ga0436363_1120086 | 3300039450 | Bacteria | 1613 |
| 885 | Ga0436363_1361193 | 3300039450 | Bacteria | 1177 |
| 886 | Ga0436362_1092046 | 3300039453 | Bacteria | 1557 |
| 887 | Ga0439466_0056963 | 3300041411 | Bacteria | 1267 |
| 888 | Ga0451787_291164 | 3300041441 | Bacteria | 822 |
| 889 | Ga0451795_0554965 | 3300041456 | Bacteria | 1234 |
| 890 | Ga0451807_1265636 | 3300041486 | Bacteria | 1058 |
| 891 | Ga0451841_0604624 | 3300041498 | Bacteria | 1329 |
| 892 | Ga0439433_0026008 | 3300041999 | Bacteria | 1324 |
| 893 | Ga0439445_0080725 | 3300042004 | Bacteria | 908 |
| 894 | Ga0439455_0065575 | 3300042012 | Bacteria | 969 |
| 895 | Ga0450920_026140 | 3300042122 | Bacteria | 1138 |
| 896 | Ga0439458_0009214 | 3300042157 | Bacteria | 2199 |
| 897 | Ga0450909_012001 | 3300042185 | Bacteria | 1269 |
| 898 | Ga0439459_0035005 | 3300042438 | Bacteria | 1041 |
| 899 | Ga0466969_0091111 | 3300044656 | Bacteria | 1445 |
| 900 | Ga0466972_0000941 | 3300044658 | Bacteria | 14002 |
| 901 | Ga0466972_0040720 | 3300044658 | Bacteria | 2262 |
| 902 | Ga0466965_0027939 | 3300044683 | Bacteria | 2739 |
| 903 | Ga0466965_0125696 | 3300044683 | Bacteria | 1327 |
| 904 | Ga0466966_0000628 | 3300044684 | Bacteria | 22447 |
| 905 | Ga0466966_0023968 | 3300044684 | Bacteria | 3994 |
| 906 | Ga0466966_0028575 | 3300044684 | Bacteria | 3631 |
| 907 | Ga0466961_0002516 | 3300044693 | Bacteria | 11373 |
| 908 | Ga0466961_0203646 | 3300044693 | Bacteria | 1223 |
| 909 | Ga0466963_0125500 | 3300044694 | Bacteria | 1769 |
| 910 | Ga0466963_0157186 | 3300044694 | Bacteria | 1581 |
| 911 | Ga0466964_0128426 | 3300044706 | Bacteria | 1151 |
| 912 | Ga0466968_0004491 | 3300044735 | Bacteria | 5217 |
| 913 | Ga0466968_0177168 | 3300044735 | Bacteria | 990 |
| 914 | Ga0466970_0189366 | 3300044765 | Bacteria | 1143 |
| 915 | Ga0466957_0073406 | 3300044842 | Bacteria | 2120 |
| 916 | Ga0466957_0302860 | 3300044842 | Bacteria | 1074 |
| 917 | Ga0466959_0012945 | 3300045049 | Bacteria | 6039 |
| 918 | Ga0466959_0331979 | 3300045049 | Bacteria | 1038 |
| 919 | Ga0466958_0171777 | 3300045836 | Bacteria | 1373 |
| 920 | Ga0466958_0237807 | 3300045836 | Bacteria | 1163 |
| 921 | Ga0466967_0282433 | 3300045976 | Bacteria | 1593 |
| 922 | Ga0466967_0367727 | 3300045976 | Bacteria | 1394 |
| 923 | Ga0466967_0492415 | 3300045976 | Bacteria | 1202 |
| 924 | Ga0466967_0504934 | 3300045976 | Bacteria | 1187 |
| 925 | Ga0466967_0566847 | 3300045976 | Bacteria | 1118 |
| 926 | Ga0495617_026570 | 3300046452 | Bacteria | 1949 |
| 927 | Ga0495592_0004461 | 3300046454 | Bacteria | 10242 |
| 928 | Ga0495592_0029657 | 3300046454 | Bacteria | 4142 |
| 929 | Ga0495592_0050389 | 3300046454 | Bacteria | 3093 |
| 930 | Ga0495592_0126857 | 3300046454 | Bacteria | 1789 |
| 931 | Ga0495603_0000936 | 3300046455 | Bacteria | 16788 |
| 932 | Ga0495603_0002927 | 3300046455 | Bacteria | 10095 |
| 933 | Ga0495603_0017727 | 3300046455 | Bacteria | 4310 |
| 934 | Ga0495603_0025404 | 3300046455 | Bacteria | 3582 |
| 935 | Ga0495603_0066165 | 3300046455 | Bacteria | 2129 |
| 936 | Ga0495603_0103707 | 3300046455 | Bacteria | 1660 |
| 937 | Ga0495603_0140937 | 3300046455 | Bacteria | 1402 |
| 938 | Ga0495590_0125429 | 3300046457 | Bacteria | 921 |
| 939 | Ga0495629_0001416 | 3300046459 | Bacteria | 18913 |
| 940 | Ga0495629_0002247 | 3300046459 | Bacteria | 14887 |
| 941 | Ga0495629_0003103 | 3300046459 | Bacteria | 12597 |
| 942 | Ga0495638_0005979 | 3300046460 | Bacteria | 8929 |
| 943 | Ga0495638_0028219 | 3300046460 | Bacteria | 3625 |
| 944 | Ga0495638_0190125 | 3300046460 | Bacteria | 1165 |
| 945 | Ga0495638_0206597 | 3300046460 | Bacteria | 1105 |
| 946 | Ga0495641_0005002 | 3300046461 | Bacteria | 9142 |
| 947 | Ga0495641_0049859 | 3300046461 | Bacteria | 1915 |
| 948 | Ga0495641_0082044 | 3300046461 | Bacteria | 1444 |
| 949 | Ga0495651_0008730 | 3300046462 | Bacteria | 7772 |
| 950 | Ga0495651_0038241 | 3300046462 | Bacteria | 3736 |
| 951 | Ga0495651_0064839 | 3300046462 | Bacteria | 2791 |
| 952 | Ga0495651_0080456 | 3300046462 | Bacteria | 2461 |
| 953 | Ga0495651_0102687 | 3300046462 | Bacteria | 2126 |
| 954 | Ga0495651_0131493 | 3300046462 | Bacteria | 1826 |
| 955 | Ga0495653_0015924 | 3300046463 | Bacteria | 6129 |
| 956 | Ga0495653_0050804 | 3300046463 | Bacteria | 3187 |
| 957 | Ga0495653_0065737 | 3300046463 | Bacteria | 2729 |
| 958 | Ga0495653_0196583 | 3300046463 | Bacteria | 1372 |
| 959 | Ga0495650_0059049 | 3300046471 | Bacteria | 1546 |
| 960 | Ga0495580_0002805 | 3300046472 | Bacteria | 14983 |
| 961 | Ga0495580_0028806 | 3300046472 | Bacteria | 4035 |
| 962 | Ga0495582_0000302 | 3300046473 | Bacteria | 27218 |
| 963 | Ga0495582_0051892 | 3300046473 | Bacteria | 2262 |
| 964 | Ga0495582_0144541 | 3300046473 | Bacteria | 1349 |
| 965 | Ga0495605_0154640 | 3300046474 | Bacteria | 1021 |
| 966 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 967 | Ga0495639_0013510 | 3300046475 | Bacteria | 3527 |
| 968 | Ga0495662_0001578 | 3300046476 | Bacteria | 11325 |
| 969 | Ga0495664_0015202 | 3300046477 | Bacteria | 4374 |
| 970 | Ga0495664_0027071 | 3300046477 | Bacteria | 3342 |
| 971 | Ga0495664_0031919 | 3300046477 | Bacteria | 3088 |
| 972 | Ga0495664_0054635 | 3300046477 | Bacteria | 2374 |
| 973 | Ga0495664_0168217 | 3300046477 | Bacteria | 1330 |
| 974 | Ga0495664_0190528 | 3300046477 | Bacteria | 1243 |
| 975 | Ga0495594_0000046 | 3300046499 | Bacteria | 53822 |
| 976 | Ga0495596_0121237 | 3300046500 | Bacteria | 1015 |
| 977 | Ga0495607_0232150 | 3300046501 | Bacteria | 897 |
| 978 | Ga0495583_0062080 | 3300046506 | Bacteria | 1665 |
| 979 | Ga0495583_0067954 | 3300046506 | Bacteria | 1573 |
| 980 | Ga0495606_0057727 | 3300046507 | Bacteria | 2498 |
| 981 | Ga0495606_0072504 | 3300046507 | Bacteria | 2163 |
| 982 | Ga0495606_0195138 | 3300046507 | Bacteria | 1158 |
| 983 | Ga0495606_0286839 | 3300046507 | Bacteria | 897 |
| 984 | Ga0495608_0005612 | 3300046511 | Bacteria | 8964 |
| 985 | Ga0495608_0168369 | 3300046511 | Bacteria | 1390 |
| 986 | Ga0495608_0193797 | 3300046511 | Bacteria | 1282 |
| 987 | Ga0495608_0275066 | 3300046511 | Bacteria | 1046 |
| 988 | Ga0495610_0015265 | 3300046512 | Bacteria | 4471 |
| 989 | Ga0495610_0141767 | 3300046512 | Bacteria | 1034 |
| 990 | Ga0495616_0036090 | 3300046513 | Bacteria | 2553 |
| 991 | Ga0495618_0073627 | 3300046514 | Bacteria | 2175 |
| 992 | Ga0495618_0344058 | 3300046514 | Bacteria | 920 |
| 993 | Ga0495620_0054100 | 3300046515 | Bacteria | 1697 |
| 994 | Ga0495620_0087184 | 3300046515 | Bacteria | 1256 |
| 995 | Ga0495628_0015500 | 3300046516 | Bacteria | 6365 |
| 996 | Ga0495628_0040083 | 3300046516 | Bacteria | 3744 |
| 997 | Ga0495628_0053908 | 3300046516 | Bacteria | 3172 |
| 998 | Ga0495628_0073940 | 3300046516 | Bacteria | 2655 |
| 999 | Ga0495630_0005610 | 3300046517 | Bacteria | 8864 |
| 1000 | Ga0495632_0108600 | 3300046519 | Bacteria | 1304 |
| 1001 | Ga0495632_0168497 | 3300046519 | Bacteria | 1007 |
| 1002 | Ga0495637_0011891 | 3300046520 | Bacteria | 4172 |
| 1003 | Ga0495637_0096500 | 3300046520 | Bacteria | 1160 |
| 1004 | Ga0495643_0052988 | 3300046522 | Bacteria | 2176 |
| 1005 | Ga0495643_0091710 | 3300046522 | Bacteria | 1566 |
| 1006 | Ga0495643_0254870 | 3300046522 | Bacteria | 817 |
| 1007 | Ga0495644_0049422 | 3300046523 | Bacteria | 1578 |
| 1008 | Ga0495644_0071701 | 3300046523 | Bacteria | 1302 |
| 1009 | Ga0495648_0001071 | 3300046524 | Bacteria | 27799 |
| 1010 | Ga0495648_0027838 | 3300046524 | Bacteria | 3776 |
| 1011 | Ga0495648_0088063 | 3300046524 | Bacteria | 1746 |
| 1012 | Ga0495648_0100171 | 3300046524 | Bacteria | 1601 |
| 1013 | Ga0495648_0120396 | 3300046524 | Bacteria | 1412 |
| 1014 | Ga0495648_0163379 | 3300046524 | Bacteria | 1148 |
| 1015 | Ga0495663_0040889 | 3300046525 | Bacteria | 1409 |
| 1016 | Ga0495663_0049035 | 3300046525 | Bacteria | 1303 |
| 1017 | Ga0495666_0031720 | 3300046526 | Bacteria | 2589 |
| 1018 | Ga0495652_0003554 | 3300046529 | Bacteria | 15313 |
| 1019 | Ga0495652_0020755 | 3300046529 | Bacteria | 5838 |
| 1020 | Ga0495652_0044098 | 3300046529 | Bacteria | 3842 |
| 1021 | Ga0495652_0423585 | 3300046529 | Bacteria | 937 |
| 1022 | Ga0495654_0016336 | 3300046530 | Bacteria | 3927 |
| 1023 | Ga0495665_0000335 | 3300046531 | Bacteria | 23811 |
| 1024 | Ga0495665_0011584 | 3300046531 | Bacteria | 4775 |
| 1025 | Ga0495640_0002138 | 3300046533 | Bacteria | 15789 |
| 1026 | Ga0495640_0017069 | 3300046533 | Bacteria | 5417 |
| 1027 | Ga0495640_0019627 | 3300046533 | Bacteria | 4985 |
| 1028 | Ga0495586_0131867 | 3300046535 | Bacteria | 1399 |
| 1029 | Ga0495587_0044776 | 3300046536 | Bacteria | 2631 |
| 1030 | Ga0495609_0072166 | 3300046538 | Bacteria | 1516 |
| 1031 | Ga0495621_0051105 | 3300046539 | Bacteria | 1478 |
| 1032 | Ga0495621_0112377 | 3300046539 | Bacteria | 1046 |
| 1033 | Ga0495645_0008238 | 3300046543 | Bacteria | 7269 |
| 1034 | Ga0495645_0023376 | 3300046543 | Bacteria | 4476 |
| 1035 | Ga0495645_0131357 | 3300046543 | Bacteria | 1754 |
| 1036 | Ga0495622_0001664 | 3300046557 | Bacteria | 11001 |
| 1037 | Ga0495622_0026583 | 3300046557 | Bacteria | 2701 |
| 1038 | Ga0495622_0043995 | 3300046557 | Bacteria | 2075 |
| 1039 | Ga0495622_0058451 | 3300046557 | Bacteria | 1786 |
| 1040 | Ga0495622_0132518 | 3300046557 | Bacteria | 1134 |
| 1041 | Ga0495633_0194887 | 3300046558 | Bacteria | 931 |
| 1042 | Ga0495667_0003584 | 3300046559 | Bacteria | 10443 |
| 1043 | Ga0495667_0008501 | 3300046559 | Bacteria | 6968 |
| 1044 | Ga0495667_0014435 | 3300046559 | Bacteria | 5337 |
| 1045 | Ga0495667_0150550 | 3300046559 | Bacteria | 1498 |
| 1046 | Ga0495656_0033066 | 3300046615 | Bacteria | 2108 |
| 1047 | Ga0495656_0134608 | 3300046615 | Bacteria | 1179 |
| 1048 | Ga0495656_0287827 | 3300046615 | Bacteria | 839 |
| 1049 | Ga0495668_0049581 | 3300046616 | Bacteria | 2328 |
| 1050 | Ga0495668_0169620 | 3300046616 | Bacteria | 1196 |
| 1051 | Ga0495668_0216571 | 3300046616 | Bacteria | 1048 |
| 1052 | Ga0495634_0004622 | 3300046642 | Bacteria | 10742 |
| 1053 | Ga0495634_0023263 | 3300046642 | Bacteria | 4356 |
| 1054 | Ga0495634_0091597 | 3300046642 | Bacteria | 1973 |
| 1055 | Ga0495634_0219195 | 3300046642 | Bacteria | 1175 |
| 1056 | Ga0495625_0071714 | 3300046660 | Bacteria | 2430 |
| 1057 | Ga0495625_0074874 | 3300046660 | Bacteria | 2370 |
| 1058 | Ga0495625_0162314 | 3300046660 | Bacteria | 1496 |
| 1059 | Ga0495625_0244074 | 3300046660 | Bacteria | 1168 |
| 1060 | Ga0495635_0000518 | 3300046663 | Bacteria | 24462 |
| 1061 | Ga0495635_0006671 | 3300046663 | Bacteria | 8062 |
| 1062 | Ga0495635_0008383 | 3300046663 | Bacteria | 7215 |
| 1063 | Ga0495635_0026959 | 3300046663 | Bacteria | 3997 |
| 1064 | Ga0495635_0098620 | 3300046663 | Bacteria | 1997 |
| 1065 | Ga0495659_0162006 | 3300046664 | Bacteria | 904 |
| 1066 | Ga0495661_0034212 | 3300046665 | Bacteria | 3198 |
| 1067 | Ga0495661_0220566 | 3300046665 | Bacteria | 983 |
| 1068 | Ga0495588_0002579 | 3300046674 | Bacteria | 7753 |
| 1069 | Ga0495588_0016851 | 3300046674 | Bacteria | 3538 |
| 1070 | Ga0495588_0023873 | 3300046674 | Bacteria | 3032 |
| 1071 | Ga0495588_0057929 | 3300046674 | Bacteria | 2002 |
| 1072 | Ga0495657_0005477 | 3300046675 | Bacteria | 10046 |
| 1073 | Ga0495657_0032801 | 3300046675 | Bacteria | 3621 |
| 1074 | Ga0495657_0214613 | 3300046675 | Bacteria | 1168 |
| 1075 | Ga0495599_0000864 | 3300046678 | Bacteria | 16965 |
| 1076 | Ga0495599_0084142 | 3300046678 | Bacteria | 1987 |
| 1077 | Ga0495599_0186043 | 3300046678 | Bacteria | 1279 |
| 1078 | Ga0495599_0207791 | 3300046678 | Bacteria | 1201 |
| 1079 | Ga0495599_0392995 | 3300046678 | Bacteria | 827 |
| 1080 | Ga0495623_0010119 | 3300046679 | Bacteria | 6105 |
| 1081 | Ga0495646_0026987 | 3300046680 | Bacteria | 3605 |
| 1082 | Ga0495646_0134232 | 3300046680 | Bacteria | 1390 |
| 1083 | Ga0495646_0174338 | 3300046680 | Bacteria | 1183 |
| 1084 | Ga0495647_0104011 | 3300046681 | Bacteria | 1178 |
| 1085 | Ga0495658_0023228 | 3300046683 | Bacteria | 3289 |
| 1086 | Ga0495658_0214841 | 3300046683 | Bacteria | 1202 |
| 1087 | Ga0495669_0015902 | 3300046684 | Bacteria | 3221 |
| 1088 | Ga0495669_0098046 | 3300046684 | Bacteria | 1359 |
| 1089 | Ga0495669_0168331 | 3300046684 | Bacteria | 1042 |
| 1090 | Ga0495613_0004485 | 3300046689 | Bacteria | 10464 |
| 1091 | Ga0495613_0145701 | 3300046689 | Bacteria | 1690 |
| 1092 | Ga0495613_0204897 | 3300046689 | Bacteria | 1389 |
| 1093 | Ga0495613_0333511 | 3300046689 | Bacteria | 1045 |
| 1094 | Ga0495613_0357636 | 3300046689 | Bacteria | 1002 |
| 1095 | Ga0495624_0000795 | 3300046690 | Bacteria | 24919 |
| 1096 | Ga0495624_0041749 | 3300046690 | Bacteria | 2933 |
| 1097 | Ga0495624_0315221 | 3300046690 | Bacteria | 942 |
| 1098 | Ga0495624_0363769 | 3300046690 | Bacteria | 870 |
| 1099 | Ga0495670_0007575 | 3300046691 | Bacteria | 5335 |
| 1100 | Ga0495671_0046554 | 3300046692 | Bacteria | 2168 |
| 1101 | Ga0495671_0082614 | 3300046692 | Bacteria | 1574 |
| 1102 | Ga0495671_0107523 | 3300046692 | Bacteria | 1362 |
| 1103 | Ga0495649_0086287 | 3300046694 | Bacteria | 1675 |
| 1104 | Ga0495649_0152812 | 3300046694 | Bacteria | 1212 |
| 1105 | Ga0495649_0186305 | 3300046694 | Bacteria | 1081 |
| 1106 | Ga0495649_0297462 | 3300046694 | Bacteria | 822 |
| 1107 | Ga0495589_0178129 | 3300046794 | Bacteria | 1009 |
| 1108 | Ga0495600_0002373 | 3300046809 | Bacteria | 10764 |
| 1109 | Ga0495600_0017875 | 3300046809 | Bacteria | 4513 |
| 1110 | Ga0495600_0067504 | 3300046809 | Bacteria | 2337 |
| 1111 | Ga0495600_0087808 | 3300046809 | Bacteria | 2028 |
| 1112 | Ga0495600_0240833 | 3300046809 | Bacteria | 1153 |
| 1113 | Ga0495600_0294526 | 3300046809 | Bacteria | 1025 |
| 1114 | Ga0495660_0245563 | 3300046810 | Bacteria | 833 |
| 1115 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 1116 | Ga0495581_0028132 | 3300047315 | Bacteria | 3259 |
| 1117 | Ga0495581_0047237 | 3300047315 | Bacteria | 2488 |
| 1118 | Ga0495581_0181574 | 3300047315 | Bacteria | 1231 |
| 1119 | Ga0495581_0237488 | 3300047315 | Bacteria | 1066 |
| 1120 | Ga0495581_0251946 | 3300047315 | Bacteria | 1033 |
| 1121 | Ga0495604_0005369 | 3300047317 | Bacteria | 10163 |
| 1122 | Ga0495604_0014589 | 3300047317 | Bacteria | 6262 |
| 1123 | Ga0495604_0025392 | 3300047317 | Bacteria | 4721 |
| 1124 | Ga0495604_0184578 | 3300047317 | Bacteria | 1457 |
| 1125 | Ga0495636_0060744 | 3300047318 | Bacteria | 1597 |
| 1126 | Ga0495636_0135694 | 3300047318 | Bacteria | 1096 |
| 1127 | Ga0495674_0004821 | 3300047319 | Bacteria | 12972 |
| 1128 | Ga0495674_0029980 | 3300047319 | Bacteria | 4949 |
| 1129 | Ga0495674_0045408 | 3300047319 | Bacteria | 3901 |
| 1130 | Ga0495674_0182566 | 3300047319 | Bacteria | 1747 |
| 1131 | Ga0495672_0176406 | 3300047320 | Bacteria | 1086 |
| 1132 | Ga0495676_0033174 | 3300047321 | Bacteria | 4351 |
| 1133 | Ga0495676_0164043 | 3300047321 | Bacteria | 1569 |
| 1134 | Ga0495676_0168826 | 3300047321 | Bacteria | 1541 |
| 1135 | Ga0495676_0248673 | 3300047321 | Bacteria | 1214 |
| 1136 | Ga0495676_0318899 | 3300047321 | Bacteria | 1044 |
| 1137 | Ga0495680_0008881 | 3300047322 | Bacteria | 9087 |
| 1138 | Ga0495683_0132660 | 3300047323 | Bacteria | 1173 |
| 1139 | Ga0495687_007148 | 3300047443 | Bacteria | 6649 |
| 1140 | Ga0495675_0020892 | 3300047444 | Bacteria | 4167 |
| 1141 | Ga0495675_0099624 | 3300047444 | Bacteria | 1820 |
| 1142 | Ga0495675_0214036 | 3300047444 | Bacteria | 1168 |
| 1143 | Ga0495677_0077709 | 3300047445 | Bacteria | 1242 |
| 1144 | Ga0495673_0127904 | 3300047469 | Bacteria | 1000 |
| 1145 | Ga0495684_0004051 | 3300047471 | Bacteria | 11430 |
| 1146 | Ga0495684_0024023 | 3300047471 | Bacteria | 4690 |
| 1147 | Ga0495686_0064143 | 3300047472 | Bacteria | 2274 |
| 1148 | Ga0495686_0078201 | 3300047472 | Bacteria | 2025 |
| 1149 | Ga0495686_0092376 | 3300047472 | Bacteria | 1835 |
| 1150 | Ga0495686_0146969 | 3300047472 | Bacteria | 1387 |
| 1151 | Ga0495686_0157627 | 3300047472 | Bacteria | 1329 |
| 1152 | Ga0495593_0000398 | 3300047673 | Bacteria | 24218 |
| 1153 | Ga0495593_0009398 | 3300047673 | Bacteria | 5674 |
| 1154 | Ga0495593_0017768 | 3300047673 | Bacteria | 4005 |
| 1155 | Ga0495593_0061511 | 3300047673 | Bacteria | 1964 |
| 1156 | Ga0495602_0010323 | 3300048088 | Bacteria | 9695 |
| 1157 | Ga0495602_0023058 | 3300048088 | Bacteria | 6075 |
| 1158 | Ga0495602_0047488 | 3300048088 | Bacteria | 3868 |
| 1159 | Ga0495602_0230322 | 3300048088 | Bacteria | 1393 |
| 1160 | Ga0495602_0268477 | 3300048088 | Bacteria | 1262 |
| 1161 | Ga0495614_0142115 | 3300048089 | Bacteria | 1067 |
| 1162 | Ga0495615_0089412 | 3300048090 | Bacteria | 856 |
| 1163 | Ga0496100_0005479 | 3300048903 | Bacteria | 6840 |
| 1164 | Ga0496100_0015556 | 3300048903 | Bacteria | 4445 |
| 1165 | Ga0496100_0020557 | 3300048903 | Bacteria | 3960 |
| 1166 | Ga0496100_0304159 | 3300048903 | Bacteria | 1194 |
| 1167 | Ga0496100_0645194 | 3300048903 | Bacteria | 824 |
| 1168 | Ga0496101_0021366 | 3300048904 | Bacteria | 4447 |
| 1169 | Ga0496101_0057108 | 3300048904 | Bacteria | 2822 |
| 1170 | Ga0496101_0101438 | 3300048904 | Bacteria | 2155 |
| 1171 | Ga0496101_0267795 | 3300048904 | Bacteria | 1333 |
| 1172 | Ga0496101_0408868 | 3300048904 | Bacteria | 1069 |
| 1173 | Ga0496102_0025855 | 3300048905 | Bacteria | 5229 |
| 1174 | Ga0496102_0069619 | 3300048905 | Bacteria | 3230 |
| 1175 | Ga0496102_0071540 | 3300048905 | Bacteria | 3184 |
| 1176 | Ga0496102_0074603 | 3300048905 | Bacteria | 3118 |
| 1177 | Ga0496102_0098901 | 3300048905 | Bacteria | 2707 |
| 1178 | Ga0496102_0196265 | 3300048905 | Bacteria | 1902 |
| 1179 | Ga0496102_0231653 | 3300048905 | Bacteria | 1741 |
| 1180 | Ga0496102_0250719 | 3300048905 | Bacteria | 1669 |
| 1181 | Ga0496102_0256331 | 3300048905 | Bacteria | 1649 |
| 1182 | Ga0496102_0396110 | 3300048905 | Bacteria | 1298 |
| 1183 | Ga0496102_0431627 | 3300048905 | Bacteria | 1237 |
| 1184 | Ga0496103_0010891 | 3300048906 | Bacteria | 5381 |
| 1185 | Ga0496103_0021472 | 3300048906 | Bacteria | 3885 |
| 1186 | Ga0496103_0123848 | 3300048906 | Bacteria | 1648 |
| 1187 | Ga0496104_0013200 | 3300048907 | Bacteria | 7446 |
| 1188 | Ga0496104_0021253 | 3300048907 | Bacteria | 5955 |
| 1189 | Ga0496104_0023224 | 3300048907 | Bacteria | 5702 |
| 1190 | Ga0496104_0081567 | 3300048907 | Bacteria | 3084 |
| 1191 | Ga0496104_0109572 | 3300048907 | Bacteria | 2646 |
| 1192 | Ga0496104_0122100 | 3300048907 | Bacteria | 2501 |
| 1193 | Ga0496104_0181592 | 3300048907 | Bacteria | 2014 |
| 1194 | Ga0496105_0002119 | 3300048908 | Bacteria | 14370 |
| 1195 | Ga0496105_0004271 | 3300048908 | Bacteria | 10750 |
| 1196 | Ga0496105_0049541 | 3300048908 | Bacteria | 3468 |
| 1197 | Ga0496105_0108810 | 3300048908 | Bacteria | 2288 |
| 1198 | Ga0496105_0270131 | 3300048908 | Bacteria | 1373 |
| 1199 | Ga0496105_0435082 | 3300048908 | Bacteria | 1037 |
| 1200 | Ga0496106_0000418 | 3300048909 | Bacteria | 30181 |
| 1201 | Ga0496106_0005807 | 3300048909 | Bacteria | 9124 |
| 1202 | Ga0496106_0008160 | 3300048909 | Bacteria | 7737 |
| 1203 | Ga0496106_0012607 | 3300048909 | Bacteria | 6243 |
| 1204 | Ga0496106_0021313 | 3300048909 | Bacteria | 4811 |
| 1205 | Ga0496106_0206036 | 3300048909 | Bacteria | 1566 |
| 1206 | Ga0496106_0266793 | 3300048909 | Bacteria | 1370 |
| 1207 | Ga0496106_0423139 | 3300048909 | Bacteria | 1070 |
| 1208 | Ga0496106_0451929 | 3300048909 | Bacteria | 1032 |
| 1209 | Ga0496106_0591381 | 3300048909 | Bacteria | 889 |
| 1210 | Ga0496107_0005061 | 3300048910 | Bacteria | 8984 |
| 1211 | Ga0496107_0021428 | 3300048910 | Bacteria | 4567 |
| 1212 | Ga0496107_0071285 | 3300048910 | Bacteria | 2524 |
| 1213 | Ga0496107_0104479 | 3300048910 | Bacteria | 2079 |
| 1214 | Ga0496107_0179311 | 3300048910 | Bacteria | 1573 |
| 1215 | Ga0496108_0000160 | 3300048911 | Bacteria | 64120 |
| 1216 | Ga0496108_0020758 | 3300048911 | Bacteria | 5399 |
| 1217 | Ga0496108_0025207 | 3300048911 | Bacteria | 4900 |
| 1218 | Ga0496108_0071623 | 3300048911 | Bacteria | 2925 |
| 1219 | Ga0496108_0217264 | 3300048911 | Bacteria | 1660 |
| 1220 | Ga0496108_0310990 | 3300048911 | Bacteria | 1373 |
| 1221 | Ga0496109_0000245 | 3300048912 | Bacteria | 52201 |
| 1222 | Ga0496109_0021697 | 3300048912 | Bacteria | 5683 |
| 1223 | Ga0496109_0089282 | 3300048912 | Bacteria | 2849 |
| 1224 | Ga0496109_0102308 | 3300048912 | Bacteria | 2659 |
| 1225 | Ga0496109_0183229 | 3300048912 | Bacteria | 1967 |
| 1226 | Ga0496109_0430333 | 3300048912 | Bacteria | 1246 |
| 1227 | Ga0496109_0497795 | 3300048912 | Bacteria | 1150 |
| 1228 | Ga0496110_0014329 | 3300048913 | Bacteria | 6578 |
| 1229 | Ga0496110_0024193 | 3300048913 | Bacteria | 5173 |
| 1230 | Ga0496110_0051735 | 3300048913 | Bacteria | 3609 |
| 1231 | Ga0496110_0233120 | 3300048913 | Bacteria | 1674 |
| 1232 | Ga0496110_0238542 | 3300048913 | Bacteria | 1654 |
| 1233 | Ga0496110_0487144 | 3300048913 | Bacteria | 1123 |
| 1234 | Ga0496111_0047295 | 3300048914 | Bacteria | 3098 |
| 1235 | Ga0496111_0065286 | 3300048914 | Bacteria | 2642 |
| 1236 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 1237 | Ga0496112_0002354 | 3300048915 | Bacteria | 15178 |
| 1238 | Ga0496112_0004127 | 3300048915 | Bacteria | 12219 |
| 1239 | Ga0496112_0004136 | 3300048915 | Bacteria | 12210 |
| 1240 | Ga0496112_0007772 | 3300048915 | Bacteria | 9542 |
| 1241 | Ga0496112_0035285 | 3300048915 | Bacteria | 4871 |
| 1242 | Ga0496112_0123482 | 3300048915 | Bacteria | 2560 |
| 1243 | Ga0496112_0136598 | 3300048915 | Bacteria | 2422 |
| 1244 | Ga0496112_0145156 | 3300048915 | Bacteria | 2341 |
| 1245 | Ga0496112_0159966 | 3300048915 | Bacteria | 2218 |
| 1246 | Ga0496113_0038433 | 3300048916 | Bacteria | 3519 |
| 1247 | Ga0496113_0053535 | 3300048916 | Bacteria | 3018 |
| 1248 | Ga0496113_0074927 | 3300048916 | Bacteria | 2581 |
| 1249 | Ga0496113_0122095 | 3300048916 | Bacteria | 2037 |
| 1250 | Ga0496113_0539875 | 3300048916 | Bacteria | 935 |
| 1251 | Ga0496114_0140628 | 3300048917 | Bacteria | 2089 |
| 1252 | Ga0496114_0245698 | 3300048917 | Bacteria | 1574 |
| 1253 | Ga0496114_0294835 | 3300048917 | Bacteria | 1431 |
| 1254 | Ga0496114_0323477 | 3300048917 | Bacteria | 1363 |
| 1255 | Ga0496114_0622413 | 3300048917 | Bacteria | 951 |
| 1256 | Ga0496115_0005337 | 3300048918 | Bacteria | 9350 |
| 1257 | Ga0496115_0014614 | 3300048918 | Bacteria | 5945 |
| 1258 | Ga0496115_0051731 | 3300048918 | Bacteria | 3293 |
| 1259 | Ga0496115_0089905 | 3300048918 | Bacteria | 2508 |
| 1260 | Ga0496115_0097833 | 3300048918 | Bacteria | 2403 |
| 1261 | Ga0496115_0398601 | 3300048918 | Bacteria | 1117 |
| 1262 | Ga0496115_0418234 | 3300048918 | Bacteria | 1086 |
| 1263 | Ga0496115_0499375 | 3300048918 | Bacteria | 978 |
| 1264 | Ga0496116_0012269 | 3300048919 | Bacteria | 7007 |
| 1265 | Ga0496116_0014117 | 3300048919 | Bacteria | 6396 |
| 1266 | Ga0496116_0102458 | 3300048919 | Bacteria | 1707 |
| 1267 | Ga0496117_0015483 | 3300048920 | Bacteria | 6497 |
| 1268 | Ga0496117_0032990 | 3300048920 | Bacteria | 3922 |
| 1269 | Ga0496117_0051718 | 3300048920 | Bacteria | 2901 |
| 1270 | Ga0496117_0149101 | 3300048920 | Bacteria | 1387 |
| 1271 | Ga0496117_0215742 | 3300048920 | Bacteria | 1072 |
| 1272 | Ga0496118_0005692 | 3300048921 | Bacteria | 14039 |
| 1273 | Ga0496118_0017056 | 3300048921 | Bacteria | 6630 |
| 1274 | Ga0496118_0028806 | 3300048921 | Bacteria | 4669 |
| 1275 | Ga0496118_0037135 | 3300048921 | Bacteria | 3926 |
| 1276 | Ga0496118_0121818 | 3300048921 | Bacteria | 1698 |
| 1277 | Ga0496118_0272520 | 3300048921 | Bacteria | 947 |
| 1278 | Ga0496118_0339636 | 3300048921 | Bacteria | 806 |
| 1279 | Ga0496119_0002669 | 3300048922 | Bacteria | 19295 |
| 1280 | Ga0496119_0014075 | 3300048922 | Bacteria | 6295 |
| 1281 | Ga0496119_0017374 | 3300048922 | Bacteria | 5411 |
| 1282 | Ga0496119_0023249 | 3300048922 | Bacteria | 4405 |
| 1283 | Ga0496119_0035864 | 3300048922 | Bacteria | 3243 |
| 1284 | Ga0496119_0072531 | 3300048922 | Bacteria | 2011 |
| 1285 | Ga0496119_0197550 | 3300048922 | Bacteria | 1043 |
| 1286 | Ga0496119_0201578 | 3300048922 | Bacteria | 1029 |
| 1287 | Ga0496120_0014496 | 3300048923 | Bacteria | 5251 |
| 1288 | Ga0496120_0054397 | 3300048923 | Bacteria | 2268 |
| 1289 | Ga0496120_0069860 | 3300048923 | Bacteria | 1933 |
| 1290 | Ga0496120_0162416 | 3300048923 | Bacteria | 1112 |
| 1291 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 1292 | Ga0496121_0000870 | 3300048924 | Bacteria | 54546 |
| 1293 | Ga0496121_0010173 | 3300048924 | Bacteria | 10650 |
| 1294 | Ga0496121_0014331 | 3300048924 | Bacteria | 8424 |
| 1295 | Ga0496121_0015878 | 3300048924 | Bacteria | 7828 |
| 1296 | Ga0496121_0021331 | 3300048924 | Bacteria | 6350 |
| 1297 | Ga0496121_0023995 | 3300048924 | Bacteria | 5849 |
| 1298 | Ga0496121_0030800 | 3300048924 | Bacteria | 4920 |
| 1299 | Ga0496121_0034826 | 3300048924 | Bacteria | 4524 |
| 1300 | Ga0496121_0089621 | 3300048924 | Bacteria | 2407 |
| 1301 | Ga0496121_0095356 | 3300048924 | Bacteria | 2312 |
| 1302 | Ga0496121_0095552 | 3300048924 | Bacteria | 2309 |
| 1303 | Ga0496121_0130086 | 3300048924 | Bacteria | 1886 |
| 1304 | Ga0496121_0145227 | 3300048924 | Bacteria | 1754 |
| 1305 | Ga0496121_0170692 | 3300048924 | Bacteria | 1580 |
| 1306 | Ga0496121_0177781 | 3300048924 | Bacteria | 1539 |
| 1307 | Ga0496121_0213940 | 3300048924 | Bacteria | 1363 |
| 1308 | Ga0496121_0219163 | 3300048924 | Bacteria | 1341 |
| 1309 | Ga0496121_0234101 | 3300048924 | Bacteria | 1284 |
| 1310 | Ga0496121_0240078 | 3300048924 | Bacteria | 1263 |
| 1311 | Ga0496121_0391485 | 3300048924 | Bacteria | 913 |
| 1312 | Ga0496122_0020531 | 3300048925 | Bacteria | 5960 |
| 1313 | Ga0496122_0038047 | 3300048925 | Bacteria | 3861 |
| 1314 | Ga0496122_0050025 | 3300048925 | Bacteria | 3191 |
| 1315 | Ga0496122_0205099 | 3300048925 | Bacteria | 1148 |
| 1316 | Ga0496122_0232738 | 3300048925 | Bacteria | 1046 |
| 1317 | Ga0496123_0003029 | 3300048926 | Bacteria | 19369 |
| 1318 | Ga0496123_0031679 | 3300048926 | Bacteria | 3843 |
| 1319 | Ga0496123_0110437 | 3300048926 | Bacteria | 1573 |
| 1320 | Ga0496123_0164249 | 3300048926 | Bacteria | 1180 |
| 1321 | Ga0496124_0000123 | 3300048927 | Bacteria | 161106 |
| 1322 | Ga0496124_0084753 | 3300048927 | Bacteria | 2597 |
| 1323 | Ga0496124_0115893 | 3300048927 | Bacteria | 2149 |
| 1324 | Ga0496124_0247269 | 3300048927 | Bacteria | 1322 |
| 1325 | Ga0496124_0296982 | 3300048927 | Bacteria | 1169 |
| 1326 | Ga0496125_0000207 | 3300048928 | Bacteria | 122897 |
| 1327 | Ga0496125_0011562 | 3300048928 | Bacteria | 8817 |
| 1328 | Ga0496125_0012916 | 3300048928 | Bacteria | 8246 |
| 1329 | Ga0496125_0139009 | 3300048928 | Bacteria | 1692 |
| 1330 | Ga0496126_0008213 | 3300048929 | Bacteria | 11288 |
| 1331 | Ga0496126_0010103 | 3300048929 | Bacteria | 9956 |
| 1332 | Ga0496126_0036335 | 3300048929 | Bacteria | 4606 |
| 1333 | Ga0496126_0056692 | 3300048929 | Bacteria | 3540 |
| 1334 | Ga0496126_0062529 | 3300048929 | Bacteria | 3340 |
| 1335 | Ga0496126_0095928 | 3300048929 | Bacteria | 2600 |
| 1336 | Ga0496126_0128201 | 3300048929 | Bacteria | 2194 |
| 1337 | Ga0496126_0132407 | 3300048929 | Bacteria | 2153 |
| 1338 | Ga0496126_0171147 | 3300048929 | Bacteria | 1850 |
| 1339 | Ga0496126_0233078 | 3300048929 | Bacteria | 1541 |
| 1340 | Ga0496126_0248727 | 3300048929 | Bacteria | 1482 |
| 1341 | Ga0496126_0263494 | 3300048929 | Bacteria | 1432 |
| 1342 | Ga0496126_0285765 | 3300048929 | Bacteria | 1365 |
| 1343 | Ga0496126_0311100 | 3300048929 | Bacteria | 1297 |
| 1344 | Ga0496126_0406211 | 3300048929 | Bacteria | 1103 |
| 1345 | Ga0496126_0463884 | 3300048929 | Bacteria | 1017 |
| 1346 | Ga0496126_0468481 | 3300048929 | Bacteria | 1011 |
| 1347 | Ga0496126_0472107 | 3300048929 | Bacteria | 1006 |
| 1348 | Ga0496126_0497807 | 3300048929 | Bacteria | 974 |
| 1349 | Ga0495678_078556 | 3300049459 | Bacteria | 1191 |
| 1350 | Ga0495682_0131917 | 3300049460 | Bacteria | 893 |
| 1351 | Ga0501031_0049312 | 3300049568 | Bacteria | 2744 |
| 1352 | Ga0501032_0011231 | 3300049569 | Bacteria | 6433 |
| 1353 | Ga0501032_0071162 | 3300049569 | Bacteria | 2318 |
| 1354 | Ga0501032_0101572 | 3300049569 | Bacteria | 1905 |
| 1355 | Ga0501032_0240969 | 3300049569 | Bacteria | 1175 |
| 1356 | Ga0501033_0001064 | 3300049570 | Bacteria | 25051 |
| 1357 | Ga0501033_0012046 | 3300049570 | Bacteria | 6602 |
| 1358 | Ga0501033_0049770 | 3300049570 | Bacteria | 3111 |
| 1359 | Ga0501034_0130679 | 3300049571 | Bacteria | 2494 |
| 1360 | Ga0501034_0313086 | 3300049571 | Bacteria | 1504 |
| 1361 | Ga0501034_0632690 | 3300049571 | Bacteria | 973 |
| 1362 | Ga0501036_0124749 | 3300049572 | Bacteria | 2174 |
| 1363 | Ga0501036_0570881 | 3300049572 | Bacteria | 939 |
| 1364 | Ga0501036_0571133 | 3300049572 | Bacteria | 939 |
| 1365 | Ga0501036_0701638 | 3300049572 | Bacteria | 836 |
| 1366 | Ga0501037_0000242 | 3300049573 | Bacteria | 46822 |
| 1367 | Ga0501037_0064561 | 3300049573 | Bacteria | 2668 |
| 1368 | Ga0501038_0016237 | 3300049574 | Bacteria | 6751 |
| 1369 | Ga0501038_0218189 | 3300049574 | Bacteria | 1523 |
| 1370 | Ga0501038_0377896 | 3300049574 | Bacteria | 1099 |
| 1371 | Ga0501039_0153933 | 3300049575 | Bacteria | 1806 |
| 1372 | Ga0501043_0000440 | 3300049579 | Bacteria | 37461 |
| 1373 | Ga0501043_0033129 | 3300049579 | Bacteria | 4064 |
| 1374 | Ga0501043_0090716 | 3300049579 | Bacteria | 2403 |
| 1375 | Ga0501043_0131751 | 3300049579 | Bacteria | 1959 |
| 1376 | Ga0501046_0237224 | 3300049580 | Bacteria | 1346 |
| 1377 | Ga0501047_0006953 | 3300049581 | Bacteria | 10627 |
| 1378 | Ga0501047_0008580 | 3300049581 | Bacteria | 9645 |
| 1379 | Ga0501047_0011808 | 3300049581 | Bacteria | 8261 |
| 1380 | Ga0501047_0027351 | 3300049581 | Bacteria | 5494 |
| 1381 | Ga0501047_0056233 | 3300049581 | Bacteria | 3804 |
| 1382 | Ga0501047_0069493 | 3300049581 | Bacteria | 3391 |
| 1383 | Ga0501047_0190762 | 3300049581 | Bacteria | 1913 |
| 1384 | Ga0501047_0238252 | 3300049581 | Bacteria | 1671 |
| 1385 | Ga0501047_0459276 | 3300049581 | Bacteria | 1102 |
| 1386 | Ga0501047_0469766 | 3300049581 | Bacteria | 1086 |
| 1387 | Ga0501048_0131505 | 3300049582 | Bacteria | 1769 |
| 1388 | Ga0501048_0238046 | 3300049582 | Bacteria | 1292 |
| 1389 | Ga0501067_0055415 | 3300049583 | Bacteria | 2197 |
| 1390 | Ga0501067_0106097 | 3300049583 | Bacteria | 1561 |
| 1391 | Ga0501068_0005571 | 3300049584 | Bacteria | 6898 |
| 1392 | Ga0501068_0222044 | 3300049584 | Bacteria | 1201 |
| 1393 | Ga0501069_0000017 | 3300049585 | Bacteria | 141492 |
| 1394 | Ga0501069_0024997 | 3300049585 | Bacteria | 3261 |
| 1395 | Ga0501069_0330006 | 3300049585 | Bacteria | 897 |
| 1396 | Ga0501070_0000236 | 3300049586 | Bacteria | 52046 |
| 1397 | Ga0501070_0000356 | 3300049586 | Bacteria | 41599 |
| 1398 | Ga0501070_0007635 | 3300049586 | Bacteria | 9182 |
| 1399 | Ga0501070_0025934 | 3300049586 | Bacteria | 4918 |
| 1400 | Ga0501070_0062784 | 3300049586 | Bacteria | 3077 |
| 1401 | Ga0501071_0143147 | 3300049587 | Bacteria | 1781 |
| 1402 | Ga0501071_0229123 | 3300049587 | Bacteria | 1399 |
| 1403 | Ga0501071_0384309 | 3300049587 | Bacteria | 1071 |
| 1404 | Ga0501071_0582316 | 3300049587 | Bacteria | 860 |
| 1405 | Ga0501073_0000531 | 3300049589 | Bacteria | 26762 |
| 1406 | Ga0501073_0032679 | 3300049589 | Bacteria | 3709 |
| 1407 | Ga0501074_0000610 | 3300049590 | Bacteria | 22218 |
| 1408 | Ga0501074_0000660 | 3300049590 | Bacteria | 21527 |
| 1409 | Ga0501074_0011565 | 3300049590 | Bacteria | 6419 |
| 1410 | Ga0501074_0031296 | 3300049590 | Bacteria | 3855 |
| 1411 | Ga0501074_0090123 | 3300049590 | Bacteria | 2196 |
| 1412 | Ga0501079_0006439 | 3300049741 | Bacteria | 8817 |
| 1413 | Ga0501080_0001422 | 3300049742 | Bacteria | 20085 |
| 1414 | Ga0501080_0005983 | 3300049742 | Bacteria | 10902 |
| 1415 | Ga0501080_0009701 | 3300049742 | Bacteria | 8791 |
| 1416 | Ga0501080_0023297 | 3300049742 | Bacteria | 5740 |
| 1417 | Ga0501080_0068569 | 3300049742 | Bacteria | 3299 |
| 1418 | Ga0501080_0159418 | 3300049742 | Bacteria | 2084 |
| 1419 | Ga0501080_0210494 | 3300049742 | Bacteria | 1782 |
| 1420 | Ga0501083_0002788 | 3300049744 | Bacteria | 12084 |
| 1421 | Ga0501083_0003168 | 3300049744 | Bacteria | 11450 |
| 1422 | Ga0501083_0092651 | 3300049744 | Bacteria | 1995 |
| 1423 | Ga0501035_0000101 | 3300049822 | Bacteria | 106949 |
| 1424 | Ga0501035_0000686 | 3300049822 | Bacteria | 36991 |
| 1425 | Ga0501035_0009055 | 3300049822 | Bacteria | 9258 |
| 1426 | Ga0501035_0020710 | 3300049822 | Bacteria | 6044 |
| 1427 | Ga0501035_0028068 | 3300049822 | Bacteria | 5139 |
| 1428 | Ga0501035_0059620 | 3300049822 | Bacteria | 3399 |
| 1429 | Ga0501035_0230946 | 3300049822 | Bacteria | 1577 |
| 1430 | Ga0501035_0324512 | 3300049822 | Bacteria | 1293 |
| 1431 | Ga0501035_0558963 | 3300049822 | Bacteria | 936 |
| 1432 | Ga0501035_0619810 | 3300049822 | Bacteria | 880 |
| 1433 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 1434 | Ga0501044_0016129 | 3300049823 | Bacteria | 8031 |
| 1435 | Ga0501044_0029369 | 3300049823 | Bacteria | 5798 |
| 1436 | Ga0501044_0036505 | 3300049823 | Bacteria | 5142 |
| 1437 | Ga0501044_0060354 | 3300049823 | Bacteria | 3883 |
| 1438 | Ga0501044_0099050 | 3300049823 | Bacteria | 2934 |
| 1439 | Ga0501044_0107251 | 3300049823 | Bacteria | 2805 |
| 1440 | Ga0501044_0112268 | 3300049823 | Bacteria | 2733 |
| 1441 | Ga0501044_0117767 | 3300049823 | Bacteria | 2660 |
| 1442 | Ga0501044_0182100 | 3300049823 | Bacteria | 2067 |
| 1443 | Ga0501044_0282669 | 3300049823 | Bacteria | 1592 |
| 1444 | Ga0501044_0313976 | 3300049823 | Bacteria | 1493 |
| 1445 | Ga0501044_0423901 | 3300049823 | Bacteria | 1240 |
| 1446 | Ga0501044_0668268 | 3300049823 | Bacteria | 926 |
| 1447 | nmdc:mga03683_118016_c1 | 3300050489 | Bacteria | 1177 |
| 1448 | nmdc:mga03683_43980_c1 | 3300050489 | Bacteria | 1844 |
| 1449 | nmdc:mga03683_9417_c2 | 3300050489 | Bacteria | 2323 |
| 1450 | nmdc:mga03n38_107513_c1 | 3300050490 | Bacteria | 1354 |
| 1451 | nmdc:mga03n38_124019_c1 | 3300050490 | Bacteria | 1273 |
| 1452 | nmdc:mga03n38_1251_c1 | 3300050490 | Bacteria | 7145 |
| 1453 | nmdc:mga03n38_2538_c1 | 3300050490 | Bacteria | 5665 |
| 1454 | nmdc:mga03n38_73656_c1 | 3300050490 | Bacteria | 1586 |
| 1455 | nmdc:mga00v17_15267_c1 | 3300050491 | Bacteria | 4308 |
| 1456 | nmdc:mga00v17_18256_c1 | 3300050491 | Bacteria | 2428 |
| 1457 | nmdc:mga00v17_19009_c1 | 3300050491 | Bacteria | 3914 |
| 1458 | nmdc:mga00v17_375472_c1 | 3300050491 | Bacteria | 924 |
| 1459 | nmdc:mga0yw44_140517_c1 | 3300050492 | Bacteria | 1569 |
| 1460 | nmdc:mga0yw44_152810_c1 | 3300050492 | Bacteria | 1507 |
| 1461 | nmdc:mga0yw44_20636_c1 | 3300050492 | Bacteria | 3661 |
| 1462 | nmdc:mga0yw44_235615_c1 | 3300050492 | Bacteria | 1216 |
| 1463 | nmdc:mga0yw44_2638_c1 | 3300050492 | Bacteria | 7724 |
| 1464 | nmdc:mga0yw44_338082_c1 | 3300050492 | Bacteria | 1012 |
| 1465 | nmdc:mga0yw44_387333_c1 | 3300050492 | Bacteria | 944 |
| 1466 | nmdc:mga0yw44_4136_c1 | 3300050492 | Bacteria | 6589 |
| 1467 | nmdc:mga0k408_105305_c1 | 3300050493 | Bacteria | 1665 |
| 1468 | nmdc:mga0k408_126963_c1 | 3300050493 | Bacteria | 1513 |
| 1469 | nmdc:mga0k408_42070_c1 | 3300050493 | Bacteria | 2632 |
| 1470 | nmdc:mga0k408_76158_c1 | 3300050493 | Bacteria | 1961 |
| 1471 | nmdc:mga06z11_110192_c1 | 3300050494 | Bacteria | 1523 |
| 1472 | nmdc:mga06z11_143381_c1 | 3300050494 | Bacteria | 1352 |
| 1473 | nmdc:mga06z11_88873_c1 | 3300050494 | Bacteria | 1674 |
| 1474 | nmdc:mga04h51_4594_c1 | 3300050495 | Bacteria | 3452 |
| 1475 | nmdc:mga04h51_50591_c1 | 3300050495 | Bacteria | 1393 |
| 1476 | nmdc:mga07m45_145085_c1 | 3300050496 | Bacteria | 1376 |
| 1477 | nmdc:mga07m45_23218_c2 | 3300050496 | Bacteria | 3062 |
| 1478 | nmdc:mga07m45_278714_c1 | 3300050496 | Bacteria | 973 |
| 1479 | nmdc:mga07m45_71999_c1 | 3300050496 | Bacteria | 1967 |
| 1480 | nmdc:mga0qj67_35930_c1 | 3300050509 | Bacteria | 3875 |
| 1481 | nmdc:mga0qj67_384036_c1 | 3300050509 | Bacteria | 1134 |
| 1482 | nmdc:mga06r32_139219_c1 | 3300050510 | Bacteria | 2403 |
| 1483 | nmdc:mga0n895_33749_c1 | 3300050512 | Bacteria | 4919 |
| 1484 | nmdc:mga0n895_55593_c1 | 3300050512 | Bacteria | 3895 |
| 1485 | nmdc:mga0n895_59184_c1 | 3300050512 | Bacteria | 3780 |
| 1486 | nmdc:mga0rr50_357987_c1 | 3300050513 | Bacteria | 1228 |
| 1487 | nmdc:mga0sz30_44073_c1 | 3300050516 | Bacteria | 1879 |
| 1488 | nmdc:mga0sz30_6129_c1 | 3300050516 | Bacteria | 4451 |
| 1489 | Ga0495601_0049033 | 3300053077 | Bacteria | 2661 |
| 1490 | Ga0495601_0128447 | 3300053077 | Bacteria | 1650 |
| 1491 | Ga0495601_0280710 | 3300053077 | Bacteria | 1086 |
| 1492 | Ga0495601_0309266 | 3300053077 | Bacteria | 1029 |
| 1493 | Ga0495612_0026224 | 3300053078 | Bacteria | 2342 |
| 1494 | Ga0495612_0132654 | 3300053078 | Bacteria | 1077 |
| 1495 | Ga0500635_0001019 | 3300053080 | Bacteria | 6708 |
| 1496 | Ga0500635_0001112 | 3300053080 | Bacteria | 6426 |
| 1497 | Ga0495619_0018218 | 3300053085 | Bacteria | 4453 |
| 1498 | Ga0495619_0164486 | 3300053085 | Bacteria | 1533 |
| 1499 | Ga0495619_0450951 | 3300053085 | Bacteria | 887 |
| 1500 | Ga0500578_0117180 | 3300053086 | Bacteria | 1676 |
| 1501 | Ga0500578_0211209 | 3300053086 | Bacteria | 1184 |
| 1502 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 1503 | Ga0500581_019218 | 3300053089 | Bacteria | 3444 |
| 1504 | Ga0500646_0014413 | 3300053090 | Bacteria | 2052 |
| 1505 | Ga0500647_0034776 | 3300053091 | Bacteria | 2407 |
| 1506 | Ga0500647_0043672 | 3300053091 | Bacteria | 2151 |
| 1507 | Ga0500583_0197130 | 3300053092 | Bacteria | 1001 |
| 1508 | Ga0500651_0013790 | 3300053093 | Bacteria | 4932 |
| 1509 | Ga0500651_0076655 | 3300053093 | Bacteria | 2076 |
| 1510 | Ga0500651_0096067 | 3300053093 | Bacteria | 1821 |
| 1511 | Ga0500566_0001605 | 3300053094 | Bacteria | 13308 |
| 1512 | Ga0500566_0002244 | 3300053094 | Bacteria | 11418 |
| 1513 | Ga0500566_0003837 | 3300053094 | Bacteria | 8959 |
| 1514 | Ga0500566_0023627 | 3300053094 | Bacteria | 3609 |
| 1515 | Ga0500640_003743 | 3300053095 | Bacteria | 5388 |
| 1516 | Ga0500640_043327 | 3300053095 | Bacteria | 1976 |
| 1517 | Ga0500641_0007867 | 3300053096 | Bacteria | 3801 |
| 1518 | Ga0500641_0028023 | 3300053096 | Bacteria | 2197 |
| 1519 | Ga0500641_0077090 | 3300053096 | Bacteria | 1410 |
| 1520 | Ga0500641_0100679 | 3300053096 | Bacteria | 1239 |
| 1521 | Ga0500648_141887 | 3300053097 | Bacteria | 1289 |
| 1522 | Ga0500650_0026074 | 3300053098 | Bacteria | 2619 |
| 1523 | Ga0500650_0111933 | 3300053098 | Bacteria | 1274 |
| 1524 | Ga0500554_067508 | 3300053102 | Bacteria | 1158 |
| 1525 | Ga0500555_026873 | 3300053103 | Bacteria | 1643 |
| 1526 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 1527 | Ga0500556_0000068 | 3300053104 | Bacteria | 103123 |
| 1528 | Ga0500557_000021 | 3300053105 | Bacteria | 89662 |
| 1529 | Ga0500558_079488 | 3300053106 | Bacteria | 1339 |
| 1530 | Ga0500562_032400 | 3300053108 | Bacteria | 1379 |
| 1531 | Ga0500562_036162 | 3300053108 | Bacteria | 1309 |
| 1532 | Ga0500562_068551 | 3300053108 | Bacteria | 956 |
| 1533 | Ga0500569_028550 | 3300053109 | Bacteria | 1547 |
| 1534 | Ga0500572_002049 | 3300053111 | Bacteria | 5008 |
| 1535 | Ga0500572_016650 | 3300053111 | Bacteria | 1876 |
| 1536 | Ga0500591_068096 | 3300053115 | Bacteria | 1621 |
| 1537 | Ga0500592_000490 | 3300053116 | Bacteria | 6558 |
| 1538 | Ga0500594_0015285 | 3300053118 | Bacteria | 1850 |
| 1539 | Ga0500594_0038557 | 3300053118 | Bacteria | 1295 |
| 1540 | Ga0500594_0043459 | 3300053118 | Bacteria | 1239 |
| 1541 | Ga0500595_003616 | 3300053119 | Bacteria | 7168 |
| 1542 | Ga0500595_009845 | 3300053119 | Bacteria | 3836 |
| 1543 | Ga0500595_020341 | 3300053119 | Bacteria | 2391 |
| 1544 | Ga0500595_021228 | 3300053119 | Bacteria | 2321 |
| 1545 | Ga0500595_023440 | 3300053119 | Bacteria | 2169 |
| 1546 | Ga0500595_043599 | 3300053119 | Bacteria | 1427 |
| 1547 | Ga0500595_068784 | 3300053119 | Bacteria | 1054 |
| 1548 | Ga0500607_052394 | 3300053121 | Bacteria | 2166 |
| 1549 | Ga0500608_000852 | 3300053122 | Bacteria | 11037 |
| 1550 | Ga0500608_087150 | 3300053122 | Bacteria | 1465 |
| 1551 | Ga0500608_183439 | 3300053122 | Bacteria | 883 |
| 1552 | Ga0500614_050622 | 3300053123 | Bacteria | 1089 |
| 1553 | Ga0500618_008819 | 3300053125 | Bacteria | 2787 |
| 1554 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 1555 | Ga0500642_0000362 | 3300053130 | Bacteria | 15284 |
| 1556 | Ga0500642_0006861 | 3300053130 | Bacteria | 3785 |
| 1557 | Ga0500652_000342 | 3300053131 | Bacteria | 16756 |
| 1558 | Ga0500655_022733 | 3300053133 | Bacteria | 1181 |
| 1559 | Ga0500559_0002074 | 3300053136 | Bacteria | 10720 |
| 1560 | Ga0500559_0007492 | 3300053136 | Bacteria | 4829 |
| 1561 | Ga0500559_0026405 | 3300053136 | Bacteria | 2473 |
| 1562 | Ga0500559_0045996 | 3300053136 | Bacteria | 1912 |
| 1563 | Ga0500559_0079650 | 3300053136 | Bacteria | 1487 |
| 1564 | Ga0500559_0204801 | 3300053136 | Bacteria | 930 |
| 1565 | Ga0500559_0236854 | 3300053136 | Bacteria | 860 |
| 1566 | Ga0500561_0047971 | 3300053137 | Bacteria | 1155 |
| 1567 | Ga0500568_0006964 | 3300053139 | Bacteria | 5604 |
| 1568 | Ga0500568_0011399 | 3300053139 | Bacteria | 4130 |
| 1569 | Ga0500568_0013697 | 3300053139 | Bacteria | 3687 |
| 1570 | Ga0500568_0015941 | 3300053139 | Bacteria | 3352 |
| 1571 | Ga0500573_0007614 | 3300053140 | Bacteria | 5917 |
| 1572 | Ga0500577_0001442 | 3300053142 | Bacteria | 6084 |
| 1573 | Ga0500586_000200 | 3300053145 | Bacteria | 11589 |
| 1574 | Ga0500588_0013721 | 3300053146 | Bacteria | 2038 |
| 1575 | Ga0500588_0034702 | 3300053146 | Bacteria | 1479 |
| 1576 | Ga0500588_0067142 | 3300053146 | Bacteria | 1166 |
| 1577 | Ga0500589_074989 | 3300053147 | Bacteria | 1522 |
| 1578 | Ga0500590_049874 | 3300053148 | Bacteria | 2130 |
| 1579 | Ga0500603_002052 | 3300053150 | Bacteria | 4448 |
| 1580 | Ga0500603_003463 | 3300053150 | Bacteria | 3386 |
| 1581 | Ga0500604_0119111 | 3300053151 | Bacteria | 882 |
| 1582 | Ga0500604_0152707 | 3300053151 | Bacteria | 784 |
| 1583 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1584 | Ga0500616_0060673 | 3300053153 | Bacteria | 1960 |
| 1585 | Ga0500616_0125865 | 3300053153 | Bacteria | 1217 |
| 1586 | Ga0500619_089556 | 3300053154 | Bacteria | 1039 |
| 1587 | Ga0500622_0002538 | 3300053156 | Bacteria | 13099 |
| 1588 | Ga0500622_0005248 | 3300053156 | Bacteria | 7825 |
| 1589 | Ga0500627_0031943 | 3300053158 | Bacteria | 2215 |
| 1590 | Ga0500627_0092111 | 3300053158 | Bacteria | 1357 |
| 1591 | Ga0500630_021324 | 3300053159 | Bacteria | 3201 |
| 1592 | Ga0500633_0079526 | 3300053160 | Bacteria | 1184 |
| 1593 | Ga0500634_0037765 | 3300053161 | Bacteria | 2626 |
| 1594 | Ga0500634_0144020 | 3300053161 | Bacteria | 1124 |
| 1595 | Ga0500638_054063 | 3300053162 | Bacteria | 1937 |
| 1596 | Ga0500638_084193 | 3300053162 | Bacteria | 1506 |
| 1597 | Ga0500638_087400 | 3300053162 | Bacteria | 1472 |
| 1598 | Ga0500639_004505 | 3300053163 | Bacteria | 7083 |
| 1599 | Ga0500639_140306 | 3300053163 | Bacteria | 1131 |
| 1600 | Ga0500639_161158 | 3300053163 | Bacteria | 1020 |
| 1601 | Ga0500636_0000834 | 3300053177 | Bacteria | 16602 |
| 1602 | Ga0500636_0037800 | 3300053177 | Bacteria | 2855 |
| 1603 | Ga0500636_0044447 | 3300053177 | Bacteria | 2619 |
| 1604 | Ga0500636_0055552 | 3300053177 | Bacteria | 2320 |
| 1605 | Ga0500636_0070418 | 3300053177 | Bacteria | 2029 |
| 1606 | Ga0500636_0152749 | 3300053177 | Bacteria | 1266 |
| 1607 | Ga0500637_0000585 | 3300053178 | Bacteria | 14328 |
| 1608 | Ga0500637_0003666 | 3300053178 | Bacteria | 7146 |
| 1609 | Ga0500637_0045191 | 3300053178 | Bacteria | 2497 |
| 1610 | Ga0500637_0051363 | 3300053178 | Bacteria | 2349 |
| 1611 | Ga0500637_0059418 | 3300053178 | Bacteria | 2189 |
| 1612 | Ga0500576_131296 | 3300053725 | Bacteria | 969 |
| 1613 | Ga0500625_123222 | 3300053729 | Bacteria | 1036 |
| 1614 | Ga0500645_020104 | 3300053730 | Bacteria | 2071 |
| 1615 | Ga0500645_023572 | 3300053730 | Bacteria | 1886 |
| 1616 | Ga0500596_003436 | 3300053735 | Bacteria | 3013 |
| 1617 | Ga0500596_004728 | 3300053735 | Bacteria | 2471 |
| 1618 | Ga0500601_000419 | 3300053737 | Bacteria | 7101 |
| 1619 | Ga0500601_008099 | 3300053737 | Bacteria | 1167 |
| 1620 | Ga0501084_0443335 | 3300054114 | Bacteria | 1098 |
| 1621 | Ga0500661_001372 | 3300055283 | Bacteria | 4539 |
| 1622 | Ga0500661_024396 | 3300055283 | Bacteria | 1069 |
| 1623 | Ga0501082_0072371 | 3300060353 | Bacteria | 2969 |
| 1624 | Ga0501082_0134170 | 3300060353 | Bacteria | 2148 |
| 1625 | Ga0501082_0581604 | 3300060353 | Bacteria | 980 |
| 1626 | Ga0466962_0015531 | 3300061719 | Bacteria | 3673 |
| 1627 | Ga0530510_0524100 | 3300061734 | Bacteria | 899 |
| 1628 | 2507505454 | 2507262055 | Bacteria | 8048963 |
| 1629 | 2508539339 | 2508501009 | Bacteria | 7784016 |
| 1630 | 2508695668 | 2508501042 | Bacteria | 8719808 |
| 1631 | 2509152183 | 2508501128 | Bacteria | 8613869 |
| 1632 | 2511395680 | 2511231028 | Bacteria | 8046582 |
| 1633 | 2513623922 | 2513237092 | Bacteria | 8341956 |
| 1634 | 2513642196 | 2513237094 | Bacteria | 8789602 |
| 1635 | 2513651330 | 2513237095 | Bacteria | 8976980 |
| 1636 | 2513659513 | 2513237096 | Bacteria | 8722461 |
| 1637 | 2513676319 | 2513237098 | Bacteria | 9902361 |
| 1638 | 2513695291 | 2513237101 | Bacteria | 7952346 |
| 1639 | 2513700715 | 2513237102 | Bacteria | 7703324 |
| 1640 | 2513718244 | 2513237104 | Bacteria | 10034502 |
| 1641 | 2513859380 | 2513237137 | Bacteria | 9558895 |
| 1642 | 2513873343 | 2513237139 | Bacteria | 8737671 |
| 1643 | 2513888576 | 2513237141 | Bacteria | 8496279 |
| 1644 | 2513921554 | 2513237145 | Bacteria | 8979722 |
| 1645 | 2513998566 | 2513237159 | Bacteria | 6810126 |
| 1646 | 2514014673 | 2513237161 | Bacteria | 8871253 |
| 1647 | 2515627649 | 2515154112 | Bacteria | 8294334 |
| 1648 | 2517106276 | 2517093001 | Bacteria | 9002274 |
| 1649 | 2517889054 | 2517572143 | Bacteria | 9484767 |
| 1650 | 2524441445 | 2524023205 | Bacteria | 8918781 |
| 1651 | 2524458386 | 2524023209 | Bacteria | 6679728 |
| 1652 | 2524467223 | 2524023210 | Bacteria | 9029266 |
| 1653 | 2524537489 | 2524023228 | Bacteria | 10118060 |
| 1654 | 2528853314 | 2528768022 | Bacteria | 10457665 |
| 1655 | 2545678091 | 2545555834 | Bacteria | 8130841 |
| 1656 | 2585280649 | 2582581308 | Bacteria | 7413247 |
| 1657 | 2585326435 | 2582581315 | Bacteria | 7318924 |
| 1658 | 2585395986 | 2582581866 | Bacteria | 6859583 |
| 1659 | 2585531583 | 2585427527 | Bacteria | 7273426 |
| 1660 | 2585551470 | 2585427530 | Bacteria | 7383882 |
| 1661 | 2603858613 | 2602042107 | Bacteria | 6226103 |
| 1662 | 2616306806 | 2615840626 | Bacteria | 7921970 |
| 1663 | 2616557657 | 2615840698 | Bacteria | 7319877 |
| 1664 | 2617352057 | 2617270735 | Bacteria | 9163226 |
| 1665 | 2617373525 | 2617270741 | Bacteria | 8201522 |
| 1666 | 2617383325 | 2617270742 | Bacteria | 6808054 |
| 1667 | 2644291742 | 2643221651 | Bacteria | 4798932 |
| 1668 | 2671124043 | 2667528175 | Bacteria | 7532676 |
| 1669 | 2723841825 | 2721755755 | Bacteria | 8322773 |
| 1670 | 2728748428 | 2728368998 | Bacteria | 8720350 |
| 1671 | 2745077579 | 2744054633 | Bacteria | 8678936 |
| 1672 | 2778173676 | 2775507266 | Bacteria | 7392367 |
| 1673 | 2793062241 | 2791355196 | Bacteria | 7323613 |
| 1674 | 2793072707 | 2791355197 | Bacteria | 8420563 |
| 1675 | 2793078301 | |||
| 1676 | 2805920691 | 2802429603 | Bacteria | 8777136 |
| 1677 | 2818237860 | 2816332527 | Bacteria | 8933356 |
| 1678 | 2819244737 | 2818991272 | Bacteria | 4622173 |
| 1679 | 2819611167 | 2818991448 | Bacteria | 6772224 |
| 1680 | 2819638900 | 2818991453 | Bacteria | 7181617 |
| 1681 | 2824604419 | 2824600985 | Bacteria | 8488197 |
| 1682 | 2824614851 | 2824609381 | Bacteria | 8672835 |
| 1683 | 2824624168 | 2824617872 | Bacteria | 8814715 |
| 1684 | 2824632848 | 2824626560 | Bacteria | 8813858 |
| 1685 | 2824643753 | 2824635225 | Bacteria | 8785348 |
| 1686 | 2824652408 | 2824644064 | Bacteria | 8743947 |
| 1687 | 2824656297 | 2824653114 | Bacteria | 8493680 |
| 1688 | 2824669887 | 2824661429 | Bacteria | 9877870 |
| 1689 | 2824671753 | 2824671348 | Bacteria | 8369588 |
| 1690 | 2824684804 | 2824679649 | Bacteria | 8248951 |
| 1691 | 2824695782 | 2824687955 | Bacteria | 8360029 |
| 1692 | 2824701663 | 2824696289 | Bacteria | 8335049 |
| 1693 | 2824710871 | 2824704595 | Bacteria | 9667483 |
| 1694 | 2824722892 | 2824714736 | Bacteria | 8717648 |
| 1695 | 2824729494 | 2824723954 | Bacteria | 8758240 |
| 1696 | 2824740221 | 2824732956 | Bacteria | 7810675 |
| 1697 | 2824751144 | 2824746037 | Bacteria | 7911610 |
| 1698 | 2824760654 | 2824753945 | Bacteria | 9787441 |
| 1699 | 2824768458 | 2824763712 | Bacteria | 9792355 |
| 1700 | 2824781372 | 2824773399 | Bacteria | 8360218 |
| 1701 | 2838030858 | 2838029111 | Bacteria | 6603031 |
| 1702 | 2838124703 | 2838122688 | Bacteria | 8803140 |
| 1703 | 2841945394 | 2841941048 | Bacteria | 8688029 |
| 1704 | 2841952180 | 2841949485 | Bacteria | 8680857 |
| 1705 | 2841965342 | 2841957949 | Bacteria | 8652217 |
| 1706 | 2841970433 | 2841966195 | Bacteria | 8673214 |
| 1707 | 2841981681 | 2841974524 | Bacteria | 8931498 |
| 1708 | 2841984961 | 2841983080 | Bacteria | 8395090 |
| 1709 | 2842043316 | 2842038055 | Bacteria | 8002051 |
| 1710 | 2842052694 | 2842045827 | Bacteria | 8006841 |
| 1711 | 2842300358 | 2842298080 | Bacteria | 6123127 |
| 1712 | 2842361125 | 2842357229 | Bacteria | 6485165 |
| 1713 | 2842477590 | 2842475841 | Bacteria | 6603183 |
| 1714 | 2842487970 | 2842482326 | Bacteria | 7212537 |
| 1715 | 2842504537 | 2842502639 | Bacteria | 6604161 |
| 1716 | 2842511787 | 2842509118 | Bacteria | 6850950 |
| 1717 | 2842524403 | 2842521101 | Bacteria | 6569494 |
| 1718 | 2844315549 | 2844315083 | Bacteria | 8138177 |
| 1719 | 2847931252 | 2847930680 | Bacteria | 9342022 |
| 1720 | 2847942345 | 2847939898 | Bacteria | 8606328 |
| 1721 | 2849083217 | 2849076700 | Bacteria | 7039503 |
| 1722 | 2852391620 | 2852387548 | Bacteria | 8025568 |
| 1723 | 2857516350 | 2857509624 | Bacteria | 7472071 |
| 1724 | 2857526262 | 2857524615 | Bacteria | 6615449 |
| 1725 | 2874592545 | 2874590934 | Bacteria | 8299676 |
| 1726 | 2874607882 | 2874604998 | Bacteria | 7834745 |
| 1727 | 2874617976 | 2874612657 | Bacteria | 8252029 |
| 1728 | 2874621199 | 2874620515 | Bacteria | 8290088 |
| 1729 | 2874628598 | 2874628541 | Bacteria | 8630250 |
| 1730 | 2874647164 | 2874645413 | Bacteria | 8214782 |
| 1731 | 2876769645 | 2876761206 | Bacteria | 10111113 |
| 1732 | 2876772548 | 2876771140 | Bacteria | 8287509 |
| 1733 | 2876819809 | 2876818435 | Bacteria | 8274608 |
| 1734 | 2879076315 | 2879074833 | Bacteria | 8279565 |
| 1735 | 2879083774 | 2879083081 | Bacteria | 8587928 |
| 1736 | 2879100443 | 2879099564 | Bacteria | 10442239 |
| 1737 | 2879113309 | 2879110137 | Bacteria | 8907982 |
| 1738 | 2879128799 | 2879127579 | Bacteria | 8294491 |
| 1739 | 2879143620 | 2879142872 | Bacteria | 8267021 |
| 1740 | 2881368930 | 2881364244 | Bacteria | 7710352 |
| 1741 | 2881673213 | 2881665667 | Bacteria | 8175609 |
| 1742 | 2885369331 | 2885366525 | Bacteria | 8326213 |
| 1743 | 2885377558 | 2885374607 | Bacteria | 8927485 |
| 1744 | 2885386722 | 2885383462 | Bacteria | 9473874 |
| 1745 | 2885415194 | 2885409591 | Bacteria | 9235467 |
| 1746 | 2888390497 | 2888388044 | Bacteria | 7304136 |
| 1747 | 2888420118 | 2888419890 | Bacteria | 7857137 |
| 1748 | 2889035298 | 2889033259 | Bacteria | 9099371 |
| 1749 | 2893067466 | 2893066018 | Bacteria | 6158120 |
| 1750 | 2903733542 | 2903727486 | Bacteria | 8281579 |
| 1751 | 2903758793 | 2903748898 | Bacteria | 9972761 |
| 1752 | 2903777915 | 2903768456 | Bacteria | 9749579 |
| 1753 | 2904667744 | 2904666416 | Bacteria | 8226587 |
| 1754 | 2904691001 | 2904690495 | Bacteria | 9412302 |
| 1755 | 2904708398 | |||
| 1756 | 2904716326 | 2904711408 | Bacteria | 9771557 |
| 1757 | 2906608896 | 2906602504 | Bacteria | 8295279 |
| 1758 | 2906613570 | |||
| 1759 | 2906631672 | 2906626472 | Bacteria | 8826946 |
| 1760 | 2906636574 | 2906635258 | Bacteria | 8601019 |
| 1761 | 2906648338 | 2906643746 | Bacteria | 8722424 |
| 1762 | 2906668104 | 2906660503 | Bacteria | 8595048 |
| 1763 | 2908747657 | 2908739725 | Bacteria | 8628932 |
| 1764 | 2908757059 | 2908756301 | Bacteria | 8864324 |
| 1765 | 2908775996 | 2908775508 | Bacteria | 8092255 |
| 1766 | 2919073885 | 2919073203 | Bacteria | 6531949 |
| 1767 | 2919453274 | 2919450847 | Bacteria | 5631160 |
| 1768 | 2922363211 | 2922361189 | Bacteria | 7436256 |
| 1769 | 2922369384 | |||
| 1770 | 2922388484 | 2922386360 | Bacteria | 7017218 |
| 1771 | 2922396580 | 2922393267 | Bacteria | 8285685 |
| 1772 | 2922434007 | |||
| 1773 | 2929618787 | 2929615660 | Bacteria | 9193770 |
| 1774 | 2929628528 | 2929624759 | Bacteria | 9339455 |
| 1775 | 2932790969 | 2932784394 | Bacteria | 9704911 |
| 1776 | 2932794138 | 2932794094 | Bacteria | 7915132 |
| 1777 | 2932809214 | 2932801729 | Bacteria | 7987968 |
| 1778 | 2932811977 | 2932809354 | Bacteria | 9135765 |
| 1779 | 2932825572 | 2932818245 | Bacteria | 9955613 |
| 1780 | 2932833685 | 2932828146 | Bacteria | 9745859 |
| 1781 | 2933580503 | 2933577622 | Bacteria | 9116884 |
| 1782 | 2935615516 | 2935608549 | Bacteria | 8203142 |
| 1783 | 2935623211 | 2935616580 | Bacteria | 9032984 |
| 1784 | 2935636034 | 2935630451 | Bacteria | 8169952 |
| 1785 | 2935644286 | 2935638405 | Bacteria | 10015038 |
| 1786 | 2935654445 | 2935648319 | Bacteria | 8801166 |
| 1787 | 2935663325 | 2935656913 | Bacteria | 8965014 |
| 1788 | 2935672132 | 2935665750 | Bacteria | 9571747 |
| 1789 | 2935679348 | 2935675223 | Bacteria | 9928132 |
| 1790 | 2935686590 | 2935684952 | Bacteria | 9590419 |
| 1791 | 2935700371 | 2935694250 | Bacteria | 9291695 |
| 1792 | 2935710319 | 2935703347 | Bacteria | 10242284 |
| 1793 | 2935716278 | 2935713505 | Bacteria | 9608509 |
| 1794 | 2935723598 | 2935722832 | Bacteria | 9608746 |
| 1795 | 2935735153 | 2935732158 | Bacteria | 9706831 |
| 1796 | 2935744056 | 2935741537 | Bacteria | 9707219 |
| 1797 | 2935752556 | 2935750917 | Bacteria | 9590372 |
| 1798 | 2935763311 | 2935760218 | Bacteria | 9817913 |
| 1799 | 2935774284 | 2935769743 | Bacteria | 7878163 |
| 1800 | 2935783350 | 2935777560 | Bacteria | 8077691 |
| 1801 | 2935789001 | 2935785616 | Bacteria | 7962367 |
| 1802 | 2935796751 | 2935793552 | Bacteria | 8012592 |
| 1803 | 2935808310 | 2935801545 | Bacteria | 9301974 |
| 1804 | 2935816076 | 2935810662 | Bacteria | 9401221 |
| 1805 | 2935825683 | 2935819856 | Bacteria | 8261050 |
| 1806 | 2935833470 | 2935827899 | Bacteria | 10038562 |
| 1807 | 2935845972 | 2935837841 | Bacteria | 9454360 |
| 1808 | 2935853447 | 2935847175 | Bacteria | 8228321 |
| 1809 | 2935861459 | 2935855204 | Bacteria | 9035059 |
| 1810 | 2935869578 | 2935864058 | Bacteria | 9784707 |
| 1811 | 2935879907 | 2935873716 | Bacteria | 9632195 |
| 1812 | 2935889165 | 2935883170 | Bacteria | 7964738 |
| 1813 | 2935915049 | 2935908558 | Bacteria | 8568796 |
| 1814 | 2935918897 | 2935916978 | Bacteria | 9113783 |
| 1815 | 2935931386 | 2935926038 | Bacteria | 8601059 |
| 1816 | 2935939983 | 2935934488 | Bacteria | 8602579 |
| 1817 | 2935947670 | 2935942939 | Bacteria | 8599779 |
| 1818 | 2935956441 | 2935951376 | Bacteria | 8602333 |
| 1819 | 2935966713 | 2935959822 | Bacteria | 7869783 |
| 1820 | 2935973235 | 2935967501 | Bacteria | 8603075 |
| 1821 | 2935980522 | 2935975950 | Bacteria | 8347125 |
| 1822 | 2935990128 | 2935984226 | Bacteria | 8302647 |
| 1823 | 2935997870 | 2935992306 | Bacteria | 9802711 |
| 1824 | 2936008865 | 2936002035 | Bacteria | 9362176 |
| 1825 | 2936017516 | 2936011229 | Bacteria | 8801034 |
| 1826 | 2936025983 | 2936019824 | Bacteria | 8804134 |
| 1827 | 2936034825 | 2936028420 | Bacteria | 8965941 |
| 1828 | 2936041081 | 2936037263 | Bacteria | 9446081 |
| 1829 | 2936052917 | 2936046547 | Bacteria | 8903709 |
| 1830 | 2936060224 | 2936055302 | Bacteria | 8785755 |
| 1831 | 2940558469 | 2940556831 | Bacteria | 9590747 |
| 1832 | 2941512662 | 2941507105 | Bacteria | 8166816 |
| 1833 | 2941520500 | 2941515067 | Bacteria | 8166720 |
| 1834 | 2941528514 | 2941523033 | Bacteria | 8169134 |
| 1835 | 2941535339 | 2941531003 | Bacteria | 7653939 |
| 1836 | 2941547141 | 2941538514 | Bacteria | 9402094 |
| 1837 | 2977865575 | 2977864932 | Bacteria | 7534097 |
| 1838 | 3005421699 | 3005416602 | Bacteria | 7064308 |
| 1839 | 3005475278 | 3005474847 | Bacteria | 9259049 |
| 1840 | 3005486670 | 3005483717 | Bacteria | 7877331 |
| 1841 | 3005508976 | 3005506211 | Bacteria | 6943378 |
| 1842 | 3005594141 | 3005587118 | Bacteria | 7794411 |
| 1843 | 3005595239 | 3005594810 | Bacteria | 8716512 |
| 1844 | 3005711182 | 3005710791 | Bacteria | 7622528 |
| 1845 | 3005718477 | 3005718088 | Bacteria | 8283608 |
| 1846 | 641642395 | 641522639 | Bacteria | 7737025 |
| 1847 | 8001847186 | 8001845381 | Bacteria | 5804942 |
| 1848 | 8003017859 | 8003014200 | Bacteria | 4059994 |
| 1849 | 8005319597 | 8005314921 | Bacteria | 7072929 |
| 1850 | 8005490220 | 8005484373 | Bacteria | 6297373 |
| 1851 | 8005646877 | 8005645114 | Bacteria | 6950293 |
| 1852 | 8005688062 | 8005682033 | Bacteria | 6726518 |
| 1853 | 8006927252 | 8006926726 | Bacteria | 6749210 |
| 1854 | 8006935999 | 8006933436 | Bacteria | 10410654 |
| 1855 | 8006975877 | 8006973647 | Bacteria | 10679141 |
| 1856 | 8006991110 | 8006984368 | Bacteria | 9651211 |
| 1857 | 8007000439 | 8006994254 | Bacteria | 8309700 |
| 1858 | 8016517987 | 8016511872 | Bacteria | 9921665 |
| 1859 | 8016526332 | 8016522445 | Bacteria | 8156687 |
| 1860 | 8016531396 | 8016530956 | Bacteria | 8155261 |
| 1861 | 8016544608 | 8016539877 | Bacteria | 8155419 |
| 1862 | 8016557466 | 8016548790 | Bacteria | 8155074 |
| 1863 | 8016565824 | 8016557553 | Bacteria | 8154380 |
| 1864 | 8016569663 | 8016566248 | Bacteria | 8158151 |
| 1865 | 8016582270 | 8016575299 | Bacteria | 8154085 |
| 1866 | 8016586145 | 8016583857 | Bacteria | 10421953 |
| 1867 | 8016603424 | 8016595262 | Bacteria | 8149947 |
| 1868 | 8016606359 | 8016603502 | Bacteria | 8731218 |
| 1869 | 8016618266 | 8016613128 | Bacteria | 8794220 |
| 1870 | 8016622917 | 8016622563 | Bacteria | 7999408 |
| 1871 | 8016635421 | 8016630954 | Bacteria | 9217207 |
| 1872 | 8017058653 | 8017057580 | Bacteria | 10023680 |
| 1873 | 8019531229 | 8019530166 | Bacteria | 8155624 |
| 1874 | 8019540323 | 8019538911 | Bacteria | 7872763 |
| 1875 | 8019549915 | 8019547302 | Bacteria | 7996444 |
| 1876 | 8019562658 | 8019555841 | Bacteria | 9642137 |
| 1877 | 8019572735 | 8019565922 | Bacteria | 9639779 |
| 1878 | 8019577004 | 8019576017 | Bacteria | 10049540 |
| 1879 | 8019595071 | 8019586578 | Bacteria | 10212056 |
| 1880 | 8019606673 | 8019597564 | Bacteria | 10041141 |
| 1881 | 8019611840 | 8019608314 | Bacteria | 10042931 |
| 1882 | 8019623167 | 8019619141 | Bacteria | 9218857 |
| 1883 | 8019629931 | 8019629233 | Bacteria | 8687553 |
| 1884 | 8019640675 | 8019638758 | Bacteria | 9062356 |
| 1885 | 8019652278 | 8019648815 | Bacteria | 10014479 |
| 1886 | 8019666768 | 8019659431 | Bacteria | 8577854 |
| 1887 | 8019676528 | 8019668869 | Bacteria | 8791617 |
| 1888 | 8019679460 | 8019678201 | Bacteria | 8863603 |
| 1889 | 8019696043 | 8019687851 | Bacteria | 8712826 |
| 1890 | 8024490777 | 8024486573 | Bacteria | 6540512 |
| 1891 | 8055742636 | 8055742211 | Bacteria | 9226248 |
| 1892 | 8056676145 | 8056673599 | Bacteria | 7871253 |
| 1893 | 8056682944 | 8056681323 | Bacteria | 8472857 |
| 1894 | 8056693785 | 8056689827 | Bacteria | 6712655 |
| 1895 | 8056971497 | 8056967851 | Bacteria | 9038162 |
| 1896 | 8057581535 | 8057575449 | Bacteria | 7367519 |
| 1897 | JGI25404J52841_10020694 | |||
| 1898 | JGI25155J39150_1000010 | |||
| 1899 | JGI25156J39149_1000033 | |||
| 1900 | JGI25156J39149_1000461 | |||
| 1901 | JGI25156J39149_1000930 | |||
| 1902 | JGI25162J39368_1000607 | |||
| 1903 | JGI25154J39366_1000058 | |||
| 1904 | JGI25154J39366_1000761 | |||
| 1905 | JGI25154J39366_1002142 | |||
| 1906 | JGI25157J39369_1000009 | |||
| 1907 | JGI25157J39369_1000045 | |||
| 1908 | JGI25159J45721_1001420 | |||
| 1909 | JGI25406J46586_10000881 | |||
| 1910 | JGI25406J46586_10009349 | |||
| 1911 | JGI25165J46597_1001489 | |||
| 1912 | JGI25165J46597_1002089 | |||
| 1913 | JGI25153J46596_10005387 | |||
| 1914 | JGI25153J46596_10006271 | |||
| 1915 | JGI25153J46596_10006385 | |||
| 1916 | JGI25153J46596_10011204 | |||
| 1917 | JGI25153J46596_10014578 | |||
| 1918 | JGI25153J46596_10052728 | |||
| 1919 | JGI25153J46596_10055018 | |||
| 1920 | rootL2_10022138 | |||
| 1921 | JGI25160J50197_1000402 | |||
| 1922 | JGI25160J50197_1005378 | |||
| 1923 | JGI25160J50197_1031032 | |||
| 1924 | JGI25161J50226_1000324 | |||
| 1925 | JGI25404J52841_10000873 | |||
| 1926 | JGI25404J52841_10025159 | |||
| 1927 | Ga0055539_1004125 | |||
| 1928 | Ga0055542_1006050 | |||
| 1929 | Ga0055526_1021210 | |||
| 1930 | Ga0055524_1015899 | |||
| 1931 | Ga0055524_1016642 | |||
| 1932 | Ga0055536_1000652 | |||
| 1933 | Ga0055536_1014230 | |||
| 1934 | Ga0055530_10000735 | |||
| 1935 | Ga0055531_10004632 | |||
| 1936 | Ga0055531_10021366 | |||
| 1937 | Ga0055531_10034300 | |||
| 1938 | Ga0055543_1000099 | |||
| 1939 | Ga0055543_1011753 | |||
| 1940 | Ga0065165_1001848 | |||
| 1941 | Ga0065165_1003775 | |||
| 1942 | Ga0065165_1003886 | |||
| 1943 | Ga0065165_1025064 | |||
| 1944 | Ga0070658_10012453 | |||
| 1945 | Ga0070658_10207299 | |||
| 1946 | Ga0070658_10298078 | |||
| 1947 | Ga0070658_10505911 | |||
| 1948 | Ga0070683_100006653 | |||
| 1949 | Ga0070683_100135402 | |||
| 1950 | Ga0070683_100494235 | |||
| 1951 | Ga0070683_100769576 | |||
| 1952 | Ga0070690_100087960 | |||
| 1953 | Ga0070677_10027314 | |||
| 1954 | Ga0068869_100031930 | |||
| 1955 | Ga0068869_100065052 | |||
| 1956 | Ga0068869_100234518 | |||
| 1957 | Ga0068869_100434449 | |||
| 1958 | Ga0068869_100702473 | |||
| 1959 | Ga0070680_100041662 | |||
| 1960 | Ga0070680_100044841 | |||
| 1961 | Ga0070680_100343000 | |||
| 1962 | Ga0070680_100590832 | |||
| 1963 | Ga0068868_100048998 | |||
| 1964 | Ga0070660_100037559 | |||
| 1965 | Ga0070660_100483715 | |||
| 1966 | Ga0070691_10220480 | |||
| 1967 | Ga0070668_100052173 | |||
| 1968 | Ga0070668_100140537 | |||
| 1969 | Ga0070668_100382903 | |||
| 1970 | Ga0070668_100485257 | |||
| 1971 | Ga0070668_100823275 | |||
| 1972 | Ga0070669_100196450 | |||
| 1973 | Ga0070669_100346758 | |||
| 1974 | Ga0070669_100391208 | |||
| 1975 | Ga0070671_100198173 | |||
| 1976 | Ga0070671_100236190 | |||
| 1977 | Ga0070671_100450287 | |||
| 1978 | Ga0070671_100469477 | |||
| 1979 | Ga0070673_100136304 | |||
| 1980 | Ga0070673_100535313 | |||
| 1981 | Ga0070688_100151913 | |||
| 1982 | Ga0070688_100263101 | |||
| 1983 | Ga0070659_100338838 | |||
| 1984 | Ga0070659_100368734 | |||
| 1985 | Ga0070659_100428373 | |||
| 1986 | Ga0070659_100598793 | |||
| 1987 | Ga0070667_100573038 | |||
| 1988 | Ga0070709_10000164 | |||
| 1989 | Ga0070709_10017700 | |||
| 1990 | Ga0070709_10055190 | |||
| 1991 | Ga0070709_10086525 | |||
| 1992 | Ga0070714_100030119 | |||
| 1993 | Ga0070714_100062614 | |||
| 1994 | Ga0070714_100104098 | |||
| 1995 | Ga0070714_100117957 | |||
| 1996 | Ga0070714_100123063 | |||
| 1997 | Ga0070714_100249189 | |||
| 1998 | Ga0070713_100004014 | |||
| 1999 | Ga0070713_100029341 | |||
| 2000 | Ga0070713_100054336 | |||
| 2001 | Ga0070713_100081484 | |||
| 2002 | Ga0070713_100131019 | |||
| 2003 | Ga0070713_100205029 | |||
| 2004 | Ga0070710_10000283 | |||
| 2005 | Ga0070710_10053256 | |||
| 2006 | Ga0070710_10069267 | |||
| 2007 | Ga0070701_10240533 | |||
| 2008 | Ga0070711_100005189 | |||
| 2009 | Ga0070711_100013134 | |||
| 2010 | Ga0070711_100025376 | |||
| 2011 | Ga0070711_100089685 | |||
| 2012 | Ga0070711_100165225 | |||
| 2013 | Ga0070711_100179445 | |||
| 2014 | Ga0070700_100044957 | |||
| 2015 | Ga0070708_100066262 | |||
| 2016 | Ga0070708_100096501 | |||
| 2017 | Ga0070663_100041632 | |||
| 2018 | Ga0070663_100139944 | |||
| 2019 | Ga0070663_100147094 | |||
| 2020 | Ga0070663_100212729 | |||
| 2021 | Ga0070663_100274288 | |||
| 2022 | Ga0070663_100296625 | |||
| 2023 | Ga0070663_100393317 | |||
| 2024 | Ga0070678_100092031 | |||
| 2025 | Ga0070678_100137508 | |||
| 2026 | Ga0070678_100256558 | |||
| 2027 | Ga0070678_100373035 | |||
| 2028 | Ga0070662_100183639 | |||
| 2029 | Ga0070662_100515585 | |||
| 2030 | Ga0070662_100687996 | |||
| 2031 | Ga0070681_10017254 | |||
| 2032 | Ga0070681_10093484 | |||
| 2033 | Ga0070681_10094766 | |||
| 2034 | Ga0070681_10299056 | |||
| 2035 | Ga0070681_10374239 | |||
| 2036 | Ga0070681_10505724 | |||
| 2037 | Ga0068867_100000132 | |||
| 2038 | Ga0068867_100181797 | |||
| 2039 | Ga0068867_100229924 | |||
| 2040 | Ga0070685_10285882 | |||
| 2041 | Ga0070706_100277642 | |||
| 2042 | Ga0070706_100520330 | |||
| 2043 | Ga0070707_100028781 | |||
| 2044 | Ga0070679_100023030 | |||
| 2045 | Ga0070679_100216359 | |||
| 2046 | Ga0070679_100251738 | |||
| 2047 | Ga0070679_100262151 | |||
| 2048 | Ga0070679_100496499 | |||
| 2049 | Ga0070684_100006976 | |||
| 2050 | Ga0070684_100026892 | |||
| 2051 | Ga0070684_100185707 | |||
| 2052 | Ga0068853_100000920 | |||
| 2053 | Ga0068853_100070306 | |||
| 2054 | Ga0068853_100311796 | |||
| 2055 | Ga0068853_100637155 | |||
| 2056 | Ga0068853_100661748 | |||
| 2057 | Ga0070672_100500904 | |||
| 2058 | Ga0070693_100144964 | |||
| 2059 | Ga0070693_100580223 | |||
| 2060 | Ga0070665_100024388 | |||
| 2061 | Ga0070665_100101283 | |||
| 2062 | Ga0070665_100211868 | |||
| 2063 | Ga0070665_100270689 | |||
| 2064 | Ga0070665_100308556 | |||
| 2065 | Ga0070665_100346113 | |||
| 2066 | Ga0070665_100422675 | |||
| 2067 | Ga0070665_100545562 | |||
| 2068 | Ga0070665_100592664 | |||
| 2069 | Ga0068855_100028007 | |||
| 2070 | Ga0068855_100098102 | |||
| 2071 | Ga0068855_100105596 | |||
| 2072 | Ga0068855_100233801 | |||
| 2073 | Ga0068855_100298791 | |||
| 2074 | Ga0068855_100455996 | |||
| 2075 | Ga0068855_100674179 | |||
| 2076 | Ga0068857_100028526 | |||
| 2077 | Ga0068857_100035276 | |||
| 2078 | Ga0068857_100208760 | |||
| 2079 | Ga0068857_100311339 | |||
| 2080 | Ga0068854_100062569 | |||
| 2081 | Ga0068854_100092598 | |||
| 2082 | Ga0068854_100191523 | |||
| 2083 | Ga0068854_100255310 | |||
| 2084 | Ga0068854_100431450 | |||
| 2085 | Ga0068856_100004492 | |||
| 2086 | Ga0068856_100292845 | |||
| 2087 | Ga0068856_100349754 | |||
| 2088 | Ga0068856_100363149 | |||
| 2089 | Ga0068856_100822091 | |||
| 2090 | Ga0068852_100010275 | |||
| 2091 | Ga0068852_100040281 | |||
| 2092 | Ga0068852_100098915 | |||
| 2093 | Ga0068852_100125731 | |||
| 2094 | Ga0068852_100225110 | |||
| 2095 | Ga0068852_100311084 | |||
| 2096 | Ga0068852_100413880 | |||
| 2097 | Ga0068852_100434126 | |||
| 2098 | Ga0068852_100508440 | |||
| 2099 | Ga0068859_100258476 | |||
| 2100 | Ga0068859_100681946 | |||
| 2101 | Ga0068864_100514833 | |||
| 2102 | Ga0068866_10041018 | |||
| 2103 | Ga0068861_100050132 | |||
| 2104 | Ga0068861_100074402 | |||
| 2105 | Ga0068861_100147213 | |||
| 2106 | Ga0068861_100315152 | |||
| 2107 | Ga0068851_10168405 | |||
| 2108 | Ga0068863_100293033 | |||
| 2109 | Ga0068858_100147750 | |||
| 2110 | Ga0068858_100555483 | |||
| 2111 | Ga0068858_100592646 | |||
| 2112 | Ga0068858_100897382 | |||
| 2113 | Ga0068860_100017741 | |||
| 2114 | Ga0068860_100057499 | |||
| 2115 | Ga0068860_100097070 | |||
| 2116 | Ga0068862_100107085 | |||
| 2117 | Ga0068862_100170312 | |||
| 2118 | Ga0068862_100339805 | |||
| 2119 | Ga0068862_100635015 | |||
| 2120 | Ga0068862_100753490 | |||
| 2121 | Ga0081455_10016293 | |||
| 2122 | Ga0081455_10027264 | |||
| 2123 | Ga0081455_10089378 | |||
| 2124 | Ga0081455_10141870 | |||
| 2125 | Ga0081455_10338688 | |||
| 2126 | Ga0081540_1002717 | |||
| 2127 | Ga0081540_1003025 | |||
| 2128 | Ga0081540_1004243 | |||
| 2129 | Ga0081540_1004583 | |||
| 2130 | Ga0081540_1005857 | |||
| 2131 | Ga0081540_1014469 | |||
| 2132 | Ga0081540_1018885 | |||
| 2133 | Ga0081540_1115847 | |||
| 2134 | Ga0081539_10000048 | |||
| 2135 | Ga0081539_10000371 | |||
| 2136 | Ga0081539_10027283 | |||
| 2137 | Ga0081539_10039012 | |||
| 2138 | Ga0070717_10038762 | |||
| 2139 | Ga0070717_10304845 | |||
| 2140 | Ga0075365_10004924 | |||
| 2141 | Ga0075365_10007177 | |||
| 2142 | Ga0075365_10130855 | |||
| 2143 | Ga0075365_10162096 | |||
| 2144 | Ga0075365_10173348 | |||
| 2145 | Ga0075365_10282347 | |||
| 2146 | Ga0075365_10286354 | |||
| 2147 | Ga0075365_10355630 | |||
| 2148 | Ga0075365_10398776 | |||
| 2149 | Ga0075368_10007084 | |||
| 2150 | Ga0075368_10057299 | |||
| 2151 | Ga0075363_100000382 | |||
| 2152 | Ga0075363_100005846 | |||
| 2153 | Ga0075363_100009480 | |||
| 2154 | Ga0075363_100126110 | |||
| 2155 | Ga0075364_10000195 | |||
| 2156 | Ga0075364_10049442 | |||
| 2157 | Ga0075364_10086211 | |||
| 2158 | Ga0075364_10150150 | |||
| 2159 | Ga0075364_10162804 | |||
| 2160 | Ga0075364_10174044 | |||
| 2161 | Ga0075364_10335348 | |||
| 2162 | Ga0070716_100008198 | |||
| 2163 | Ga0070716_100009333 | |||
| 2164 | Ga0070716_100032839 | |||
| 2165 | Ga0070716_100199137 | |||
| 2166 | Ga0070712_100023970 | |||
| 2167 | Ga0070712_100027147 | |||
| 2168 | Ga0070712_100096550 | |||
| 2169 | Ga0075362_10035287 | |||
| 2170 | Ga0075367_10080527 | |||
| 2171 | Ga0075367_10097099 | |||
| 2172 | Ga0075367_10171907 | |||
| 2173 | Ga0075367_10177025 | |||
| 2174 | Ga0075367_10298190 | |||
| 2175 | Ga0075367_10312096 | |||
| 2176 | Ga0075367_10431034 | |||
| 2177 | Ga0075369_10038939 | |||
| 2178 | Ga0075369_10118264 | |||
| 2179 | Ga0075366_10012656 | |||
| 2180 | Ga0075366_10055656 | |||
| 2181 | Ga0075366_10179064 | |||
| 2182 | Ga0097621_100021414 | |||
| 2183 | Ga0097621_100338574 | |||
| 2184 | Ga0097621_100397341 | |||
| 2185 | Ga0075370_10018863 | |||
| 2186 | Ga0075370_10059152 | |||
| 2187 | Ga0075370_10181566 | |||
| 2188 | Ga0068871_100040788 | |||
| 2189 | Ga0068871_100048194 | |||
| 2190 | Ga0068871_100562738 | |||
| 2191 | Ga0075428_100438771 | |||
| 2192 | Ga0075430_100026357 | |||
| 2193 | Ga0075430_100105658 | |||
| 2194 | Ga0075431_100428391 | |||
| 2195 | Ga0075434_100047268 | |||
| 2196 | Ga0075434_100459994 | |||
| 2197 | Ga0068865_100178984 | |||
| 2198 | Ga0068865_100179000 | |||
| 2199 | Ga0068865_100269681 | |||
| 2200 | Ga0097620_100258488 | |||
| 2201 | Ga0097620_100681901 | |||
| 2202 | Ga0099825_1017392 | |||
| 2203 | Ga0099824_1007180 | |||
| 2204 | Ga0099824_1027556 | |||
| 2205 | Ga0099822_1002271 | |||
| 2206 | Ga0099823_1023214 | |||
| 2207 | Ga0075435_100380488 | |||
| 2208 | Ga0099794_10047333 | |||
| 2209 | Ga0099795_10037802 | |||
| 2210 | Ga0105250_10165893 | |||
| 2211 | Ga0105240_10000013 | |||
| 2212 | Ga0105240_10012727 | |||
| 2213 | Ga0105240_10020094 | |||
| 2214 | Ga0105240_10022735 | |||
| 2215 | Ga0105240_10055770 | |||
| 2216 | Ga0105240_10332844 | |||
| 2217 | Ga0105240_10719140 | |||
| 2218 | Ga0105240_10734820 | |||
| 2219 | Ga0105245_10226247 | |||
| 2220 | Ga0105247_10023886 | |||
| 2221 | Ga0105247_10057618 | |||
| 2222 | Ga0105247_10182009 | |||
| 2223 | Ga0105247_10293768 | |||
| 2224 | Ga0105243_10263184 | |||
| 2225 | Ga0105243_10271879 | |||
| 2226 | Ga0105243_10430073 | |||
| 2227 | Ga0105243_10553103 | |||
| 2228 | Ga0105243_10562392 | |||
| 2229 | Ga0105241_10049205 | |||
| 2230 | Ga0105241_10339602 | |||
| 2231 | Ga0105241_10391324 | |||
| 2232 | Ga0105248_10120731 | |||
| 2233 | Ga0105248_10635602 | |||
| 2234 | Ga0105248_10689155 | |||
| 2235 | Ga0105248_10898060 | |||
| 2236 | Ga0105237_10002598 | |||
| 2237 | Ga0105237_10017536 | |||
| 2238 | Ga0105237_10091115 | |||
| 2239 | Ga0105237_10221142 | |||
| 2240 | Ga0105237_10240258 | |||
| 2241 | Ga0105237_10247679 | |||
| 2242 | Ga0105237_10301126 | |||
| 2243 | Ga0105237_10352310 | |||
| 2244 | Ga0105237_10475520 | |||
| 2245 | Ga0105237_10595280 | |||
| 2246 | Ga0105237_10689385 | |||
| 2247 | Ga0105238_10009549 | |||
| 2248 | Ga0105238_10025758 | |||
| 2249 | Ga0105238_10069644 | |||
| 2250 | Ga0105238_10104060 | |||
| 2251 | Ga0105238_10338890 | |||
| 2252 | Ga0105238_10436104 | |||
| 2253 | Ga0105238_10468490 | |||
| 2254 | Ga0105238_10523078 | |||
| 2255 | Ga0105249_10280767 | |||
| 2256 | Ga0105249_10967360 | |||
| 2257 | Ga0099796_10013549 | |||
| 2258 | Ga0105239_10001552 | |||
| 2259 | Ga0105239_10029609 | |||
| 2260 | Ga0105239_10049028 | |||
| 2261 | Ga0105239_10066302 | |||
| 2262 | Ga0105239_10098964 | |||
| 2263 | Ga0105239_10322873 | |||
| 2264 | Ga0105239_10367445 | |||
| 2265 | Ga0105239_10420512 | |||
| 2266 | Ga0105239_10818285 | |||
| 2267 | Ga0105239_11237692 | |||
| 2268 | Ga0105246_10151091 | |||
| 2269 | Ga0157373_10143046 | |||
| 2270 | Ga0157370_10002466 | |||
| 2271 | Ga0157370_10049322 | |||
| 2272 | Ga0157370_10365195 | |||
| 2273 | Ga0157370_10436693 | |||
| 2274 | Ga0157369_10011256 | |||
| 2275 | Ga0157369_10030438 | |||
| 2276 | Ga0157369_10343414 | |||
| 2277 | Ga0157369_10429996 | |||
| 2278 | Ga0157369_10576917 | |||
| 2279 | Ga0157369_10778104 | |||
| 2280 | Ga0157369_10955390 | |||
| 2281 | Ga0157374_10141827 | |||
| 2282 | Ga0157374_10284100 | |||
| 2283 | Ga0157374_10319696 | |||
| 2284 | Ga0157374_10868258 | |||
| 2285 | Ga0157378_10020915 | |||
| 2286 | Ga0157378_10288653 | |||
| 2287 | Ga0157378_10463998 | |||
| 2288 | Ga0157378_10499372 | |||
| 2289 | Ga0157378_10837462 | |||
| 2290 | Ga0163162_10021854 | |||
| 2291 | Ga0163162_10065364 | |||
| 2292 | Ga0163162_10139830 | |||
| 2293 | Ga0163162_10425837 | |||
| 2294 | Ga0163162_10465549 | |||
| 2295 | Ga0163162_10927317 | |||
| 2296 | Ga0157372_10140987 | |||
| 2297 | Ga0157375_10126812 | |||
| 2298 | Ga0157375_10444794 | |||
| 2299 | Ga0157375_10481067 | |||
| 2300 | Ga0157375_10745912 | |||
| 2301 | Ga0163163_10002309 | |||
| 2302 | Ga0163163_10090473 | |||
| 2303 | Ga0163163_10289488 | |||
| 2304 | Ga0163163_10479801 | |||
| 2305 | Ga0163163_10947428 | |||
| 2306 | Ga0157380_10179675 | |||
| 2307 | Ga0157380_10264590 | |||
| 2308 | Ga0157380_10350881 | |||
| 2309 | Ga0182008_10048597 | |||
| 2310 | Ga0182008_10119980 | |||
| 2311 | Ga0157377_10063879 | |||
| 2312 | Ga0157377_10078346 | |||
| 2313 | Ga0157379_10397168 | |||
| 2314 | Ga0157379_10480485 | |||
| 2315 | Ga0157379_10555022 | |||
| 2316 | Ga0157376_10444440 | |||
| 2317 | Ga0182007_10002170 | |||
| 2318 | Ga0182005_1001931 | |||
| 2319 | Ga0206356_11507318 | |||
| 2320 | Ga0206353_10766002 | |||
| 2321 | Ga0214544_1000665 | |||
| 2322 | Ga0214542_1000486 | |||
| 2323 | Ga0214545_1000307 | |||
| 2324 | Ga0214543_1006816 | |||
| 2325 | Ga0213873_10003722 | |||
| 2326 | Ga0213872_10005811 | |||
| 2327 | Ga0213874_10035729 | |||
| 2328 | Ga0213874_10077232 | |||
| 2329 | Ga0213874_10107495 | |||
| 2330 | Ga0213876_10005727 | |||
| 2331 | Ga0213876_10140100 | |||
| 2332 | Ga0213871_10011628 | |||
| 2333 | Ga0209435_100009 | |||
| 2334 | Ga0209760_102134 | |||
| 2335 | Ga0209563_102071 | |||
| 2336 | Ga0209437_100107 | |||
| 2337 | Ga0209258_100603 | |||
| 2338 | Ga0209646_1000012 | |||
| 2339 | Ga0209646_1000018 | |||
| 2340 | Ga0209026_1000004 | |||
| 2341 | Ga0209026_1000068 | |||
| 2342 | Ga0209677_100543 | |||
| 2343 | Ga0209677_102252 | |||
| 2344 | Ga0209677_108510 | |||
| 2345 | Ga0209148_1000295 | |||
| 2346 | Ga0209148_1009014 | |||
| 2347 | Ga0209148_1009972 | |||
| 2348 | Ga0209759_1000003 | |||
| 2349 | Ga0209759_1000007 | |||
| 2350 | Ga0209233_1000072 | |||
| 2351 | Ga0209233_1000331 | |||
| 2352 | Ga0209233_1001838 | |||
| 2353 | Ga0209233_1003799 | |||
| 2354 | Ga0209233_1026225 | |||
| 2355 | Ga0209455_1006515 | |||
| 2356 | Ga0209673_1017234 | |||
| 2357 | Ga0209130_1000132 | |||
| 2358 | Ga0209675_1003067 | |||
| 2359 | Ga0209675_1012970 | |||
| 2360 | Ga0209676_1001214 | |||
| 2361 | Ga0209676_1014191 | |||
| 2362 | Ga0209676_1020233 | |||
| 2363 | Ga0209025_1004676 | |||
| 2364 | Ga0209025_1061552 | |||
| 2365 | Ga0209564_1001079 | |||
| 2366 | Ga0209564_1006939 | |||
| 2367 | Ga0209564_1007238 | |||
| 2368 | Ga0209564_1011458 | |||
| 2369 | Ga0209758_1000069 | |||
| 2370 | Ga0209758_1001816 | |||
| 2371 | Ga0209758_1001900 | |||
| 2372 | Ga0209758_1002809 | |||
| 2373 | Ga0209758_1003717 | |||
| 2374 | Ga0209758_1007298 | |||
| 2375 | Ga0209758_1008809 | |||
| 2376 | Ga0209758_1021604 | |||
| 2377 | Ga0209758_1040930 | |||
| 2378 | Ga0209758_1052380 | |||
| 2379 | Ga0209758_1067323 | |||
| 2380 | Ga0209050_1001391 | |||
| 2381 | Ga0209256_1002256 | |||
| 2382 | Ga0209256_1003770 | |||
| 2383 | Ga0209256_1005844 | |||
| 2384 | Ga0209256_1024062 | |||
| 2385 | Ga0207426_1000246 | |||
| 2386 | Ga0207426_1001802 | |||
| 2387 | Ga0207426_1004864 | |||
| 2388 | Ga0207426_1015528 | |||
| 2389 | Ga0209051_1010403 | |||
| 2390 | Ga0209051_1032751 | |||
| 2391 | Ga0209257_1000861 | |||
| 2392 | Ga0209257_1001693 | |||
| 2393 | Ga0209257_1004375 | |||
| 2394 | Ga0209257_1007230 | |||
| 2395 | Ga0209257_1044554 | |||
| 2396 | Ga0207697_10057289 | |||
| 2397 | Ga0207656_10047104 | |||
| 2398 | Ga0207656_10237828 | |||
| 2399 | Ga0207696_1029161 | |||
| 2400 | Ga0207682_10123497 | |||
| 2401 | Ga0207692_10000528 | |||
| 2402 | Ga0207692_10118118 | |||
| 2403 | Ga0207692_10295086 | |||
| 2404 | Ga0207642_10078666 | |||
| 2405 | Ga0207710_10111278 | |||
| 2406 | Ga0207710_10196426 | |||
| 2407 | Ga0207647_10166237 | |||
| 2408 | Ga0207685_10015765 | |||
| 2409 | Ga0207699_10000514 | |||
| 2410 | Ga0207699_10008188 | |||
| 2411 | Ga0207699_10010527 | |||
| 2412 | Ga0207699_10041934 | |||
| 2413 | Ga0207699_10214747 | |||
| 2414 | Ga0207699_10373520 | |||
| 2415 | Ga0207645_10041038 | |||
| 2416 | Ga0207645_10257501 | |||
| 2417 | Ga0207643_10070380 | |||
| 2418 | Ga0207643_10078747 | |||
| 2419 | Ga0207643_10199373 | |||
| 2420 | Ga0207705_10131879 | |||
| 2421 | Ga0207684_10160331 | |||
| 2422 | Ga0207654_10236159 | |||
| 2423 | Ga0207707_10001310 | |||
| 2424 | Ga0207707_10001402 | |||
| 2425 | Ga0207707_10051217 | |||
| 2426 | Ga0207707_10095278 | |||
| 2427 | Ga0207707_10131454 | |||
| 2428 | Ga0207707_10364834 | |||
| 2429 | Ga0207695_10000044 | |||
| 2430 | Ga0207695_10000148 | |||
| 2431 | Ga0207695_10003993 | |||
| 2432 | Ga0207695_10129811 | |||
| 2433 | Ga0207695_10355538 | |||
| 2434 | Ga0207695_10372267 | |||
| 2435 | Ga0207671_10000226 | |||
| 2436 | Ga0207671_10020952 | |||
| 2437 | Ga0207671_10048383 | |||
| 2438 | Ga0207671_10221193 | |||
| 2439 | Ga0207671_10498463 | |||
| 2440 | Ga0207693_10208915 | |||
| 2441 | Ga0207693_10231153 | |||
| 2442 | Ga0207663_10000375 | |||
| 2443 | Ga0207663_10055118 | |||
| 2444 | Ga0207663_10137563 | |||
| 2445 | Ga0207663_10231549 | |||
| 2446 | Ga0207663_10412634 | |||
| 2447 | Ga0207660_10047438 | |||
| 2448 | Ga0207660_10058358 | |||
| 2449 | Ga0207660_10138790 | |||
| 2450 | Ga0207660_10148215 | |||
| 2451 | Ga0207660_10220462 | |||
| 2452 | Ga0207660_10251525 | |||
| 2453 | Ga0207662_10211110 | |||
| 2454 | Ga0207657_10042668 | |||
| 2455 | Ga0207657_10049757 | |||
| 2456 | Ga0207657_10291162 | |||
| 2457 | Ga0207657_10357314 | |||
| 2458 | Ga0207649_10040379 | |||
| 2459 | Ga0207649_10301725 | |||
| 2460 | Ga0207649_10349453 | |||
| 2461 | Ga0207652_10001370 | |||
| 2462 | Ga0207652_10016073 | |||
| 2463 | Ga0207652_10276187 | |||
| 2464 | Ga0207646_10105621 | |||
| 2465 | Ga0207681_10288869 | |||
| 2466 | Ga0207694_10030854 | |||
| 2467 | Ga0207694_10059035 | |||
| 2468 | Ga0207694_10439491 | |||
| 2469 | Ga0207694_10494651 | |||
| 2470 | Ga0207650_10256799 | |||
| 2471 | Ga0207687_10002193 | |||
| 2472 | Ga0207700_10004601 | |||
| 2473 | Ga0207700_10062122 | |||
| 2474 | Ga0207700_10072990 | |||
| 2475 | Ga0207700_10091578 | |||
| 2476 | Ga0207700_10115402 | |||
| 2477 | Ga0207700_10158564 | |||
| 2478 | Ga0207700_10219356 | |||
| 2479 | Ga0207664_10004078 | |||
| 2480 | Ga0207664_10027086 | |||
| 2481 | Ga0207664_10041295 | |||
| 2482 | Ga0207664_10245334 | |||
| 2483 | Ga0207644_10072932 | |||
| 2484 | Ga0207690_10166497 | |||
| 2485 | Ga0207690_10471515 | |||
| 2486 | Ga0207706_10138351 | |||
| 2487 | Ga0207709_10247931 | |||
| 2488 | Ga0207709_10281180 | |||
| 2489 | Ga0207669_10011353 | |||
| 2490 | Ga0207669_10027226 | |||
| 2491 | Ga0207669_10257188 | |||
| 2492 | Ga0207704_10240201 | |||
| 2493 | Ga0207665_10016516 | |||
| 2494 | Ga0207665_10035202 | |||
| 2495 | Ga0207665_10054050 | |||
| 2496 | Ga0207665_10146904 | |||
| 2497 | Ga0207665_10267605 | |||
| 2498 | Ga0207665_10355207 | |||
| 2499 | Ga0207691_10175248 | |||
| 2500 | Ga0207691_10310873 | |||
| 2501 | Ga0207711_10333200 | |||
| 2502 | Ga0207711_10442796 | |||
| 2503 | Ga0207689_10012963 | |||
| 2504 | Ga0207689_10058572 | |||
| 2505 | Ga0207689_10157738 | |||
| 2506 | Ga0207689_10253696 | |||
| 2507 | Ga0207689_10351545 | |||
| 2508 | Ga0207661_10000878 | |||
| 2509 | Ga0207661_10026373 | |||
| 2510 | Ga0207661_10154480 | |||
| 2511 | Ga0207661_10666776 | |||
| 2512 | Ga0207679_10049493 | |||
| 2513 | Ga0207667_10002941 | |||
| 2514 | Ga0207667_10051535 | |||
| 2515 | Ga0207667_10224638 | |||
| 2516 | Ga0207667_10350671 | |||
| 2517 | Ga0207667_10381571 | |||
| 2518 | Ga0207667_10387579 | |||
| 2519 | Ga0207651_10799949 | |||
| 2520 | Ga0207712_10412499 | |||
| 2521 | Ga0207668_10293540 | |||
| 2522 | Ga0207668_10360208 | |||
| 2523 | Ga0207668_10372735 | |||
| 2524 | Ga0207668_10462947 | |||
| 2525 | Ga0207640_10004118 | |||
| 2526 | Ga0207640_10018861 | |||
| 2527 | Ga0207640_10280025 | |||
| 2528 | Ga0207640_10468153 | |||
| 2529 | Ga0207640_10710820 | |||
| 2530 | Ga0207658_10109156 | |||
| 2531 | Ga0207658_10531026 | |||
| 2532 | Ga0207677_10006274 | |||
| 2533 | Ga0207677_10064251 | |||
| 2534 | Ga0207677_10290760 | |||
| 2535 | Ga0207677_10490919 | |||
| 2536 | Ga0207703_10194914 | |||
| 2537 | Ga0207703_10209416 | |||
| 2538 | Ga0207703_10272804 | |||
| 2539 | Ga0207703_10711359 | |||
| 2540 | Ga0207639_10191284 | |||
| 2541 | Ga0207639_10343545 | |||
| 2542 | Ga0207639_10425442 | |||
| 2543 | Ga0207639_10476951 | |||
| 2544 | Ga0207639_10777349 | |||
| 2545 | Ga0207678_10073898 | |||
| 2546 | Ga0207678_10075876 | |||
| 2547 | Ga0207678_10173331 | |||
| 2548 | Ga0207678_10210337 | |||
| 2549 | Ga0207678_10244235 | |||
| 2550 | Ga0207678_10264609 | |||
| 2551 | Ga0207678_10267737 | |||
| 2552 | Ga0207678_10283635 | |||
| 2553 | Ga0207678_10293874 | |||
| 2554 | Ga0207678_10349488 | |||
| 2555 | Ga0207708_10035100 | |||
| 2556 | Ga0207708_10326432 | |||
| 2557 | Ga0207702_10000253 | |||
| 2558 | Ga0207702_10000318 | |||
| 2559 | Ga0207702_10231624 | |||
| 2560 | Ga0207702_10329654 | |||
| 2561 | Ga0207702_10486013 | |||
| 2562 | Ga0207641_10349703 | |||
| 2563 | Ga0207641_10764809 | |||
| 2564 | Ga0207648_10509839 | |||
| 2565 | Ga0207676_10129529 | |||
| 2566 | Ga0207674_10028915 | |||
| 2567 | Ga0207674_10042170 | |||
| 2568 | Ga0207674_10311069 | |||
| 2569 | Ga0207674_10580713 | |||
| 2570 | Ga0207675_100149906 | |||
| 2571 | Ga0207675_100154963 | |||
| 2572 | Ga0207675_100248454 | |||
| 2573 | Ga0207675_100454123 | |||
| 2574 | Ga0207675_100542946 | |||
| 2575 | Ga0207683_10120309 | |||
| 2576 | Ga0207683_10130661 | |||
| 2577 | Ga0207683_10142206 | |||
| 2578 | Ga0207683_10231116 | |||
| 2579 | Ga0207683_10246688 | |||
| 2580 | Ga0207683_10301546 | |||
| 2581 | Ga0207683_10577699 | |||
| 2582 | Ga0207698_10024892 | |||
| 2583 | Ga0207698_10126294 | |||
| 2584 | Ga0207698_10300921 | |||
| 2585 | Ga0207698_10307333 | |||
| 2586 | Ga0207698_10399309 | |||
| 2587 | Ga0207698_10426604 | |||
| 2588 | Ga0207698_10493304 | |||
| 2589 | Ga0209389_1000102 | |||
| 2590 | Ga0209389_1000142 | |||
| 2591 | Ga0209371_1001938 | |||
| 2592 | Ga0209589_1000035 | |||
| 2593 | Ga0209589_1000331 | |||
| 2594 | Ga0209489_100079 | |||
| 2595 | Ga0209489_100404 | |||
| 2596 | Ga0209489_100818 | |||
| 2597 | Ga0209700_100077 | |||
| 2598 | Ga0209700_100408 | |||
| 2599 | Ga0209179_1001374 | |||
| 2600 | Ga0209588_1001357 | |||
| 2601 | Ga0209813_10009317 | |||
| 2602 | Ga0209813_10031457 | |||
| 2603 | Ga0207428_10243821 | |||
| 2604 | Ga0268266_10008616 | |||
| 2605 | Ga0268266_10048797 | |||
| 2606 | Ga0268266_10060781 | |||
| 2607 | Ga0268266_10247167 | |||
| 2608 | Ga0268266_10275692 | |||
| 2609 | Ga0268266_10370293 | |||
| 2610 | Ga0268266_10391596 | |||
| 2611 | Ga0268266_10518135 | |||
| 2612 | Ga0268265_10014031 | |||
| 2613 | Ga0268265_10275630 | |||
| 2614 | Ga0268264_10000062 | |||
| 2615 | Ga0268264_10234589 | |||
| 2616 | Ga0268264_10392478 | |||
| 2617 | Ga0268264_10448204 | |||
| 2618 | Ga0268264_10490861 | |||
| 2619 | Ga0265319_1017352 | |||
| 2620 | Ga0265334_10046153 | |||
| 2621 | Ga0265318_10012602 | |||
| 2622 | Ga0265323_10002871 | |||
| 2623 | Ga0265322_10020639 | |||
| 2624 | Ga0265336_10000032 | |||
| 2625 | Ga0265336_10002816 | |||
| 2626 | Ga0307517_10000232 | |||
| 2627 | Ga0307517_10195851 | |||
| 2628 | Ga0307515_10072079 | |||
| 2629 | Ga0307515_10314675 | |||
| 2630 | Ga0307515_10423249 | |||
| 2631 | Ga0265338_10000422 | |||
| 2632 | Ga0265324_10006919 | |||
| 2633 | Ga0265324_10015991 | |||
| 2634 | Ga0268256_1001682 | |||
| 2635 | Ga0307511_10125475 | |||
| 2636 | Ga0265760_10000096 | |||
| 2637 | Ga0265330_10011940 | |||
| 2638 | Ga0265330_10043394 | |||
| 2639 | Ga0265332_10010082 | |||
| 2640 | Ga0265332_10030416 | |||
| 2641 | Ga0265325_10008852 | |||
| 2642 | Ga0265329_10011836 | |||
| 2643 | Ga0265340_10010992 | |||
| 2644 | Ga0265339_10001248 | |||
| 2645 | Ga0265339_10010315 | |||
| 2646 | Ga0265331_10026374 | |||
| 2647 | Ga0265331_10052921 | |||
| 2648 | Ga0265331_10060809 | |||
| 2649 | Ga0265316_10170223 | |||
| 2650 | Ga0307513_10316548 | |||
| 2651 | Ga0307513_10361326 | |||
| 2652 | Ga0307513_10518950 | |||
| 2653 | Ga0307509_10056747 | |||
| 2654 | Ga0307509_10147247 | |||
| 2655 | Ga0307509_10267919 | |||
| 2656 | Ga0307509_10429862 | |||
| 2657 | Ga0307408_100047045 | |||
| 2658 | Ga0307508_10000045 | |||
| 2659 | Ga0307508_10022102 | |||
| 2660 | Ga0307508_10208054 | |||
| 2661 | Ga0307508_10381219 | |||
| 2662 | Ga0307508_10445253 | |||
| 2663 | Ga0265314_10005054 | |||
| 2664 | Ga0265314_10036026 | |||
| 2665 | Ga0265342_10000026 | |||
| 2666 | Ga0265342_10015623 | |||
| 2667 | Ga0265342_10040808 | |||
| 2668 | Ga0307516_10080981 | |||
| 2669 | Ga0307516_10107884 | |||
| 2670 | Ga0307413_10153592 | |||
| 2671 | Ga0307413_10381996 | |||
| 2672 | Ga0307407_10138680 | |||
| 2673 | Ga0307412_10190428 | |||
| 2674 | Ga0307412_10320291 | |||
| 2675 | Ga0307409_100387605 | |||
| 2676 | Ga0307416_100432738 | |||
| 2677 | Ga0307411_10489071 | |||
| 2678 | Ga0307415_100331735 | |||
| 2679 | Ga0307415_100525348 | |||
| 2680 | Ga0307415_100694017 | |||
| 2681 | Ga0307507_10063749 | |||
| 2682 | Ga0307510_10005192 | |||
| 2683 | Ga0307510_10010957 | |||
| 2684 | Ga0307510_10154095 | |||
| 2685 | Ga0315911_1000008 | |||
| 2686 | Ga0373930_0063062 | |||
| 2687 | Ga0373926_0018000 | |||
| 2688 | Ga0373929_0023418 | |||
| 2689 | Ga0373929_0030064 | |||
| 2690 | Ga0373934_0023131 | |||
| 2691 | Ga0373934_0048927 | |||
| 2692 | Ga0373934_0075890 | |||
| 2693 | Ga0373923_0007245 | |||
| 2694 | Ga0373923_0067787 | |||
| 2695 | Ga0373936_0007829 | |||
| 2696 | Ga0373936_0010431 | |||
| 2697 | Ga0373936_0240563 | |||
| 2698 | Ga0373941_0056801 | |||
| 2699 | Ga0373945_0033473 | |||
| 2700 | Ga0373945_0034697 | |||
| 2701 | Ga0373953_0002766 | |||
| 2702 | Ga0373953_0029830 | |||
| 2703 | Ga0373954_0007515 | |||
| 2704 | Ga0373954_0041652 | |||
| 2705 | Ga0373954_0072568 | |||
| 2706 | Ga0373956_0063075 | |||
| 2707 | Ga0373957_0017724 | |||
| 2708 | Ga0373957_0183188 | |||
| 2709 | Ga0373943_0003229 | |||
| 2710 | Ga0373943_0066803 | |||
| 2711 | Ga0373943_0230672 | |||
| 2712 | Ga0373946_0036453 | |||
| 2713 | Ga0373955_0011290 | |||
| 2714 | Ga0373955_0036661 | |||
| 2715 | Ga0373942_0029275 | |||
| 2716 | Ga0373962_0042191 | |||
| 2717 | Ga0373924_0035386 | |||
| 2718 | Ga0373924_0071228 | |||
| 2719 | Ga0373931_0013496 | |||
| 2720 | Ga0373931_0026163 | |||
| 2721 | Ga0373931_0114920 | |||
| 2722 | Ga0373935_0004301 | |||
| 2723 | Ga0373935_0025334 | |||
| 2724 | Ga0373927_0000766 | |||
| 2725 | Ga0373927_0002321 | |||
| 2726 | Ga0373927_0011298 | |||
| 2727 | Ga0373927_0018485 | |||
| 2728 | Ga0373927_0036330 | |||
| 2729 | Ga0373927_0052279 | |||
| 2730 | Ga0373927_0148385 | |||
| 2731 | Ga0373927_0478362 | |||
| 2732 | Ga0373933_0000218 | |||
| 2733 | Ga0373933_0133740 | |||
| 2734 | Ga0373933_0223100 | |||
| 2735 | Ga0373933_0284996 | |||
| 2736 | Ga0373947_0000310 | |||
| 2737 | Ga0373947_0008207 | |||
| 2738 | Ga0373947_0051170 | |||
| 2739 | Ga0373947_0064613 | |||
| 2740 | Ga0373937_0007978 | |||
| 2741 | Ga0373937_0080516 | |||
| 2742 | Ga0373937_0220533 | |||
| 2743 | Ga0373937_0312494 | |||
| 2744 | Ga0372808_018578 | |||
| 2745 | Ga0373925_0008418 | |||
| 2746 | Ga0373925_0016057 | |||
| 2747 | Ga0373925_0016895 | |||
| 2748 | Ga0373925_0034756 | |||
| 2749 | Ga0373925_0044131 | |||
| 2750 | Ga0373925_0133593 | |||
| 2751 | Ga0373925_0138946 | |||
| 2752 | Ga0373925_0250483 | |||
| 2753 | Ga0395899_0164845 | |||
| 2754 | Ga0395900_0000423 | |||
| 2755 | Ga0395900_0364696 | |||
| 2756 | Ga0395900_0366141 | |||
| 2757 | Ga0395898_0010460 | |||
| 2758 | Ga0395898_0016086 | |||
| 2759 | Ga0395898_0037142 | |||
| 2760 | Ga0395898_0129821 | |||
| 2761 | Ga0395898_0358162 | |||
| 2762 | Ga0395905_0017321 | |||
| 2763 | Ga0395905_0182703 | |||
| 2764 | Ga0395905_0471650 | |||
| 2765 | Ga0436364_0114057 | |||
| 2766 | Ga0395901_0010143 | |||
| 2767 | Ga0395901_0129559 | |||
| 2768 | Ga0395901_0611625 | |||
| 2769 | Ga0436365_1493424 | |||
| 2770 | Ga0436365_1890248 | |||
| 2771 | Ga0436360_0380405 | |||
| 2772 | Ga0436360_0734498 | |||
| 2773 | Ga0436360_1352967 | |||
| 2774 | Ga0436361_0609024 | |||
| 2775 | Ga0436361_0908871 | |||
| 2776 | Ga0436361_1023454 | |||
| 2777 | Ga0436363_0110349 | |||
| 2778 | Ga0436363_0462270 | |||
| 2779 | Ga0436363_0797587 | |||
| 2780 | Ga0436363_1120086 | |||
| 2781 | Ga0436363_1361193 | |||
| 2782 | Ga0436362_1092046 | |||
| 2783 | Ga0439466_0056963 | |||
| 2784 | Ga0451787_291164 | |||
| 2785 | Ga0451795_0554965 | |||
| 2786 | Ga0451807_1265636 | |||
| 2787 | Ga0451841_0604624 | |||
| 2788 | Ga0439433_0026008 | |||
| 2789 | Ga0439445_0080725 | |||
| 2790 | Ga0439455_0065575 | |||
| 2791 | Ga0450920_026140 | |||
| 2792 | Ga0439458_0009214 | |||
| 2793 | Ga0450909_012001 | |||
| 2794 | Ga0439459_0035005 | |||
| 2795 | Ga0466969_0091111 | |||
| 2796 | Ga0466972_0000941 | |||
| 2797 | Ga0466972_0040720 | |||
| 2798 | Ga0466965_0027939 | |||
| 2799 | Ga0466965_0125696 | |||
| 2800 | Ga0466966_0000628 | |||
| 2801 | Ga0466966_0023968 | |||
| 2802 | Ga0466966_0028575 | |||
| 2803 | Ga0466961_0002516 | |||
| 2804 | Ga0466961_0203646 | |||
| 2805 | Ga0466963_0125500 | |||
| 2806 | Ga0466963_0157186 | |||
| 2807 | Ga0466964_0128426 | |||
| 2808 | Ga0466968_0004491 | |||
| 2809 | Ga0466968_0177168 | |||
| 2810 | Ga0466970_0189366 | |||
| 2811 | Ga0466957_0073406 | |||
| 2812 | Ga0466957_0302860 | |||
| 2813 | Ga0466959_0012945 | |||
| 2814 | Ga0466959_0331979 | |||
| 2815 | Ga0466958_0171777 | |||
| 2816 | Ga0466958_0237807 | |||
| 2817 | Ga0466967_0282433 | |||
| 2818 | Ga0466967_0367727 | |||
| 2819 | Ga0466967_0492415 | |||
| 2820 | Ga0466967_0504934 | |||
| 2821 | Ga0466967_0566847 | |||
| 2822 | Ga0495617_026570 | |||
| 2823 | Ga0495592_0004461 | |||
| 2824 | Ga0495592_0029657 | |||
| 2825 | Ga0495592_0050389 | |||
| 2826 | Ga0495592_0126857 | |||
| 2827 | Ga0495603_0000936 | |||
| 2828 | Ga0495603_0002927 | |||
| 2829 | Ga0495603_0017727 | |||
| 2830 | Ga0495603_0025404 | |||
| 2831 | Ga0495603_0066165 | |||
| 2832 | Ga0495603_0103707 | |||
| 2833 | Ga0495603_0140937 | |||
| 2834 | Ga0495590_0125429 | |||
| 2835 | Ga0495629_0001416 | |||
| 2836 | Ga0495629_0002247 | |||
| 2837 | Ga0495629_0003103 | |||
| 2838 | Ga0495638_0005979 | |||
| 2839 | Ga0495638_0028219 | |||
| 2840 | Ga0495638_0190125 | |||
| 2841 | Ga0495638_0206597 | |||
| 2842 | Ga0495641_0005002 | |||
| 2843 | Ga0495641_0049859 | |||
| 2844 | Ga0495641_0082044 | |||
| 2845 | Ga0495651_0008730 | |||
| 2846 | Ga0495651_0038241 | |||
| 2847 | Ga0495651_0064839 | |||
| 2848 | Ga0495651_0080456 | |||
| 2849 | Ga0495651_0102687 | |||
| 2850 | Ga0495651_0131493 | |||
| 2851 | Ga0495653_0015924 | |||
| 2852 | Ga0495653_0050804 | |||
| 2853 | Ga0495653_0065737 | |||
| 2854 | Ga0495653_0196583 | |||
| 2855 | Ga0495650_0059049 | |||
| 2856 | Ga0495580_0002805 | |||
| 2857 | Ga0495580_0028806 | |||
| 2858 | Ga0495582_0000302 | |||
| 2859 | Ga0495582_0051892 | |||
| 2860 | Ga0495582_0144541 | |||
| 2861 | Ga0495605_0154640 | |||
| 2862 | Ga0495639_0000072 | |||
| 2863 | Ga0495639_0013510 | |||
| 2864 | Ga0495662_0001578 | |||
| 2865 | Ga0495664_0015202 | |||
| 2866 | Ga0495664_0027071 | |||
| 2867 | Ga0495664_0031919 | |||
| 2868 | Ga0495664_0054635 | |||
| 2869 | Ga0495664_0168217 | |||
| 2870 | Ga0495664_0190528 | |||
| 2871 | Ga0495594_0000046 | |||
| 2872 | Ga0495596_0121237 | |||
| 2873 | Ga0495607_0232150 | |||
| 2874 | Ga0495583_0062080 | |||
| 2875 | Ga0495583_0067954 | |||
| 2876 | Ga0495606_0057727 | |||
| 2877 | Ga0495606_0072504 | |||
| 2878 | Ga0495606_0195138 | |||
| 2879 | Ga0495606_0286839 | |||
| 2880 | Ga0495608_0005612 | |||
| 2881 | Ga0495608_0168369 | |||
| 2882 | Ga0495608_0193797 | |||
| 2883 | Ga0495608_0275066 | |||
| 2884 | Ga0495610_0015265 | |||
| 2885 | Ga0495610_0141767 | |||
| 2886 | Ga0495616_0036090 | |||
| 2887 | Ga0495618_0073627 | |||
| 2888 | Ga0495618_0344058 | |||
| 2889 | Ga0495620_0054100 | |||
| 2890 | Ga0495620_0087184 | |||
| 2891 | Ga0495628_0015500 | |||
| 2892 | Ga0495628_0040083 | |||
| 2893 | Ga0495628_0053908 | |||
| 2894 | Ga0495628_0073940 | |||
| 2895 | Ga0495630_0005610 | |||
| 2896 | Ga0495632_0108600 | |||
| 2897 | Ga0495632_0168497 | |||
| 2898 | Ga0495637_0011891 | |||
| 2899 | Ga0495637_0096500 | |||
| 2900 | Ga0495643_0052988 | |||
| 2901 | Ga0495643_0091710 | |||
| 2902 | Ga0495643_0254870 | |||
| 2903 | Ga0495644_0049422 | |||
| 2904 | Ga0495644_0071701 | |||
| 2905 | Ga0495648_0001071 | |||
| 2906 | Ga0495648_0027838 | |||
| 2907 | Ga0495648_0088063 | |||
| 2908 | Ga0495648_0100171 | |||
| 2909 | Ga0495648_0120396 | |||
| 2910 | Ga0495648_0163379 | |||
| 2911 | Ga0495663_0040889 | |||
| 2912 | Ga0495663_0049035 | |||
| 2913 | Ga0495666_0031720 | |||
| 2914 | Ga0495652_0003554 | |||
| 2915 | Ga0495652_0020755 | |||
| 2916 | Ga0495652_0044098 | |||
| 2917 | Ga0495652_0423585 | |||
| 2918 | Ga0495654_0016336 | |||
| 2919 | Ga0495665_0000335 | |||
| 2920 | Ga0495665_0011584 | |||
| 2921 | Ga0495640_0002138 | |||
| 2922 | Ga0495640_0017069 | |||
| 2923 | Ga0495640_0019627 | |||
| 2924 | Ga0495586_0131867 | |||
| 2925 | Ga0495587_0044776 | |||
| 2926 | Ga0495609_0072166 | |||
| 2927 | Ga0495621_0051105 | |||
| 2928 | Ga0495621_0112377 | |||
| 2929 | Ga0495645_0008238 | |||
| 2930 | Ga0495645_0023376 | |||
| 2931 | Ga0495645_0131357 | |||
| 2932 | Ga0495622_0001664 | |||
| 2933 | Ga0495622_0026583 | |||
| 2934 | Ga0495622_0043995 | |||
| 2935 | Ga0495622_0058451 | |||
| 2936 | Ga0495622_0132518 | |||
| 2937 | Ga0495633_0194887 | |||
| 2938 | Ga0495667_0003584 | |||
| 2939 | Ga0495667_0008501 | |||
| 2940 | Ga0495667_0014435 | |||
| 2941 | Ga0495667_0150550 | |||
| 2942 | Ga0495656_0033066 | |||
| 2943 | Ga0495656_0134608 | |||
| 2944 | Ga0495656_0287827 | |||
| 2945 | Ga0495668_0049581 | |||
| 2946 | Ga0495668_0169620 | |||
| 2947 | Ga0495668_0216571 | |||
| 2948 | Ga0495634_0004622 | |||
| 2949 | Ga0495634_0023263 | |||
| 2950 | Ga0495634_0091597 | |||
| 2951 | Ga0495634_0219195 | |||
| 2952 | Ga0495625_0071714 | |||
| 2953 | Ga0495625_0074874 | |||
| 2954 | Ga0495625_0162314 | |||
| 2955 | Ga0495625_0244074 | |||
| 2956 | Ga0495635_0000518 | |||
| 2957 | Ga0495635_0006671 | |||
| 2958 | Ga0495635_0008383 | |||
| 2959 | Ga0495635_0026959 | |||
| 2960 | Ga0495635_0098620 | |||
| 2961 | Ga0495659_0162006 | |||
| 2962 | Ga0495661_0034212 | |||
| 2963 | Ga0495661_0220566 | |||
| 2964 | Ga0495588_0002579 | |||
| 2965 | Ga0495588_0016851 | |||
| 2966 | Ga0495588_0023873 | |||
| 2967 | Ga0495588_0057929 | |||
| 2968 | Ga0495657_0005477 | |||
| 2969 | Ga0495657_0032801 | |||
| 2970 | Ga0495657_0214613 | |||
| 2971 | Ga0495599_0000864 | |||
| 2972 | Ga0495599_0084142 | |||
| 2973 | Ga0495599_0186043 | |||
| 2974 | Ga0495599_0207791 | |||
| 2975 | Ga0495599_0392995 | |||
| 2976 | Ga0495623_0010119 | |||
| 2977 | Ga0495646_0026987 | |||
| 2978 | Ga0495646_0134232 | |||
| 2979 | Ga0495646_0174338 | |||
| 2980 | Ga0495647_0104011 | |||
| 2981 | Ga0495658_0023228 | |||
| 2982 | Ga0495658_0214841 | |||
| 2983 | Ga0495669_0015902 | |||
| 2984 | Ga0495669_0098046 | |||
| 2985 | Ga0495669_0168331 | |||
| 2986 | Ga0495613_0004485 | |||
| 2987 | Ga0495613_0145701 | |||
| 2988 | Ga0495613_0204897 | |||
| 2989 | Ga0495613_0333511 | |||
| 2990 | Ga0495613_0357636 | |||
| 2991 | Ga0495624_0000795 | |||
| 2992 | Ga0495624_0041749 | |||
| 2993 | Ga0495624_0315221 | |||
| 2994 | Ga0495624_0363769 | |||
| 2995 | Ga0495670_0007575 | |||
| 2996 | Ga0495671_0046554 | |||
| 2997 | Ga0495671_0082614 | |||
| 2998 | Ga0495671_0107523 | |||
| 2999 | Ga0495649_0086287 | |||
| 3000 | Ga0495649_0152812 | |||
| 3001 | Ga0495649_0186305 | |||
| 3002 | Ga0495649_0297462 | |||
| 3003 | Ga0495589_0178129 | |||
| 3004 | Ga0495600_0002373 | |||
| 3005 | Ga0495600_0017875 | |||
| 3006 | Ga0495600_0067504 | |||
| 3007 | Ga0495600_0087808 | |||
| 3008 | Ga0495600_0240833 | |||
| 3009 | Ga0495600_0294526 | |||
| 3010 | Ga0495660_0245563 | |||
| 3011 | Ga0495581_0000030 | |||
| 3012 | Ga0495581_0028132 | |||
| 3013 | Ga0495581_0047237 | |||
| 3014 | Ga0495581_0181574 | |||
| 3015 | Ga0495581_0237488 | |||
| 3016 | Ga0495581_0251946 | |||
| 3017 | Ga0495604_0005369 | |||
| 3018 | Ga0495604_0014589 | |||
| 3019 | Ga0495604_0025392 | |||
| 3020 | Ga0495604_0184578 | |||
| 3021 | Ga0495636_0060744 | |||
| 3022 | Ga0495636_0135694 | |||
| 3023 | Ga0495674_0004821 | |||
| 3024 | Ga0495674_0029980 | |||
| 3025 | Ga0495674_0045408 | |||
| 3026 | Ga0495674_0182566 | |||
| 3027 | Ga0495672_0176406 | |||
| 3028 | Ga0495676_0033174 | |||
| 3029 | Ga0495676_0164043 | |||
| 3030 | Ga0495676_0168826 | |||
| 3031 | Ga0495676_0248673 | |||
| 3032 | Ga0495676_0318899 | |||
| 3033 | Ga0495680_0008881 | |||
| 3034 | Ga0495683_0132660 | |||
| 3035 | Ga0495687_007148 | |||
| 3036 | Ga0495675_0020892 | |||
| 3037 | Ga0495675_0099624 | |||
| 3038 | Ga0495675_0214036 | |||
| 3039 | Ga0495677_0077709 | |||
| 3040 | Ga0495673_0127904 | |||
| 3041 | Ga0495684_0004051 | |||
| 3042 | Ga0495684_0024023 | |||
| 3043 | Ga0495686_0064143 | |||
| 3044 | Ga0495686_0078201 | |||
| 3045 | Ga0495686_0092376 | |||
| 3046 | Ga0495686_0146969 | |||
| 3047 | Ga0495686_0157627 | |||
| 3048 | Ga0495593_0000398 | |||
| 3049 | Ga0495593_0009398 | |||
| 3050 | Ga0495593_0017768 | |||
| 3051 | Ga0495593_0061511 | |||
| 3052 | Ga0495602_0010323 | |||
| 3053 | Ga0495602_0023058 | |||
| 3054 | Ga0495602_0047488 | |||
| 3055 | Ga0495602_0230322 | |||
| 3056 | Ga0495602_0268477 | |||
| 3057 | Ga0495614_0142115 | |||
| 3058 | Ga0495615_0089412 | |||
| 3059 | Ga0496100_0005479 | |||
| 3060 | Ga0496100_0015556 | |||
| 3061 | Ga0496100_0020557 | |||
| 3062 | Ga0496100_0304159 | |||
| 3063 | Ga0496100_0645194 | |||
| 3064 | Ga0496101_0021366 | |||
| 3065 | Ga0496101_0057108 | |||
| 3066 | Ga0496101_0101438 | |||
| 3067 | Ga0496101_0267795 | |||
| 3068 | Ga0496101_0408868 | |||
| 3069 | Ga0496102_0025855 | |||
| 3070 | Ga0496102_0069619 | |||
| 3071 | Ga0496102_0071540 | |||
| 3072 | Ga0496102_0074603 | |||
| 3073 | Ga0496102_0098901 | |||
| 3074 | Ga0496102_0196265 | |||
| 3075 | Ga0496102_0231653 | |||
| 3076 | Ga0496102_0250719 | |||
| 3077 | Ga0496102_0256331 | |||
| 3078 | Ga0496102_0396110 | |||
| 3079 | Ga0496102_0431627 | |||
| 3080 | Ga0496103_0010891 | |||
| 3081 | Ga0496103_0021472 | |||
| 3082 | Ga0496103_0123848 | |||
| 3083 | Ga0496104_0013200 | |||
| 3084 | Ga0496104_0021253 | |||
| 3085 | Ga0496104_0023224 | |||
| 3086 | Ga0496104_0081567 | |||
| 3087 | Ga0496104_0109572 | |||
| 3088 | Ga0496104_0122100 | |||
| 3089 | Ga0496104_0181592 | |||
| 3090 | Ga0496105_0002119 | |||
| 3091 | Ga0496105_0004271 | |||
| 3092 | Ga0496105_0049541 | |||
| 3093 | Ga0496105_0108810 | |||
| 3094 | Ga0496105_0270131 | |||
| 3095 | Ga0496105_0435082 | |||
| 3096 | Ga0496106_0000418 | |||
| 3097 | Ga0496106_0005807 | |||
| 3098 | Ga0496106_0008160 | |||
| 3099 | Ga0496106_0012607 | |||
| 3100 | Ga0496106_0021313 | |||
| 3101 | Ga0496106_0206036 | |||
| 3102 | Ga0496106_0266793 | |||
| 3103 | Ga0496106_0423139 | |||
| 3104 | Ga0496106_0451929 | |||
| 3105 | Ga0496106_0591381 | |||
| 3106 | Ga0496107_0005061 | |||
| 3107 | Ga0496107_0021428 | |||
| 3108 | Ga0496107_0071285 | |||
| 3109 | Ga0496107_0104479 | |||
| 3110 | Ga0496107_0179311 | |||
| 3111 | Ga0496108_0000160 | |||
| 3112 | Ga0496108_0020758 | |||
| 3113 | Ga0496108_0025207 | |||
| 3114 | Ga0496108_0071623 | |||
| 3115 | Ga0496108_0217264 | |||
| 3116 | Ga0496108_0310990 | |||
| 3117 | Ga0496109_0000245 | |||
| 3118 | Ga0496109_0021697 | |||
| 3119 | Ga0496109_0089282 | |||
| 3120 | Ga0496109_0102308 | |||
| 3121 | Ga0496109_0183229 | |||
| 3122 | Ga0496109_0430333 | |||
| 3123 | Ga0496109_0497795 | |||
| 3124 | Ga0496110_0014329 | |||
| 3125 | Ga0496110_0024193 | |||
| 3126 | Ga0496110_0051735 | |||
| 3127 | Ga0496110_0233120 | |||
| 3128 | Ga0496110_0238542 | |||
| 3129 | Ga0496110_0487144 | |||
| 3130 | Ga0496111_0047295 | |||
| 3131 | Ga0496111_0065286 | |||
| 3132 | Ga0496112_0000018 | |||
| 3133 | Ga0496112_0002354 | |||
| 3134 | Ga0496112_0004127 | |||
| 3135 | Ga0496112_0004136 | |||
| 3136 | Ga0496112_0007772 | |||
| 3137 | Ga0496112_0035285 | |||
| 3138 | Ga0496112_0123482 | |||
| 3139 | Ga0496112_0136598 | |||
| 3140 | Ga0496112_0145156 | |||
| 3141 | Ga0496112_0159966 | |||
| 3142 | Ga0496113_0038433 | |||
| 3143 | Ga0496113_0053535 | |||
| 3144 | Ga0496113_0074927 | |||
| 3145 | Ga0496113_0122095 | |||
| 3146 | Ga0496113_0539875 | |||
| 3147 | Ga0496114_0140628 | |||
| 3148 | Ga0496114_0245698 | |||
| 3149 | Ga0496114_0294835 | |||
| 3150 | Ga0496114_0323477 | |||
| 3151 | Ga0496114_0622413 | |||
| 3152 | Ga0496115_0005337 | |||
| 3153 | Ga0496115_0014614 | |||
| 3154 | Ga0496115_0051731 | |||
| 3155 | Ga0496115_0089905 | |||
| 3156 | Ga0496115_0097833 | |||
| 3157 | Ga0496115_0398601 | |||
| 3158 | Ga0496115_0418234 | |||
| 3159 | Ga0496115_0499375 | |||
| 3160 | Ga0496116_0012269 | |||
| 3161 | Ga0496116_0014117 | |||
| 3162 | Ga0496116_0102458 | |||
| 3163 | Ga0496117_0015483 | |||
| 3164 | Ga0496117_0032990 | |||
| 3165 | Ga0496117_0051718 | |||
| 3166 | Ga0496117_0149101 | |||
| 3167 | Ga0496117_0215742 | |||
| 3168 | Ga0496118_0005692 | |||
| 3169 | Ga0496118_0017056 | |||
| 3170 | Ga0496118_0028806 | |||
| 3171 | Ga0496118_0037135 | |||
| 3172 | Ga0496118_0121818 | |||
| 3173 | Ga0496118_0272520 | |||
| 3174 | Ga0496118_0339636 | |||
| 3175 | Ga0496119_0002669 | |||
| 3176 | Ga0496119_0014075 | |||
| 3177 | Ga0496119_0017374 | |||
| 3178 | Ga0496119_0023249 | |||
| 3179 | Ga0496119_0035864 | |||
| 3180 | Ga0496119_0072531 | |||
| 3181 | Ga0496119_0197550 | |||
| 3182 | Ga0496119_0201578 | |||
| 3183 | Ga0496120_0014496 | |||
| 3184 | Ga0496120_0054397 | |||
| 3185 | Ga0496120_0069860 | |||
| 3186 | Ga0496120_0162416 | |||
| 3187 | Ga0496121_0000278 | |||
| 3188 | Ga0496121_0000870 | |||
| 3189 | Ga0496121_0010173 | |||
| 3190 | Ga0496121_0014331 | |||
| 3191 | Ga0496121_0015878 | |||
| 3192 | Ga0496121_0021331 | |||
| 3193 | Ga0496121_0023995 | |||
| 3194 | Ga0496121_0030800 | |||
| 3195 | Ga0496121_0034826 | |||
| 3196 | Ga0496121_0089621 | |||
| 3197 | Ga0496121_0095356 | |||
| 3198 | Ga0496121_0095552 | |||
| 3199 | Ga0496121_0130086 | |||
| 3200 | Ga0496121_0145227 | |||
| 3201 | Ga0496121_0170692 | |||
| 3202 | Ga0496121_0177781 | |||
| 3203 | Ga0496121_0213940 | |||
| 3204 | Ga0496121_0219163 | |||
| 3205 | Ga0496121_0234101 | |||
| 3206 | Ga0496121_0240078 | |||
| 3207 | Ga0496121_0391485 | |||
| 3208 | Ga0496122_0020531 | |||
| 3209 | Ga0496122_0038047 | |||
| 3210 | Ga0496122_0050025 | |||
| 3211 | Ga0496122_0205099 | |||
| 3212 | Ga0496122_0232738 | |||
| 3213 | Ga0496123_0003029 | |||
| 3214 | Ga0496123_0031679 | |||
| 3215 | Ga0496123_0110437 | |||
| 3216 | Ga0496123_0164249 | |||
| 3217 | Ga0496124_0000123 | |||
| 3218 | Ga0496124_0084753 | |||
| 3219 | Ga0496124_0115893 | |||
| 3220 | Ga0496124_0247269 | |||
| 3221 | Ga0496124_0296982 | |||
| 3222 | Ga0496125_0000207 | |||
| 3223 | Ga0496125_0011562 | |||
| 3224 | Ga0496125_0012916 | |||
| 3225 | Ga0496125_0139009 | |||
| 3226 | Ga0496126_0008213 | |||
| 3227 | Ga0496126_0010103 | |||
| 3228 | Ga0496126_0036335 | |||
| 3229 | Ga0496126_0056692 | |||
| 3230 | Ga0496126_0062529 | |||
| 3231 | Ga0496126_0095928 | |||
| 3232 | Ga0496126_0128201 | |||
| 3233 | Ga0496126_0132407 | |||
| 3234 | Ga0496126_0171147 | |||
| 3235 | Ga0496126_0233078 | |||
| 3236 | Ga0496126_0248727 | |||
| 3237 | Ga0496126_0263494 | |||
| 3238 | Ga0496126_0285765 | |||
| 3239 | Ga0496126_0311100 | |||
| 3240 | Ga0496126_0406211 | |||
| 3241 | Ga0496126_0463884 | |||
| 3242 | Ga0496126_0468481 | |||
| 3243 | Ga0496126_0472107 | |||
| 3244 | Ga0496126_0497807 | |||
| 3245 | Ga0495678_078556 | |||
| 3246 | Ga0495682_0131917 | |||
| 3247 | Ga0501031_0049312 | |||
| 3248 | Ga0501032_0011231 | |||
| 3249 | Ga0501032_0071162 | |||
| 3250 | Ga0501032_0101572 | |||
| 3251 | Ga0501032_0240969 | |||
| 3252 | Ga0501033_0001064 | |||
| 3253 | Ga0501033_0012046 | |||
| 3254 | Ga0501033_0049770 | |||
| 3255 | Ga0501034_0130679 | |||
| 3256 | Ga0501034_0313086 | |||
| 3257 | Ga0501034_0632690 | |||
| 3258 | Ga0501036_0124749 | |||
| 3259 | Ga0501036_0570881 | |||
| 3260 | Ga0501036_0571133 | |||
| 3261 | Ga0501036_0701638 | |||
| 3262 | Ga0501037_0000242 | |||
| 3263 | Ga0501037_0064561 | |||
| 3264 | Ga0501038_0016237 | |||
| 3265 | Ga0501038_0218189 | |||
| 3266 | Ga0501038_0377896 | |||
| 3267 | Ga0501039_0153933 | |||
| 3268 | Ga0501043_0000440 | |||
| 3269 | Ga0501043_0033129 | |||
| 3270 | Ga0501043_0090716 | |||
| 3271 | Ga0501043_0131751 | |||
| 3272 | Ga0501046_0237224 | |||
| 3273 | Ga0501047_0006953 | |||
| 3274 | Ga0501047_0008580 | |||
| 3275 | Ga0501047_0011808 | |||
| 3276 | Ga0501047_0027351 | |||
| 3277 | Ga0501047_0056233 | |||
| 3278 | Ga0501047_0069493 | |||
| 3279 | Ga0501047_0190762 | |||
| 3280 | Ga0501047_0238252 | |||
| 3281 | Ga0501047_0459276 | |||
| 3282 | Ga0501047_0469766 | |||
| 3283 | Ga0501048_0131505 | |||
| 3284 | Ga0501048_0238046 | |||
| 3285 | Ga0501067_0055415 | |||
| 3286 | Ga0501067_0106097 | |||
| 3287 | Ga0501068_0005571 | |||
| 3288 | Ga0501068_0222044 | |||
| 3289 | Ga0501069_0000017 | |||
| 3290 | Ga0501069_0024997 | |||
| 3291 | Ga0501069_0330006 | |||
| 3292 | Ga0501070_0000236 | |||
| 3293 | Ga0501070_0000356 | |||
| 3294 | Ga0501070_0007635 | |||
| 3295 | Ga0501070_0025934 | |||
| 3296 | Ga0501070_0062784 | |||
| 3297 | Ga0501071_0143147 | |||
| 3298 | Ga0501071_0229123 | |||
| 3299 | Ga0501071_0384309 | |||
| 3300 | Ga0501071_0582316 | |||
| 3301 | Ga0501073_0000531 | |||
| 3302 | Ga0501073_0032679 | |||
| 3303 | Ga0501074_0000610 | |||
| 3304 | Ga0501074_0000660 | |||
| 3305 | Ga0501074_0011565 | |||
| 3306 | Ga0501074_0031296 | |||
| 3307 | Ga0501074_0090123 | |||
| 3308 | Ga0501079_0006439 | |||
| 3309 | Ga0501080_0001422 | |||
| 3310 | Ga0501080_0005983 | |||
| 3311 | Ga0501080_0009701 | |||
| 3312 | Ga0501080_0023297 | |||
| 3313 | Ga0501080_0068569 | |||
| 3314 | Ga0501080_0159418 | |||
| 3315 | Ga0501080_0210494 | |||
| 3316 | Ga0501083_0002788 | |||
| 3317 | Ga0501083_0003168 | |||
| 3318 | Ga0501083_0092651 | |||
| 3319 | Ga0501035_0000101 | |||
| 3320 | Ga0501035_0000686 | |||
| 3321 | Ga0501035_0009055 | |||
| 3322 | Ga0501035_0020710 | |||
| 3323 | Ga0501035_0028068 | |||
| 3324 | Ga0501035_0059620 | |||
| 3325 | Ga0501035_0230946 | |||
| 3326 | Ga0501035_0324512 | |||
| 3327 | Ga0501035_0558963 | |||
| 3328 | Ga0501035_0619810 | |||
| 3329 | Ga0501044_0000010 | |||
| 3330 | Ga0501044_0016129 | |||
| 3331 | Ga0501044_0029369 | |||
| 3332 | Ga0501044_0036505 | |||
| 3333 | Ga0501044_0060354 | |||
| 3334 | Ga0501044_0099050 | |||
| 3335 | Ga0501044_0107251 | |||
| 3336 | Ga0501044_0112268 | |||
| 3337 | Ga0501044_0117767 | |||
| 3338 | Ga0501044_0182100 | |||
| 3339 | Ga0501044_0282669 | |||
| 3340 | Ga0501044_0313976 | |||
| 3341 | Ga0501044_0423901 | |||
| 3342 | Ga0501044_0668268 | |||
| 3343 | nmdc:mga03683_118016_c1 | |||
| 3344 | nmdc:mga03683_43980_c1 | |||
| 3345 | nmdc:mga03683_9417_c2 | |||
| 3346 | nmdc:mga03n38_107513_c1 | |||
| 3347 | nmdc:mga03n38_124019_c1 | |||
| 3348 | nmdc:mga03n38_1251_c1 | |||
| 3349 | nmdc:mga03n38_2538_c1 | |||
| 3350 | nmdc:mga03n38_73656_c1 | |||
| 3351 | nmdc:mga00v17_15267_c1 | |||
| 3352 | nmdc:mga00v17_18256_c1 | |||
| 3353 | nmdc:mga00v17_19009_c1 | |||
| 3354 | nmdc:mga00v17_375472_c1 | |||
| 3355 | nmdc:mga0yw44_140517_c1 | |||
| 3356 | nmdc:mga0yw44_152810_c1 | |||
| 3357 | nmdc:mga0yw44_20636_c1 | |||
| 3358 | nmdc:mga0yw44_235615_c1 | |||
| 3359 | nmdc:mga0yw44_2638_c1 | |||
| 3360 | nmdc:mga0yw44_338082_c1 | |||
| 3361 | nmdc:mga0yw44_387333_c1 | |||
| 3362 | nmdc:mga0yw44_4136_c1 | |||
| 3363 | nmdc:mga0k408_105305_c1 | |||
| 3364 | nmdc:mga0k408_126963_c1 | |||
| 3365 | nmdc:mga0k408_42070_c1 | |||
| 3366 | nmdc:mga0k408_76158_c1 | |||
| 3367 | nmdc:mga06z11_110192_c1 | |||
| 3368 | nmdc:mga06z11_143381_c1 | |||
| 3369 | nmdc:mga06z11_88873_c1 | |||
| 3370 | nmdc:mga04h51_4594_c1 | |||
| 3371 | nmdc:mga04h51_50591_c1 | |||
| 3372 | nmdc:mga07m45_145085_c1 | |||
| 3373 | nmdc:mga07m45_23218_c2 | |||
| 3374 | nmdc:mga07m45_278714_c1 | |||
| 3375 | nmdc:mga07m45_71999_c1 | |||
| 3376 | nmdc:mga0qj67_35930_c1 | |||
| 3377 | nmdc:mga0qj67_384036_c1 | |||
| 3378 | nmdc:mga06r32_139219_c1 | |||
| 3379 | nmdc:mga0n895_33749_c1 | |||
| 3380 | nmdc:mga0n895_55593_c1 | |||
| 3381 | nmdc:mga0n895_59184_c1 | |||
| 3382 | nmdc:mga0rr50_357987_c1 | |||
| 3383 | nmdc:mga0sz30_44073_c1 | |||
| 3384 | nmdc:mga0sz30_6129_c1 | |||
| 3385 | Ga0495601_0049033 | |||
| 3386 | Ga0495601_0128447 | |||
| 3387 | Ga0495601_0280710 | |||
| 3388 | Ga0495601_0309266 | |||
| 3389 | Ga0495612_0026224 | |||
| 3390 | Ga0495612_0132654 | |||
| 3391 | Ga0500635_0001019 | |||
| 3392 | Ga0500635_0001112 | |||
| 3393 | Ga0495619_0018218 | |||
| 3394 | Ga0495619_0164486 | |||
| 3395 | Ga0495619_0450951 | |||
| 3396 | Ga0500578_0117180 | |||
| 3397 | Ga0500578_0211209 | |||
| 3398 | Ga0500643_000112 | |||
| 3399 | Ga0500581_019218 | |||
| 3400 | Ga0500646_0014413 | |||
| 3401 | Ga0500647_0034776 | |||
| 3402 | Ga0500647_0043672 | |||
| 3403 | Ga0500583_0197130 | |||
| 3404 | Ga0500651_0013790 | |||
| 3405 | Ga0500651_0076655 | |||
| 3406 | Ga0500651_0096067 | |||
| 3407 | Ga0500566_0001605 | |||
| 3408 | Ga0500566_0002244 | |||
| 3409 | Ga0500566_0003837 | |||
| 3410 | Ga0500566_0023627 | |||
| 3411 | Ga0500640_003743 | |||
| 3412 | Ga0500640_043327 | |||
| 3413 | Ga0500641_0007867 | |||
| 3414 | Ga0500641_0028023 | |||
| 3415 | Ga0500641_0077090 | |||
| 3416 | Ga0500641_0100679 | |||
| 3417 | Ga0500648_141887 | |||
| 3418 | Ga0500650_0026074 | |||
| 3419 | Ga0500650_0111933 | |||
| 3420 | Ga0500554_067508 | |||
| 3421 | Ga0500555_026873 | |||
| 3422 | Ga0500556_0000006 | |||
| 3423 | Ga0500556_0000068 | |||
| 3424 | Ga0500557_000021 | |||
| 3425 | Ga0500558_079488 | |||
| 3426 | Ga0500562_032400 | |||
| 3427 | Ga0500562_036162 | |||
| 3428 | Ga0500562_068551 | |||
| 3429 | Ga0500569_028550 | |||
| 3430 | Ga0500572_002049 | |||
| 3431 | Ga0500572_016650 | |||
| 3432 | Ga0500591_068096 | |||
| 3433 | Ga0500592_000490 | |||
| 3434 | Ga0500594_0015285 | |||
| 3435 | Ga0500594_0038557 | |||
| 3436 | Ga0500594_0043459 | |||
| 3437 | Ga0500595_003616 | |||
| 3438 | Ga0500595_009845 | |||
| 3439 | Ga0500595_020341 | |||
| 3440 | Ga0500595_021228 | |||
| 3441 | Ga0500595_023440 | |||
| 3442 | Ga0500595_043599 | |||
| 3443 | Ga0500595_068784 | |||
| 3444 | Ga0500607_052394 | |||
| 3445 | Ga0500608_000852 | |||
| 3446 | Ga0500608_087150 | |||
| 3447 | Ga0500608_183439 | |||
| 3448 | Ga0500614_050622 | |||
| 3449 | Ga0500618_008819 | |||
| 3450 | Ga0500642_0000004 | |||
| 3451 | Ga0500642_0000362 | |||
| 3452 | Ga0500642_0006861 | |||
| 3453 | Ga0500652_000342 | |||
| 3454 | Ga0500655_022733 | |||
| 3455 | Ga0500559_0002074 | |||
| 3456 | Ga0500559_0007492 | |||
| 3457 | Ga0500559_0026405 | |||
| 3458 | Ga0500559_0045996 | |||
| 3459 | Ga0500559_0079650 | |||
| 3460 | Ga0500559_0204801 | |||
| 3461 | Ga0500559_0236854 | |||
| 3462 | Ga0500561_0047971 | |||
| 3463 | Ga0500568_0006964 | |||
| 3464 | Ga0500568_0011399 | |||
| 3465 | Ga0500568_0013697 | |||
| 3466 | Ga0500568_0015941 | |||
| 3467 | Ga0500573_0007614 | |||
| 3468 | Ga0500577_0001442 | |||
| 3469 | Ga0500586_000200 | |||
| 3470 | Ga0500588_0013721 | |||
| 3471 | Ga0500588_0034702 | |||
| 3472 | Ga0500588_0067142 | |||
| 3473 | Ga0500589_074989 | |||
| 3474 | Ga0500590_049874 | |||
| 3475 | Ga0500603_002052 | |||
| 3476 | Ga0500603_003463 | |||
| 3477 | Ga0500604_0119111 | |||
| 3478 | Ga0500604_0152707 | |||
| 3479 | Ga0500616_0000022 | |||
| 3480 | Ga0500616_0060673 | |||
| 3481 | Ga0500616_0125865 | |||
| 3482 | Ga0500619_089556 | |||
| 3483 | Ga0500622_0002538 | |||
| 3484 | Ga0500622_0005248 | |||
| 3485 | Ga0500627_0031943 | |||
| 3486 | Ga0500627_0092111 | |||
| 3487 | Ga0500630_021324 | |||
| 3488 | Ga0500633_0079526 | |||
| 3489 | Ga0500634_0037765 | |||
| 3490 | Ga0500634_0144020 | |||
| 3491 | Ga0500638_054063 | |||
| 3492 | Ga0500638_084193 | |||
| 3493 | Ga0500638_087400 | |||
| 3494 | Ga0500639_004505 | |||
| 3495 | Ga0500639_140306 | |||
| 3496 | Ga0500639_161158 | |||
| 3497 | Ga0500636_0000834 | |||
| 3498 | Ga0500636_0037800 | |||
| 3499 | Ga0500636_0044447 | |||
| 3500 | Ga0500636_0055552 | |||
| 3501 | Ga0500636_0070418 | |||
| 3502 | Ga0500636_0152749 | |||
| 3503 | Ga0500637_0000585 | |||
| 3504 | Ga0500637_0003666 | |||
| 3505 | Ga0500637_0045191 | |||
| 3506 | Ga0500637_0051363 | |||
| 3507 | Ga0500637_0059418 | |||
| 3508 | Ga0500576_131296 | |||
| 3509 | Ga0500625_123222 | |||
| 3510 | Ga0500645_020104 | |||
| 3511 | Ga0500645_023572 | |||
| 3512 | Ga0500596_003436 | |||
| 3513 | Ga0500596_004728 | |||
| 3514 | Ga0500601_000419 | |||
| 3515 | Ga0500601_008099 | |||
| 3516 | Ga0501084_0443335 | |||
| 3517 | Ga0500661_001372 | |||
| 3518 | Ga0500661_024396 | |||
| 3519 | Ga0501082_0072371 | |||
| 3520 | Ga0501082_0134170 | |||
| 3521 | Ga0501082_0581604 | |||
| 3522 | Ga0466962_0015531 | |||
| 3523 | Ga0530510_0524100 | |||
| 3524 | 2507505454 | |||
| 3525 | 2508539339 | |||
| 3526 | 2508695668 | |||
| 3527 | 2509152183 | |||
| 3528 | 2511395680 | |||
| 3529 | 2513623922 | |||
| 3530 | 2513642196 | |||
| 3531 | 2513651330 | |||
| 3532 | 2513659513 | |||
| 3533 | 2513676319 | |||
| 3534 | 2513695291 | |||
| 3535 | 2513700715 | |||
| 3536 | 2513718244 | |||
| 3537 | 2513859380 | |||
| 3538 | 2513873343 | |||
| 3539 | 2513888576 | |||
| 3540 | 2513921554 | |||
| 3541 | 2513998566 | |||
| 3542 | 2514014673 | |||
| 3543 | 2515627649 | |||
| 3544 | 2517106276 | |||
| 3545 | 2517889054 | |||
| 3546 | 2524441445 | |||
| 3547 | 2524458386 | |||
| 3548 | 2524467223 | |||
| 3549 | 2524537489 | |||
| 3550 | 2528853314 | |||
| 3551 | 2545678091 | |||
| 3552 | 2585280649 | |||
| 3553 | 2585326435 | |||
| 3554 | 2585395986 | |||
| 3555 | 2585531583 | |||
| 3556 | 2585551470 | |||
| 3557 | 2603858613 | |||
| 3558 | 2616306806 | |||
| 3559 | 2616557657 | |||
| 3560 | 2617352057 | |||
| 3561 | 2617373525 | |||
| 3562 | 2617383325 | |||
| 3563 | 2644291742 | |||
| 3564 | 2671124043 | |||
| 3565 | 2723841825 | |||
| 3566 | 2728748428 | |||
| 3567 | 2745077579 | |||
| 3568 | 2778173676 | |||
| 3569 | 2793062241 | |||
| 3570 | 2793072707 | |||
| 3571 | 2793078301 | |||
| 3572 | 2805920691 | |||
| 3573 | 2818237860 | |||
| 3574 | 2819244737 | |||
| 3575 | 2819611167 | |||
| 3576 | 2819638900 | |||
| 3577 | 2824604419 | |||
| 3578 | 2824614851 | |||
| 3579 | 2824624168 | |||
| 3580 | 2824632848 | |||
| 3581 | 2824643753 | |||
| 3582 | 2824652408 | |||
| 3583 | 2824656297 | |||
| 3584 | 2824669887 | |||
| 3585 | 2824671753 | |||
| 3586 | 2824684804 | |||
| 3587 | 2824695782 | |||
| 3588 | 2824701663 | |||
| 3589 | 2824710871 | |||
| 3590 | 2824722892 | |||
| 3591 | 2824729494 | |||
| 3592 | 2824740221 | |||
| 3593 | 2824751144 | |||
| 3594 | 2824760654 | |||
| 3595 | 2824768458 | |||
| 3596 | 2824781372 | |||
| 3597 | 2838030858 | |||
| 3598 | 2838124703 | |||
| 3599 | 2841945394 | |||
| 3600 | 2841952180 | |||
| 3601 | 2841965342 | |||
| 3602 | 2841970433 | |||
| 3603 | 2841981681 | |||
| 3604 | 2841984961 | |||
| 3605 | 2842043316 | |||
| 3606 | 2842052694 | |||
| 3607 | 2842300358 | |||
| 3608 | 2842361125 | |||
| 3609 | 2842477590 | |||
| 3610 | 2842487970 | |||
| 3611 | 2842504537 | |||
| 3612 | 2842511787 | |||
| 3613 | 2842524403 | |||
| 3614 | 2844315549 | |||
| 3615 | 2847931252 | |||
| 3616 | 2847942345 | |||
| 3617 | 2849083217 | |||
| 3618 | 2852391620 | |||
| 3619 | 2857516350 | |||
| 3620 | 2857526262 | |||
| 3621 | 2874592545 | |||
| 3622 | 2874607882 | |||
| 3623 | 2874617976 | |||
| 3624 | 2874621199 | |||
| 3625 | 2874628598 | |||
| 3626 | 2874647164 | |||
| 3627 | 2876769645 | |||
| 3628 | 2876772548 | |||
| 3629 | 2876819809 | |||
| 3630 | 2879076315 | |||
| 3631 | 2879083774 | |||
| 3632 | 2879100443 | |||
| 3633 | 2879113309 | |||
| 3634 | 2879128799 | |||
| 3635 | 2879143620 | |||
| 3636 | 2881368930 | |||
| 3637 | 2881673213 | |||
| 3638 | 2885369331 | |||
| 3639 | 2885377558 | |||
| 3640 | 2885386722 | |||
| 3641 | 2885415194 | |||
| 3642 | 2888390497 | |||
| 3643 | 2888420118 | |||
| 3644 | 2889035298 | |||
| 3645 | 2893067466 | |||
| 3646 | 2903733542 | |||
| 3647 | 2903758793 | |||
| 3648 | 2903777915 | |||
| 3649 | 2904667744 | |||
| 3650 | 2904691001 | |||
| 3651 | 2904708398 | |||
| 3652 | 2904716326 | |||
| 3653 | 2906608896 | |||
| 3654 | 2906613570 | |||
| 3655 | 2906631672 | |||
| 3656 | 2906636574 | |||
| 3657 | 2906648338 | |||
| 3658 | 2906668104 | |||
| 3659 | 2908747657 | |||
| 3660 | 2908757059 | |||
| 3661 | 2908775996 | |||
| 3662 | 2919073885 | |||
| 3663 | 2919453274 | |||
| 3664 | 2922363211 | |||
| 3665 | 2922369384 | |||
| 3666 | 2922388484 | |||
| 3667 | 2922396580 | |||
| 3668 | 2922434007 | |||
| 3669 | 2929618787 | |||
| 3670 | 2929628528 | |||
| 3671 | 2932790969 | |||
| 3672 | 2932794138 | |||
| 3673 | 2932809214 | |||
| 3674 | 2932811977 | |||
| 3675 | 2932825572 | |||
| 3676 | 2932833685 | |||
| 3677 | 2933580503 | |||
| 3678 | 2935615516 | |||
| 3679 | 2935623211 | |||
| 3680 | 2935636034 | |||
| 3681 | 2935644286 | |||
| 3682 | 2935654445 | |||
| 3683 | 2935663325 | |||
| 3684 | 2935672132 | |||
| 3685 | 2935679348 | |||
| 3686 | 2935686590 | |||
| 3687 | 2935700371 | |||
| 3688 | 2935710319 | |||
| 3689 | 2935716278 | |||
| 3690 | 2935723598 | |||
| 3691 | 2935735153 | |||
| 3692 | 2935744056 | |||
| 3693 | 2935752556 | |||
| 3694 | 2935763311 | |||
| 3695 | 2935774284 | |||
| 3696 | 2935783350 | |||
| 3697 | 2935789001 | |||
| 3698 | 2935796751 | |||
| 3699 | 2935808310 | |||
| 3700 | 2935816076 | |||
| 3701 | 2935825683 | |||
| 3702 | 2935833470 | |||
| 3703 | 2935845972 | |||
| 3704 | 2935853447 | |||
| 3705 | 2935861459 | |||
| 3706 | 2935869578 | |||
| 3707 | 2935879907 | |||
| 3708 | 2935889165 | |||
| 3709 | 2935915049 | |||
| 3710 | 2935918897 | |||
| 3711 | 2935931386 | |||
| 3712 | 2935939983 | |||
| 3713 | 2935947670 | |||
| 3714 | 2935956441 | |||
| 3715 | 2935966713 | |||
| 3716 | 2935973235 | |||
| 3717 | 2935980522 | |||
| 3718 | 2935990128 | |||
| 3719 | 2935997870 | |||
| 3720 | 2936008865 | |||
| 3721 | 2936017516 | |||
| 3722 | 2936025983 | |||
| 3723 | 2936034825 | |||
| 3724 | 2936041081 | |||
| 3725 | 2936052917 | |||
| 3726 | 2936060224 | |||
| 3727 | 2940558469 | |||
| 3728 | 2941512662 | |||
| 3729 | 2941520500 | |||
| 3730 | 2941528514 | |||
| 3731 | 2941535339 | |||
| 3732 | 2941547141 | |||
| 3733 | 2977865575 | |||
| 3734 | 3005421699 | |||
| 3735 | 3005475278 | |||
| 3736 | 3005486670 | |||
| 3737 | 3005508976 | |||
| 3738 | 3005594141 | |||
| 3739 | 3005595239 | |||
| 3740 | 3005711182 | |||
| 3741 | 3005718477 | |||
| 3742 | 641642395 | |||
| 3743 | 8001847186 | |||
| 3744 | 8003017859 | |||
| 3745 | 8005319597 | |||
| 3746 | 8005490220 | |||
| 3747 | 8005646877 | |||
| 3748 | 8005688062 | |||
| 3749 | 8006927252 | |||
| 3750 | 8006935999 | |||
| 3751 | 8006975877 | |||
| 3752 | 8006991110 | |||
| 3753 | 8007000439 | |||
| 3754 | 8016517987 | |||
| 3755 | 8016526332 | |||
| 3756 | 8016531396 | |||
| 3757 | 8016544608 | |||
| 3758 | 8016557466 | |||
| 3759 | 8016565824 | |||
| 3760 | 8016569663 | |||
| 3761 | 8016582270 | |||
| 3762 | 8016586145 | |||
| 3763 | 8016603424 | |||
| 3764 | 8016606359 | |||
| 3765 | 8016618266 | |||
| 3766 | 8016622917 | |||
| 3767 | 8016635421 | |||
| 3768 | 8017058653 | |||
| 3769 | 8019531229 | |||
| 3770 | 8019540323 | |||
| 3771 | 8019549915 | |||
| 3772 | 8019562658 | |||
| 3773 | 8019572735 | |||
| 3774 | 8019577004 | |||
| 3775 | 8019595071 | |||
| 3776 | 8019606673 | |||
| 3777 | 8019611840 | |||
| 3778 | 8019623167 | |||
| 3779 | 8019629931 | |||
| 3780 | 8019640675 | |||
| 3781 | 8019652278 | |||
| 3782 | 8019666768 | |||
| 3783 | 8019676528 | |||
| 3784 | 8019679460 | |||
| 3785 | 8019696043 | |||
| 3786 | 8024490777 | |||
| 3787 | 8055742636 | |||
| 3788 | 8056676145 | |||
| 3789 | 8056682944 | |||
| 3790 | 8056693785 | |||
| 3791 | 8056971497 | |||
| 3792 | 8057581535 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iqg-assembly1.cif.gz_B | crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form | 0.9872 | 5 | 251 |
| 8bci-assembly2.cif.gz_C | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 | 0.9866 | 6 | 251 |
| 8bcj-assembly2.cif.gz_D | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ | 0.9857 | 5 | 251 |
| 4e3z-assembly1.cif.gz_B | crystal structure of a oxidoreductase from rhizobium etli cfn 42 | 0.9839 | 6 | 251 |
| 8bci-assembly2.cif.gz_D | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 | 0.9833 | 5 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jigA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9721 | 2 | 251 | 3.40.50.720 |
| 4jigA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.968 | 2 | 251 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9653 | 6 | 250 | 3.40.50.720 |
| 3i3oG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9624 | 6 | 251 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.962 | 6 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M6VJ76-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9894 | 2 | 251 |
GO:0016614
|
| AF-A0A317PHF8-F1-model_v4 | Glucose 1-dehydrogenase | 0.9894 | 5 | 251 |
GO:0016614
|
| AF-A0A2N4YNE3-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9888 | 109 | 251 |
GO:0016614
|
| AF-A0A1S1NS57-F1-model_v4 | Glucose 1-dehydrogenase (EC 1.1.1.47) | 0.9886 | 5 | 251 |
GO:0047936
|
| AF-A0A420WTP5-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9885 | 5 | 251 |
GO:0016491
|