F495812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1826 | 984 | 1334 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300006186|Ga0075369_10130104|Ga0075369_101301041 |
| Length | 97 |
| Sequence | MNAVSPMAPSATRTVKLVYFAWVRERVGLPEETLDIPADLATIADLVRWLKARGEGYEAAFANEAVVRAALDQVHAKPHAALGNAREIAFFPPMTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 10 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 15 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 16 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 17 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 21 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 22 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 23 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 24 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 25 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 26 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 27 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 28 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 29 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 30 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 31 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 32 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 33 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 34 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 35 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 36 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 37 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 38 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 39 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 40 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 41 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 42 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 43 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 44 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 45 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 46 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 47 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 48 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 49 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 50 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 51 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 52 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 53 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 54 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 55 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 56 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 57 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 58 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 59 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 60 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 61 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 62 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 63 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 64 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 65 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 66 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 67 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 68 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 69 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 70 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 71 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 72 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 73 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 74 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 75 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 76 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 77 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 78 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 79 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 80 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 81 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 82 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 83 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 84 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 85 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 86 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 87 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 88 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 89 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 90 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 91 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 92 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 93 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 94 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 95 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 96 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 97 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 98 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 99 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 100 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 101 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 102 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 103 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 104 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 105 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 106 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 107 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 108 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 109 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 110 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 111 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 112 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 113 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 114 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 115 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 116 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 117 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 118 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 119 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 120 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 121 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 122 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 123 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 124 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 125 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 126 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 127 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 128 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 129 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 130 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 131 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 132 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 133 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 134 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 135 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 136 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 137 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 138 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 139 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 140 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 141 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 142 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 143 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 144 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 145 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 146 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 147 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 148 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 149 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 150 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 151 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 152 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 153 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 154 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 155 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 156 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 157 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 158 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 159 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 160 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 161 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 162 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 163 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 164 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 165 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 166 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 167 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 168 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 169 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 170 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 171 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 172 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 173 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 174 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 175 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 176 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 177 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 178 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 179 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 180 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 181 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 182 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 183 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 184 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 185 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 186 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 187 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 188 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 189 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 190 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 191 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 192 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 193 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 194 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 195 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 196 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 197 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 198 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 199 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 200 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 201 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 202 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 203 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 204 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 205 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 206 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 207 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 208 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 209 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 210 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 211 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 212 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 213 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 214 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 215 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 216 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 217 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 218 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 219 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 220 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 221 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 222 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 223 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 224 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 225 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 226 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 227 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 228 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 229 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 230 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 231 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 232 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 233 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 234 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 235 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 236 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 237 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 238 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 239 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 240 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 241 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 242 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 243 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 244 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 245 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 246 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 247 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 248 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 249 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 250 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 251 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 252 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 253 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 254 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 255 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 256 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 257 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 258 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 259 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 260 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 261 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 262 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 263 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 264 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 265 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 266 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 267 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 268 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 269 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 270 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 271 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 272 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 273 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 274 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 275 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 276 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 277 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 278 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 279 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 280 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 281 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 282 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 283 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 284 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 285 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 286 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 287 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 288 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 289 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 290 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 291 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 292 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 293 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 294 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 295 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 296 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 297 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 298 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 299 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 300 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 301 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 302 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 303 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 304 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 305 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 306 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 307 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 308 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 309 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 310 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 311 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 312 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 313 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 314 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 315 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 316 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 317 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 318 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 319 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 320 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 321 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 322 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 323 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 324 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 325 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 326 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 327 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 328 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 329 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 330 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 331 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 332 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 333 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 334 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 335 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 336 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 337 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 338 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 339 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 340 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 341 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 342 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 343 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 344 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 345 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 346 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 347 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 348 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 349 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 350 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 351 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 352 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 353 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 354 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 355 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 356 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 357 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 358 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 359 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 360 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 361 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 362 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 363 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 364 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 365 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 366 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 367 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 368 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 369 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 370 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 371 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 372 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 373 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 374 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 375 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 376 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 377 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 378 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 379 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 380 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 381 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 382 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 383 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 384 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 385 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 386 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 387 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 388 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 389 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 390 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 391 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 392 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 393 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 394 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 395 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 396 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 397 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 398 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 399 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 400 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 401 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 402 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 403 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 404 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 405 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 406 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 407 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 408 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 409 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 410 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 411 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 412 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 413 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 414 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 415 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 416 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 417 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 418 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 419 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 420 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 421 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 422 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 423 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 424 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 425 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 426 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 427 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 428 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 429 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 430 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 431 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 432 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 433 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 434 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 435 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 436 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 437 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 438 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 439 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 440 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 441 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 442 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 443 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 444 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 445 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 446 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 447 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 448 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 449 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 450 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 451 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 452 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 453 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 454 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 455 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 456 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 457 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 458 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 459 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 460 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 461 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 462 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 463 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 464 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 465 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 466 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 467 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 468 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 469 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 470 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 471 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 472 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 473 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 474 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 475 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 476 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 477 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 478 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 479 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 480 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 481 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 482 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 483 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 484 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 485 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 486 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 487 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 488 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 489 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 490 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 491 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 492 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 493 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 494 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 495 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 496 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 498 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 500 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 501 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 502 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 503 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 504 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 505 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 506 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 507 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 508 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 509 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 510 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 511 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 512 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 513 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 514 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 515 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 516 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 517 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 518 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 520 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 521 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 522 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 524 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 525 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 526 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 527 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 528 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 531 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 532 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 533 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 534 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 535 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 536 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 538 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 539 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 540 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 541 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 542 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 543 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 544 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 545 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 546 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 547 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 548 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 549 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 550 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 551 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 552 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 553 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 555 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 556 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 557 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 558 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 560 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 561 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 562 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 564 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 565 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 566 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 567 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 568 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 569 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 570 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 571 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 572 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 573 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 574 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 575 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 576 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 577 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 578 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 579 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 580 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 581 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 582 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 583 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 584 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 585 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 586 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 587 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 588 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 589 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 590 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 591 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 592 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 593 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 594 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 595 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 596 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 597 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 598 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 599 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 600 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 601 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 602 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 603 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 604 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 605 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 606 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 607 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 608 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 609 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 611 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 612 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 613 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 615 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 616 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 617 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 618 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 619 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 620 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 621 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 622 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 623 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 624 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 625 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 626 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 627 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 628 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 629 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 630 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 631 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 684 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 688 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 690 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 691 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 693 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 697 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 698 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 699 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 700 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 701 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 702 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 703 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 704 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 705 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 706 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 707 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 708 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 709 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 710 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 711 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 712 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 713 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 714 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 715 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 716 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 717 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 718 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 719 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 720 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 721 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 722 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 723 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 724 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 725 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 726 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 727 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 728 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 729 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 730 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 731 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 732 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 733 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 734 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 735 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 736 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 737 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 738 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 739 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 740 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 741 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 742 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 743 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 744 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 745 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 746 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 747 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 748 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 749 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 750 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 751 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 752 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 753 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 754 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 755 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 756 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 757 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 758 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 759 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 760 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 761 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 762 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 763 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 764 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 765 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 766 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 767 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 768 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 769 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 770 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 771 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 772 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 773 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 774 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 775 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 776 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 777 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 778 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 779 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 780 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 781 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 782 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 783 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 784 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 785 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 786 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 787 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 788 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 789 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 790 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 791 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 792 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 793 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 794 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 795 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 796 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 821 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 822 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 823 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 824 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 825 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 826 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 827 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 838 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 839 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 840 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 841 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 842 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 843 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 844 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 845 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 846 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 847 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 848 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 849 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 850 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 851 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 852 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 853 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 854 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 855 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 856 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 857 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 858 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 859 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 860 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 861 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 862 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 863 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 864 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 865 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 866 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 867 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 868 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 869 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 870 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 871 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 872 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 873 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 874 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 876 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 877 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 878 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 879 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 880 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 881 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 882 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 883 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 884 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 885 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 886 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 887 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 888 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 889 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 890 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 891 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 892 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 893 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 894 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 895 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 896 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 897 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 898 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 899 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 900 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 901 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 902 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 903 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 904 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 905 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 906 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 907 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 908 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 909 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 910 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 911 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 912 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 913 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 914 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 915 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 916 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 917 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 918 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 919 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 920 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 921 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 922 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 923 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 928 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 929 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 930 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 931 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 932 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 933 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 934 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 935 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 936 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 937 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 938 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 939 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 940 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 941 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 942 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 943 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 944 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 945 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 946 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 947 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 948 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 949 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 950 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 951 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 952 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 953 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 954 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 955 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 956 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 957 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 958 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 959 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 960 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 961 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 962 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 963 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 964 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 965 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 966 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 967 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 968 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 969 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 970 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 971 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 972 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 973 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 974 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 975 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 976 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 977 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 978 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 979 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 980 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 981 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 982 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 983 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 984 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.78 |
| Metatranscriptomes | 0.27 |
| Isolates | 26.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.6 |
| Nodule | 21.91 |
| Rhizoplane | 3.23 |
| Rhizosphere | 52.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C5265 | 2010549000 | Bacteria | 1234 |
| 2 | JGI24740J21852_10000075 | 3300001979 | Bacteria | 33245 |
| 3 | JGI24740J21852_10008525 | 3300001979 | Bacteria | 4079 |
| 4 | JGI25155J39150_1000032 | 3300002704 | Bacteria | 105511 |
| 5 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 6 | JGI25156J39149_1005548 | 3300002705 | Bacteria | 3616 |
| 7 | JGI25162J39368_1001169 | 3300002737 | Bacteria | 15592 |
| 8 | JGI25162J39368_1001727 | 3300002737 | Bacteria | 10548 |
| 9 | JGI25162J39368_1003463 | 3300002737 | Bacteria | 4530 |
| 10 | JGI25154J39366_1000324 | 3300002738 | Bacteria | 27739 |
| 11 | JGI25158J39367_1000210 | 3300002739 | Bacteria | 13780 |
| 12 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 13 | JGI25157J39369_1000624 | 3300002741 | Bacteria | 19993 |
| 14 | JGI25159J45721_1000002 | 3300002987 | Bacteria | 289163 |
| 15 | JGI25159J45721_1000136 | 3300002987 | Bacteria | 34768 |
| 16 | JGI25159J45721_1004812 | 3300002987 | Bacteria | 4363 |
| 17 | JGI25151J46595_10025237 | 3300003187 | Bacteria | 2421 |
| 18 | JGI25151J46595_10034315 | 3300003187 | Bacteria | 1942 |
| 19 | JGI25151J46595_10077075 | 3300003187 | Bacteria | 982 |
| 20 | JGI25165J46597_1000028 | 3300003214 | Bacteria | 325146 |
| 21 | JGI25165J46597_1000630 | 3300003214 | Bacteria | 29232 |
| 22 | JGI25165J46597_1000944 | 3300003214 | Bacteria | 19880 |
| 23 | rootH2_10025055 | 3300003320 | Bacteria | 4537 |
| 24 | rootL2_10082663 | 3300003322 | Bacteria | 3939 |
| 25 | rootH1_10117768 | 3300003323 | Bacteria | 2152 |
| 26 | rootH1_10117786 | 3300003323 | Bacteria | 1654 |
| 27 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 28 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 29 | JGI25160J50197_1000191 | 3300003354 | Bacteria | 51959 |
| 30 | JGI25160J50197_1023350 | 3300003354 | Bacteria | 1785 |
| 31 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 32 | JGI25161J50226_1000489 | 3300003374 | Bacteria | 17865 |
| 33 | JGI25161J50226_1000704 | 3300003374 | Bacteria | 13116 |
| 34 | Ga0006562J51391_1007860 | 3300003578 | Bacteria | 2779 |
| 35 | Ga0006562J51391_1097928 | 3300003578 | Bacteria | 1340 |
| 36 | Ga0055539_1014217 | 3300003752 | Bacteria | 972 |
| 37 | Ga0055542_1000989 | 3300003762 | Bacteria | 18379 |
| 38 | Ga0055529_1002302 | 3300003763 | Bacteria | 3824 |
| 39 | Ga0055526_1001505 | 3300003771 | Bacteria | 16503 |
| 40 | Ga0055526_1013003 | 3300003771 | Bacteria | 3566 |
| 41 | Ga0055526_1043655 | 3300003771 | Bacteria | 1089 |
| 42 | Ga0055526_1063506 | 3300003771 | Bacteria | 776 |
| 43 | Ga0055524_1001479 | 3300003775 | Bacteria | 13409 |
| 44 | Ga0055524_1007611 | 3300003775 | Bacteria | 4579 |
| 45 | Ga0055524_1009931 | 3300003775 | Bacteria | 3826 |
| 46 | Ga0055524_1023880 | 3300003775 | Bacteria | 1956 |
| 47 | Ga0055524_1040839 | 3300003775 | Bacteria | 1177 |
| 48 | Ga0055536_1000984 | 3300003781 | Bacteria | 18060 |
| 49 | Ga0055528_1000460 | 3300003790 | Bacteria | 32499 |
| 50 | Ga0055528_1005249 | 3300003790 | Bacteria | 6079 |
| 51 | Ga0055528_1026969 | 3300003790 | Bacteria | 1632 |
| 52 | Ga0055528_1090666 | 3300003790 | Bacteria | 525 |
| 53 | Ga0055531_10017167 | 3300003794 | Bacteria | 3071 |
| 54 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 55 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 56 | Ga0055543_1001749 | 3300004625 | Bacteria | 8117 |
| 57 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 58 | Ga0065165_1000095 | 3300005262 | Bacteria | 145470 |
| 59 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 60 | Ga0065165_1003558 | 3300005262 | Bacteria | 10770 |
| 61 | Ga0065165_1061053 | 3300005262 | Bacteria | 1033 |
| 62 | Ga0065165_1112062 | 3300005262 | Bacteria | 670 |
| 63 | Ga0070658_11449349 | 3300005327 | Bacteria | 596 |
| 64 | Ga0070690_100054478 | 3300005330 | Bacteria | 2561 |
| 65 | Ga0070690_100723783 | 3300005330 | Bacteria | 766 |
| 66 | Ga0070670_100009220 | 3300005331 | Bacteria | 8432 |
| 67 | Ga0070670_100656590 | 3300005331 | Bacteria | 941 |
| 68 | Ga0070670_100829185 | 3300005331 | Bacteria | 836 |
| 69 | Ga0068869_100804422 | 3300005334 | Bacteria | 808 |
| 70 | Ga0068869_101297975 | 3300005334 | Bacteria | 642 |
| 71 | Ga0070666_10148138 | 3300005335 | Bacteria | 1637 |
| 72 | Ga0070680_100716936 | 3300005336 | Bacteria | 861 |
| 73 | Ga0070680_100909786 | 3300005336 | Bacteria | 759 |
| 74 | Ga0070682_100292531 | 3300005337 | Bacteria | 1192 |
| 75 | Ga0070682_101026383 | 3300005337 | Bacteria | 686 |
| 76 | Ga0068868_100295750 | 3300005338 | Bacteria | 1374 |
| 77 | Ga0068868_100834536 | 3300005338 | Bacteria | 834 |
| 78 | Ga0070660_100055967 | 3300005339 | Bacteria | 3050 |
| 79 | Ga0070689_100014099 | 3300005340 | Bacteria | 5798 |
| 80 | Ga0070689_100602971 | 3300005340 | Bacteria | 951 |
| 81 | Ga0070687_100002628 | 3300005343 | Bacteria | 6792 |
| 82 | Ga0070661_100375400 | 3300005344 | Bacteria | 1120 |
| 83 | Ga0070661_100714655 | 3300005344 | Bacteria | 817 |
| 84 | Ga0070668_100167676 | 3300005347 | Bacteria | 1786 |
| 85 | Ga0070668_101217888 | 3300005347 | Bacteria | 682 |
| 86 | Ga0070675_100104071 | 3300005354 | Bacteria | 2394 |
| 87 | Ga0070675_100714828 | 3300005354 | Bacteria | 913 |
| 88 | Ga0070671_100078659 | 3300005355 | Bacteria | 2756 |
| 89 | Ga0070671_101750644 | 3300005355 | Bacteria | 552 |
| 90 | Ga0070674_100117477 | 3300005356 | Bacteria | 1964 |
| 91 | Ga0070674_100990778 | 3300005356 | Bacteria | 737 |
| 92 | Ga0070674_102154929 | 3300005356 | Bacteria | 509 |
| 93 | Ga0070673_100837545 | 3300005364 | Bacteria | 851 |
| 94 | Ga0070673_101814591 | 3300005364 | Bacteria | 578 |
| 95 | Ga0070673_102034949 | 3300005364 | Bacteria | 545 |
| 96 | Ga0070688_100116761 | 3300005365 | Bacteria | 1782 |
| 97 | Ga0070659_100315195 | 3300005366 | Bacteria | 1306 |
| 98 | Ga0070659_100749590 | 3300005366 | Bacteria | 847 |
| 99 | Ga0070667_100136430 | 3300005367 | Bacteria | 2145 |
| 100 | Ga0070667_100750264 | 3300005367 | Bacteria | 905 |
| 101 | Ga0070667_101115791 | 3300005367 | Bacteria | 737 |
| 102 | Ga0070667_101470175 | 3300005367 | Bacteria | 640 |
| 103 | Ga0070667_101576079 | 3300005367 | Bacteria | 617 |
| 104 | Ga0070700_100300835 | 3300005441 | Bacteria | 1171 |
| 105 | Ga0070708_101173899 | 3300005445 | Bacteria | 718 |
| 106 | Ga0070663_100038200 | 3300005455 | Bacteria | 3348 |
| 107 | Ga0070663_100052068 | 3300005455 | Bacteria | 2919 |
| 108 | Ga0070663_100054895 | 3300005455 | Bacteria | 2850 |
| 109 | Ga0070663_100349623 | 3300005455 | Bacteria | 1197 |
| 110 | Ga0070663_100862676 | 3300005455 | Bacteria | 780 |
| 111 | Ga0070663_101806730 | 3300005455 | Bacteria | 548 |
| 112 | Ga0070678_100022607 | 3300005456 | Bacteria | 4172 |
| 113 | Ga0070678_100329089 | 3300005456 | Bacteria | 1307 |
| 114 | Ga0070678_100678395 | 3300005456 | Bacteria | 926 |
| 115 | Ga0070662_100605516 | 3300005457 | Bacteria | 922 |
| 116 | Ga0070662_101046303 | 3300005457 | Bacteria | 700 |
| 117 | Ga0070681_10325145 | 3300005458 | Bacteria | 1447 |
| 118 | Ga0068867_101568184 | 3300005459 | Bacteria | 615 |
| 119 | Ga0068867_101869010 | 3300005459 | Bacteria | 566 |
| 120 | Ga0070685_10637606 | 3300005466 | Bacteria | 771 |
| 121 | Ga0070699_101768060 | 3300005518 | Bacteria | 566 |
| 122 | Ga0070679_101446866 | 3300005530 | Bacteria | 634 |
| 123 | Ga0070679_101817761 | 3300005530 | Bacteria | 558 |
| 124 | Ga0068853_101184563 | 3300005539 | Bacteria | 737 |
| 125 | Ga0070672_100074617 | 3300005543 | Bacteria | 2706 |
| 126 | Ga0070686_100151471 | 3300005544 | Bacteria | 1625 |
| 127 | Ga0070695_100866056 | 3300005545 | Bacteria | 728 |
| 128 | Ga0070696_101653125 | 3300005546 | Bacteria | 551 |
| 129 | Ga0070665_100012057 | 3300005548 | Bacteria | 8721 |
| 130 | Ga0070665_100121404 | 3300005548 | Bacteria | 2615 |
| 131 | Ga0070665_100226673 | 3300005548 | Bacteria | 1869 |
| 132 | Ga0070665_100727811 | 3300005548 | Bacteria | 1005 |
| 133 | Ga0070665_101541354 | 3300005548 | Bacteria | 673 |
| 134 | Ga0070665_102538616 | 3300005548 | Bacteria | 514 |
| 135 | Ga0070704_100686395 | 3300005549 | Bacteria | 907 |
| 136 | Ga0068855_100832466 | 3300005563 | Bacteria | 979 |
| 137 | Ga0068855_101351368 | 3300005563 | Bacteria | 736 |
| 138 | Ga0068855_101360002 | 3300005563 | Bacteria | 733 |
| 139 | Ga0068855_101494603 | 3300005563 | Bacteria | 694 |
| 140 | Ga0070664_101367996 | 3300005564 | Bacteria | 669 |
| 141 | Ga0068857_101095070 | 3300005577 | Bacteria | 769 |
| 142 | Ga0068857_101336963 | 3300005577 | Bacteria | 696 |
| 143 | Ga0068857_102475825 | 3300005577 | Bacteria | 510 |
| 144 | Ga0068854_100136143 | 3300005578 | Bacteria | 1880 |
| 145 | Ga0068854_100244926 | 3300005578 | Bacteria | 1429 |
| 146 | Ga0068854_100777584 | 3300005578 | Bacteria | 833 |
| 147 | Ga0068854_101708401 | 3300005578 | Bacteria | 575 |
| 148 | Ga0068854_101798367 | 3300005578 | Bacteria | 562 |
| 149 | Ga0068856_100070458 | 3300005614 | Bacteria | 3459 |
| 150 | Ga0070702_100685868 | 3300005615 | Bacteria | 779 |
| 151 | Ga0068852_100111240 | 3300005616 | Bacteria | 2490 |
| 152 | Ga0068852_100682644 | 3300005616 | Bacteria | 1036 |
| 153 | Ga0068852_102429860 | 3300005616 | Bacteria | 544 |
| 154 | Ga0068859_100278386 | 3300005617 | Bacteria | 1766 |
| 155 | Ga0068859_101337119 | 3300005617 | Bacteria | 790 |
| 156 | Ga0068859_102599594 | 3300005617 | Bacteria | 557 |
| 157 | Ga0068864_100004815 | 3300005618 | Bacteria | 11064 |
| 158 | Ga0068864_100516260 | 3300005618 | Bacteria | 1151 |
| 159 | Ga0068861_100314578 | 3300005719 | Bacteria | 1362 |
| 160 | Ga0068861_100399749 | 3300005719 | Bacteria | 1219 |
| 161 | Ga0068858_100161184 | 3300005842 | Bacteria | 2112 |
| 162 | Ga0068858_100866151 | 3300005842 | Bacteria | 883 |
| 163 | Ga0068860_100998293 | 3300005843 | Bacteria | 855 |
| 164 | Ga0068862_100401566 | 3300005844 | Bacteria | 1282 |
| 165 | Ga0068862_101058033 | 3300005844 | Bacteria | 805 |
| 166 | Ga0081539_10001131 | 3300005985 | Bacteria | 48406 |
| 167 | Ga0075365_10013889 | 3300006038 | Bacteria | 4831 |
| 168 | Ga0075365_10024163 | 3300006038 | Bacteria | 3829 |
| 169 | Ga0075365_10173955 | 3300006038 | Bacteria | 1503 |
| 170 | Ga0075365_10356916 | 3300006038 | Bacteria | 1030 |
| 171 | Ga0075365_10458027 | 3300006038 | Bacteria | 901 |
| 172 | Ga0075365_10567237 | 3300006038 | Bacteria | 803 |
| 173 | Ga0075365_10931011 | 3300006038 | Bacteria | 612 |
| 174 | Ga0075365_11335457 | 3300006038 | Bacteria | 504 |
| 175 | Ga0075368_10007739 | 3300006042 | Bacteria | 3803 |
| 176 | Ga0075368_10267938 | 3300006042 | Bacteria | 732 |
| 177 | Ga0075363_100073258 | 3300006048 | Bacteria | 1863 |
| 178 | Ga0075363_100124627 | 3300006048 | Bacteria | 1441 |
| 179 | Ga0075363_100251247 | 3300006048 | Bacteria | 1018 |
| 180 | Ga0075363_101008530 | 3300006048 | Bacteria | 513 |
| 181 | Ga0075364_10012041 | 3300006051 | Bacteria | 5276 |
| 182 | Ga0075364_10553044 | 3300006051 | Bacteria | 787 |
| 183 | Ga0075364_10793323 | 3300006051 | Bacteria | 646 |
| 184 | Ga0075362_10002404 | 3300006177 | Bacteria | 6275 |
| 185 | Ga0075362_10024220 | 3300006177 | Bacteria | 2574 |
| 186 | Ga0075367_10037653 | 3300006178 | Bacteria | 2812 |
| 187 | Ga0075367_10054745 | 3300006178 | Bacteria | 2366 |
| 188 | Ga0075367_10169458 | 3300006178 | Bacteria | 1360 |
| 189 | Ga0075367_10227761 | 3300006178 | Bacteria | 1167 |
| 190 | Ga0075367_10424745 | 3300006178 | Bacteria | 842 |
| 191 | Ga0075369_10006353 | 3300006186 | Bacteria | 4465 |
| 192 | Ga0075369_10130104 | 3300006186 | Bacteria | 1143 |
| 193 | Ga0075369_10180034 | 3300006186 | Bacteria | 972 |
| 194 | Ga0075369_10239084 | 3300006186 | Bacteria | 842 |
| 195 | Ga0075366_10213875 | 3300006195 | Bacteria | 1174 |
| 196 | Ga0075366_10793893 | 3300006195 | Bacteria | 589 |
| 197 | Ga0097621_101948134 | 3300006237 | Bacteria | 561 |
| 198 | Ga0097621_102363655 | 3300006237 | Bacteria | 509 |
| 199 | Ga0075370_10023755 | 3300006353 | Bacteria | 3380 |
| 200 | Ga0075370_10079906 | 3300006353 | Bacteria | 1879 |
| 201 | Ga0075370_10267047 | 3300006353 | Bacteria | 1015 |
| 202 | Ga0075370_10497113 | 3300006353 | Bacteria | 736 |
| 203 | Ga0068871_100579205 | 3300006358 | Bacteria | 1019 |
| 204 | Ga0068871_100711248 | 3300006358 | Bacteria | 921 |
| 205 | Ga0075428_100235851 | 3300006844 | Bacteria | 1974 |
| 206 | Ga0068865_100504739 | 3300006881 | Bacteria | 1009 |
| 207 | Ga0068865_100564251 | 3300006881 | Bacteria | 958 |
| 208 | Ga0068865_101074993 | 3300006881 | Bacteria | 708 |
| 209 | Ga0097620_100278387 | 3300006931 | Bacteria | 1766 |
| 210 | Ga0097620_101336670 | 3300006931 | Bacteria | 790 |
| 211 | Ga0097620_102599881 | 3300006931 | Bacteria | 557 |
| 212 | Ga0105251_10008871 | 3300009011 | Bacteria | 6019 |
| 213 | Ga0105244_10496521 | 3300009036 | Bacteria | 562 |
| 214 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 215 | Ga0105240_10381721 | 3300009093 | Bacteria | 1591 |
| 216 | Ga0105240_10527204 | 3300009093 | Bacteria | 1310 |
| 217 | Ga0111539_10286338 | 3300009094 | Bacteria | 1917 |
| 218 | Ga0111539_11718509 | 3300009094 | Bacteria | 728 |
| 219 | Ga0111539_11918052 | 3300009094 | Bacteria | 687 |
| 220 | Ga0111539_12969398 | 3300009094 | Bacteria | 548 |
| 221 | Ga0105245_10123083 | 3300009098 | Bacteria | 2425 |
| 222 | Ga0105245_11845478 | 3300009098 | Bacteria | 657 |
| 223 | Ga0105245_11854741 | 3300009098 | Bacteria | 656 |
| 224 | Ga0105247_10054813 | 3300009101 | Bacteria | 2460 |
| 225 | Ga0105247_10893303 | 3300009101 | Bacteria | 686 |
| 226 | Ga0105247_11669274 | 3300009101 | Bacteria | 526 |
| 227 | Ga0105243_10250889 | 3300009148 | Bacteria | 1580 |
| 228 | Ga0105243_10546312 | 3300009148 | Bacteria | 1106 |
| 229 | Ga0105243_11147000 | 3300009148 | Bacteria | 788 |
| 230 | Ga0105243_11304643 | 3300009148 | Bacteria | 743 |
| 231 | Ga0105243_12052874 | 3300009148 | Bacteria | 607 |
| 232 | Ga0105242_10180889 | 3300009176 | Bacteria | 1860 |
| 233 | Ga0105242_12183621 | 3300009176 | Bacteria | 599 |
| 234 | Ga0105248_10015377 | 3300009177 | Bacteria | 8441 |
| 235 | Ga0105248_10335817 | 3300009177 | Bacteria | 1702 |
| 236 | Ga0105248_10660482 | 3300009177 | Bacteria | 1179 |
| 237 | Ga0105248_12313296 | 3300009177 | Bacteria | 612 |
| 238 | Ga0105237_10002365 | 3300009545 | Bacteria | 23399 |
| 239 | Ga0105237_11856567 | 3300009545 | Bacteria | 610 |
| 240 | Ga0105238_10092726 | 3300009551 | Bacteria | 3008 |
| 241 | Ga0105249_10302469 | 3300009553 | Bacteria | 1605 |
| 242 | Ga0105249_10865072 | 3300009553 | Bacteria | 970 |
| 243 | Ga0123342_1042104 | 3300009766 | Bacteria | 1623 |
| 244 | Ga0099796_10046910 | 3300010159 | Bacteria | 1485 |
| 245 | Ga0105239_10012029 | 3300010375 | Bacteria | 9650 |
| 246 | Ga0105239_10013157 | 3300010375 | Bacteria | 9193 |
| 247 | Ga0105239_11075225 | 3300010375 | Bacteria | 926 |
| 248 | Ga0105239_11341881 | 3300010375 | Bacteria | 825 |
| 249 | Ga0105239_11747489 | 3300010375 | Bacteria | 720 |
| 250 | Ga0105246_10368627 | 3300011119 | Bacteria | 1183 |
| 251 | Ga0105246_10959503 | 3300011119 | Bacteria | 771 |
| 252 | Ga0105246_12592543 | 3300011119 | Bacteria | 501 |
| 253 | Ga0157314_1046160 | 3300012500 | Bacteria | 542 |
| 254 | Ga0157313_1033713 | 3300012503 | Bacteria | 595 |
| 255 | Ga0157373_10135794 | 3300013100 | Bacteria | 1729 |
| 256 | Ga0157373_10777314 | 3300013100 | Bacteria | 705 |
| 257 | Ga0157371_10891306 | 3300013102 | Bacteria | 674 |
| 258 | Ga0157370_10003636 | 3300013104 | Bacteria | 18019 |
| 259 | Ga0157370_10113036 | 3300013104 | Bacteria | 2538 |
| 260 | Ga0157370_10305394 | 3300013104 | Bacteria | 1468 |
| 261 | Ga0157370_10694141 | 3300013104 | Bacteria | 929 |
| 262 | Ga0157370_10849273 | 3300013104 | Bacteria | 830 |
| 263 | Ga0157369_10049860 | 3300013105 | Bacteria | 4536 |
| 264 | Ga0157369_10185520 | 3300013105 | Bacteria | 2188 |
| 265 | Ga0157369_10199521 | 3300013105 | Bacteria | 2100 |
| 266 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 267 | Ga0171462_1006 | 3300013250 | Bacteria | 432986 |
| 268 | Ga0157374_10111656 | 3300013296 | Bacteria | 2630 |
| 269 | Ga0157374_11011596 | 3300013296 | Bacteria | 850 |
| 270 | Ga0157374_12037994 | 3300013296 | Bacteria | 600 |
| 271 | Ga0157378_10256214 | 3300013297 | Bacteria | 1677 |
| 272 | Ga0157378_10698258 | 3300013297 | Bacteria | 1034 |
| 273 | Ga0157378_11290035 | 3300013297 | Bacteria | 771 |
| 274 | Ga0163162_10021032 | 3300013306 | Bacteria | 6418 |
| 275 | Ga0163162_10040362 | 3300013306 | Bacteria | 4667 |
| 276 | Ga0163162_10226735 | 3300013306 | Bacteria | 1998 |
| 277 | Ga0163162_10789499 | 3300013306 | Bacteria | 1067 |
| 278 | Ga0157372_11527829 | 3300013307 | Bacteria | 769 |
| 279 | Ga0157375_11269747 | 3300013308 | Bacteria | 865 |
| 280 | Ga0157375_12450897 | 3300013308 | Bacteria | 623 |
| 281 | Ga0157375_12996842 | 3300013308 | Bacteria | 564 |
| 282 | Ga0157375_13218066 | 3300013308 | Bacteria | 545 |
| 283 | Ga0157375_13631517 | 3300013308 | Bacteria | 513 |
| 284 | Ga0163163_10559799 | 3300014325 | Bacteria | 1206 |
| 285 | Ga0157380_10201489 | 3300014326 | Bacteria | 1766 |
| 286 | Ga0157380_10663586 | 3300014326 | Bacteria | 1042 |
| 287 | Ga0157380_11000817 | 3300014326 | Bacteria | 869 |
| 288 | Ga0182008_10055587 | 3300014497 | Bacteria | 1957 |
| 289 | Ga0182008_10075376 | 3300014497 | Bacteria | 1659 |
| 290 | Ga0182008_10210516 | 3300014497 | Bacteria | 992 |
| 291 | Ga0182008_10449140 | 3300014497 | Bacteria | 701 |
| 292 | Ga0157377_10354396 | 3300014745 | Bacteria | 985 |
| 293 | Ga0157379_10980218 | 3300014968 | Bacteria | 805 |
| 294 | Ga0157379_11011881 | 3300014968 | Bacteria | 793 |
| 295 | Ga0157376_10610420 | 3300014969 | Bacteria | 1087 |
| 296 | Ga0157376_10850109 | 3300014969 | Bacteria | 928 |
| 297 | Ga0157376_12094137 | 3300014969 | Bacteria | 604 |
| 298 | Ga0182007_10000460 | 3300015262 | Bacteria | 24598 |
| 299 | Ga0182005_1015635 | 3300015265 | Bacteria | 2115 |
| 300 | Ga0183363_1412 | 3300015690 | Bacteria | 3458 |
| 301 | Ga0163161_10516212 | 3300017792 | Bacteria | 975 |
| 302 | Ga0163161_10715323 | 3300017792 | Bacteria | 835 |
| 303 | Ga0163161_11229244 | 3300017792 | Bacteria | 649 |
| 304 | Ga0163161_11933006 | 3300017792 | Bacteria | 525 |
| 305 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 306 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 307 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 308 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 309 | Ga0213874_10014157 | 3300021377 | Bacteria | 2080 |
| 310 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 311 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 312 | Ga0228598_1031096 | 3300024227 | Bacteria | 1051 |
| 313 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 314 | Ga0209436_101739 | 3300025208 | Bacteria | 7155 |
| 315 | Ga0209672_123228 | 3300025228 | Bacteria | 573 |
| 316 | Ga0207427_113132 | 3300025231 | Bacteria | 817 |
| 317 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 318 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 319 | Ga0207425_1025968 | 3300025245 | Bacteria | 1205 |
| 320 | Ga0207425_1054664 | 3300025245 | Bacteria | 719 |
| 321 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 322 | Ga0209646_1008549 | 3300025246 | Bacteria | 1644 |
| 323 | Ga0209646_1017574 | 3300025246 | Bacteria | 1053 |
| 324 | Ga0209026_1000120 | 3300025250 | Bacteria | 130091 |
| 325 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 326 | Ga0209677_100845 | 3300025253 | Bacteria | 15183 |
| 327 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 328 | Ga0209148_1007473 | 3300025254 | Bacteria | 2269 |
| 329 | Ga0209148_1037625 | 3300025254 | Bacteria | 685 |
| 330 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 331 | Ga0209759_1000288 | 3300025256 | Bacteria | 69733 |
| 332 | Ga0209759_1046353 | 3300025256 | Bacteria | 704 |
| 333 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 334 | Ga0209129_1001697 | 3300025258 | Bacteria | 11899 |
| 335 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 336 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 337 | Ga0209233_1000087 | 3300025261 | Bacteria | 325225 |
| 338 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 339 | Ga0209233_1004475 | 3300025261 | Bacteria | 4744 |
| 340 | Ga0209455_1000777 | 3300025272 | Bacteria | 17856 |
| 341 | Ga0209455_1021938 | 3300025272 | Bacteria | 1227 |
| 342 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 343 | Ga0209673_1001326 | 3300025273 | Bacteria | 24843 |
| 344 | Ga0209673_1004666 | 3300025273 | Bacteria | 7240 |
| 345 | Ga0209673_1066826 | 3300025273 | Bacteria | 872 |
| 346 | Ga0209673_1100635 | 3300025273 | Bacteria | 622 |
| 347 | Ga0209673_1102733 | 3300025273 | Bacteria | 612 |
| 348 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 349 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 350 | Ga0209130_1000148 | 3300025284 | Bacteria | 109763 |
| 351 | Ga0209130_1013563 | 3300025284 | Bacteria | 2082 |
| 352 | Ga0209130_1022880 | 3300025284 | Bacteria | 1387 |
| 353 | Ga0209675_1035650 | 3300025291 | Bacteria | 1133 |
| 354 | Ga0209676_1000694 | 3300025292 | Bacteria | 47316 |
| 355 | Ga0209676_1017727 | 3300025292 | Bacteria | 2509 |
| 356 | Ga0209025_1000149 | 3300025294 | Bacteria | 173393 |
| 357 | Ga0209025_1000580 | 3300025294 | Bacteria | 66332 |
| 358 | Ga0209025_1009457 | 3300025294 | Bacteria | 6785 |
| 359 | Ga0209025_1010350 | 3300025294 | Bacteria | 6330 |
| 360 | Ga0209025_1015894 | 3300025294 | Bacteria | 4492 |
| 361 | Ga0209025_1019505 | 3300025294 | Bacteria | 3767 |
| 362 | Ga0209025_1026975 | 3300025294 | Bacteria | 2864 |
| 363 | Ga0209025_1046050 | 3300025294 | Bacteria | 1800 |
| 364 | Ga0209025_1117947 | 3300025294 | Bacteria | 799 |
| 365 | Ga0209025_1147818 | 3300025294 | Bacteria | 654 |
| 366 | Ga0209564_1000431 | 3300025295 | Bacteria | 72866 |
| 367 | Ga0209564_1001106 | 3300025295 | Bacteria | 31905 |
| 368 | Ga0209564_1001342 | 3300025295 | Bacteria | 26169 |
| 369 | Ga0209564_1009309 | 3300025295 | Bacteria | 4694 |
| 370 | Ga0209564_1050292 | 3300025295 | Bacteria | 1022 |
| 371 | Ga0209564_1057945 | 3300025295 | Bacteria | 888 |
| 372 | Ga0209758_1009477 | 3300025297 | Bacteria | 6043 |
| 373 | Ga0209758_1031764 | 3300025297 | Bacteria | 2159 |
| 374 | Ga0209758_1060745 | 3300025297 | Bacteria | 1249 |
| 375 | Ga0209758_1075338 | 3300025297 | Bacteria | 1043 |
| 376 | Ga0209758_1152389 | 3300025297 | Bacteria | 585 |
| 377 | Ga0209050_1002170 | 3300025298 | Bacteria | 17758 |
| 378 | Ga0209050_1073321 | 3300025298 | Bacteria | 755 |
| 379 | Ga0209256_1000877 | 3300025299 | Bacteria | 37183 |
| 380 | Ga0209256_1001068 | 3300025299 | Bacteria | 31760 |
| 381 | Ga0209256_1001781 | 3300025299 | Bacteria | 20391 |
| 382 | Ga0209256_1005328 | 3300025299 | Bacteria | 7477 |
| 383 | Ga0209256_1005521 | 3300025299 | Bacteria | 7229 |
| 384 | Ga0209256_1008937 | 3300025299 | Bacteria | 4509 |
| 385 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 386 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 387 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 388 | Ga0207426_1005259 | 3300025302 | Bacteria | 5969 |
| 389 | Ga0209051_1015125 | 3300025303 | Bacteria | 3565 |
| 390 | Ga0209051_1021615 | 3300025303 | Bacteria | 2731 |
| 391 | Ga0209051_1022549 | 3300025303 | Bacteria | 2647 |
| 392 | Ga0209051_1025554 | 3300025303 | Bacteria | 2399 |
| 393 | Ga0209257_1005277 | 3300025304 | Bacteria | 9211 |
| 394 | Ga0209257_1038965 | 3300025304 | Bacteria | 1433 |
| 395 | Ga0209257_1084948 | 3300025304 | Bacteria | 803 |
| 396 | Ga0209257_1128230 | 3300025304 | Bacteria | 584 |
| 397 | Ga0207697_10506497 | 3300025315 | Bacteria | 533 |
| 398 | Ga0207655_1136851 | 3300025728 | Bacteria | 791 |
| 399 | Ga0207713_1016350 | 3300025735 | Bacteria | 3767 |
| 400 | Ga0207682_10016410 | 3300025893 | Bacteria | 2888 |
| 401 | Ga0207710_10713050 | 3300025900 | Bacteria | 526 |
| 402 | Ga0207688_10142825 | 3300025901 | Bacteria | 1410 |
| 403 | Ga0207688_10846381 | 3300025901 | Bacteria | 579 |
| 404 | Ga0207680_10276331 | 3300025903 | Bacteria | 1166 |
| 405 | Ga0207647_10285591 | 3300025904 | Bacteria | 941 |
| 406 | Ga0207645_10021086 | 3300025907 | Bacteria | 4253 |
| 407 | Ga0207645_10379884 | 3300025907 | Bacteria | 948 |
| 408 | Ga0207643_10459258 | 3300025908 | Bacteria | 811 |
| 409 | Ga0207705_10149112 | 3300025909 | Bacteria | 1751 |
| 410 | Ga0207705_10585120 | 3300025909 | Bacteria | 868 |
| 411 | Ga0207707_10275687 | 3300025912 | Bacteria | 1457 |
| 412 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 413 | Ga0207695_10068516 | 3300025913 | Bacteria | 3636 |
| 414 | Ga0207695_10158443 | 3300025913 | Bacteria | 2197 |
| 415 | Ga0207695_10991360 | 3300025913 | Bacteria | 720 |
| 416 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 417 | Ga0207663_10586278 | 3300025916 | Bacteria | 875 |
| 418 | Ga0207662_10782504 | 3300025918 | Bacteria | 672 |
| 419 | Ga0207657_10103856 | 3300025919 | Bacteria | 2355 |
| 420 | Ga0207649_10744690 | 3300025920 | Bacteria | 762 |
| 421 | Ga0207649_10894806 | 3300025920 | Bacteria | 696 |
| 422 | Ga0207649_11198737 | 3300025920 | Bacteria | 600 |
| 423 | Ga0207649_11578143 | 3300025920 | Bacteria | 519 |
| 424 | Ga0207652_11019144 | 3300025921 | Bacteria | 727 |
| 425 | Ga0207652_11596561 | 3300025921 | Bacteria | 556 |
| 426 | Ga0207681_10555121 | 3300025923 | Bacteria | 946 |
| 427 | Ga0207681_11555692 | 3300025923 | Bacteria | 554 |
| 428 | Ga0207694_10472535 | 3300025924 | Bacteria | 1048 |
| 429 | Ga0207650_10005961 | 3300025925 | Bacteria | 8320 |
| 430 | Ga0207659_10893205 | 3300025926 | Bacteria | 764 |
| 431 | Ga0207687_10156457 | 3300025927 | Bacteria | 1744 |
| 432 | Ga0207644_10048295 | 3300025931 | Bacteria | 3042 |
| 433 | Ga0207644_10051407 | 3300025931 | Bacteria | 2958 |
| 434 | Ga0207644_11219243 | 3300025931 | Bacteria | 632 |
| 435 | Ga0207690_10147147 | 3300025932 | Bacteria | 1742 |
| 436 | Ga0207690_10803309 | 3300025932 | Bacteria | 777 |
| 437 | Ga0207706_10145632 | 3300025933 | Bacteria | 2084 |
| 438 | Ga0207706_10963393 | 3300025933 | Bacteria | 718 |
| 439 | Ga0207706_10977684 | 3300025933 | Bacteria | 712 |
| 440 | Ga0207706_11397420 | 3300025933 | Bacteria | 575 |
| 441 | Ga0207686_10266629 | 3300025934 | Bacteria | 1258 |
| 442 | Ga0207709_10150026 | 3300025935 | Bacteria | 1613 |
| 443 | Ga0207709_10344727 | 3300025935 | Bacteria | 1122 |
| 444 | Ga0207709_10977994 | 3300025935 | Bacteria | 691 |
| 445 | Ga0207670_10003940 | 3300025936 | Bacteria | 7924 |
| 446 | Ga0207669_10110122 | 3300025937 | Bacteria | 1843 |
| 447 | Ga0207669_10344493 | 3300025937 | Bacteria | 1149 |
| 448 | Ga0207704_11181416 | 3300025938 | Bacteria | 652 |
| 449 | Ga0207691_10640451 | 3300025940 | Bacteria | 898 |
| 450 | Ga0207711_10076090 | 3300025941 | Bacteria | 2922 |
| 451 | Ga0207711_11662394 | 3300025941 | Bacteria | 582 |
| 452 | Ga0207689_11319931 | 3300025942 | Bacteria | 606 |
| 453 | Ga0207661_10637934 | 3300025944 | Bacteria | 979 |
| 454 | Ga0207679_11020068 | 3300025945 | Bacteria | 759 |
| 455 | Ga0207667_11057673 | 3300025949 | Bacteria | 796 |
| 456 | Ga0207667_11308885 | 3300025949 | Bacteria | 701 |
| 457 | Ga0207651_10205792 | 3300025960 | Bacteria | 1581 |
| 458 | Ga0207651_10743365 | 3300025960 | Bacteria | 867 |
| 459 | Ga0207651_10868605 | 3300025960 | Bacteria | 802 |
| 460 | Ga0207712_10564920 | 3300025961 | Bacteria | 980 |
| 461 | Ga0207712_11067324 | 3300025961 | Bacteria | 718 |
| 462 | Ga0207668_10179167 | 3300025972 | Bacteria | 1670 |
| 463 | Ga0207668_10671379 | 3300025972 | Bacteria | 909 |
| 464 | Ga0207668_10864079 | 3300025972 | Bacteria | 804 |
| 465 | Ga0207640_10150463 | 3300025981 | Bacteria | 1709 |
| 466 | Ga0207640_10155131 | 3300025981 | Bacteria | 1687 |
| 467 | Ga0207640_11304725 | 3300025981 | Bacteria | 648 |
| 468 | Ga0207658_10129704 | 3300025986 | Bacteria | 2024 |
| 469 | Ga0207658_10202043 | 3300025986 | Bacteria | 1660 |
| 470 | Ga0207658_10313549 | 3300025986 | Bacteria | 1356 |
| 471 | Ga0207658_10703577 | 3300025986 | Bacteria | 913 |
| 472 | Ga0207658_11707178 | 3300025986 | Bacteria | 575 |
| 473 | Ga0207677_10122790 | 3300026023 | Bacteria | 1957 |
| 474 | Ga0207677_11279385 | 3300026023 | Bacteria | 673 |
| 475 | Ga0207677_12065241 | 3300026023 | Bacteria | 530 |
| 476 | Ga0207703_10483128 | 3300026035 | Bacteria | 1161 |
| 477 | Ga0207703_10772864 | 3300026035 | Bacteria | 916 |
| 478 | Ga0207639_10335608 | 3300026041 | Bacteria | 1346 |
| 479 | Ga0207639_11494026 | 3300026041 | Bacteria | 634 |
| 480 | Ga0207678_10058238 | 3300026067 | Bacteria | 3324 |
| 481 | Ga0207678_10129738 | 3300026067 | Bacteria | 2150 |
| 482 | Ga0207678_10525768 | 3300026067 | Bacteria | 1033 |
| 483 | Ga0207678_10588475 | 3300026067 | Bacteria | 975 |
| 484 | Ga0207678_10637871 | 3300026067 | Bacteria | 935 |
| 485 | Ga0207678_10683760 | 3300026067 | Bacteria | 902 |
| 486 | Ga0207708_10137301 | 3300026075 | Bacteria | 1916 |
| 487 | Ga0207702_11714129 | 3300026078 | Bacteria | 621 |
| 488 | Ga0207702_11837235 | 3300026078 | Bacteria | 598 |
| 489 | Ga0207641_10636151 | 3300026088 | Bacteria | 1047 |
| 490 | Ga0207648_10959821 | 3300026089 | Bacteria | 800 |
| 491 | Ga0207676_10003179 | 3300026095 | Bacteria | 11705 |
| 492 | Ga0207676_10523656 | 3300026095 | Bacteria | 1129 |
| 493 | Ga0207674_11293015 | 3300026116 | Bacteria | 699 |
| 494 | Ga0207674_11840489 | 3300026116 | Bacteria | 572 |
| 495 | Ga0207675_100121294 | 3300026118 | Bacteria | 2474 |
| 496 | Ga0207675_100765701 | 3300026118 | Bacteria | 977 |
| 497 | Ga0207683_10012420 | 3300026121 | Bacteria | 7267 |
| 498 | Ga0207683_10048163 | 3300026121 | Bacteria | 3733 |
| 499 | Ga0207683_10177284 | 3300026121 | Bacteria | 1932 |
| 500 | Ga0207683_10661389 | 3300026121 | Bacteria | 968 |
| 501 | Ga0207698_10034126 | 3300026142 | Bacteria | 3706 |
| 502 | Ga0209281_1000236 | 3300027111 | Bacteria | 113362 |
| 503 | Ga0209281_1000266 | 3300027111 | Bacteria | 100574 |
| 504 | Ga0209371_1001249 | 3300027312 | Bacteria | 18174 |
| 505 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 506 | Ga0209282_1401494 | 3300027666 | Bacteria | 538 |
| 507 | Ga0209813_10183299 | 3300027866 | Bacteria | 767 |
| 508 | Ga0209974_10068959 | 3300027876 | Bacteria | 1204 |
| 509 | Ga0207428_10364317 | 3300027907 | Bacteria | 1062 |
| 510 | Ga0268266_10014527 | 3300028379 | Bacteria | 6769 |
| 511 | Ga0268266_10107861 | 3300028379 | Bacteria | 2463 |
| 512 | Ga0268266_10209519 | 3300028379 | Bacteria | 1787 |
| 513 | Ga0268266_10238826 | 3300028379 | Bacteria | 1676 |
| 514 | Ga0268266_10698121 | 3300028379 | Bacteria | 978 |
| 515 | Ga0268266_10823368 | 3300028379 | Bacteria | 897 |
| 516 | Ga0268266_11366561 | 3300028379 | Bacteria | 684 |
| 517 | Ga0268266_11417798 | 3300028379 | Bacteria | 670 |
| 518 | Ga0268265_10816259 | 3300028380 | Bacteria | 910 |
| 519 | Ga0268265_11158668 | 3300028380 | Bacteria | 769 |
| 520 | Ga0268265_11583614 | 3300028380 | Bacteria | 660 |
| 521 | Ga0268264_10858757 | 3300028381 | Bacteria | 909 |
| 522 | Ga0307515_10010607 | 3300028794 | Bacteria | 17629 |
| 523 | Ga0307515_10196211 | 3300028794 | Bacteria | 1910 |
| 524 | Ga0307515_10533009 | 3300028794 | Bacteria | 784 |
| 525 | Ga0268256_1000660 | 3300030500 | Bacteria | 26255 |
| 526 | Ga0265330_10083771 | 3300031235 | Bacteria | 1372 |
| 527 | Ga0265330_10171737 | 3300031235 | Bacteria | 919 |
| 528 | Ga0265332_10158692 | 3300031238 | Bacteria | 945 |
| 529 | Ga0265328_10062459 | 3300031239 | Bacteria | 1368 |
| 530 | Ga0265328_10298263 | 3300031239 | Bacteria | 622 |
| 531 | Ga0265325_10030702 | 3300031241 | Bacteria | 2880 |
| 532 | Ga0265325_10090453 | 3300031241 | Bacteria | 1510 |
| 533 | Ga0265325_10140843 | 3300031241 | Bacteria | 1147 |
| 534 | Ga0265325_10225700 | 3300031241 | Bacteria | 856 |
| 535 | Ga0265329_10149690 | 3300031242 | Bacteria | 756 |
| 536 | Ga0265340_10001562 | 3300031247 | Bacteria | 13158 |
| 537 | Ga0265340_10042630 | 3300031247 | Bacteria | 2227 |
| 538 | Ga0265340_10043089 | 3300031247 | Bacteria | 2213 |
| 539 | Ga0265340_10045419 | 3300031247 | Bacteria | 2146 |
| 540 | Ga0265340_10045992 | 3300031247 | Bacteria | 2130 |
| 541 | Ga0265340_10263442 | 3300031247 | Bacteria | 767 |
| 542 | Ga0265339_10091947 | 3300031249 | Bacteria | 1589 |
| 543 | Ga0265339_10156184 | 3300031249 | Bacteria | 1151 |
| 544 | Ga0265339_10415584 | 3300031249 | Bacteria | 627 |
| 545 | Ga0265339_10478538 | 3300031249 | Bacteria | 576 |
| 546 | Ga0265331_10001287 | 3300031250 | Bacteria | 18686 |
| 547 | Ga0265331_10089679 | 3300031250 | Bacteria | 1422 |
| 548 | Ga0265331_10097138 | 3300031250 | Bacteria | 1358 |
| 549 | Ga0265331_10368994 | 3300031250 | Bacteria | 643 |
| 550 | Ga0265331_10555454 | 3300031250 | Bacteria | 518 |
| 551 | Ga0265327_10000095 | 3300031251 | Bacteria | 194803 |
| 552 | Ga0265316_10185929 | 3300031344 | Bacteria | 1545 |
| 553 | Ga0265316_10930171 | 3300031344 | Bacteria | 607 |
| 554 | Ga0307513_10006330 | 3300031456 | Bacteria | 15498 |
| 555 | Ga0307513_10214632 | 3300031456 | Bacteria | 1752 |
| 556 | Ga0307513_10309409 | 3300031456 | Bacteria | 1343 |
| 557 | Ga0307408_100057540 | 3300031548 | Bacteria | 2823 |
| 558 | Ga0307408_100135901 | 3300031548 | Bacteria | 1924 |
| 559 | Ga0307408_101366534 | 3300031548 | Bacteria | 666 |
| 560 | Ga0307408_101833211 | 3300031548 | Bacteria | 580 |
| 561 | Ga0265313_10007558 | 3300031595 | Bacteria | 7388 |
| 562 | Ga0265313_10019903 | 3300031595 | Bacteria | 3719 |
| 563 | Ga0265313_10031991 | 3300031595 | Bacteria | 2692 |
| 564 | Ga0265313_10112760 | 3300031595 | Bacteria | 1194 |
| 565 | Ga0316575_10170132 | 3300031665 | Bacteria | 903 |
| 566 | Ga0316579_10080566 | 3300031691 | Bacteria | 1550 |
| 567 | Ga0265314_10037766 | 3300031711 | Bacteria | 3497 |
| 568 | Ga0265314_10146472 | 3300031711 | Bacteria | 1454 |
| 569 | Ga0265314_10162969 | 3300031711 | Bacteria | 1355 |
| 570 | Ga0265314_10561813 | 3300031711 | Bacteria | 592 |
| 571 | Ga0265342_10064019 | 3300031712 | Bacteria | 2159 |
| 572 | Ga0265342_10170989 | 3300031712 | Bacteria | 1195 |
| 573 | Ga0265342_10180588 | 3300031712 | Bacteria | 1156 |
| 574 | Ga0265342_10624597 | 3300031712 | Bacteria | 542 |
| 575 | Ga0307516_10104873 | 3300031730 | Bacteria | 2639 |
| 576 | Ga0307405_10177698 | 3300031731 | Bacteria | 1525 |
| 577 | Ga0307405_10191204 | 3300031731 | Bacteria | 1479 |
| 578 | Ga0307405_10522614 | 3300031731 | Bacteria | 955 |
| 579 | Ga0307405_11553399 | 3300031731 | Bacteria | 583 |
| 580 | Ga0316577_10609486 | 3300031733 | Bacteria | 621 |
| 581 | Ga0307413_10071775 | 3300031824 | Bacteria | 2183 |
| 582 | Ga0307410_10108694 | 3300031852 | Bacteria | 2003 |
| 583 | Ga0307406_10009795 | 3300031901 | Bacteria | 5391 |
| 584 | Ga0307406_10086670 | 3300031901 | Bacteria | 2097 |
| 585 | Ga0307406_10373811 | 3300031901 | Bacteria | 1121 |
| 586 | Ga0307406_11177694 | 3300031901 | Bacteria | 665 |
| 587 | Ga0307412_10273644 | 3300031911 | Bacteria | 1323 |
| 588 | Ga0307412_10379300 | 3300031911 | Bacteria | 1144 |
| 589 | Ga0307412_10421675 | 3300031911 | Bacteria | 1092 |
| 590 | Ga0307412_11248577 | 3300031911 | Bacteria | 667 |
| 591 | Ga0307412_11959248 | 3300031911 | Bacteria | 541 |
| 592 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 593 | Ga0307409_100097147 | 3300031995 | Bacteria | 2432 |
| 594 | Ga0307409_100555550 | 3300031995 | Bacteria | 1128 |
| 595 | Ga0307409_100788681 | 3300031995 | Bacteria | 957 |
| 596 | Ga0307409_101005982 | 3300031995 | Bacteria | 852 |
| 597 | Ga0307409_101022835 | 3300031995 | Bacteria | 845 |
| 598 | Ga0307409_101337941 | 3300031995 | Bacteria | 742 |
| 599 | Ga0307416_100206173 | 3300032002 | Bacteria | 1870 |
| 600 | Ga0307416_100739011 | 3300032002 | Bacteria | 1076 |
| 601 | Ga0307416_100786570 | 3300032002 | Bacteria | 1046 |
| 602 | Ga0307416_102309240 | 3300032002 | Bacteria | 638 |
| 603 | Ga0307414_11651350 | 3300032004 | Bacteria | 597 |
| 604 | Ga0307411_10011705 | 3300032005 | Bacteria | 4750 |
| 605 | Ga0307415_102358078 | 3300032126 | Bacteria | 523 |
| 606 | Ga0316593_10308730 | 3300032168 | Bacteria | 600 |
| 607 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 608 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 609 | Ga0373948_0044536 | 3300034817 | Bacteria | 938 |
| 610 | Ga0373958_0116867 | 3300034819 | Bacteria | 641 |
| 611 | Ga0373928_0044563 | 3300035084 | Bacteria | 1030 |
| 612 | Ga0373929_0045814 | 3300035085 | Bacteria | 986 |
| 613 | Ga0373929_0091196 | 3300035085 | Bacteria | 756 |
| 614 | Ga0373944_0134099 | 3300035089 | Bacteria | 863 |
| 615 | Ga0373923_0160968 | 3300035111 | Bacteria | 1024 |
| 616 | Ga0373939_0065154 | 3300035114 | Bacteria | 1171 |
| 617 | Ga0373941_0017338 | 3300035115 | Bacteria | 1972 |
| 618 | Ga0373941_0022048 | 3300035115 | Bacteria | 1804 |
| 619 | Ga0373941_0067397 | 3300035115 | Bacteria | 1180 |
| 620 | Ga0373945_0194682 | 3300035116 | Bacteria | 839 |
| 621 | Ga0373945_0314766 | 3300035116 | Bacteria | 673 |
| 622 | Ga0373954_0149670 | 3300035118 | Bacteria | 1140 |
| 623 | Ga0373960_0004122 | 3300035121 | Bacteria | 3322 |
| 624 | Ga0373943_0040534 | 3300035170 | Bacteria | 2249 |
| 625 | Ga0373946_0677114 | 3300035171 | Bacteria | 538 |
| 626 | Ga0373955_0820692 | 3300035172 | Bacteria | 572 |
| 627 | Ga0373942_0195710 | 3300035207 | Bacteria | 668 |
| 628 | Ga0373942_0215262 | 3300035207 | Bacteria | 642 |
| 629 | Ga0373961_0004785 | 3300035241 | Bacteria | 3255 |
| 630 | Ga0373961_0034038 | 3300035241 | Bacteria | 1438 |
| 631 | Ga0373962_0377996 | 3300035242 | Bacteria | 517 |
| 632 | Ga0373931_0002120 | 3300035691 | Bacteria | 8740 |
| 633 | Ga0373931_0013881 | 3300035691 | Bacteria | 3930 |
| 634 | Ga0373931_0713394 | 3300035691 | Bacteria | 663 |
| 635 | Ga0373935_0271890 | 3300035692 | Bacteria | 1191 |
| 636 | Ga0373927_0027265 | 3300035695 | Bacteria | 3731 |
| 637 | Ga0373937_1323102 | 3300036401 | Bacteria | 668 |
| 638 | Ga0316582_0256716 | 3300036647 | Bacteria | 1198 |
| 639 | Ga0316584_0842783 | 3300036712 | Bacteria | 620 |
| 640 | Ga0373925_0374694 | 3300037068 | Bacteria | 1158 |
| 641 | Ga0373925_0695920 | 3300037068 | Bacteria | 838 |
| 642 | Ga0395899_0047689 | 3300037312 | Bacteria | 3189 |
| 643 | Ga0395898_0049480 | 3300037466 | Bacteria | 4118 |
| 644 | Ga0395898_0279979 | 3300037466 | Bacteria | 1591 |
| 645 | Ga0395898_0355110 | 3300037466 | Bacteria | 1398 |
| 646 | Ga0395905_0037309 | 3300037471 | Bacteria | 4564 |
| 647 | Ga0395905_0052400 | 3300037471 | Bacteria | 3820 |
| 648 | Ga0395901_0082006 | 3300038443 | Bacteria | 3369 |
| 649 | Ga0395901_1155786 | 3300038443 | Bacteria | 742 |
| 650 | Ga0436365_0366823 | 3300039437 | Bacteria | 547 |
| 651 | Ga0436363_0775146 | 3300039450 | Bacteria | 11928 |
| 652 | Ga0439436_0006455 | 3300041404 | Bacteria | 3600 |
| 653 | Ga0439436_0149499 | 3300041404 | Bacteria | 658 |
| 654 | Ga0439436_0207568 | 3300041404 | Bacteria | 562 |
| 655 | Ga0439438_017861 | 3300041405 | Bacteria | 2031 |
| 656 | Ga0439466_0130362 | 3300041411 | Bacteria | 774 |
| 657 | Ga0439465_0001711 | 3300041413 | Bacteria | 7165 |
| 658 | Ga0439465_0089399 | 3300041413 | Bacteria | 1052 |
| 659 | Ga0439465_0102356 | 3300041413 | Bacteria | 990 |
| 660 | Ga0451789_1320308 | 3300041443 | Bacteria | 531 |
| 661 | Ga0451791_1932150 | 3300041451 | Bacteria | 579 |
| 662 | Ga0451797_0392121 | 3300041453 | Bacteria | 844 |
| 663 | Ga0451802_0083164 | 3300041460 | Bacteria | 716 |
| 664 | Ga0451839_0636310 | 3300041496 | Bacteria | 580 |
| 665 | Ga0451841_1019038 | 3300041498 | Bacteria | 858 |
| 666 | Ga0451853_2943703 | 3300041512 | Bacteria | 583 |
| 667 | Ga0439433_0078267 | 3300041999 | Bacteria | 802 |
| 668 | Ga0439445_0166395 | 3300042004 | Bacteria | 645 |
| 669 | Ga0439448_0225608 | 3300042005 | Bacteria | 659 |
| 670 | Ga0439432_040707 | 3300042006 | Bacteria | 1474 |
| 671 | Ga0439449_0001047 | 3300042007 | Bacteria | 10900 |
| 672 | Ga0439462_0121485 | 3300042015 | Bacteria | 727 |
| 673 | Ga0439462_0189933 | 3300042015 | Bacteria | 583 |
| 674 | Ga0450920_036575 | 3300042122 | Bacteria | 974 |
| 675 | Ga0450923_039887 | 3300042125 | Bacteria | 984 |
| 676 | Ga0450906_008450 | 3300042145 | Bacteria | 1991 |
| 677 | Ga0439458_0047121 | 3300042157 | Bacteria | 1057 |
| 678 | Ga0450908_029936 | 3300042184 | Bacteria | 946 |
| 679 | Ga0450909_080054 | 3300042185 | Bacteria | 528 |
| 680 | Ga0439434_0020056 | 3300042435 | Bacteria | 2006 |
| 681 | Ga0450918_001738 | 3300042531 | Bacteria | 4242 |
| 682 | Ga0466972_0082447 | 3300044658 | Bacteria | 1530 |
| 683 | Ga0466965_0132840 | 3300044683 | Bacteria | 1292 |
| 684 | Ga0466965_0432222 | 3300044683 | Bacteria | 731 |
| 685 | Ga0466966_0803263 | 3300044684 | Bacteria | 567 |
| 686 | Ga0466963_0020949 | 3300044694 | Bacteria | 4119 |
| 687 | Ga0466968_0455478 | 3300044735 | Bacteria | 633 |
| 688 | Ga0466970_0107199 | 3300044765 | Bacteria | 1524 |
| 689 | Ga0466957_0092513 | 3300044842 | Bacteria | 1897 |
| 690 | Ga0466960_0025395 | 3300044901 | Bacteria | 2681 |
| 691 | Ga0466960_0317440 | 3300044901 | Bacteria | 882 |
| 692 | Ga0466960_0511477 | 3300044901 | Bacteria | 704 |
| 693 | Ga0466960_0576090 | 3300044901 | Bacteria | 666 |
| 694 | Ga0466959_0628274 | 3300045049 | Bacteria | 721 |
| 695 | Ga0466967_0814156 | 3300045976 | Bacteria | 928 |
| 696 | Ga0466967_0922145 | 3300045976 | Bacteria | 869 |
| 697 | Ga0495627_150236 | 3300046453 | Bacteria | 650 |
| 698 | Ga0495592_0046201 | 3300046454 | Bacteria | 3246 |
| 699 | Ga0495592_0260565 | 3300046454 | Bacteria | 1142 |
| 700 | Ga0495590_0220384 | 3300046457 | Bacteria | 701 |
| 701 | Ga0495629_0026890 | 3300046459 | Bacteria | 4086 |
| 702 | Ga0495638_0016460 | 3300046460 | Bacteria | 4953 |
| 703 | Ga0495638_0046065 | 3300046460 | Bacteria | 2741 |
| 704 | Ga0495638_0114859 | 3300046460 | Bacteria | 1596 |
| 705 | Ga0495641_0539109 | 3300046461 | Bacteria | 533 |
| 706 | Ga0495651_0552564 | 3300046462 | Bacteria | 731 |
| 707 | Ga0495653_0078871 | 3300046463 | Bacteria | 2441 |
| 708 | Ga0495653_0567504 | 3300046463 | Bacteria | 701 |
| 709 | Ga0495650_0104198 | 3300046471 | Bacteria | 1061 |
| 710 | Ga0495650_0219604 | 3300046471 | Bacteria | 655 |
| 711 | Ga0495662_0031142 | 3300046476 | Bacteria | 2576 |
| 712 | Ga0495664_0308462 | 3300046477 | Bacteria | 955 |
| 713 | Ga0495596_0111419 | 3300046500 | Bacteria | 1063 |
| 714 | Ga0495607_0400987 | 3300046501 | Bacteria | 624 |
| 715 | Ga0495606_0010031 | 3300046507 | Bacteria | 7916 |
| 716 | Ga0495606_0088887 | 3300046507 | Bacteria | 1904 |
| 717 | Ga0495606_0203377 | 3300046507 | Bacteria | 1127 |
| 718 | Ga0495610_0006212 | 3300046512 | Bacteria | 8290 |
| 719 | Ga0495610_0063217 | 3300046512 | Bacteria | 1754 |
| 720 | Ga0495610_0141051 | 3300046512 | Bacteria | 1037 |
| 721 | Ga0495610_0214715 | 3300046512 | Bacteria | 780 |
| 722 | Ga0495610_0240221 | 3300046512 | Bacteria | 722 |
| 723 | Ga0495616_0283838 | 3300046513 | Bacteria | 703 |
| 724 | Ga0495620_0150916 | 3300046515 | Bacteria | 906 |
| 725 | Ga0495620_0263773 | 3300046515 | Bacteria | 656 |
| 726 | Ga0495632_0218774 | 3300046519 | Bacteria | 862 |
| 727 | Ga0495643_0027457 | 3300046522 | Bacteria | 3198 |
| 728 | Ga0495643_0037538 | 3300046522 | Bacteria | 2656 |
| 729 | Ga0495643_0044122 | 3300046522 | Bacteria | 2424 |
| 730 | Ga0495643_0226322 | 3300046522 | Bacteria | 884 |
| 731 | Ga0495644_0220612 | 3300046523 | Bacteria | 733 |
| 732 | Ga0495648_0378833 | 3300046524 | Bacteria | 638 |
| 733 | Ga0495648_0407376 | 3300046524 | Bacteria | 606 |
| 734 | Ga0495652_0525183 | 3300046529 | Bacteria | 817 |
| 735 | Ga0495587_0678349 | 3300046536 | Bacteria | 565 |
| 736 | Ga0495621_0219587 | 3300046539 | Bacteria | 769 |
| 737 | Ga0495597_0349024 | 3300046542 | Bacteria | 568 |
| 738 | Ga0495645_0142971 | 3300046543 | Bacteria | 1668 |
| 739 | Ga0495645_0838178 | 3300046543 | Bacteria | 549 |
| 740 | Ga0495622_0106271 | 3300046557 | Bacteria | 1286 |
| 741 | Ga0495656_0586067 | 3300046615 | Bacteria | 596 |
| 742 | Ga0495668_0066336 | 3300046616 | Bacteria | 1986 |
| 743 | Ga0495668_0140952 | 3300046616 | Bacteria | 1319 |
| 744 | Ga0495668_0471569 | 3300046616 | Bacteria | 691 |
| 745 | Ga0495668_0634570 | 3300046616 | Bacteria | 590 |
| 746 | Ga0495634_0533571 | 3300046642 | Bacteria | 685 |
| 747 | Ga0495625_0088160 | 3300046660 | Bacteria | 2150 |
| 748 | Ga0495625_0133822 | 3300046660 | Bacteria | 1677 |
| 749 | Ga0495625_0244218 | 3300046660 | Bacteria | 1168 |
| 750 | Ga0495625_0377402 | 3300046660 | Bacteria | 890 |
| 751 | Ga0495625_0529141 | 3300046660 | Bacteria | 717 |
| 752 | Ga0495625_0554266 | 3300046660 | Bacteria | 696 |
| 753 | Ga0495635_1037604 | 3300046663 | Bacteria | 521 |
| 754 | Ga0495588_0048206 | 3300046674 | Bacteria | 2188 |
| 755 | Ga0495657_0072858 | 3300046675 | Bacteria | 2239 |
| 756 | Ga0495623_0257965 | 3300046679 | Bacteria | 978 |
| 757 | Ga0495658_0120709 | 3300046683 | Bacteria | 1585 |
| 758 | Ga0495613_0686622 | 3300046689 | Bacteria | 675 |
| 759 | Ga0495624_0185559 | 3300046690 | Bacteria | 1266 |
| 760 | Ga0495649_0438076 | 3300046694 | Bacteria | 654 |
| 761 | Ga0495589_0108077 | 3300046794 | Bacteria | 1344 |
| 762 | Ga0495600_0123827 | 3300046809 | Bacteria | 1681 |
| 763 | Ga0495660_0032319 | 3300046810 | Bacteria | 2939 |
| 764 | Ga0495660_0361697 | 3300046810 | Bacteria | 643 |
| 765 | Ga0495604_0028877 | 3300047317 | Bacteria | 4413 |
| 766 | Ga0495604_0422102 | 3300047317 | Bacteria | 875 |
| 767 | Ga0495674_1327161 | 3300047319 | Bacteria | 539 |
| 768 | Ga0495680_0418083 | 3300047322 | Bacteria | 923 |
| 769 | Ga0495687_063971 | 3300047443 | Bacteria | 1504 |
| 770 | Ga0495687_095090 | 3300047443 | Bacteria | 1131 |
| 771 | Ga0495673_0214526 | 3300047469 | Bacteria | 715 |
| 772 | Ga0495681_0080705 | 3300047470 | Bacteria | 1453 |
| 773 | Ga0495686_0002844 | 3300047472 | Bacteria | 15625 |
| 774 | Ga0495686_0011672 | 3300047472 | Bacteria | 6185 |
| 775 | Ga0495686_0028624 | 3300047472 | Bacteria | 3628 |
| 776 | Ga0495686_0317298 | 3300047472 | Bacteria | 855 |
| 777 | Ga0495686_0510555 | 3300047472 | Bacteria | 632 |
| 778 | Ga0495602_0660150 | 3300048088 | Bacteria | 713 |
| 779 | Ga0495602_0902761 | 3300048088 | Bacteria | 588 |
| 780 | Ga0495626_0025458 | 3300048091 | Bacteria | 2894 |
| 781 | Ga0496100_0016492 | 3300048903 | Bacteria | 4339 |
| 782 | Ga0496100_0767447 | 3300048903 | Bacteria | 755 |
| 783 | Ga0496101_0291059 | 3300048904 | Bacteria | 1278 |
| 784 | Ga0496101_0383035 | 3300048904 | Bacteria | 1106 |
| 785 | Ga0496101_0405490 | 3300048904 | Bacteria | 1074 |
| 786 | Ga0496101_0421716 | 3300048904 | Bacteria | 1052 |
| 787 | Ga0496101_0680711 | 3300048904 | Bacteria | 812 |
| 788 | Ga0496102_0199108 | 3300048905 | Bacteria | 1888 |
| 789 | Ga0496102_0505898 | 3300048905 | Bacteria | 1130 |
| 790 | Ga0496102_0866232 | 3300048905 | Bacteria | 825 |
| 791 | Ga0496102_0909821 | 3300048905 | Bacteria | 801 |
| 792 | Ga0496102_1039957 | 3300048905 | Bacteria | 739 |
| 793 | Ga0496103_0043920 | 3300048906 | Bacteria | 2752 |
| 794 | Ga0496104_0094490 | 3300048907 | Bacteria | 2860 |
| 795 | Ga0496104_0546919 | 3300048907 | Bacteria | 1069 |
| 796 | Ga0496104_0697772 | 3300048907 | Bacteria | 923 |
| 797 | Ga0496104_1747712 | 3300048907 | Bacteria | 524 |
| 798 | Ga0496105_0550856 | 3300048908 | Bacteria | 900 |
| 799 | Ga0496105_0581033 | 3300048908 | Bacteria | 872 |
| 800 | Ga0496105_0804237 | 3300048908 | Bacteria | 714 |
| 801 | Ga0496105_0977184 | 3300048908 | Bacteria | 634 |
| 802 | Ga0496106_0016430 | 3300048909 | Bacteria | 5476 |
| 803 | Ga0496106_0224296 | 3300048909 | Bacteria | 1499 |
| 804 | Ga0496106_1182545 | 3300048909 | Bacteria | 597 |
| 805 | Ga0496107_0075565 | 3300048910 | Bacteria | 2452 |
| 806 | Ga0496108_0096285 | 3300048911 | Bacteria | 2521 |
| 807 | Ga0496108_0122367 | 3300048911 | Bacteria | 2232 |
| 808 | Ga0496109_0023524 | 3300048912 | Bacteria | 5470 |
| 809 | Ga0496109_0126970 | 3300048912 | Bacteria | 2378 |
| 810 | Ga0496109_1903835 | 3300048912 | Bacteria | 527 |
| 811 | Ga0496110_0056926 | 3300048913 | Bacteria | 3440 |
| 812 | Ga0496110_0179413 | 3300048913 | Bacteria | 1923 |
| 813 | Ga0496110_0986462 | 3300048913 | Bacteria | 750 |
| 814 | Ga0496110_1096251 | 3300048913 | Bacteria | 704 |
| 815 | Ga0496111_0127301 | 3300048914 | Bacteria | 1883 |
| 816 | Ga0496111_0274367 | 3300048914 | Bacteria | 1251 |
| 817 | Ga0496112_0052437 | 3300048915 | Bacteria | 4003 |
| 818 | Ga0496112_0057193 | 3300048915 | Bacteria | 3839 |
| 819 | Ga0496112_0142644 | 3300048915 | Bacteria | 2364 |
| 820 | Ga0496112_0675681 | 3300048915 | Bacteria | 961 |
| 821 | Ga0496112_1101560 | 3300048915 | Bacteria | 712 |
| 822 | Ga0496112_1230459 | 3300048915 | Bacteria | 665 |
| 823 | Ga0496113_0451804 | 3300048916 | Bacteria | 1032 |
| 824 | Ga0496113_0683664 | 3300048916 | Bacteria | 820 |
| 825 | Ga0496114_0076482 | 3300048917 | Bacteria | 2820 |
| 826 | Ga0496114_0130392 | 3300048917 | Bacteria | 2170 |
| 827 | Ga0496114_0422455 | 3300048917 | Bacteria | 1181 |
| 828 | Ga0496114_0551466 | 3300048917 | Bacteria | 1018 |
| 829 | Ga0496115_0169071 | 3300048918 | Bacteria | 1808 |
| 830 | Ga0496115_0188617 | 3300048918 | Bacteria | 1703 |
| 831 | Ga0496115_0782721 | 3300048918 | Bacteria | 744 |
| 832 | Ga0496116_0036873 | 3300048919 | Bacteria | 3416 |
| 833 | Ga0496116_0061983 | 3300048919 | Bacteria | 2417 |
| 834 | Ga0496116_0067211 | 3300048919 | Bacteria | 2290 |
| 835 | Ga0496116_0224656 | 3300048919 | Bacteria | 958 |
| 836 | Ga0496117_0006751 | 3300048920 | Bacteria | 11463 |
| 837 | Ga0496117_0014861 | 3300048920 | Bacteria | 6680 |
| 838 | Ga0496117_0076186 | 3300048920 | Bacteria | 2225 |
| 839 | Ga0496117_0080253 | 3300048920 | Bacteria | 2146 |
| 840 | Ga0496117_0084069 | 3300048920 | Bacteria | 2078 |
| 841 | Ga0496117_0466083 | 3300048920 | Bacteria | 621 |
| 842 | Ga0496117_0500428 | 3300048920 | Bacteria | 589 |
| 843 | Ga0496118_0003715 | 3300048921 | Bacteria | 18909 |
| 844 | Ga0496118_0010030 | 3300048921 | Bacteria | 9443 |
| 845 | Ga0496118_0082361 | 3300048921 | Bacteria | 2255 |
| 846 | Ga0496118_0197134 | 3300048921 | Bacteria | 1197 |
| 847 | Ga0496118_0197932 | 3300048921 | Bacteria | 1194 |
| 848 | Ga0496119_0009045 | 3300048922 | Bacteria | 8634 |
| 849 | Ga0496119_0036191 | 3300048922 | Bacteria | 3225 |
| 850 | Ga0496119_0039161 | 3300048922 | Bacteria | 3049 |
| 851 | Ga0496119_0042057 | 3300048922 | Bacteria | 2901 |
| 852 | Ga0496119_0431032 | 3300048922 | Bacteria | 624 |
| 853 | Ga0496120_0026604 | 3300048923 | Bacteria | 3570 |
| 854 | Ga0496120_0062583 | 3300048923 | Bacteria | 2073 |
| 855 | Ga0496120_0097153 | 3300048923 | Bacteria | 1563 |
| 856 | Ga0496120_0117110 | 3300048923 | Bacteria | 1383 |
| 857 | Ga0496120_0426736 | 3300048923 | Bacteria | 581 |
| 858 | Ga0496121_0018097 | 3300048924 | Bacteria | 7128 |
| 859 | Ga0496121_0045342 | 3300048924 | Bacteria | 3779 |
| 860 | Ga0496121_0065852 | 3300048924 | Bacteria | 2945 |
| 861 | Ga0496121_0074664 | 3300048924 | Bacteria | 2711 |
| 862 | Ga0496121_0146696 | 3300048924 | Bacteria | 1742 |
| 863 | Ga0496121_0265597 | 3300048924 | Bacteria | 1182 |
| 864 | Ga0496122_0001107 | 3300048925 | Bacteria | 46550 |
| 865 | Ga0496122_0016172 | 3300048925 | Bacteria | 7085 |
| 866 | Ga0496122_0031570 | 3300048925 | Bacteria | 4405 |
| 867 | Ga0496122_0034124 | 3300048925 | Bacteria | 4171 |
| 868 | Ga0496122_0048526 | 3300048925 | Bacteria | 3262 |
| 869 | Ga0496122_0248610 | 3300048925 | Bacteria | 996 |
| 870 | Ga0496122_0320076 | 3300048925 | Bacteria | 825 |
| 871 | Ga0496122_0579549 | 3300048925 | Bacteria | 529 |
| 872 | Ga0496123_0000562 | 3300048926 | Bacteria | 63590 |
| 873 | Ga0496123_0052247 | 3300048926 | Bacteria | 2714 |
| 874 | Ga0496123_0097553 | 3300048926 | Bacteria | 1721 |
| 875 | Ga0496123_0124906 | 3300048926 | Bacteria | 1438 |
| 876 | Ga0496123_0140471 | 3300048926 | Bacteria | 1321 |
| 877 | Ga0496123_0289706 | 3300048926 | Bacteria | 787 |
| 878 | Ga0496124_0045730 | 3300048927 | Bacteria | 3752 |
| 879 | Ga0496124_0054556 | 3300048927 | Bacteria | 3382 |
| 880 | Ga0496124_0064786 | 3300048927 | Bacteria | 3050 |
| 881 | Ga0496124_0076226 | 3300048927 | Bacteria | 2769 |
| 882 | Ga0496124_0282531 | 3300048927 | Bacteria | 1209 |
| 883 | Ga0496124_0377166 | 3300048927 | Bacteria | 993 |
| 884 | Ga0496124_0443073 | 3300048927 | Bacteria | 888 |
| 885 | Ga0496124_0483676 | 3300048927 | Bacteria | 835 |
| 886 | Ga0496124_0491336 | 3300048927 | Bacteria | 826 |
| 887 | Ga0496124_0677215 | 3300048927 | Bacteria | 657 |
| 888 | Ga0496125_0001370 | 3300048928 | Bacteria | 35861 |
| 889 | Ga0496125_0083675 | 3300048928 | Bacteria | 2426 |
| 890 | Ga0496125_0121749 | 3300048928 | Bacteria | 1859 |
| 891 | Ga0496125_0184448 | 3300048928 | Bacteria | 1385 |
| 892 | Ga0496125_0391440 | 3300048928 | Bacteria | 815 |
| 893 | Ga0496125_0405944 | 3300048928 | Bacteria | 795 |
| 894 | Ga0496125_0413004 | 3300048928 | Bacteria | 785 |
| 895 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 896 | Ga0496126_0003015 | 3300048929 | Bacteria | 21841 |
| 897 | Ga0496126_0103078 | 3300048929 | Bacteria | 2494 |
| 898 | Ga0496126_0167746 | 3300048929 | Bacteria | 1872 |
| 899 | Ga0496126_0192559 | 3300048929 | Bacteria | 1726 |
| 900 | Ga0496126_0906626 | 3300048929 | Bacteria | 668 |
| 901 | Ga0495678_267563 | 3300049459 | Bacteria | 503 |
| 902 | Ga0501291_152841 | 3300049514 | Bacteria | 523 |
| 903 | Ga0501299_054410 | 3300049522 | Bacteria | 834 |
| 904 | Ga0501031_0000014 | 3300049568 | Bacteria | 127199 |
| 905 | Ga0501031_0001971 | 3300049568 | Bacteria | 12963 |
| 906 | Ga0501031_0105814 | 3300049568 | Bacteria | 1836 |
| 907 | Ga0501031_0376889 | 3300049568 | Bacteria | 918 |
| 908 | Ga0501031_0824410 | 3300049568 | Bacteria | 594 |
| 909 | Ga0501031_0861417 | 3300049568 | Bacteria | 580 |
| 910 | Ga0501032_0000015 | 3300049569 | Bacteria | 176755 |
| 911 | Ga0501032_0000025 | 3300049569 | Bacteria | 138521 |
| 912 | Ga0501032_0003745 | 3300049569 | Bacteria | 11530 |
| 913 | Ga0501032_0024369 | 3300049569 | Bacteria | 4179 |
| 914 | Ga0501032_0081191 | 3300049569 | Bacteria | 2157 |
| 915 | Ga0501032_0088775 | 3300049569 | Bacteria | 2052 |
| 916 | Ga0501032_0137807 | 3300049569 | Bacteria | 1608 |
| 917 | Ga0501032_0396759 | 3300049569 | Bacteria | 886 |
| 918 | Ga0501032_0414713 | 3300049569 | Bacteria | 864 |
| 919 | Ga0501032_0521889 | 3300049569 | Bacteria | 758 |
| 920 | Ga0501032_0717828 | 3300049569 | Bacteria | 633 |
| 921 | Ga0501033_0000023 | 3300049570 | Bacteria | 176725 |
| 922 | Ga0501033_0000229 | 3300049570 | Bacteria | 54036 |
| 923 | Ga0501033_0001216 | 3300049570 | Bacteria | 23119 |
| 924 | Ga0501033_0001969 | 3300049570 | Bacteria | 17888 |
| 925 | Ga0501033_0005696 | 3300049570 | Bacteria | 9821 |
| 926 | Ga0501033_0026545 | 3300049570 | Bacteria | 4359 |
| 927 | Ga0501033_0028102 | 3300049570 | Bacteria | 4227 |
| 928 | Ga0501033_0048896 | 3300049570 | Bacteria | 3140 |
| 929 | Ga0501033_0072521 | 3300049570 | Bacteria | 2528 |
| 930 | Ga0501033_0108891 | 3300049570 | Bacteria | 2018 |
| 931 | Ga0501033_0187778 | 3300049570 | Bacteria | 1480 |
| 932 | Ga0501033_0389184 | 3300049570 | Bacteria | 973 |
| 933 | Ga0501033_0408738 | 3300049570 | Bacteria | 946 |
| 934 | Ga0501033_0456493 | 3300049570 | Bacteria | 887 |
| 935 | Ga0501033_0810880 | 3300049570 | Bacteria | 632 |
| 936 | Ga0501034_0000073 | 3300049571 | Bacteria | 176737 |
| 937 | Ga0501034_0001862 | 3300049571 | Bacteria | 26764 |
| 938 | Ga0501034_0020231 | 3300049571 | Bacteria | 6796 |
| 939 | Ga0501034_0060876 | 3300049571 | Bacteria | 3792 |
| 940 | Ga0501034_0079454 | 3300049571 | Bacteria | 3283 |
| 941 | Ga0501034_0122722 | 3300049571 | Bacteria | 2584 |
| 942 | Ga0501034_0123215 | 3300049571 | Bacteria | 2578 |
| 943 | Ga0501034_0139402 | 3300049571 | Bacteria | 2405 |
| 944 | Ga0501034_0288655 | 3300049571 | Bacteria | 1579 |
| 945 | Ga0501034_0291447 | 3300049571 | Bacteria | 1570 |
| 946 | Ga0501034_0307254 | 3300049571 | Bacteria | 1521 |
| 947 | Ga0501034_0378691 | 3300049571 | Bacteria | 1340 |
| 948 | Ga0501034_0389914 | 3300049571 | Bacteria | 1317 |
| 949 | Ga0501034_0395936 | 3300049571 | Bacteria | 1304 |
| 950 | Ga0501034_0526172 | 3300049571 | Bacteria | 1094 |
| 951 | Ga0501034_0697660 | 3300049571 | Bacteria | 914 |
| 952 | Ga0501034_0698638 | 3300049571 | Bacteria | 913 |
| 953 | Ga0501034_0793131 | 3300049571 | Bacteria | 840 |
| 954 | Ga0501034_0847211 | 3300049571 | Bacteria | 804 |
| 955 | Ga0501034_1231765 | 3300049571 | Bacteria | 626 |
| 956 | Ga0501034_1600637 | 3300049571 | Bacteria | 524 |
| 957 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 958 | Ga0501036_0001402 | 3300049572 | Bacteria | 18518 |
| 959 | Ga0501036_0006176 | 3300049572 | Bacteria | 9724 |
| 960 | Ga0501036_0205069 | 3300049572 | Bacteria | 1658 |
| 961 | Ga0501036_0224443 | 3300049572 | Bacteria | 1577 |
| 962 | Ga0501036_0236010 | 3300049572 | Bacteria | 1534 |
| 963 | Ga0501036_0277095 | 3300049572 | Bacteria | 1404 |
| 964 | Ga0501036_0485729 | 3300049572 | Bacteria | 1028 |
| 965 | Ga0501036_0593031 | 3300049572 | Bacteria | 919 |
| 966 | Ga0501036_0899567 | 3300049572 | Bacteria | 726 |
| 967 | Ga0501036_1110278 | 3300049572 | Bacteria | 646 |
| 968 | Ga0501036_1172201 | 3300049572 | Bacteria | 626 |
| 969 | Ga0501037_0000048 | 3300049573 | Bacteria | 113375 |
| 970 | Ga0501037_0000176 | 3300049573 | Bacteria | 60011 |
| 971 | Ga0501037_0000828 | 3300049573 | Bacteria | 23090 |
| 972 | Ga0501037_0016939 | 3300049573 | Bacteria | 5362 |
| 973 | Ga0501037_0036439 | 3300049573 | Bacteria | 3625 |
| 974 | Ga0501037_0079088 | 3300049573 | Bacteria | 2386 |
| 975 | Ga0501037_0099630 | 3300049573 | Bacteria | 2099 |
| 976 | Ga0501037_0100166 | 3300049573 | Bacteria | 2092 |
| 977 | Ga0501037_0119331 | 3300049573 | Bacteria | 1897 |
| 978 | Ga0501037_0248906 | 3300049573 | Bacteria | 1244 |
| 979 | Ga0501037_0885778 | 3300049573 | Bacteria | 586 |
| 980 | Ga0501037_0899989 | 3300049573 | Bacteria | 580 |
| 981 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 982 | Ga0501038_0000862 | 3300049574 | Bacteria | 26891 |
| 983 | Ga0501038_0002080 | 3300049574 | Bacteria | 18546 |
| 984 | Ga0501038_0070054 | 3300049574 | Bacteria | 2978 |
| 985 | Ga0501038_0139672 | 3300049574 | Bacteria | 1983 |
| 986 | Ga0501038_0159284 | 3300049574 | Bacteria | 1836 |
| 987 | Ga0501038_0180255 | 3300049574 | Bacteria | 1705 |
| 988 | Ga0501038_0220923 | 3300049574 | Bacteria | 1512 |
| 989 | Ga0501038_0251353 | 3300049574 | Bacteria | 1400 |
| 990 | Ga0501038_0302664 | 3300049574 | Bacteria | 1254 |
| 991 | Ga0501038_0338173 | 3300049574 | Bacteria | 1174 |
| 992 | Ga0501038_0346042 | 3300049574 | Bacteria | 1158 |
| 993 | Ga0501038_0449010 | 3300049574 | Bacteria | 992 |
| 994 | Ga0501038_0468901 | 3300049574 | Bacteria | 966 |
| 995 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 996 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 997 | Ga0501039_0003603 | 3300049575 | Bacteria | 11608 |
| 998 | Ga0501039_0043673 | 3300049575 | Bacteria | 3461 |
| 999 | Ga0501039_0130512 | 3300049575 | Bacteria | 1972 |
| 1000 | Ga0501039_0160922 | 3300049575 | Bacteria | 1764 |
| 1001 | Ga0501039_0389942 | 3300049575 | Bacteria | 1094 |
| 1002 | Ga0501039_0520110 | 3300049575 | Bacteria | 934 |
| 1003 | Ga0501039_0659405 | 3300049575 | Bacteria | 819 |
| 1004 | Ga0501039_1091182 | 3300049575 | Bacteria | 619 |
| 1005 | Ga0501040_0134996 | 3300049576 | Bacteria | 1737 |
| 1006 | Ga0501040_0271230 | 3300049576 | Bacteria | 1211 |
| 1007 | Ga0501041_0171474 | 3300049577 | Bacteria | 1358 |
| 1008 | Ga0501041_0371871 | 3300049577 | Bacteria | 904 |
| 1009 | Ga0501041_0402797 | 3300049577 | Bacteria | 867 |
| 1010 | Ga0501042_0022915 | 3300049578 | Bacteria | 4363 |
| 1011 | Ga0501042_0796869 | 3300049578 | Bacteria | 687 |
| 1012 | Ga0501042_0848560 | 3300049578 | Bacteria | 665 |
| 1013 | Ga0501043_0000051 | 3300049579 | Bacteria | 106957 |
| 1014 | Ga0501043_0000114 | 3300049579 | Bacteria | 75782 |
| 1015 | Ga0501043_0000298 | 3300049579 | Bacteria | 44905 |
| 1016 | Ga0501043_0097713 | 3300049579 | Bacteria | 2308 |
| 1017 | Ga0501043_0123911 | 3300049579 | Bacteria | 2026 |
| 1018 | Ga0501043_0193524 | 3300049579 | Bacteria | 1581 |
| 1019 | Ga0501043_0331146 | 3300049579 | Bacteria | 1159 |
| 1020 | Ga0501043_0348760 | 3300049579 | Bacteria | 1125 |
| 1021 | Ga0501043_0578768 | 3300049579 | Bacteria | 831 |
| 1022 | Ga0501043_0592499 | 3300049579 | Bacteria | 820 |
| 1023 | Ga0501043_0684458 | 3300049579 | Bacteria | 750 |
| 1024 | Ga0501043_0689456 | 3300049579 | Bacteria | 747 |
| 1025 | Ga0501043_0806801 | 3300049579 | Bacteria | 678 |
| 1026 | Ga0501046_0002813 | 3300049580 | Bacteria | 16205 |
| 1027 | Ga0501046_0210740 | 3300049580 | Bacteria | 1443 |
| 1028 | Ga0501046_0222356 | 3300049580 | Bacteria | 1397 |
| 1029 | Ga0501046_0435005 | 3300049580 | Bacteria | 944 |
| 1030 | Ga0501046_0612252 | 3300049580 | Bacteria | 772 |
| 1031 | Ga0501046_0743585 | 3300049580 | Bacteria | 689 |
| 1032 | Ga0501046_1202505 | 3300049580 | Bacteria | 521 |
| 1033 | Ga0501047_0000801 | 3300049581 | Bacteria | 32872 |
| 1034 | Ga0501047_0003631 | 3300049581 | Bacteria | 14539 |
| 1035 | Ga0501047_0007205 | 3300049581 | Bacteria | 10455 |
| 1036 | Ga0501047_0024244 | 3300049581 | Bacteria | 5824 |
| 1037 | Ga0501047_0037480 | 3300049581 | Bacteria | 4688 |
| 1038 | Ga0501047_0056953 | 3300049581 | Bacteria | 3780 |
| 1039 | Ga0501047_0066964 | 3300049581 | Bacteria | 3461 |
| 1040 | Ga0501047_0126975 | 3300049581 | Bacteria | 2431 |
| 1041 | Ga0501047_0135061 | 3300049581 | Bacteria | 2347 |
| 1042 | Ga0501047_0160390 | 3300049581 | Bacteria | 2120 |
| 1043 | Ga0501047_0296359 | 3300049581 | Bacteria | 1460 |
| 1044 | Ga0501047_0314922 | 3300049581 | Bacteria | 1405 |
| 1045 | Ga0501047_0317553 | 3300049581 | Bacteria | 1398 |
| 1046 | Ga0501047_0397273 | 3300049581 | Bacteria | 1212 |
| 1047 | Ga0501047_0538013 | 3300049581 | Bacteria | 993 |
| 1048 | Ga0501047_0640339 | 3300049581 | Bacteria | 883 |
| 1049 | Ga0501047_0713277 | 3300049581 | Bacteria | 820 |
| 1050 | Ga0501047_0765362 | 3300049581 | Bacteria | 781 |
| 1051 | Ga0501047_0821544 | 3300049581 | Bacteria | 744 |
| 1052 | Ga0501047_0870283 | 3300049581 | Bacteria | 715 |
| 1053 | Ga0501047_0957566 | 3300049581 | Bacteria | 669 |
| 1054 | Ga0501047_1159146 | 3300049581 | Bacteria | 586 |
| 1055 | Ga0501047_1261978 | 3300049581 | Bacteria | 553 |
| 1056 | Ga0501047_1330168 | 3300049581 | Bacteria | 533 |
| 1057 | Ga0501048_0005516 | 3300049582 | Bacteria | 9627 |
| 1058 | Ga0501048_0020520 | 3300049582 | Bacteria | 4842 |
| 1059 | Ga0501048_0637783 | 3300049582 | Bacteria | 765 |
| 1060 | Ga0501048_0754454 | 3300049582 | Bacteria | 699 |
| 1061 | Ga0501067_0002093 | 3300049583 | Bacteria | 10999 |
| 1062 | Ga0501067_0025416 | 3300049583 | Bacteria | 3282 |
| 1063 | Ga0501067_0085497 | 3300049583 | Bacteria | 1750 |
| 1064 | Ga0501067_0148337 | 3300049583 | Bacteria | 1307 |
| 1065 | Ga0501067_0277425 | 3300049583 | Bacteria | 933 |
| 1066 | Ga0501068_0021421 | 3300049584 | Bacteria | 3774 |
| 1067 | Ga0501068_0050259 | 3300049584 | Bacteria | 2520 |
| 1068 | Ga0501068_0178750 | 3300049584 | Bacteria | 1341 |
| 1069 | Ga0501068_0622087 | 3300049584 | Bacteria | 704 |
| 1070 | Ga0501068_1194656 | 3300049584 | Bacteria | 504 |
| 1071 | Ga0501069_0000016 | 3300049585 | Bacteria | 142565 |
| 1072 | Ga0501069_0003777 | 3300049585 | Bacteria | 7790 |
| 1073 | Ga0501069_0004450 | 3300049585 | Bacteria | 7237 |
| 1074 | Ga0501069_0035566 | 3300049585 | Bacteria | 2745 |
| 1075 | Ga0501069_0046007 | 3300049585 | Bacteria | 2419 |
| 1076 | Ga0501069_0053290 | 3300049585 | Bacteria | 2253 |
| 1077 | Ga0501069_0192208 | 3300049585 | Bacteria | 1181 |
| 1078 | Ga0501069_0405145 | 3300049585 | Bacteria | 807 |
| 1079 | Ga0501070_0000186 | 3300049586 | Bacteria | 58369 |
| 1080 | Ga0501070_0000931 | 3300049586 | Bacteria | 26365 |
| 1081 | Ga0501070_0006076 | 3300049586 | Bacteria | 10289 |
| 1082 | Ga0501070_0006421 | 3300049586 | Bacteria | 10006 |
| 1083 | Ga0501070_0011400 | 3300049586 | Bacteria | 7513 |
| 1084 | Ga0501070_0025050 | 3300049586 | Bacteria | 5003 |
| 1085 | Ga0501070_0107402 | 3300049586 | Bacteria | 2306 |
| 1086 | Ga0501070_0126598 | 3300049586 | Bacteria | 2111 |
| 1087 | Ga0501070_0246047 | 3300049586 | Bacteria | 1463 |
| 1088 | Ga0501070_0255729 | 3300049586 | Bacteria | 1432 |
| 1089 | Ga0501070_0289420 | 3300049586 | Bacteria | 1335 |
| 1090 | Ga0501070_0474697 | 3300049586 | Bacteria | 1007 |
| 1091 | Ga0501070_0531996 | 3300049586 | Bacteria | 942 |
| 1092 | Ga0501070_0594590 | 3300049586 | Bacteria | 882 |
| 1093 | Ga0501070_0621858 | 3300049586 | Bacteria | 860 |
| 1094 | Ga0501070_0636116 | 3300049586 | Bacteria | 848 |
| 1095 | Ga0501070_0690710 | 3300049586 | Bacteria | 808 |
| 1096 | Ga0501070_0701238 | 3300049586 | Bacteria | 800 |
| 1097 | Ga0501070_0927086 | 3300049586 | Bacteria | 678 |
| 1098 | Ga0501071_0004977 | 3300049587 | Bacteria | 8488 |
| 1099 | Ga0501071_0013894 | 3300049587 | Bacteria | 5498 |
| 1100 | Ga0501071_0099158 | 3300049587 | Bacteria | 2147 |
| 1101 | Ga0501071_0236158 | 3300049587 | Bacteria | 1378 |
| 1102 | Ga0501071_0556507 | 3300049587 | Bacteria | 881 |
| 1103 | Ga0501071_0866794 | 3300049587 | Bacteria | 696 |
| 1104 | Ga0501071_1111468 | 3300049587 | Bacteria | 611 |
| 1105 | Ga0501072_0381774 | 3300049588 | Bacteria | 1118 |
| 1106 | Ga0501072_0473067 | 3300049588 | Bacteria | 992 |
| 1107 | Ga0501072_0824625 | 3300049588 | Bacteria | 726 |
| 1108 | Ga0501072_0982712 | 3300049588 | Bacteria | 658 |
| 1109 | Ga0501073_0001927 | 3300049589 | Bacteria | 15444 |
| 1110 | Ga0501073_0031080 | 3300049589 | Bacteria | 3811 |
| 1111 | Ga0501073_0069860 | 3300049589 | Bacteria | 2447 |
| 1112 | Ga0501073_0092940 | 3300049589 | Bacteria | 2096 |
| 1113 | Ga0501073_0097234 | 3300049589 | Bacteria | 2045 |
| 1114 | Ga0501073_0130012 | 3300049589 | Bacteria | 1745 |
| 1115 | Ga0501073_0141309 | 3300049589 | Bacteria | 1668 |
| 1116 | Ga0501073_0156523 | 3300049589 | Bacteria | 1579 |
| 1117 | Ga0501073_0169919 | 3300049589 | Bacteria | 1509 |
| 1118 | Ga0501073_0185341 | 3300049589 | Bacteria | 1440 |
| 1119 | Ga0501073_0407456 | 3300049589 | Bacteria | 939 |
| 1120 | Ga0501073_0410190 | 3300049589 | Bacteria | 936 |
| 1121 | Ga0501073_0599732 | 3300049589 | Bacteria | 761 |
| 1122 | Ga0501073_1164911 | 3300049589 | Bacteria | 529 |
| 1123 | Ga0501074_0000831 | 3300049590 | Bacteria | 19586 |
| 1124 | Ga0501074_0001818 | 3300049590 | Bacteria | 14602 |
| 1125 | Ga0501074_0047325 | 3300049590 | Bacteria | 3110 |
| 1126 | Ga0501074_0073258 | 3300049590 | Bacteria | 2461 |
| 1127 | Ga0501074_0099182 | 3300049590 | Bacteria | 2085 |
| 1128 | Ga0501074_0124714 | 3300049590 | Bacteria | 1842 |
| 1129 | Ga0501074_0371372 | 3300049590 | Bacteria | 1015 |
| 1130 | Ga0501074_0462062 | 3300049590 | Bacteria | 900 |
| 1131 | Ga0501074_0464656 | 3300049590 | Bacteria | 897 |
| 1132 | Ga0501074_0846314 | 3300049590 | Bacteria | 644 |
| 1133 | Ga0501074_0875036 | 3300049590 | Bacteria | 632 |
| 1134 | Ga0501074_1042126 | 3300049590 | Bacteria | 575 |
| 1135 | Ga0501074_1045860 | 3300049590 | Bacteria | 574 |
| 1136 | Ga0501074_1294738 | 3300049590 | Bacteria | 511 |
| 1137 | Ga0501075_0092368 | 3300049591 | Bacteria | 2297 |
| 1138 | Ga0501075_0561574 | 3300049591 | Bacteria | 871 |
| 1139 | Ga0501076_0096701 | 3300049592 | Bacteria | 2379 |
| 1140 | Ga0501076_0145684 | 3300049592 | Bacteria | 1926 |
| 1141 | Ga0501076_0357653 | 3300049592 | Bacteria | 1199 |
| 1142 | Ga0501076_0442465 | 3300049592 | Bacteria | 1070 |
| 1143 | Ga0501076_0692037 | 3300049592 | Bacteria | 842 |
| 1144 | Ga0501076_1281469 | 3300049592 | Bacteria | 603 |
| 1145 | Ga0501077_0072866 | 3300049593 | Bacteria | 2176 |
| 1146 | Ga0501077_0153358 | 3300049593 | Bacteria | 1462 |
| 1147 | Ga0501077_0220110 | 3300049593 | Bacteria | 1206 |
| 1148 | Ga0501077_0266593 | 3300049593 | Bacteria | 1089 |
| 1149 | Ga0501077_0409219 | 3300049593 | Bacteria | 867 |
| 1150 | Ga0501223_094886 | 3300049663 | Bacteria | 609 |
| 1151 | Ga0501238_011525 | 3300049671 | Bacteria | 1188 |
| 1152 | Ga0501079_0010606 | 3300049741 | Bacteria | 7011 |
| 1153 | Ga0501079_0085851 | 3300049741 | Bacteria | 2436 |
| 1154 | Ga0501079_0095573 | 3300049741 | Bacteria | 2303 |
| 1155 | Ga0501079_0409423 | 3300049741 | Bacteria | 1064 |
| 1156 | Ga0501079_0877373 | 3300049741 | Bacteria | 706 |
| 1157 | Ga0501079_1328203 | 3300049741 | Bacteria | 566 |
| 1158 | Ga0501080_0001450 | 3300049742 | Bacteria | 19946 |
| 1159 | Ga0501080_0004427 | 3300049742 | Bacteria | 12498 |
| 1160 | Ga0501080_0005392 | 3300049742 | Bacteria | 11401 |
| 1161 | Ga0501080_0011492 | 3300049742 | Bacteria | 8106 |
| 1162 | Ga0501080_0027959 | 3300049742 | Bacteria | 5244 |
| 1163 | Ga0501080_0033685 | 3300049742 | Bacteria | 4782 |
| 1164 | Ga0501080_0106323 | 3300049742 | Bacteria | 2601 |
| 1165 | Ga0501080_0149501 | 3300049742 | Bacteria | 2159 |
| 1166 | Ga0501080_0369916 | 3300049742 | Bacteria | 1292 |
| 1167 | Ga0501080_0655661 | 3300049742 | Bacteria | 928 |
| 1168 | Ga0501080_0737411 | 3300049742 | Bacteria | 867 |
| 1169 | Ga0501080_0805636 | 3300049742 | Bacteria | 823 |
| 1170 | Ga0501081_0750904 | 3300049743 | Bacteria | 733 |
| 1171 | Ga0501081_0906220 | 3300049743 | Bacteria | 665 |
| 1172 | Ga0501083_0000111 | 3300049744 | Bacteria | 55529 |
| 1173 | Ga0501083_0001724 | 3300049744 | Bacteria | 14896 |
| 1174 | Ga0501083_0003402 | 3300049744 | Bacteria | 11133 |
| 1175 | Ga0501083_0061019 | 3300049744 | Bacteria | 2518 |
| 1176 | Ga0501083_0150491 | 3300049744 | Bacteria | 1524 |
| 1177 | Ga0501083_0267327 | 3300049744 | Bacteria | 1112 |
| 1178 | Ga0501083_0267625 | 3300049744 | Bacteria | 1112 |
| 1179 | Ga0501083_0287392 | 3300049744 | Bacteria | 1069 |
| 1180 | Ga0501083_0615441 | 3300049744 | Bacteria | 706 |
| 1181 | Ga0501083_0679520 | 3300049744 | Bacteria | 670 |
| 1182 | Ga0501083_0701017 | 3300049744 | Bacteria | 658 |
| 1183 | Ga0501083_0910504 | 3300049744 | Bacteria | 572 |
| 1184 | Ga0501083_0929007 | 3300049744 | Bacteria | 566 |
| 1185 | Ga0501083_1041056 | 3300049744 | Bacteria | 533 |
| 1186 | Ga0501280_001370 | 3300049776 | Bacteria | 4580 |
| 1187 | Ga0501035_0000022 | 3300049822 | Bacteria | 208622 |
| 1188 | Ga0501035_0000102 | 3300049822 | Bacteria | 106915 |
| 1189 | Ga0501035_0000690 | 3300049822 | Bacteria | 36838 |
| 1190 | Ga0501035_0000752 | 3300049822 | Bacteria | 34903 |
| 1191 | Ga0501035_0001093 | 3300049822 | Bacteria | 28434 |
| 1192 | Ga0501035_0001914 | 3300049822 | Bacteria | 20905 |
| 1193 | Ga0501035_0012136 | 3300049822 | Bacteria | 7968 |
| 1194 | Ga0501035_0029146 | 3300049822 | Bacteria | 5033 |
| 1195 | Ga0501035_0098972 | 3300049822 | Bacteria | 2560 |
| 1196 | Ga0501035_0108729 | 3300049822 | Bacteria | 2431 |
| 1197 | Ga0501035_0109655 | 3300049822 | Bacteria | 2419 |
| 1198 | Ga0501035_0117013 | 3300049822 | Bacteria | 2332 |
| 1199 | Ga0501035_0158230 | 3300049822 | Bacteria | 1962 |
| 1200 | Ga0501035_0174693 | 3300049822 | Bacteria | 1854 |
| 1201 | Ga0501035_0183865 | 3300049822 | Bacteria | 1800 |
| 1202 | Ga0501035_0420319 | 3300049822 | Bacteria | 1110 |
| 1203 | Ga0501035_0565260 | 3300049822 | Bacteria | 930 |
| 1204 | Ga0501035_0664206 | 3300049822 | Bacteria | 844 |
| 1205 | Ga0501035_0915627 | 3300049822 | Bacteria | 694 |
| 1206 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 1207 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 1208 | Ga0501044_0000255 | 3300049823 | Bacteria | 67530 |
| 1209 | Ga0501044_0002922 | 3300049823 | Bacteria | 19435 |
| 1210 | Ga0501044_0016909 | 3300049823 | Bacteria | 7824 |
| 1211 | Ga0501044_0021665 | 3300049823 | Bacteria | 6852 |
| 1212 | Ga0501044_0022140 | 3300049823 | Bacteria | 6776 |
| 1213 | Ga0501044_0049355 | 3300049823 | Bacteria | 4345 |
| 1214 | Ga0501044_0070221 | 3300049823 | Bacteria | 3563 |
| 1215 | Ga0501044_0082154 | 3300049823 | Bacteria | 3261 |
| 1216 | Ga0501044_0089157 | 3300049823 | Bacteria | 3113 |
| 1217 | Ga0501044_0098827 | 3300049823 | Bacteria | 2938 |
| 1218 | Ga0501044_0131509 | 3300049823 | Bacteria | 2496 |
| 1219 | Ga0501044_0156921 | 3300049823 | Bacteria | 2254 |
| 1220 | Ga0501044_0164118 | 3300049823 | Bacteria | 2196 |
| 1221 | Ga0501044_0296069 | 3300049823 | Bacteria | 1548 |
| 1222 | Ga0501044_0500508 | 3300049823 | Bacteria | 1116 |
| 1223 | Ga0501044_0640775 | 3300049823 | Bacteria | 952 |
| 1224 | Ga0501044_0890514 | 3300049823 | Bacteria | 765 |
| 1225 | Ga0501044_1144578 | 3300049823 | Bacteria | 647 |
| 1226 | Ga0501044_1435774 | 3300049823 | Bacteria | 555 |
| 1227 | Ga0501045_0005999 | 3300049824 | Bacteria | 8407 |
| 1228 | Ga0501045_0048465 | 3300049824 | Bacteria | 3097 |
| 1229 | Ga0501045_0270327 | 3300049824 | Bacteria | 1265 |
| 1230 | Ga0501045_0448015 | 3300049824 | Bacteria | 960 |
| 1231 | Ga0501045_0689354 | 3300049824 | Bacteria | 754 |
| 1232 | Ga0501045_1285448 | 3300049824 | Unclassified | 533 |
| 1233 | nmdc:mga03683_139460_c1 | 3300050489 | Bacteria | 1089 |
| 1234 | nmdc:mga03n38_431760_c1 | 3300050490 | Bacteria | 730 |
| 1235 | nmdc:mga03n38_633722_c1 | 3300050490 | Bacteria | 611 |
| 1236 | nmdc:mga03n38_85051_c1 | 3300050490 | Bacteria | 1495 |
| 1237 | nmdc:mga03n38_902838_c1 | 3300050490 | Bacteria | 519 |
| 1238 | nmdc:mga00v17_115_c2 | 3300050491 | Bacteria | 47780 |
| 1239 | nmdc:mga00v17_300630_c1 | 3300050491 | Bacteria | 1042 |
| 1240 | nmdc:mga0yw44_102224_c1 | 3300050492 | Bacteria | 1827 |
| 1241 | nmdc:mga0yw44_141277_c1 | 3300050492 | Bacteria | 1565 |
| 1242 | nmdc:mga0yw44_184850_c1 | 3300050492 | Bacteria | 1373 |
| 1243 | nmdc:mga0yw44_240571_c1 | 3300050492 | Bacteria | 1203 |
| 1244 | nmdc:mga0yw44_332942_c1 | 3300050492 | Bacteria | 1020 |
| 1245 | nmdc:mga0yw44_66004_c1 | 3300050492 | Bacteria | 2232 |
| 1246 | nmdc:mga0yw44_81368_c1 | 3300050492 | Bacteria | 2030 |
| 1247 | nmdc:mga0k408_36900_c1 | 3300050493 | Bacteria | 1346 |
| 1248 | nmdc:mga0k408_658257_c1 | 3300050493 | Bacteria | 615 |
| 1249 | nmdc:mga06z11_197649_c1 | 3300050494 | Bacteria | 1166 |
| 1250 | nmdc:mga06z11_222987_c1 | 3300050494 | Bacteria | 1102 |
| 1251 | nmdc:mga06z11_23123_c1 | 3300050494 | Bacteria | 2914 |
| 1252 | nmdc:mga06z11_66941_c1 | 3300050494 | Bacteria | 1890 |
| 1253 | nmdc:mga06z11_821366_c1 | 3300050494 | Bacteria | 566 |
| 1254 | nmdc:mga04h51_33389_c1 | 3300050495 | Bacteria | 1638 |
| 1255 | nmdc:mga07m45_229620_c1 | 3300050496 | Bacteria | 1080 |
| 1256 | nmdc:mga07m45_28926_c1 | 3300050496 | Bacteria | 3060 |
| 1257 | nmdc:mga07m45_845887_c1 | 3300050496 | Bacteria | 524 |
| 1258 | nmdc:mga08y16_453195_c1 | 3300050511 | Bacteria | 1308 |
| 1259 | nmdc:mga0sz30_16635_c1 | 3300050516 | Bacteria | 2923 |
| 1260 | nmdc:mga0sz30_193405_c1 | 3300050516 | Bacteria | 903 |
| 1261 | nmdc:mga0sz30_263223_c1 | 3300050516 | Bacteria | 768 |
| 1262 | nmdc:mga0sz30_39361_c1 | 3300050516 | Bacteria | 1357 |
| 1263 | nmdc:mga0sz30_77891_c1 | 3300050516 | Bacteria | 914 |
| 1264 | Ga0495612_0137474 | 3300053078 | Bacteria | 1058 |
| 1265 | Ga0495655_0111615 | 3300053083 | Bacteria | 822 |
| 1266 | Ga0495655_0277816 | 3300053083 | Bacteria | 570 |
| 1267 | Ga0495595_0539691 | 3300053084 | Bacteria | 595 |
| 1268 | Ga0495619_0041037 | 3300053085 | Bacteria | 3026 |
| 1269 | Ga0500643_010419 | 3300053087 | Bacteria | 3461 |
| 1270 | Ga0500644_0014616 | 3300053088 | Bacteria | 2220 |
| 1271 | Ga0500646_0218015 | 3300053090 | Bacteria | 661 |
| 1272 | Ga0500651_0400215 | 3300053093 | Bacteria | 771 |
| 1273 | Ga0500562_148309 | 3300053108 | Bacteria | 639 |
| 1274 | Ga0500592_074338 | 3300053116 | Bacteria | 562 |
| 1275 | Ga0500595_037747 | 3300053119 | Bacteria | 1574 |
| 1276 | Ga0500607_264271 | 3300053121 | Bacteria | 671 |
| 1277 | Ga0500618_012633 | 3300053125 | Bacteria | 2205 |
| 1278 | Ga0500621_166484 | 3300053126 | Bacteria | 812 |
| 1279 | Ga0500642_0460303 | 3300053130 | Bacteria | 544 |
| 1280 | Ga0500658_0103484 | 3300053134 | Bacteria | 1245 |
| 1281 | Ga0500559_0318752 | 3300053136 | Bacteria | 729 |
| 1282 | Ga0500568_0000143 | 3300053139 | Bacteria | 63442 |
| 1283 | Ga0500568_0003084 | 3300053139 | Bacteria | 9512 |
| 1284 | Ga0500568_0314746 | 3300053139 | Bacteria | 568 |
| 1285 | Ga0500568_0365473 | 3300053139 | Bacteria | 523 |
| 1286 | Ga0500590_001637 | 3300053148 | Bacteria | 9350 |
| 1287 | Ga0500604_0132226 | 3300053151 | Bacteria | 839 |
| 1288 | Ga0500616_0001190 | 3300053153 | Bacteria | 26447 |
| 1289 | Ga0500616_0059686 | 3300053153 | Bacteria | 1980 |
| 1290 | Ga0500616_0133505 | 3300053153 | Bacteria | 1170 |
| 1291 | Ga0500616_0140386 | 3300053153 | Bacteria | 1130 |
| 1292 | Ga0500620_003773 | 3300053155 | Bacteria | 3285 |
| 1293 | Ga0500622_0000364 | 3300053156 | Bacteria | 43740 |
| 1294 | Ga0500622_0000757 | 3300053156 | Bacteria | 28152 |
| 1295 | Ga0500622_0231560 | 3300053156 | Bacteria | 822 |
| 1296 | Ga0500624_093001 | 3300053157 | Bacteria | 613 |
| 1297 | Ga0500627_0127639 | 3300053158 | Bacteria | 1148 |
| 1298 | Ga0500627_0166663 | 3300053158 | Bacteria | 993 |
| 1299 | Ga0500627_0228484 | 3300053158 | Bacteria | 828 |
| 1300 | Ga0500627_0295216 | 3300053158 | Bacteria | 708 |
| 1301 | Ga0500627_0299371 | 3300053158 | Bacteria | 702 |
| 1302 | Ga0500627_0346384 | 3300053158 | Bacteria | 641 |
| 1303 | Ga0500633_0005625 | 3300053160 | Bacteria | 2997 |
| 1304 | Ga0500634_0002302 | 3300053161 | Bacteria | 7985 |
| 1305 | Ga0500634_0404040 | 3300053161 | Bacteria | 504 |
| 1306 | Ga0500636_0008368 | 3300053177 | Bacteria | 6001 |
| 1307 | Ga0500611_050029 | 3300053727 | Bacteria | 954 |
| 1308 | Ga0500645_036989 | 3300053730 | Bacteria | 1451 |
| 1309 | Ga0500645_180497 | 3300053730 | Bacteria | 574 |
| 1310 | Ga0500565_078516 | 3300053734 | Bacteria | 524 |
| 1311 | Ga0501084_0011781 | 3300054114 | Bacteria | 7239 |
| 1312 | Ga0501084_0029187 | 3300054114 | Bacteria | 4613 |
| 1313 | Ga0501084_0318848 | 3300054114 | Bacteria | 1313 |
| 1314 | Ga0501084_0425202 | 3300054114 | Bacteria | 1123 |
| 1315 | Ga0501084_0540056 | 3300054114 | Bacteria | 985 |
| 1316 | Ga0501084_0863401 | 3300054114 | Bacteria | 761 |
| 1317 | Ga0501084_1043279 | 3300054114 | Bacteria | 687 |
| 1318 | Ga0501084_1214317 | 3300054114 | Bacteria | 632 |
| 1319 | Ga0501084_1331957 | 3300054114 | Bacteria | 602 |
| 1320 | Ga0501084_1551807 | 3300054114 | Bacteria | 554 |
| 1321 | Ga0587088_130745 | 3300059508 | Bacteria | 590 |
| 1322 | Ga0587068_110313 | 3300059641 | Bacteria | 587 |
| 1323 | Ga0501082_0006649 | 3300060353 | Bacteria | 10004 |
| 1324 | Ga0501082_0016167 | 3300060353 | Bacteria | 6421 |
| 1325 | Ga0501082_0028296 | 3300060353 | Bacteria | 4830 |
| 1326 | Ga0501082_0153547 | 3300060353 | Bacteria | 2000 |
| 1327 | Ga0501082_0175464 | 3300060353 | Bacteria | 1863 |
| 1328 | Ga0501082_0201294 | 3300060353 | Bacteria | 1732 |
| 1329 | Ga0501082_0294964 | 3300060353 | Bacteria | 1412 |
| 1330 | Ga0501082_0321173 | 3300060353 | Bacteria | 1349 |
| 1331 | Ga0501082_0397747 | 3300060353 | Bacteria | 1202 |
| 1332 | Ga0501082_0476446 | 3300060353 | Bacteria | 1091 |
| 1333 | Ga0501082_1495677 | 3300060353 | Bacteria | 590 |
| 1334 | Ga0530510_0447622 | 3300061734 | Bacteria | 976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 3004289098 | 3004292461 | 77 |
| 2 | iso_pu_bacteria | 2503198000 | 2503203262 | 79 |
| 3 | iso_pu_bacteria | 2937843397 | 2937846817 | 79 |
| 4 | iso_pu_bacteria | 3000017691 | 3000019832 | 79 |
| 5 | iso_pu_bacteria | 8054563764 | 8054564132 | 79 |
| 6 | 3300049583 | Ga0501067_0002093 | Ga0501067_0002093_8272_8514 | 80 |
| 7 | 3300049590 | Ga0501074_0846314 | Ga0501074_0846314_193_435 | 80 |
| 8 | 3300049592 | Ga0501076_0357653 | Ga0501076_0357653_473_715 | 80 |
| 9 | 3300049741 | Ga0501079_0877373 | Ga0501079_0877373_117_359 | 80 |
| 10 | 3300049744 | Ga0501083_0061019 | Ga0501083_0061019_1339_1581 | 80 |
| 11 | 3300054114 | Ga0501084_0029187 | Ga0501084_0029187_804_1046 | 80 |
| 12 | 3300054114 | Ga0501084_0540056 | Ga0501084_0540056_266_520 | 80 |
| 13 | 3300060353 | Ga0501082_0016167 | Ga0501082_0016167_3916_4158 | 80 |
| 14 | 3300061734 | Ga0530510_0447622 | Ga0530510_0447622_494_736 | 80 |
| 15 | iso_pu_bacteria | 2510917022 | 2511137065 | 80 |
| 16 | iso_pu_bacteria | 2524023209 | 2524460613 | 80 |
| 17 | iso_pu_bacteria | 2582581307 | 2585273225 | 80 |
| 18 | iso_pu_bacteria | 2582581316 | 2585329605 | 80 |
| 19 | iso_pu_bacteria | 2585427531 | 2585559475 | 80 |
| 20 | iso_pu_bacteria | 2585427609 | 2585905149 | 80 |
| 21 | iso_pu_bacteria | 2585428125 | 2587979736 | 80 |
| 22 | iso_pu_bacteria | 2615840698 | 2616553973 | 80 |
| 23 | iso_pu_bacteria | 2617270742 | 2617386742 | 80 |
| 24 | iso_pu_bacteria | 2643221582 | 2643918747 | 80 |
| 25 | iso_pu_bacteria | 2757320392 | 2757571746 | 80 |
| 26 | iso_pu_bacteria | 2765235802 | 2765465230 | 80 |
| 27 | iso_pu_bacteria | 2775506902 | 2776271915 | 80 |
| 28 | iso_pu_bacteria | 2775506904 | 2776279568 | 80 |
| 29 | iso_pu_bacteria | 2842298080 | 2842302417 | 80 |
| 30 | iso_pu_bacteria | 2842357229 | 2842360850 | 80 |
| 31 | iso_pu_bacteria | 2842482326 | 2842482884 | 80 |
| 32 | iso_pu_bacteria | 2842509118 | 2842509758 | 80 |
| 33 | iso_pu_bacteria | 2891373044 | 2891376994 | 80 |
| 34 | iso_pu_bacteria | 2904578770 | 2904581400 | 80 |
| 35 | iso_pu_bacteria | 2919119836 | 2919122636 | 80 |
| 36 | iso_pu_bacteria | 2937822353 | 2937829324 | 80 |
| 37 | iso_pu_bacteria | 3002141150 | 3002143370 | 80 |
| 38 | iso_pu_bacteria | 8003570095 | 8003570614 | 80 |
| 39 | iso_pu_bacteria | 8024486573 | 8024489725 | 80 |
| 40 | 3300013306 | Ga0163162_10021032 | Ga0163162_100210323 | 81 |
| 41 | 3300046616 | Ga0495668_0634570 | Ga0495668_0634570_25_270 | 81 |
| 42 | iso_pu_bacteria | 2508501123 | 2509116523 | 81 |
| 43 | iso_pu_bacteria | 2508501127 | 2509141442 | 81 |
| 44 | iso_pu_bacteria | 2509276018 | 2509371799 | 81 |
| 45 | iso_pu_bacteria | 2509276022 | 2509397694 | 81 |
| 46 | iso_pu_bacteria | 2510065059 | 2510318948 | 81 |
| 47 | iso_pu_bacteria | 2512875016 | 2512929854 | 81 |
| 48 | iso_pu_bacteria | 2512875024 | 2512964629 | 81 |
| 49 | iso_pu_bacteria | 2513237164 | 2514033271 | 81 |
| 50 | iso_pu_bacteria | 2513237305 | 2514418483 | 81 |
| 51 | iso_pu_bacteria | 2534681786 | 2535484444 | 81 |
| 52 | iso_pu_bacteria | 2582581308 | 2585278940 | 81 |
| 53 | iso_pu_bacteria | 2582581315 | 2585325445 | 81 |
| 54 | iso_pu_bacteria | 2585427527 | 2585530737 | 81 |
| 55 | iso_pu_bacteria | 2585427530 | 2585554917 | 81 |
| 56 | iso_pu_bacteria | 2585427608 | 2585902146 | 81 |
| 57 | iso_pu_bacteria | 2588253730 | 2588515450 | 81 |
| 58 | iso_pu_bacteria | 2597489875 | 2597814985 | 81 |
| 59 | iso_pu_bacteria | 2615840626 | 2616305787 | 81 |
| 60 | iso_pu_bacteria | 2643221595 | 2643985308 | 81 |
| 61 | iso_pu_bacteria | 2643221627 | 2644155056 | 81 |
| 62 | iso_pu_bacteria | 2667528174 | 2671115273 | 81 |
| 63 | iso_pu_bacteria | 2687453392 | 2688600100 | 81 |
| 64 | iso_pu_bacteria | 2693429783 | 2694633634 | 81 |
| 65 | iso_pu_bacteria | 2693429784 | 2694640027 | 81 |
| 66 | iso_pu_bacteria | 2721755686 | 2723577340 | 81 |
| 67 | iso_pu_bacteria | 2751185800 | 2753359010 | 81 |
| 68 | iso_pu_bacteria | 2756170246 | 2756673340 | 81 |
| 69 | iso_pu_bacteria | 2758568016 | 2758641247 | 81 |
| 70 | iso_pu_bacteria | 2775507266 | 2778177518 | 81 |
| 71 | iso_pu_bacteria | 2791355123 | 2792749084 | 81 |
| 72 | iso_pu_bacteria | 2818991448 | 2819611563 | 81 |
| 73 | iso_pu_bacteria | 2818991453 | 2819639216 | 81 |
| 74 | iso_pu_bacteria | 2838029111 | 2838031462 | 81 |
| 75 | iso_pu_bacteria | 2838736955 | 2838741191 | 81 |
| 76 | iso_pu_bacteria | 2841840854 | 2841844912 | 81 |
| 77 | iso_pu_bacteria | 2842140634 | 2842144634 | 81 |
| 78 | iso_pu_bacteria | 2842475841 | 2842477942 | 81 |
| 79 | iso_pu_bacteria | 2842502639 | 2842504751 | 81 |
| 80 | iso_pu_bacteria | 2844002411 | 2844005799 | 81 |
| 81 | iso_pu_bacteria | 2844009547 | 2844015411 | 81 |
| 82 | iso_pu_bacteria | 2847670302 | 2847671771 | 81 |
| 83 | iso_pu_bacteria | 2852387548 | 2852389111 | 81 |
| 84 | iso_pu_bacteria | 2854896431 | 2854897218 | 81 |
| 85 | iso_pu_bacteria | 2854911287 | 2854914529 | 81 |
| 86 | iso_pu_bacteria | 2856314179 | 2856318499 | 81 |
| 87 | iso_pu_bacteria | 2856320880 | 2856324445 | 81 |
| 88 | iso_pu_bacteria | 2856328259 | 2856333353 | 81 |
| 89 | iso_pu_bacteria | 2856334872 | 2856337564 | 81 |
| 90 | iso_pu_bacteria | 2856342000 | 2856346849 | 81 |
| 91 | iso_pu_bacteria | 2857349434 | 2857355915 | 81 |
| 92 | iso_pu_bacteria | 2857367948 | 2857368651 | 81 |
| 93 | iso_pu_bacteria | 2869162929 | 2869164983 | 81 |
| 94 | iso_pu_bacteria | 2869169390 | 2869174810 | 81 |
| 95 | iso_pu_bacteria | 2869234852 | 2869239383 | 81 |
| 96 | iso_pu_bacteria | 2869242130 | 2869247650 | 81 |
| 97 | iso_pu_bacteria | 2869249662 | 2869252501 | 81 |
| 98 | iso_pu_bacteria | 2869256925 | 2869260219 | 81 |
| 99 | iso_pu_bacteria | 2869264136 | 2869268891 | 81 |
| 100 | iso_pu_bacteria | 2869271264 | 2869271716 | 81 |
| 101 | iso_pu_bacteria | 2869278585 | 2869281559 | 81 |
| 102 | iso_pu_bacteria | 2871435913 | 2871437060 | 81 |
| 103 | iso_pu_bacteria | 2871451962 | 2871455188 | 81 |
| 104 | iso_pu_bacteria | 2871459585 | 2871462232 | 81 |
| 105 | iso_pu_bacteria | 2871466892 | 2871468827 | 81 |
| 106 | iso_pu_bacteria | 2871481445 | 2871488413 | 81 |
| 107 | iso_pu_bacteria | 2874109183 | 2874113402 | 81 |
| 108 | iso_pu_bacteria | 2874116593 | 2874120081 | 81 |
| 109 | iso_pu_bacteria | 2874123672 | 2874127507 | 81 |
| 110 | iso_pu_bacteria | 2874131515 | 2874138806 | 81 |
| 111 | iso_pu_bacteria | 2874139085 | 2874140779 | 81 |
| 112 | iso_pu_bacteria | 2874162495 | 2874163434 | 81 |
| 113 | iso_pu_bacteria | 2874168670 | 2874175490 | 81 |
| 114 | iso_pu_bacteria | 2876363079 | 2876366583 | 81 |
| 115 | iso_pu_bacteria | 2876386047 | 2876388146 | 81 |
| 116 | iso_pu_bacteria | 2876399893 | 2876401250 | 81 |
| 117 | iso_pu_bacteria | 2876406927 | 2876409293 | 81 |
| 118 | iso_pu_bacteria | 2876420981 | 2876424613 | 81 |
| 119 | iso_pu_bacteria | 2878035449 | 2878037835 | 81 |
| 120 | iso_pu_bacteria | 2878730984 | 2878734023 | 81 |
| 121 | iso_pu_bacteria | 2878738818 | 2878742558 | 81 |
| 122 | iso_pu_bacteria | 2878774303 | 2878779899 | 81 |
| 123 | iso_pu_bacteria | 2878781027 | 2878785845 | 81 |
| 124 | iso_pu_bacteria | 2882632389 | 2882635088 | 81 |
| 125 | iso_pu_bacteria | 2885312484 | 2885316426 | 81 |
| 126 | iso_pu_bacteria | 2888337043 | 2888341266 | 81 |
| 127 | iso_pu_bacteria | 2888343758 | 2888348460 | 81 |
| 128 | iso_pu_bacteria | 2899803654 | 2899803810 | 81 |
| 129 | iso_pu_bacteria | 2903448605 | 2903452757 | 81 |
| 130 | iso_pu_bacteria | 2903513507 | 2903518819 | 81 |
| 131 | iso_pu_bacteria | 2903521522 | 2903524451 | 81 |
| 132 | iso_pu_bacteria | 2903528002 | 2903530081 | 81 |
| 133 | iso_pu_bacteria | 2906363423 | 2906367895 | 81 |
| 134 | iso_pu_bacteria | 2906370794 | 2906372651 | 81 |
| 135 | iso_pu_bacteria | 2906386501 | 2906389836 | 81 |
| 136 | iso_pu_bacteria | 2906393657 | 2906394895 | 81 |
| 137 | iso_pu_bacteria | 2906401398 | 2906406818 | 81 |
| 138 | iso_pu_bacteria | 2906408224 | 2906412858 | 81 |
| 139 | iso_pu_bacteria | 2906414383 | 2906418536 | 81 |
| 140 | iso_pu_bacteria | 2906427513 | 2906431592 | 81 |
| 141 | iso_pu_bacteria | 2919408235 | 2919409344 | 81 |
| 142 | iso_pu_bacteria | 2922151315 | 2922157930 | 81 |
| 143 | iso_pu_bacteria | 2922172374 | 2922176839 | 81 |
| 144 | iso_pu_bacteria | 2922178524 | 2922184697 | 81 |
| 145 | iso_pu_bacteria | 2924710171 | 2924711539 | 81 |
| 146 | iso_pu_bacteria | 2924733363 | 2924735351 | 81 |
| 147 | iso_pu_bacteria | 2924741084 | 2924742338 | 81 |
| 148 | iso_pu_bacteria | 2924748358 | 2924754554 | 81 |
| 149 | iso_pu_bacteria | 2924754689 | 2924756813 | 81 |
| 150 | iso_pu_bacteria | 2924762789 | 2924764672 | 81 |
| 151 | iso_pu_bacteria | 2924776078 | 2924780358 | 81 |
| 152 | iso_pu_bacteria | 2937848649 | 2937852379 | 81 |
| 153 | iso_pu_bacteria | 2937861824 | 2937862560 | 81 |
| 154 | iso_pu_bacteria | 2937868953 | 2937875458 | 81 |
| 155 | iso_pu_bacteria | 2937877337 | 2937882881 | 81 |
| 156 | iso_pu_bacteria | 2937972304 | 2937973148 | 81 |
| 157 | iso_pu_bacteria | 2937980651 | 2937984655 | 81 |
| 158 | iso_pu_bacteria | 2958034702 | 2958037520 | 81 |
| 159 | iso_pu_bacteria | 2958041894 | 2958047232 | 81 |
| 160 | iso_pu_bacteria | 2958064165 | 2958068704 | 81 |
| 161 | iso_pu_bacteria | 2958084443 | 2958090006 | 81 |
| 162 | iso_pu_bacteria | 2958108152 | 2958110503 | 81 |
| 163 | iso_pu_bacteria | 2958122699 | 2958123517 | 81 |
| 164 | iso_pu_bacteria | 2958137437 | 2958142351 | 81 |
| 165 | iso_pu_bacteria | 2958144490 | 2958151298 | 81 |
| 166 | iso_pu_bacteria | 2958158011 | 2958160052 | 81 |
| 167 | iso_pu_bacteria | 2961136820 | 2961144480 | 81 |
| 168 | iso_pu_bacteria | 2961183825 | 2961189984 | 81 |
| 169 | iso_pu_bacteria | 2963644680 | 2963649378 | 81 |
| 170 | iso_pu_bacteria | 2965025482 | 2965030625 | 81 |
| 171 | iso_pu_bacteria | 2965032056 | 2965037754 | 81 |
| 172 | iso_pu_bacteria | 2965040258 | 2965046882 | 81 |
| 173 | iso_pu_bacteria | 2965047637 | 2965050893 | 81 |
| 174 | iso_pu_bacteria | 2965089291 | 2965095911 | 81 |
| 175 | iso_pu_bacteria | 2965102966 | 2965108034 | 81 |
| 176 | iso_pu_bacteria | 2965110997 | 2965111246 | 81 |
| 177 | iso_pu_bacteria | 2968016561 | 2968019645 | 81 |
| 178 | iso_pu_bacteria | 2968083720 | 2968084538 | 81 |
| 179 | iso_pu_bacteria | 2968138860 | 2968144111 | 81 |
| 180 | iso_pu_bacteria | 2970469710 | 2970472966 | 81 |
| 181 | iso_pu_bacteria | 2970489779 | 2970492111 | 81 |
| 182 | iso_pu_bacteria | 2970510686 | 2970512547 | 81 |
| 183 | iso_pu_bacteria | 2970524798 | 2970529737 | 81 |
| 184 | iso_pu_bacteria | 2970532167 | 2970532395 | 81 |
| 185 | iso_pu_bacteria | 2970540015 | 2970541867 | 81 |
| 186 | iso_pu_bacteria | 2970547951 | 2970551076 | 81 |
| 187 | iso_pu_bacteria | 2970593180 | 2970596162 | 81 |
| 188 | iso_pu_bacteria | 2970619444 | 2970621647 | 81 |
| 189 | iso_pu_bacteria | 2970627176 | 2970627405 | 81 |
| 190 | iso_pu_bacteria | 2977828996 | 2977829332 | 81 |
| 191 | iso_pu_bacteria | 2977851361 | 2977854049 | 81 |
| 192 | iso_pu_bacteria | 2977858184 | 2977861680 | 81 |
| 193 | iso_pu_bacteria | 2977872689 | 2977876162 | 81 |
| 194 | iso_pu_bacteria | 2977898635 | 2977902840 | 81 |
| 195 | iso_pu_bacteria | 2977907340 | 2977915035 | 81 |
| 196 | iso_pu_bacteria | 2977915119 | 2977917724 | 81 |
| 197 | iso_pu_bacteria | 2977922695 | 2977927199 | 81 |
| 198 | iso_pu_bacteria | 2977935797 | 2977937041 | 81 |
| 199 | iso_pu_bacteria | 2977950692 | 2977956671 | 81 |
| 200 | iso_pu_bacteria | 2977957713 | 2977960775 | 81 |
| 201 | iso_pu_bacteria | 2977986579 | 2977990545 | 81 |
| 202 | iso_pu_bacteria | 2979772303 | 2979777379 | 81 |
| 203 | iso_pu_bacteria | 2979793036 | 2979797798 | 81 |
| 204 | iso_pu_bacteria | 2987636660 | 2987639729 | 81 |
| 205 | iso_pu_bacteria | 2987645492 | 2987648438 | 81 |
| 206 | iso_pu_bacteria | 2987666974 | 2987667475 | 81 |
| 207 | iso_pu_bacteria | 2987673487 | 2987674712 | 81 |
| 208 | iso_pu_bacteria | 2996348954 | 2996351913 | 81 |
| 209 | iso_pu_bacteria | 2996386984 | 2996392398 | 81 |
| 210 | iso_pu_bacteria | 3000135777 | 3000141816 | 81 |
| 211 | iso_pu_bacteria | 3004167301 | 3004170864 | 81 |
| 212 | iso_pu_bacteria | 3004195979 | 3004197332 | 81 |
| 213 | iso_pu_bacteria | 3004203850 | 3004207302 | 81 |
| 214 | iso_pu_bacteria | 3004211236 | 3004214670 | 81 |
| 215 | iso_pu_bacteria | 3004218560 | 3004219353 | 81 |
| 216 | iso_pu_bacteria | 3004232784 | 3004235602 | 81 |
| 217 | iso_pu_bacteria | 3004239961 | 3004247405 | 81 |
| 218 | iso_pu_bacteria | 3004248173 | 3004251214 | 81 |
| 219 | iso_pu_bacteria | 3004268573 | 3004272192 | 81 |
| 220 | iso_pu_bacteria | 3004275668 | 3004278611 | 81 |
| 221 | iso_pu_bacteria | 3005416602 | 3005417174 | 81 |
| 222 | iso_pu_bacteria | 637000159 | 637079597 | 81 |
| 223 | iso_pu_bacteria | 649633066 | 649874577 | 81 |
| 224 | iso_pu_bacteria | 8004300914 | 8004307084 | 81 |
| 225 | iso_pu_bacteria | 8004312739 | 8004319406 | 81 |
| 226 | iso_pu_bacteria | 8004361976 | 8004369376 | 81 |
| 227 | iso_pu_bacteria | 8004445564 | 8004446578 | 81 |
| 228 | iso_pu_bacteria | 8004695233 | 8004700116 | 81 |
| 229 | iso_pu_bacteria | 8004727605 | 8004731358 | 81 |
| 230 | iso_pu_bacteria | 8005314921 | 8005315235 | 81 |
| 231 | iso_pu_bacteria | 8005484373 | 8005485595 | 81 |
| 232 | iso_pu_bacteria | 8005645114 | 8005649881 | 81 |
| 233 | iso_pu_bacteria | 8005682033 | 8005684534 | 81 |
| 234 | iso_pu_bacteria | 8018150411 | 8018152521 | 81 |
| 235 | iso_pu_bacteria | 8046767195 | 8046767710 | 81 |
| 236 | iso_pu_bacteria | 8054558443 | 8054562080 | 81 |
| 237 | iso_pu_bacteria | 8055617313 | 8055622671 | 81 |
| 238 | iso_pu_bacteria | 8057575449 | 8057582164 | 81 |
| 239 | 3300048912 | Ga0496109_1903835 | Ga0496109_1903835_43_297 | 82 |
| 240 | iso_pu_bacteria | 2508501122 | 2509108556 | 82 |
| 241 | iso_pu_bacteria | 2509276019 | 2509374417 | 82 |
| 242 | iso_pu_bacteria | 2510065057 | 2510307209 | 82 |
| 243 | iso_pu_bacteria | 2511231052 | 2511501057 | 82 |
| 244 | iso_pu_bacteria | 2512047086 | 2512532465 | 82 |
| 245 | iso_pu_bacteria | 2512875026 | 2512972196 | 82 |
| 246 | iso_pu_bacteria | 2513237086 | 2513582832 | 82 |
| 247 | iso_pu_bacteria | 2513237089 | 2513603275 | 82 |
| 248 | iso_pu_bacteria | 2513237091 | 2513618987 | 82 |
| 249 | iso_pu_bacteria | 2513237140 | 2513881056 | 82 |
| 250 | iso_pu_bacteria | 2513237143 | 2513902292 | 82 |
| 251 | iso_pu_bacteria | 2513237156 | 2513983881 | 82 |
| 252 | iso_pu_bacteria | 2513237159 | 2514001920 | 82 |
| 253 | iso_pu_bacteria | 2513237160 | 2514004730 | 82 |
| 254 | iso_pu_bacteria | 2515154107 | 2515608167 | 82 |
| 255 | iso_pu_bacteria | 2516143018 | 2516208918 | 82 |
| 256 | iso_pu_bacteria | 2516653046 | 2516892338 | 82 |
| 257 | iso_pu_bacteria | 2517487022 | 2517569138 | 82 |
| 258 | iso_pu_bacteria | 2524023207 | 2524451095 | 82 |
| 259 | iso_pu_bacteria | 2551306084 | 2551680478 | 82 |
| 260 | iso_pu_bacteria | 2551306085 | 2551683865 | 82 |
| 261 | iso_pu_bacteria | 2551306086 | 2551695309 | 82 |
| 262 | iso_pu_bacteria | 2551306087 | 2551704081 | 82 |
| 263 | iso_pu_bacteria | 2551306089 | 2551709737 | 82 |
| 264 | iso_pu_bacteria | 2551306090 | 2551722571 | 82 |
| 265 | iso_pu_bacteria | 2551306091 | 2551727263 | 82 |
| 266 | iso_pu_bacteria | 2551306092 | 2551737883 | 82 |
| 267 | iso_pu_bacteria | 2551306093 | 2551743479 | 82 |
| 268 | iso_pu_bacteria | 2558860100 | 2558863444 | 82 |
| 269 | iso_pu_bacteria | 2582581283 | 2585165599 | 82 |
| 270 | iso_pu_bacteria | 2582581306 | 2585266125 | 82 |
| 271 | iso_pu_bacteria | 2582581865 | 2585387125 | 82 |
| 272 | iso_pu_bacteria | 2582581866 | 2585392755 | 82 |
| 273 | iso_pu_bacteria | 2599185156 | 2599333723 | 82 |
| 274 | iso_pu_bacteria | 2599185352 | 2600191974 | 82 |
| 275 | iso_pu_bacteria | 2643221557 | 2643807161 | 82 |
| 276 | iso_pu_bacteria | 2643221607 | 2644046523 | 82 |
| 277 | iso_pu_bacteria | 2643221610 | 2644069573 | 82 |
| 278 | iso_pu_bacteria | 2643221618 | 2644108951 | 82 |
| 279 | iso_pu_bacteria | 2643221626 | 2644151473 | 82 |
| 280 | iso_pu_bacteria | 2643221636 | 2644202229 | 82 |
| 281 | iso_pu_bacteria | 2643221655 | 2644311607 | 82 |
| 282 | iso_pu_bacteria | 2643221659 | 2644329865 | 82 |
| 283 | iso_pu_bacteria | 2643221668 | 2644380543 | 82 |
| 284 | iso_pu_bacteria | 2643221675 | 2644420727 | 82 |
| 285 | iso_pu_bacteria | 2643221680 | 2644454252 | 82 |
| 286 | iso_pu_bacteria | 2643221686 | 2644479313 | 82 |
| 287 | iso_pu_bacteria | 2643221689 | 2644502361 | 82 |
| 288 | iso_pu_bacteria | 2643221698 | 2644546539 | 82 |
| 289 | iso_pu_bacteria | 2643221712 | 2644617406 | 82 |
| 290 | iso_pu_bacteria | 2643221723 | 2644675608 | 82 |
| 291 | iso_pu_bacteria | 2643221726 | 2644689589 | 82 |
| 292 | iso_pu_bacteria | 2657244999 | 2657683224 | 82 |
| 293 | iso_pu_bacteria | 2690316117 | 2692316786 | 82 |
| 294 | iso_pu_bacteria | 2751185821 | 2753460846 | 82 |
| 295 | iso_pu_bacteria | 2791355082 | 2792584203 | 82 |
| 296 | iso_pu_bacteria | 2791355091 | 2792622646 | 82 |
| 297 | iso_pu_bacteria | 2791355092 | 2792628433 | 82 |
| 298 | iso_pu_bacteria | 2791355094 | 2792638306 | 82 |
| 299 | iso_pu_bacteria | 2791355253 | 2793282341 | 82 |
| 300 | iso_pu_bacteria | 2802428858 | 2802717782 | 82 |
| 301 | iso_pu_bacteria | 2802428859 | 2802723289 | 82 |
| 302 | iso_pu_bacteria | 2802428860 | 2802733152 | 82 |
| 303 | iso_pu_bacteria | 2802428861 | 2802736266 | 82 |
| 304 | iso_pu_bacteria | 2802428862 | 2802743524 | 82 |
| 305 | iso_pu_bacteria | 2802428863 | 2802750763 | 82 |
| 306 | iso_pu_bacteria | 2802429268 | 2804751387 | 82 |
| 307 | iso_pu_bacteria | 2838074704 | 2838076481 | 82 |
| 308 | iso_pu_bacteria | 2842521101 | 2842526308 | 82 |
| 309 | iso_pu_bacteria | 2842922631 | 2842924839 | 82 |
| 310 | iso_pu_bacteria | 2844163670 | 2844168475 | 82 |
| 311 | iso_pu_bacteria | 2847417321 | 2847418148 | 82 |
| 312 | iso_pu_bacteria | 2848992105 | 2848993123 | 82 |
| 313 | iso_pu_bacteria | 2850079185 | 2850080517 | 82 |
| 314 | iso_pu_bacteria | 2855825444 | 2855831410 | 82 |
| 315 | iso_pu_bacteria | 2855839649 | 2855840534 | 82 |
| 316 | iso_pu_bacteria | 2855872281 | 2855878898 | 82 |
| 317 | iso_pu_bacteria | 2858800743 | 2858801062 | 82 |
| 318 | iso_pu_bacteria | 2896384573 | 2896386681 | 82 |
| 319 | iso_pu_bacteria | 2913295892 | 2913297405 | 82 |
| 320 | iso_pu_bacteria | 2915980308 | 2915986262 | 82 |
| 321 | iso_pu_bacteria | 2915986958 | 2915988466 | 82 |
| 322 | iso_pu_bacteria | 2915993759 | 2915996173 | 82 |
| 323 | iso_pu_bacteria | 2916000859 | 2916002078 | 82 |
| 324 | iso_pu_bacteria | 2916007675 | 2916014019 | 82 |
| 325 | iso_pu_bacteria | 2916014648 | 2916015411 | 82 |
| 326 | iso_pu_bacteria | 2916021584 | 2916025139 | 82 |
| 327 | iso_pu_bacteria | 2916028427 | 2916032624 | 82 |
| 328 | iso_pu_bacteria | 2916035215 | 2916040263 | 82 |
| 329 | iso_pu_bacteria | 2916041962 | 2916042458 | 82 |
| 330 | iso_pu_bacteria | 2916048683 | 2916052551 | 82 |
| 331 | iso_pu_bacteria | 2916055098 | 2916055272 | 82 |
| 332 | iso_pu_bacteria | 2916061851 | 2916062912 | 82 |
| 333 | iso_pu_bacteria | 2916068649 | 2916076100 | 82 |
| 334 | iso_pu_bacteria | 2916076590 | 2916077632 | 82 |
| 335 | iso_pu_bacteria | 2920760137 | 2920762835 | 82 |
| 336 | iso_pu_bacteria | 2920822456 | 2920823885 | 82 |
| 337 | iso_pu_bacteria | 2921201388 | 2921204353 | 82 |
| 338 | iso_pu_bacteria | 2921208531 | 2921209985 | 82 |
| 339 | iso_pu_bacteria | 2921237296 | 2921240058 | 82 |
| 340 | iso_pu_bacteria | 2921244191 | 2921246181 | 82 |
| 341 | iso_pu_bacteria | 2921250672 | 2921251043 | 82 |
| 342 | iso_pu_bacteria | 2921257292 | 2921257872 | 82 |
| 343 | iso_pu_bacteria | 2921263974 | 2921264149 | 82 |
| 344 | iso_pu_bacteria | 2921282425 | 2921286234 | 82 |
| 345 | iso_pu_bacteria | 2921289301 | 2921294844 | 82 |
| 346 | iso_pu_bacteria | 2921296804 | 2921299759 | 82 |
| 347 | iso_pu_bacteria | 2924144063 | 2924146600 | 82 |
| 348 | iso_pu_bacteria | 2924150972 | 2924151184 | 82 |
| 349 | iso_pu_bacteria | 2924158325 | 2924160661 | 82 |
| 350 | iso_pu_bacteria | 2924165586 | 2924171699 | 82 |
| 351 | iso_pu_bacteria | 2924172951 | 2924177538 | 82 |
| 352 | iso_pu_bacteria | 2924179722 | 2924185904 | 82 |
| 353 | iso_pu_bacteria | 2924186466 | 2924187089 | 82 |
| 354 | iso_pu_bacteria | 2924193448 | 2924198150 | 82 |
| 355 | iso_pu_bacteria | 2924200457 | 2924203007 | 82 |
| 356 | iso_pu_bacteria | 2924207177 | 2924212646 | 82 |
| 357 | iso_pu_bacteria | 2924214083 | 2924220180 | 82 |
| 358 | iso_pu_bacteria | 2924221636 | 2924226748 | 82 |
| 359 | iso_pu_bacteria | 2924228884 | 2924230277 | 82 |
| 360 | iso_pu_bacteria | 2936996657 | 2937001015 | 82 |
| 361 | iso_pu_bacteria | 2937002841 | 2937004303 | 82 |
| 362 | iso_pu_bacteria | 2937009748 | 2937011056 | 82 |
| 363 | iso_pu_bacteria | 2937016420 | 2937019388 | 82 |
| 364 | iso_pu_bacteria | 2937023124 | 2937028488 | 82 |
| 365 | iso_pu_bacteria | 2937029754 | 2937029777 | 82 |
| 366 | iso_pu_bacteria | 2937036028 | 2937036803 | 82 |
| 367 | iso_pu_bacteria | 2937042894 | 2937048331 | 82 |
| 368 | iso_pu_bacteria | 2937049772 | 2937052063 | 82 |
| 369 | iso_pu_bacteria | 2937056579 | 2937059159 | 82 |
| 370 | iso_pu_bacteria | 2937063883 | 2937067853 | 82 |
| 371 | iso_pu_bacteria | 2937071275 | 2937073956 | 82 |
| 372 | iso_pu_bacteria | 2937078374 | 2937082883 | 82 |
| 373 | iso_pu_bacteria | 2937084907 | 2937090513 | 82 |
| 374 | iso_pu_bacteria | 2937091812 | 2937095677 | 82 |
| 375 | iso_pu_bacteria | 2937098957 | 2937104130 | 82 |
| 376 | iso_pu_bacteria | 2937106411 | 2937110747 | 82 |
| 377 | iso_pu_bacteria | 2937113482 | 2937113954 | 82 |
| 378 | iso_pu_bacteria | 2937119839 | 2937125451 | 82 |
| 379 | iso_pu_bacteria | 2937126314 | 2937129019 | 82 |
| 380 | iso_pu_bacteria | 2941499720 | 2941500174 | 82 |
| 381 | iso_pu_bacteria | 2957375807 | 2957379936 | 82 |
| 382 | iso_pu_bacteria | 2957382221 | 2957385815 | 82 |
| 383 | iso_pu_bacteria | 2957388812 | 2957389044 | 82 |
| 384 | iso_pu_bacteria | 2957395598 | 2957398348 | 82 |
| 385 | iso_pu_bacteria | 2957402308 | 2957407521 | 82 |
| 386 | iso_pu_bacteria | 2957408893 | 2957411627 | 82 |
| 387 | iso_pu_bacteria | 2957415311 | 2957418896 | 82 |
| 388 | iso_pu_bacteria | 2957422303 | 2957423188 | 82 |
| 389 | iso_pu_bacteria | 2957430029 | 2957432526 | 82 |
| 390 | iso_pu_bacteria | 2957437181 | 2957438783 | 82 |
| 391 | iso_pu_bacteria | 2957443900 | 2957446508 | 82 |
| 392 | iso_pu_bacteria | 2957450854 | 2957456600 | 82 |
| 393 | iso_pu_bacteria | 2957457609 | 2957463326 | 82 |
| 394 | iso_pu_bacteria | 2957464669 | 2957466645 | 82 |
| 395 | iso_pu_bacteria | 2957471148 | 2957473160 | 82 |
| 396 | iso_pu_bacteria | 2957478035 | 2957479932 | 82 |
| 397 | iso_pu_bacteria | 2957484790 | 2957485735 | 82 |
| 398 | iso_pu_bacteria | 2957491536 | 2957496242 | 82 |
| 399 | iso_pu_bacteria | 2957498199 | 2957505367 | 82 |
| 400 | iso_pu_bacteria | 2957505466 | 2957506173 | 82 |
| 401 | iso_pu_bacteria | 2960584000 | 2960588746 | 82 |
| 402 | iso_pu_bacteria | 2960591022 | 2960595662 | 82 |
| 403 | iso_pu_bacteria | 2960597568 | 2960601619 | 82 |
| 404 | iso_pu_bacteria | 2960603979 | 2960608575 | 82 |
| 405 | iso_pu_bacteria | 2960610863 | 2960617357 | 82 |
| 406 | iso_pu_bacteria | 2960617483 | 2960617788 | 82 |
| 407 | iso_pu_bacteria | 2960624210 | 2960625342 | 82 |
| 408 | iso_pu_bacteria | 2960631154 | 2960633136 | 82 |
| 409 | iso_pu_bacteria | 2960637947 | 2960643177 | 82 |
| 410 | iso_pu_bacteria | 2960645483 | 2960645884 | 82 |
| 411 | iso_pu_bacteria | 2960652885 | 2960658023 | 82 |
| 412 | iso_pu_bacteria | 2960660292 | 2960666492 | 82 |
| 413 | iso_pu_bacteria | 2960667422 | 2960668679 | 82 |
| 414 | iso_pu_bacteria | 2960674078 | 2960676939 | 82 |
| 415 | iso_pu_bacteria | 2960680706 | 2960684251 | 82 |
| 416 | iso_pu_bacteria | 2960687367 | 2960687704 | 82 |
| 417 | iso_pu_bacteria | 2960693952 | 2960696779 | 82 |
| 418 | iso_pu_bacteria | 2964607997 | 2964608719 | 82 |
| 419 | iso_pu_bacteria | 2964615318 | 2964616345 | 82 |
| 420 | iso_pu_bacteria | 2964621998 | 2964628880 | 82 |
| 421 | iso_pu_bacteria | 2964628898 | 2964635396 | 82 |
| 422 | iso_pu_bacteria | 2964636051 | 2964642552 | 82 |
| 423 | iso_pu_bacteria | 2964643177 | 2964646938 | 82 |
| 424 | iso_pu_bacteria | 2964649959 | 2964656323 | 82 |
| 425 | iso_pu_bacteria | 2964656573 | 2964659210 | 82 |
| 426 | iso_pu_bacteria | 2964663802 | 2964665563 | 82 |
| 427 | iso_pu_bacteria | 2964670856 | 2964674954 | 82 |
| 428 | iso_pu_bacteria | 2964678106 | 2964679398 | 82 |
| 429 | iso_pu_bacteria | 2964685014 | 2964685506 | 82 |
| 430 | iso_pu_bacteria | 2964691889 | 2964692126 | 82 |
| 431 | iso_pu_bacteria | 2964698721 | 2964703505 | 82 |
| 432 | iso_pu_bacteria | 2964705432 | 2964705906 | 82 |
| 433 | iso_pu_bacteria | 2964712639 | 2964714329 | 82 |
| 434 | iso_pu_bacteria | 2964719344 | 2964720826 | 82 |
| 435 | iso_pu_bacteria | 2967664464 | 2967668692 | 82 |
| 436 | iso_pu_bacteria | 2967671571 | 2967677126 | 82 |
| 437 | iso_pu_bacteria | 2967678726 | 2967681131 | 82 |
| 438 | iso_pu_bacteria | 2967686174 | 2967687123 | 82 |
| 439 | iso_pu_bacteria | 2967693043 | 2967693333 | 82 |
| 440 | iso_pu_bacteria | 2967699805 | 2967701242 | 82 |
| 441 | iso_pu_bacteria | 2967706974 | 2967714300 | 82 |
| 442 | iso_pu_bacteria | 2967714385 | 2967716441 | 82 |
| 443 | iso_pu_bacteria | 2967721400 | 2967723341 | 82 |
| 444 | iso_pu_bacteria | 2967728569 | 2967734645 | 82 |
| 445 | iso_pu_bacteria | 2967735183 | 2967735531 | 82 |
| 446 | iso_pu_bacteria | 2967742019 | 2967742755 | 82 |
| 447 | iso_pu_bacteria | 2967748971 | 2967754518 | 82 |
| 448 | iso_pu_bacteria | 2967755722 | 2967756982 | 82 |
| 449 | iso_pu_bacteria | 2967762386 | 2967764519 | 82 |
| 450 | iso_pu_bacteria | 2967769361 | 2967771693 | 82 |
| 451 | iso_pu_bacteria | 2967775926 | 2967776714 | 82 |
| 452 | iso_pu_bacteria | 2970019648 | 2970020526 | 82 |
| 453 | iso_pu_bacteria | 2970026789 | 2970032666 | 82 |
| 454 | iso_pu_bacteria | 2970033650 | 2970035745 | 82 |
| 455 | iso_pu_bacteria | 2970040964 | 2970041626 | 82 |
| 456 | iso_pu_bacteria | 2970047711 | 2970050494 | 82 |
| 457 | iso_pu_bacteria | 2970054988 | 2970057907 | 82 |
| 458 | iso_pu_bacteria | 2970061556 | 2970067773 | 82 |
| 459 | iso_pu_bacteria | 2970068827 | 2970075522 | 82 |
| 460 | iso_pu_bacteria | 2970076120 | 2970081382 | 82 |
| 461 | iso_pu_bacteria | 2970082768 | 2970085362 | 82 |
| 462 | iso_pu_bacteria | 2970088815 | 2970091626 | 82 |
| 463 | iso_pu_bacteria | 2970095765 | 2970100942 | 82 |
| 464 | iso_pu_bacteria | 2970102677 | 2970105088 | 82 |
| 465 | iso_pu_bacteria | 2970109326 | 2970114574 | 82 |
| 466 | iso_pu_bacteria | 2970116247 | 2970122595 | 82 |
| 467 | iso_pu_bacteria | 2970122695 | 2970124369 | 82 |
| 468 | iso_pu_bacteria | 2970129317 | 2970129605 | 82 |
| 469 | iso_pu_bacteria | 2970136068 | 2970137311 | 82 |
| 470 | iso_pu_bacteria | 2970143518 | 2970144462 | 82 |
| 471 | iso_pu_bacteria | 2970149975 | 2970155814 | 82 |
| 472 | iso_pu_bacteria | 2970156795 | 2970159800 | 82 |
| 473 | iso_pu_bacteria | 2970164137 | 2970166836 | 82 |
| 474 | iso_pu_bacteria | 2970170962 | 2970176013 | 82 |
| 475 | iso_pu_bacteria | 2970177841 | 2970182249 | 82 |
| 476 | iso_pu_bacteria | 2970184632 | 2970190902 | 82 |
| 477 | iso_pu_bacteria | 2970191845 | 2970194293 | 82 |
| 478 | iso_pu_bacteria | 2977516862 | 2977517985 | 82 |
| 479 | iso_pu_bacteria | 2977523885 | 2977529791 | 82 |
| 480 | iso_pu_bacteria | 2977530762 | 2977531988 | 82 |
| 481 | iso_pu_bacteria | 2977537788 | 2977538075 | 82 |
| 482 | iso_pu_bacteria | 2977544691 | 2977546004 | 82 |
| 483 | iso_pu_bacteria | 2977551784 | 2977552075 | 82 |
| 484 | iso_pu_bacteria | 2977558990 | 2977562796 | 82 |
| 485 | iso_pu_bacteria | 2977565890 | 2977566300 | 82 |
| 486 | iso_pu_bacteria | 2977572785 | 2977576520 | 82 |
| 487 | iso_pu_bacteria | 2977579622 | 2977585717 | 82 |
| 488 | iso_pu_bacteria | 643692032 | 643825123 | 82 |
| 489 | iso_pu_bacteria | 648276728 | 648736452 | 82 |
| 490 | iso_pu_bacteria | 8003992118 | 8003993033 | 82 |
| 491 | iso_pu_bacteria | 8003999396 | 8004000272 | 82 |
| 492 | iso_pu_bacteria | 8049293176 | 8049293961 | 82 |
| 493 | 2010549000 | RicEn_C5265 | RicEn_93940 | 83 |
| 494 | 3300001979 | JGI24740J21852_10000075 | JGI24740J21852_100000752 | 83 |
| 495 | 3300001979 | JGI24740J21852_10008525 | JGI24740J21852_100085252 | 83 |
| 496 | 3300002704 | JGI25155J39150_1000032 | JGI25155J39150_100003224 | 83 |
| 497 | 3300002705 | JGI25156J39149_1000129 | JGI25156J39149_100012924 | 83 |
| 498 | 3300002705 | JGI25156J39149_1005548 | JGI25156J39149_10055483 | 83 |
| 499 | 3300002737 | JGI25162J39368_1001169 | JGI25162J39368_100116918 | 83 |
| 500 | 3300002737 | JGI25162J39368_1001727 | JGI25162J39368_100172711 | 83 |
| 501 | 3300002737 | JGI25162J39368_1003463 | JGI25162J39368_10034636 | 83 |
| 502 | 3300002738 | JGI25154J39366_1000324 | JGI25154J39366_10003244 | 83 |
| 503 | 3300002739 | JGI25158J39367_1000210 | JGI25158J39367_10002108 | 83 |
| 504 | 3300002741 | JGI25157J39369_1000061 | JGI25157J39369_100006124 | 83 |
| 505 | 3300002741 | JGI25157J39369_1000624 | JGI25157J39369_100062418 | 83 |
| 506 | 3300002987 | JGI25159J45721_1000002 | JGI25159J45721_1000002191 | 83 |
| 507 | 3300002987 | JGI25159J45721_1000136 | JGI25159J45721_100013626 | 83 |
| 508 | 3300002987 | JGI25159J45721_1004812 | JGI25159J45721_10048121 | 83 |
| 509 | 3300003187 | JGI25151J46595_10025237 | JGI25151J46595_100252372 | 83 |
| 510 | 3300003187 | JGI25151J46595_10034315 | JGI25151J46595_100343153 | 83 |
| 511 | 3300003187 | JGI25151J46595_10077075 | JGI25151J46595_100770752 | 83 |
| 512 | 3300003214 | JGI25165J46597_1000028 | JGI25165J46597_1000028141 | 83 |
| 513 | 3300003214 | JGI25165J46597_1000630 | JGI25165J46597_100063021 | 83 |
| 514 | 3300003214 | JGI25165J46597_1000944 | JGI25165J46597_100094418 | 83 |
| 515 | 3300003320 | rootH2_10025055 | rootH2_100250557 | 83 |
| 516 | 3300003322 | rootL2_10082663 | rootL2_100826633 | 83 |
| 517 | 3300003323 | rootH1_10117768 | rootH1_101177683 | 83 |
| 518 | 3300003323 | rootH1_10117786 | rootH1_101177863 | 83 |
| 519 | 3300003354 | JGI25160J50197_1000008 | JGI25160J50197_1000008191 | 83 |
| 520 | 3300003354 | JGI25160J50197_1000015 | JGI25160J50197_100001537 | 83 |
| 521 | 3300003354 | JGI25160J50197_1000191 | JGI25160J50197_100019127 | 83 |
| 522 | 3300003354 | JGI25160J50197_1023350 | JGI25160J50197_10233503 | 83 |
| 523 | 3300003374 | JGI25161J50226_1000005 | JGI25161J50226_1000005204 | 83 |
| 524 | 3300003374 | JGI25161J50226_1000489 | JGI25161J50226_100048911 | 83 |
| 525 | 3300003374 | JGI25161J50226_1000704 | JGI25161J50226_10007049 | 83 |
| 526 | 3300003578 | Ga0006562J51391_1007860 | Ga0006562J51391_10078603 | 83 |
| 527 | 3300003578 | Ga0006562J51391_1097928 | Ga0006562J51391_10979282 | 83 |
| 528 | 3300003752 | Ga0055539_1014217 | Ga0055539_10142172 | 83 |
| 529 | 3300003762 | Ga0055542_1000989 | Ga0055542_10009892 | 83 |
| 530 | 3300003763 | Ga0055529_1002302 | Ga0055529_10023025 | 83 |
| 531 | 3300003771 | Ga0055526_1001505 | Ga0055526_100150513 | 83 |
| 532 | 3300003771 | Ga0055526_1013003 | Ga0055526_10130032 | 83 |
| 533 | 3300003771 | Ga0055526_1043655 | Ga0055526_10436552 | 83 |
| 534 | 3300003771 | Ga0055526_1063506 | Ga0055526_10635062 | 83 |
| 535 | 3300003775 | Ga0055524_1001479 | Ga0055524_100147911 | 83 |
| 536 | 3300003775 | Ga0055524_1007611 | Ga0055524_10076117 | 83 |
| 537 | 3300003775 | Ga0055524_1009931 | Ga0055524_10099314 | 83 |
| 538 | 3300003775 | Ga0055524_1023880 | Ga0055524_10238803 | 83 |
| 539 | 3300003775 | Ga0055524_1040839 | Ga0055524_10408392 | 83 |
| 540 | 3300003781 | Ga0055536_1000984 | Ga0055536_100098410 | 83 |
| 541 | 3300003790 | Ga0055528_1000460 | Ga0055528_10004607 | 83 |
| 542 | 3300003790 | Ga0055528_1005249 | Ga0055528_10052493 | 83 |
| 543 | 3300003790 | Ga0055528_1026969 | Ga0055528_10269693 | 83 |
| 544 | 3300003790 | Ga0055528_1090666 | Ga0055528_10906661 | 83 |
| 545 | 3300003794 | Ga0055531_10017167 | Ga0055531_100171675 | 83 |
| 546 | 3300004625 | Ga0055543_1000012 | Ga0055543_100001238 | 83 |
| 547 | 3300004625 | Ga0055543_1000040 | Ga0055543_100004051 | 83 |
| 548 | 3300004625 | Ga0055543_1001749 | Ga0055543_10017493 | 83 |
| 549 | 3300005262 | Ga0065165_1000015 | Ga0065165_1000015192 | 83 |
| 550 | 3300005262 | Ga0065165_1000095 | Ga0065165_100009515 | 83 |
| 551 | 3300005262 | Ga0065165_1000125 | Ga0065165_1000125103 | 83 |
| 552 | 3300005262 | Ga0065165_1003558 | Ga0065165_100355811 | 83 |
| 553 | 3300005262 | Ga0065165_1061053 | Ga0065165_10610532 | 83 |
| 554 | 3300005262 | Ga0065165_1112062 | Ga0065165_11120621 | 83 |
| 555 | 3300005327 | Ga0070658_11449349 | Ga0070658_114493491 | 83 |
| 556 | 3300005330 | Ga0070690_100054478 | Ga0070690_1000544784 | 83 |
| 557 | 3300005330 | Ga0070690_100723783 | Ga0070690_1007237831 | 83 |
| 558 | 3300005331 | Ga0070670_100009220 | Ga0070670_1000092203 | 83 |
| 559 | 3300005331 | Ga0070670_100656590 | Ga0070670_1006565902 | 83 |
| 560 | 3300005331 | Ga0070670_100829185 | Ga0070670_1008291852 | 83 |
| 561 | 3300005334 | Ga0068869_100804422 | Ga0068869_1008044222 | 83 |
| 562 | 3300005334 | Ga0068869_101297975 | Ga0068869_1012979752 | 83 |
| 563 | 3300005335 | Ga0070666_10148138 | Ga0070666_101481382 | 83 |
| 564 | 3300005336 | Ga0070680_100716936 | Ga0070680_1007169362 | 83 |
| 565 | 3300005336 | Ga0070680_100909786 | Ga0070680_1009097861 | 83 |
| 566 | 3300005337 | Ga0070682_100292531 | Ga0070682_1002925313 | 83 |
| 567 | 3300005337 | Ga0070682_101026383 | Ga0070682_1010263832 | 83 |
| 568 | 3300005338 | Ga0068868_100295750 | Ga0068868_1002957503 | 83 |
| 569 | 3300005338 | Ga0068868_100834536 | Ga0068868_1008345362 | 83 |
| 570 | 3300005339 | Ga0070660_100055967 | Ga0070660_1000559672 | 83 |
| 571 | 3300005340 | Ga0070689_100014099 | Ga0070689_1000140993 | 83 |
| 572 | 3300005340 | Ga0070689_100602971 | Ga0070689_1006029712 | 83 |
| 573 | 3300005343 | Ga0070687_100002628 | Ga0070687_1000026282 | 83 |
| 574 | 3300005344 | Ga0070661_100375400 | Ga0070661_1003754002 | 83 |
| 575 | 3300005344 | Ga0070661_100714655 | Ga0070661_1007146552 | 83 |
| 576 | 3300005347 | Ga0070668_100167676 | Ga0070668_1001676761 | 83 |
| 577 | 3300005347 | Ga0070668_101217888 | Ga0070668_1012178882 | 83 |
| 578 | 3300005354 | Ga0070675_100104071 | Ga0070675_1001040713 | 83 |
| 579 | 3300005354 | Ga0070675_100714828 | Ga0070675_1007148282 | 83 |
| 580 | 3300005355 | Ga0070671_100078659 | Ga0070671_1000786593 | 83 |
| 581 | 3300005355 | Ga0070671_101750644 | Ga0070671_1017506441 | 83 |
| 582 | 3300005356 | Ga0070674_100117477 | Ga0070674_1001174773 | 83 |
| 583 | 3300005356 | Ga0070674_100990778 | Ga0070674_1009907782 | 83 |
| 584 | 3300005356 | Ga0070674_102154929 | Ga0070674_1021549292 | 83 |
| 585 | 3300005364 | Ga0070673_100837545 | Ga0070673_1008375452 | 83 |
| 586 | 3300005364 | Ga0070673_101814591 | Ga0070673_1018145912 | 83 |
| 587 | 3300005364 | Ga0070673_102034949 | Ga0070673_1020349491 | 83 |
| 588 | 3300005365 | Ga0070688_100116761 | Ga0070688_1001167612 | 83 |
| 589 | 3300005366 | Ga0070659_100315195 | Ga0070659_1003151953 | 83 |
| 590 | 3300005366 | Ga0070659_100749590 | Ga0070659_1007495902 | 83 |
| 591 | 3300005367 | Ga0070667_100136430 | Ga0070667_1001364302 | 83 |
| 592 | 3300005367 | Ga0070667_100750264 | Ga0070667_1007502641 | 83 |
| 593 | 3300005367 | Ga0070667_101115791 | Ga0070667_1011157912 | 83 |
| 594 | 3300005367 | Ga0070667_101470175 | Ga0070667_1014701752 | 83 |
| 595 | 3300005367 | Ga0070667_101576079 | Ga0070667_1015760792 | 83 |
| 596 | 3300005441 | Ga0070700_100300835 | Ga0070700_1003008351 | 83 |
| 597 | 3300005445 | Ga0070708_101173899 | Ga0070708_1011738992 | 83 |
| 598 | 3300005455 | Ga0070663_100038200 | Ga0070663_1000382003 | 83 |
| 599 | 3300005455 | Ga0070663_100052068 | Ga0070663_1000520683 | 83 |
| 600 | 3300005455 | Ga0070663_100054895 | Ga0070663_1000548953 | 83 |
| 601 | 3300005455 | Ga0070663_100349623 | Ga0070663_1003496232 | 83 |
| 602 | 3300005455 | Ga0070663_100862676 | Ga0070663_1008626761 | 83 |
| 603 | 3300005455 | Ga0070663_101806730 | Ga0070663_1018067302 | 83 |
| 604 | 3300005456 | Ga0070678_100022607 | Ga0070678_1000226075 | 83 |
| 605 | 3300005456 | Ga0070678_100329089 | Ga0070678_1003290891 | 83 |
| 606 | 3300005456 | Ga0070678_100678395 | Ga0070678_1006783952 | 83 |
| 607 | 3300005457 | Ga0070662_100605516 | Ga0070662_1006055162 | 83 |
| 608 | 3300005457 | Ga0070662_101046303 | Ga0070662_1010463032 | 83 |
| 609 | 3300005458 | Ga0070681_10325145 | Ga0070681_103251452 | 83 |
| 610 | 3300005459 | Ga0068867_101568184 | Ga0068867_1015681842 | 83 |
| 611 | 3300005459 | Ga0068867_101869010 | Ga0068867_1018690102 | 83 |
| 612 | 3300005466 | Ga0070685_10637606 | Ga0070685_106376062 | 83 |
| 613 | 3300005518 | Ga0070699_101768060 | Ga0070699_1017680601 | 83 |
| 614 | 3300005530 | Ga0070679_101446866 | Ga0070679_1014468662 | 83 |
| 615 | 3300005530 | Ga0070679_101817761 | Ga0070679_1018177612 | 83 |
| 616 | 3300005539 | Ga0068853_101184563 | Ga0068853_1011845632 | 83 |
| 617 | 3300005543 | Ga0070672_100074617 | Ga0070672_1000746172 | 83 |
| 618 | 3300005544 | Ga0070686_100151471 | Ga0070686_1001514711 | 83 |
| 619 | 3300005545 | Ga0070695_100866056 | Ga0070695_1008660562 | 83 |
| 620 | 3300005546 | Ga0070696_101653125 | Ga0070696_1016531252 | 83 |
| 621 | 3300005548 | Ga0070665_100012057 | Ga0070665_1000120578 | 83 |
| 622 | 3300005548 | Ga0070665_100121404 | Ga0070665_1001214044 | 83 |
| 623 | 3300005548 | Ga0070665_100226673 | Ga0070665_1002266732 | 83 |
| 624 | 3300005548 | Ga0070665_100727811 | Ga0070665_1007278112 | 83 |
| 625 | 3300005548 | Ga0070665_101541354 | Ga0070665_1015413541 | 83 |
| 626 | 3300005548 | Ga0070665_102538616 | Ga0070665_1025386161 | 83 |
| 627 | 3300005549 | Ga0070704_100686395 | Ga0070704_1006863952 | 83 |
| 628 | 3300005563 | Ga0068855_100832466 | Ga0068855_1008324662 | 83 |
| 629 | 3300005563 | Ga0068855_101351368 | Ga0068855_1013513682 | 83 |
| 630 | 3300005563 | Ga0068855_101360002 | Ga0068855_1013600022 | 83 |
| 631 | 3300005563 | Ga0068855_101494603 | Ga0068855_1014946032 | 83 |
| 632 | 3300005564 | Ga0070664_101367996 | Ga0070664_1013679962 | 83 |
| 633 | 3300005577 | Ga0068857_101095070 | Ga0068857_1010950702 | 83 |
| 634 | 3300005577 | Ga0068857_101336963 | Ga0068857_1013369631 | 83 |
| 635 | 3300005577 | Ga0068857_102475825 | Ga0068857_1024758252 | 83 |
| 636 | 3300005578 | Ga0068854_100136143 | Ga0068854_1001361434 | 83 |
| 637 | 3300005578 | Ga0068854_100244926 | Ga0068854_1002449263 | 83 |
| 638 | 3300005578 | Ga0068854_100777584 | Ga0068854_1007775842 | 83 |
| 639 | 3300005578 | Ga0068854_101708401 | Ga0068854_1017084012 | 83 |
| 640 | 3300005578 | Ga0068854_101798367 | Ga0068854_1017983672 | 83 |
| 641 | 3300005614 | Ga0068856_100070458 | Ga0068856_1000704582 | 83 |
| 642 | 3300005615 | Ga0070702_100685868 | Ga0070702_1006858682 | 83 |
| 643 | 3300005616 | Ga0068852_100111240 | Ga0068852_1001112405 | 83 |
| 644 | 3300005616 | Ga0068852_100682644 | Ga0068852_1006826441 | 83 |
| 645 | 3300005616 | Ga0068852_102429860 | Ga0068852_1024298602 | 83 |
| 646 | 3300005617 | Ga0068859_100278386 | Ga0068859_1002783862 | 83 |
| 647 | 3300005617 | Ga0068859_101337119 | Ga0068859_1013371192 | 83 |
| 648 | 3300005617 | Ga0068859_102599594 | Ga0068859_1025995941 | 83 |
| 649 | 3300005618 | Ga0068864_100004815 | Ga0068864_1000048153 | 83 |
| 650 | 3300005618 | Ga0068864_100516260 | Ga0068864_1005162603 | 83 |
| 651 | 3300005719 | Ga0068861_100314578 | Ga0068861_1003145783 | 83 |
| 652 | 3300005719 | Ga0068861_100399749 | Ga0068861_1003997493 | 83 |
| 653 | 3300005842 | Ga0068858_100161184 | Ga0068858_1001611843 | 83 |
| 654 | 3300005842 | Ga0068858_100866151 | Ga0068858_1008661512 | 83 |
| 655 | 3300005843 | Ga0068860_100998293 | Ga0068860_1009982932 | 83 |
| 656 | 3300005844 | Ga0068862_100401566 | Ga0068862_1004015662 | 83 |
| 657 | 3300005844 | Ga0068862_101058033 | Ga0068862_1010580332 | 83 |
| 658 | 3300005985 | Ga0081539_10001131 | Ga0081539_1000113119 | 83 |
| 659 | 3300006038 | Ga0075365_10013889 | Ga0075365_100138896 | 83 |
| 660 | 3300006038 | Ga0075365_10024163 | Ga0075365_100241633 | 83 |
| 661 | 3300006038 | Ga0075365_10173955 | Ga0075365_101739552 | 83 |
| 662 | 3300006038 | Ga0075365_10356916 | Ga0075365_103569162 | 83 |
| 663 | 3300006038 | Ga0075365_10458027 | Ga0075365_104580271 | 83 |
| 664 | 3300006038 | Ga0075365_10567237 | Ga0075365_105672372 | 83 |
| 665 | 3300006038 | Ga0075365_10931011 | Ga0075365_109310112 | 83 |
| 666 | 3300006038 | Ga0075365_11335457 | Ga0075365_113354572 | 83 |
| 667 | 3300006042 | Ga0075368_10007739 | Ga0075368_100077393 | 83 |
| 668 | 3300006042 | Ga0075368_10267938 | Ga0075368_102679382 | 83 |
| 669 | 3300006048 | Ga0075363_100073258 | Ga0075363_1000732583 | 83 |
| 670 | 3300006048 | Ga0075363_100124627 | Ga0075363_1001246273 | 83 |
| 671 | 3300006048 | Ga0075363_100251247 | Ga0075363_1002512471 | 83 |
| 672 | 3300006048 | Ga0075363_101008530 | Ga0075363_1010085302 | 83 |
| 673 | 3300006051 | Ga0075364_10012041 | Ga0075364_100120415 | 83 |
| 674 | 3300006051 | Ga0075364_10553044 | Ga0075364_105530442 | 83 |
| 675 | 3300006051 | Ga0075364_10793323 | Ga0075364_107933231 | 83 |
| 676 | 3300006177 | Ga0075362_10002404 | Ga0075362_1000240410 | 83 |
| 677 | 3300006177 | Ga0075362_10024220 | Ga0075362_100242202 | 83 |
| 678 | 3300006178 | Ga0075367_10037653 | Ga0075367_100376531 | 83 |
| 679 | 3300006178 | Ga0075367_10054745 | Ga0075367_100547454 | 83 |
| 680 | 3300006178 | Ga0075367_10169458 | Ga0075367_101694582 | 83 |
| 681 | 3300006178 | Ga0075367_10227761 | Ga0075367_102277612 | 83 |
| 682 | 3300006178 | Ga0075367_10424745 | Ga0075367_104247451 | 83 |
| 683 | 3300006186 | Ga0075369_10006353 | Ga0075369_100063534 | 83 |
| 684 | 3300006186 | Ga0075369_10130104 | Ga0075369_101301041 | 83 |
| 685 | 3300006186 | Ga0075369_10180034 | Ga0075369_101800342 | 83 |
| 686 | 3300006186 | Ga0075369_10239084 | Ga0075369_102390842 | 83 |
| 687 | 3300006195 | Ga0075366_10213875 | Ga0075366_102138752 | 83 |
| 688 | 3300006195 | Ga0075366_10793893 | Ga0075366_107938931 | 83 |
| 689 | 3300006237 | Ga0097621_101948134 | Ga0097621_1019481342 | 83 |
| 690 | 3300006237 | Ga0097621_102363655 | Ga0097621_1023636552 | 83 |
| 691 | 3300006353 | Ga0075370_10023755 | Ga0075370_100237555 | 83 |
| 692 | 3300006353 | Ga0075370_10079906 | Ga0075370_100799063 | 83 |
| 693 | 3300006353 | Ga0075370_10267047 | Ga0075370_102670473 | 83 |
| 694 | 3300006353 | Ga0075370_10497113 | Ga0075370_104971132 | 83 |
| 695 | 3300006358 | Ga0068871_100579205 | Ga0068871_1005792052 | 83 |
| 696 | 3300006358 | Ga0068871_100711248 | Ga0068871_1007112482 | 83 |
| 697 | 3300006844 | Ga0075428_100235851 | Ga0075428_1002358514 | 83 |
| 698 | 3300006881 | Ga0068865_100504739 | Ga0068865_1005047392 | 83 |
| 699 | 3300006881 | Ga0068865_100564251 | Ga0068865_1005642512 | 83 |
| 700 | 3300006881 | Ga0068865_101074993 | Ga0068865_1010749932 | 83 |
| 701 | 3300006931 | Ga0097620_100278387 | Ga0097620_1002783872 | 83 |
| 702 | 3300006931 | Ga0097620_101336670 | Ga0097620_1013366702 | 83 |
| 703 | 3300006931 | Ga0097620_102599881 | Ga0097620_1025998812 | 83 |
| 704 | 3300009011 | Ga0105251_10008871 | Ga0105251_100088714 | 83 |
| 705 | 3300009036 | Ga0105244_10496521 | Ga0105244_104965212 | 83 |
| 706 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032182 | 83 |
| 707 | 3300009093 | Ga0105240_10381721 | Ga0105240_103817213 | 83 |
| 708 | 3300009093 | Ga0105240_10527204 | Ga0105240_105272043 | 83 |
| 709 | 3300009094 | Ga0111539_10286338 | Ga0111539_102863383 | 83 |
| 710 | 3300009094 | Ga0111539_11718509 | Ga0111539_117185092 | 83 |
| 711 | 3300009094 | Ga0111539_11918052 | Ga0111539_119180522 | 83 |
| 712 | 3300009094 | Ga0111539_12969398 | Ga0111539_129693982 | 83 |
| 713 | 3300009098 | Ga0105245_10123083 | Ga0105245_101230833 | 83 |
| 714 | 3300009098 | Ga0105245_11845478 | Ga0105245_118454782 | 83 |
| 715 | 3300009098 | Ga0105245_11854741 | Ga0105245_118547412 | 83 |
| 716 | 3300009101 | Ga0105247_10054813 | Ga0105247_100548132 | 83 |
| 717 | 3300009101 | Ga0105247_10893303 | Ga0105247_108933032 | 83 |
| 718 | 3300009101 | Ga0105247_11669274 | Ga0105247_116692741 | 83 |
| 719 | 3300009148 | Ga0105243_10250889 | Ga0105243_102508892 | 83 |
| 720 | 3300009148 | Ga0105243_10546312 | Ga0105243_105463122 | 83 |
| 721 | 3300009148 | Ga0105243_11147000 | Ga0105243_111470002 | 83 |
| 722 | 3300009148 | Ga0105243_11304643 | Ga0105243_113046432 | 83 |
| 723 | 3300009148 | Ga0105243_12052874 | Ga0105243_120528742 | 83 |
| 724 | 3300009176 | Ga0105242_10180889 | Ga0105242_101808893 | 83 |
| 725 | 3300009176 | Ga0105242_12183621 | Ga0105242_121836212 | 83 |
| 726 | 3300009177 | Ga0105248_10015377 | Ga0105248_100153777 | 83 |
| 727 | 3300009177 | Ga0105248_10335817 | Ga0105248_103358172 | 83 |
| 728 | 3300009177 | Ga0105248_10660482 | Ga0105248_106604823 | 83 |
| 729 | 3300009177 | Ga0105248_12313296 | Ga0105248_123132962 | 83 |
| 730 | 3300009545 | Ga0105237_10002365 | Ga0105237_100023659 | 83 |
| 731 | 3300009545 | Ga0105237_11856567 | Ga0105237_118565671 | 83 |
| 732 | 3300009551 | Ga0105238_10092726 | Ga0105238_100927264 | 83 |
| 733 | 3300009553 | Ga0105249_10302469 | Ga0105249_103024692 | 83 |
| 734 | 3300009553 | Ga0105249_10865072 | Ga0105249_108650722 | 83 |
| 735 | 3300009766 | Ga0123342_1042104 | Ga0123342_10421043 | 83 |
| 736 | 3300010159 | Ga0099796_10046910 | Ga0099796_100469102 | 83 |
| 737 | 3300010375 | Ga0105239_10012029 | Ga0105239_1001202912 | 83 |
| 738 | 3300010375 | Ga0105239_10013157 | Ga0105239_100131578 | 83 |
| 739 | 3300010375 | Ga0105239_11075225 | Ga0105239_110752252 | 83 |
| 740 | 3300010375 | Ga0105239_11341881 | Ga0105239_113418811 | 83 |
| 741 | 3300010375 | Ga0105239_11747489 | Ga0105239_117474892 | 83 |
| 742 | 3300011119 | Ga0105246_10368627 | Ga0105246_103686272 | 83 |
| 743 | 3300011119 | Ga0105246_10959503 | Ga0105246_109595032 | 83 |
| 744 | 3300011119 | Ga0105246_12592543 | Ga0105246_125925431 | 83 |
| 745 | 3300012500 | Ga0157314_1046160 | Ga0157314_10461602 | 83 |
| 746 | 3300012503 | Ga0157313_1033713 | Ga0157313_10337132 | 83 |
| 747 | 3300013100 | Ga0157373_10135794 | Ga0157373_101357943 | 83 |
| 748 | 3300013100 | Ga0157373_10777314 | Ga0157373_107773142 | 83 |
| 749 | 3300013102 | Ga0157371_10891306 | Ga0157371_108913062 | 83 |
| 750 | 3300013104 | Ga0157370_10003636 | Ga0157370_1000363612 | 83 |
| 751 | 3300013104 | Ga0157370_10113036 | Ga0157370_101130364 | 83 |
| 752 | 3300013104 | Ga0157370_10305394 | Ga0157370_103053942 | 83 |
| 753 | 3300013104 | Ga0157370_10694141 | Ga0157370_106941412 | 83 |
| 754 | 3300013104 | Ga0157370_10849273 | Ga0157370_108492732 | 83 |
| 755 | 3300013105 | Ga0157369_10049860 | Ga0157369_100498604 | 83 |
| 756 | 3300013105 | Ga0157369_10185520 | Ga0157369_101855203 | 83 |
| 757 | 3300013105 | Ga0157369_10199521 | Ga0157369_101995212 | 83 |
| 758 | 3300013249 | Ga0171463_1001 | Ga0171463_1001181 | 83 |
| 759 | 3300013250 | Ga0171462_1006 | Ga0171462_1006247 | 83 |
| 760 | 3300013296 | Ga0157374_10111656 | Ga0157374_101116562 | 83 |
| 761 | 3300013296 | Ga0157374_11011596 | Ga0157374_110115962 | 83 |
| 762 | 3300013296 | Ga0157374_12037994 | Ga0157374_120379942 | 83 |
| 763 | 3300013297 | Ga0157378_10256214 | Ga0157378_102562142 | 83 |
| 764 | 3300013297 | Ga0157378_10698258 | Ga0157378_106982583 | 83 |
| 765 | 3300013297 | Ga0157378_11290035 | Ga0157378_112900352 | 83 |
| 766 | 3300013306 | Ga0163162_10040362 | Ga0163162_100403624 | 83 |
| 767 | 3300013306 | Ga0163162_10226735 | Ga0163162_102267353 | 83 |
| 768 | 3300013306 | Ga0163162_10789499 | Ga0163162_107894992 | 83 |
| 769 | 3300013307 | Ga0157372_11527829 | Ga0157372_115278292 | 83 |
| 770 | 3300013308 | Ga0157375_11269747 | Ga0157375_112697472 | 83 |
| 771 | 3300013308 | Ga0157375_12450897 | Ga0157375_124508972 | 83 |
| 772 | 3300013308 | Ga0157375_12996842 | Ga0157375_129968422 | 83 |
| 773 | 3300013308 | Ga0157375_13218066 | Ga0157375_132180662 | 83 |
| 774 | 3300013308 | Ga0157375_13631517 | Ga0157375_136315171 | 83 |
| 775 | 3300014325 | Ga0163163_10559799 | Ga0163163_105597993 | 83 |
| 776 | 3300014326 | Ga0157380_10201489 | Ga0157380_102014891 | 83 |
| 777 | 3300014326 | Ga0157380_10663586 | Ga0157380_106635862 | 83 |
| 778 | 3300014326 | Ga0157380_11000817 | Ga0157380_110008172 | 83 |
| 779 | 3300014497 | Ga0182008_10055587 | Ga0182008_100555873 | 83 |
| 780 | 3300014497 | Ga0182008_10075376 | Ga0182008_100753762 | 83 |
| 781 | 3300014497 | Ga0182008_10210516 | Ga0182008_102105162 | 83 |
| 782 | 3300014497 | Ga0182008_10449140 | Ga0182008_104491402 | 83 |
| 783 | 3300014745 | Ga0157377_10354396 | Ga0157377_103543962 | 83 |
| 784 | 3300014968 | Ga0157379_10980218 | Ga0157379_109802182 | 83 |
| 785 | 3300014968 | Ga0157379_11011881 | Ga0157379_110118811 | 83 |
| 786 | 3300014969 | Ga0157376_10610420 | Ga0157376_106104202 | 83 |
| 787 | 3300014969 | Ga0157376_10850109 | Ga0157376_108501092 | 83 |
| 788 | 3300014969 | Ga0157376_12094137 | Ga0157376_120941371 | 83 |
| 789 | 3300015262 | Ga0182007_10000460 | Ga0182007_1000046019 | 83 |
| 790 | 3300015265 | Ga0182005_1015635 | Ga0182005_10156353 | 83 |
| 791 | 3300015690 | Ga0183363_1412 | Ga0183363_14126 | 83 |
| 792 | 3300017792 | Ga0163161_10516212 | Ga0163161_105162122 | 83 |
| 793 | 3300017792 | Ga0163161_10715323 | Ga0163161_107153232 | 83 |
| 794 | 3300017792 | Ga0163161_11229244 | Ga0163161_112292441 | 83 |
| 795 | 3300017792 | Ga0163161_11933006 | Ga0163161_119330061 | 83 |
| 796 | 3300021320 | Ga0214544_1000017 | Ga0214544_1000017149 | 83 |
| 797 | 3300021321 | Ga0214542_1000006 | Ga0214542_100000681 | 83 |
| 798 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003518 | 83 |
| 799 | 3300021327 | Ga0214543_1000014 | Ga0214543_1000014242 | 83 |
| 800 | 3300021377 | Ga0213874_10014157 | Ga0213874_100141572 | 83 |
| 801 | 3300022739 | Ga0228711_1000001 | Ga0228711_100000124 | 83 |
| 802 | 3300022740 | Ga0228710_1000001 | Ga0228710_1000001301 | 83 |
| 803 | 3300024227 | Ga0228598_1031096 | Ga0228598_10310962 | 83 |
| 804 | 3300025206 | Ga0209435_100042 | Ga0209435_10004225 | 83 |
| 805 | 3300025208 | Ga0209436_101739 | Ga0209436_1017393 | 83 |
| 806 | 3300025228 | Ga0209672_123228 | Ga0209672_1232281 | 83 |
| 807 | 3300025231 | Ga0207427_113132 | Ga0207427_1131322 | 83 |
| 808 | 3300025233 | Ga0209437_100033 | Ga0209437_100033311 | 83 |
| 809 | 3300025233 | Ga0209437_100075 | Ga0209437_100075195 | 83 |
| 810 | 3300025245 | Ga0207425_1025968 | Ga0207425_10259682 | 83 |
| 811 | 3300025245 | Ga0207425_1054664 | Ga0207425_10546641 | 83 |
| 812 | 3300025246 | Ga0209646_1000145 | Ga0209646_100014525 | 83 |
| 813 | 3300025246 | Ga0209646_1008549 | Ga0209646_10085492 | 83 |
| 814 | 3300025246 | Ga0209646_1017574 | Ga0209646_10175742 | 83 |
| 815 | 3300025250 | Ga0209026_1000120 | Ga0209026_100012055 | 83 |
| 816 | 3300025250 | Ga0209026_1000160 | Ga0209026_100016025 | 83 |
| 817 | 3300025253 | Ga0209677_100845 | Ga0209677_10084510 | 83 |
| 818 | 3300025254 | Ga0209148_1000056 | Ga0209148_1000056262 | 83 |
| 819 | 3300025254 | Ga0209148_1007473 | Ga0209148_10074732 | 83 |
| 820 | 3300025254 | Ga0209148_1037625 | Ga0209148_10376252 | 83 |
| 821 | 3300025256 | Ga0209759_1000177 | Ga0209759_100017725 | 83 |
| 822 | 3300025256 | Ga0209759_1000288 | Ga0209759_100028850 | 83 |
| 823 | 3300025256 | Ga0209759_1046353 | Ga0209759_10463532 | 83 |
| 824 | 3300025258 | Ga0209129_1000137 | Ga0209129_100013712 | 83 |
| 825 | 3300025258 | Ga0209129_1001697 | Ga0209129_10016976 | 83 |
| 826 | 3300025261 | Ga0209233_1000056 | Ga0209233_100005621 | 83 |
| 827 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064111 | 83 |
| 828 | 3300025261 | Ga0209233_1000087 | Ga0209233_1000087142 | 83 |
| 829 | 3300025261 | Ga0209233_1000209 | Ga0209233_100020997 | 83 |
| 830 | 3300025261 | Ga0209233_1004475 | Ga0209233_10044752 | 83 |
| 831 | 3300025272 | Ga0209455_1000777 | Ga0209455_100077716 | 83 |
| 832 | 3300025272 | Ga0209455_1021938 | Ga0209455_10219382 | 83 |
| 833 | 3300025273 | Ga0209673_1000319 | Ga0209673_100031937 | 83 |
| 834 | 3300025273 | Ga0209673_1001326 | Ga0209673_100132621 | 83 |
| 835 | 3300025273 | Ga0209673_1004666 | Ga0209673_10046668 | 83 |
| 836 | 3300025273 | Ga0209673_1066826 | Ga0209673_10668262 | 83 |
| 837 | 3300025273 | Ga0209673_1100635 | Ga0209673_11006352 | 83 |
| 838 | 3300025273 | Ga0209673_1102733 | Ga0209673_11027332 | 83 |
| 839 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007111 | 83 |
| 840 | 3300025284 | Ga0209130_1000018 | Ga0209130_1000018233 | 83 |
| 841 | 3300025284 | Ga0209130_1000148 | Ga0209130_1000148107 | 83 |
| 842 | 3300025284 | Ga0209130_1013563 | Ga0209130_10135633 | 83 |
| 843 | 3300025284 | Ga0209130_1022880 | Ga0209130_10228803 | 83 |
| 844 | 3300025291 | Ga0209675_1035650 | Ga0209675_10356501 | 83 |
| 845 | 3300025292 | Ga0209676_1000694 | Ga0209676_100069430 | 83 |
| 846 | 3300025292 | Ga0209676_1017727 | Ga0209676_10177271 | 83 |
| 847 | 3300025294 | Ga0209025_1000149 | Ga0209025_1000149113 | 83 |
| 848 | 3300025294 | Ga0209025_1000580 | Ga0209025_100058020 | 83 |
| 849 | 3300025294 | Ga0209025_1009457 | Ga0209025_10094576 | 83 |
| 850 | 3300025294 | Ga0209025_1010350 | Ga0209025_10103503 | 83 |
| 851 | 3300025294 | Ga0209025_1015894 | Ga0209025_10158943 | 83 |
| 852 | 3300025294 | Ga0209025_1019505 | Ga0209025_10195052 | 83 |
| 853 | 3300025294 | Ga0209025_1026975 | Ga0209025_10269753 | 83 |
| 854 | 3300025294 | Ga0209025_1046050 | Ga0209025_10460502 | 83 |
| 855 | 3300025294 | Ga0209025_1117947 | Ga0209025_11179472 | 83 |
| 856 | 3300025294 | Ga0209025_1147818 | Ga0209025_11478181 | 83 |
| 857 | 3300025295 | Ga0209564_1000431 | Ga0209564_100043128 | 83 |
| 858 | 3300025295 | Ga0209564_1001106 | Ga0209564_100110616 | 83 |
| 859 | 3300025295 | Ga0209564_1001342 | Ga0209564_100134220 | 83 |
| 860 | 3300025295 | Ga0209564_1009309 | Ga0209564_10093092 | 83 |
| 861 | 3300025295 | Ga0209564_1050292 | Ga0209564_10502922 | 83 |
| 862 | 3300025295 | Ga0209564_1057945 | Ga0209564_10579452 | 83 |
| 863 | 3300025297 | Ga0209758_1009477 | Ga0209758_10094778 | 83 |
| 864 | 3300025297 | Ga0209758_1031764 | Ga0209758_10317643 | 83 |
| 865 | 3300025297 | Ga0209758_1060745 | Ga0209758_10607452 | 83 |
| 866 | 3300025297 | Ga0209758_1075338 | Ga0209758_10753383 | 83 |
| 867 | 3300025297 | Ga0209758_1152389 | Ga0209758_11523892 | 83 |
| 868 | 3300025298 | Ga0209050_1002170 | Ga0209050_100217011 | 83 |
| 869 | 3300025298 | Ga0209050_1073321 | Ga0209050_10733212 | 83 |
| 870 | 3300025299 | Ga0209256_1000877 | Ga0209256_100087721 | 83 |
| 871 | 3300025299 | Ga0209256_1001068 | Ga0209256_10010688 | 83 |
| 872 | 3300025299 | Ga0209256_1001781 | Ga0209256_10017817 | 83 |
| 873 | 3300025299 | Ga0209256_1005328 | Ga0209256_10053284 | 83 |
| 874 | 3300025299 | Ga0209256_1005521 | Ga0209256_10055212 | 83 |
| 875 | 3300025299 | Ga0209256_1008937 | Ga0209256_10089371 | 83 |
| 876 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044156 | 83 |
| 877 | 3300025302 | Ga0207426_1000064 | Ga0207426_1000064111 | 83 |
| 878 | 3300025302 | Ga0207426_1000119 | Ga0207426_1000119179 | 83 |
| 879 | 3300025302 | Ga0207426_1005259 | Ga0207426_10052594 | 83 |
| 880 | 3300025303 | Ga0209051_1015125 | Ga0209051_10151255 | 83 |
| 881 | 3300025303 | Ga0209051_1021615 | Ga0209051_10216152 | 83 |
| 882 | 3300025303 | Ga0209051_1022549 | Ga0209051_10225493 | 83 |
| 883 | 3300025303 | Ga0209051_1025554 | Ga0209051_10255543 | 83 |
| 884 | 3300025304 | Ga0209257_1005277 | Ga0209257_100527711 | 83 |
| 885 | 3300025304 | Ga0209257_1038965 | Ga0209257_10389652 | 83 |
| 886 | 3300025304 | Ga0209257_1084948 | Ga0209257_10849482 | 83 |
| 887 | 3300025304 | Ga0209257_1128230 | Ga0209257_11282302 | 83 |
| 888 | 3300025315 | Ga0207697_10506497 | Ga0207697_105064972 | 83 |
| 889 | 3300025728 | Ga0207655_1136851 | Ga0207655_11368512 | 83 |
| 890 | 3300025735 | Ga0207713_1016350 | Ga0207713_10163504 | 83 |
| 891 | 3300025893 | Ga0207682_10016410 | Ga0207682_100164105 | 83 |
| 892 | 3300025900 | Ga0207710_10713050 | Ga0207710_107130502 | 83 |
| 893 | 3300025901 | Ga0207688_10142825 | Ga0207688_101428252 | 83 |
| 894 | 3300025901 | Ga0207688_10846381 | Ga0207688_108463812 | 83 |
| 895 | 3300025903 | Ga0207680_10276331 | Ga0207680_102763313 | 83 |
| 896 | 3300025904 | Ga0207647_10285591 | Ga0207647_102855912 | 83 |
| 897 | 3300025907 | Ga0207645_10021086 | Ga0207645_100210865 | 83 |
| 898 | 3300025907 | Ga0207645_10379884 | Ga0207645_103798842 | 83 |
| 899 | 3300025908 | Ga0207643_10459258 | Ga0207643_104592582 | 83 |
| 900 | 3300025909 | Ga0207705_10149112 | Ga0207705_101491123 | 83 |
| 901 | 3300025909 | Ga0207705_10585120 | Ga0207705_105851202 | 83 |
| 902 | 3300025912 | Ga0207707_10275687 | Ga0207707_102756872 | 83 |
| 903 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024183 | 83 |
| 904 | 3300025913 | Ga0207695_10068516 | Ga0207695_100685163 | 83 |
| 905 | 3300025913 | Ga0207695_10158443 | Ga0207695_101584432 | 83 |
| 906 | 3300025913 | Ga0207695_10991360 | Ga0207695_109913601 | 83 |
| 907 | 3300025914 | Ga0207671_10000718 | Ga0207671_1000071818 | 83 |
| 908 | 3300025916 | Ga0207663_10586278 | Ga0207663_105862782 | 83 |
| 909 | 3300025918 | Ga0207662_10782504 | Ga0207662_107825042 | 83 |
| 910 | 3300025919 | Ga0207657_10103856 | Ga0207657_101038563 | 83 |
| 911 | 3300025920 | Ga0207649_10744690 | Ga0207649_107446902 | 83 |
| 912 | 3300025920 | Ga0207649_10894806 | Ga0207649_108948062 | 83 |
| 913 | 3300025920 | Ga0207649_11198737 | Ga0207649_111987372 | 83 |
| 914 | 3300025920 | Ga0207649_11578143 | Ga0207649_115781432 | 83 |
| 915 | 3300025921 | Ga0207652_11019144 | Ga0207652_110191442 | 83 |
| 916 | 3300025921 | Ga0207652_11596561 | Ga0207652_115965611 | 83 |
| 917 | 3300025923 | Ga0207681_10555121 | Ga0207681_105551213 | 83 |
| 918 | 3300025923 | Ga0207681_11555692 | Ga0207681_115556921 | 83 |
| 919 | 3300025924 | Ga0207694_10472535 | Ga0207694_104725352 | 83 |
| 920 | 3300025925 | Ga0207650_10005961 | Ga0207650_100059613 | 83 |
| 921 | 3300025926 | Ga0207659_10893205 | Ga0207659_108932052 | 83 |
| 922 | 3300025927 | Ga0207687_10156457 | Ga0207687_101564573 | 83 |
| 923 | 3300025931 | Ga0207644_10048295 | Ga0207644_100482952 | 83 |
| 924 | 3300025931 | Ga0207644_10051407 | Ga0207644_100514072 | 83 |
| 925 | 3300025931 | Ga0207644_11219243 | Ga0207644_112192432 | 83 |
| 926 | 3300025932 | Ga0207690_10147147 | Ga0207690_101471473 | 83 |
| 927 | 3300025932 | Ga0207690_10803309 | Ga0207690_108033092 | 83 |
| 928 | 3300025933 | Ga0207706_10145632 | Ga0207706_101456323 | 83 |
| 929 | 3300025933 | Ga0207706_10963393 | Ga0207706_109633932 | 83 |
| 930 | 3300025933 | Ga0207706_10977684 | Ga0207706_109776842 | 83 |
| 931 | 3300025933 | Ga0207706_11397420 | Ga0207706_113974202 | 83 |
| 932 | 3300025934 | Ga0207686_10266629 | Ga0207686_102666293 | 83 |
| 933 | 3300025935 | Ga0207709_10150026 | Ga0207709_101500261 | 83 |
| 934 | 3300025935 | Ga0207709_10344727 | Ga0207709_103447272 | 83 |
| 935 | 3300025935 | Ga0207709_10977994 | Ga0207709_109779941 | 83 |
| 936 | 3300025936 | Ga0207670_10003940 | Ga0207670_100039403 | 83 |
| 937 | 3300025937 | Ga0207669_10110122 | Ga0207669_101101222 | 83 |
| 938 | 3300025937 | Ga0207669_10344493 | Ga0207669_103444932 | 83 |
| 939 | 3300025938 | Ga0207704_11181416 | Ga0207704_111814161 | 83 |
| 940 | 3300025940 | Ga0207691_10640451 | Ga0207691_106404512 | 83 |
| 941 | 3300025941 | Ga0207711_10076090 | Ga0207711_100760903 | 83 |
| 942 | 3300025941 | Ga0207711_11662394 | Ga0207711_116623942 | 83 |
| 943 | 3300025942 | Ga0207689_11319931 | Ga0207689_113199312 | 83 |
| 944 | 3300025944 | Ga0207661_10637934 | Ga0207661_106379342 | 83 |
| 945 | 3300025945 | Ga0207679_11020068 | Ga0207679_110200682 | 83 |
| 946 | 3300025949 | Ga0207667_11057673 | Ga0207667_110576732 | 83 |
| 947 | 3300025949 | Ga0207667_11308885 | Ga0207667_113088852 | 83 |
| 948 | 3300025960 | Ga0207651_10205792 | Ga0207651_102057922 | 83 |
| 949 | 3300025960 | Ga0207651_10743365 | Ga0207651_107433652 | 83 |
| 950 | 3300025960 | Ga0207651_10868605 | Ga0207651_108686052 | 83 |
| 951 | 3300025961 | Ga0207712_10564920 | Ga0207712_105649202 | 83 |
| 952 | 3300025961 | Ga0207712_11067324 | Ga0207712_110673242 | 83 |
| 953 | 3300025972 | Ga0207668_10179167 | Ga0207668_101791673 | 83 |
| 954 | 3300025972 | Ga0207668_10671379 | Ga0207668_106713792 | 83 |
| 955 | 3300025972 | Ga0207668_10864079 | Ga0207668_108640792 | 83 |
| 956 | 3300025981 | Ga0207640_10150463 | Ga0207640_101504632 | 83 |
| 957 | 3300025981 | Ga0207640_10155131 | Ga0207640_101551313 | 83 |
| 958 | 3300025981 | Ga0207640_11304725 | Ga0207640_113047252 | 83 |
| 959 | 3300025986 | Ga0207658_10129704 | Ga0207658_101297043 | 83 |
| 960 | 3300025986 | Ga0207658_10202043 | Ga0207658_102020433 | 83 |
| 961 | 3300025986 | Ga0207658_10313549 | Ga0207658_103135492 | 83 |
| 962 | 3300025986 | Ga0207658_10703577 | Ga0207658_107035772 | 83 |
| 963 | 3300025986 | Ga0207658_11707178 | Ga0207658_117071782 | 83 |
| 964 | 3300026023 | Ga0207677_10122790 | Ga0207677_101227903 | 83 |
| 965 | 3300026023 | Ga0207677_11279385 | Ga0207677_112793852 | 83 |
| 966 | 3300026023 | Ga0207677_12065241 | Ga0207677_120652412 | 83 |
| 967 | 3300026035 | Ga0207703_10483128 | Ga0207703_104831282 | 83 |
| 968 | 3300026035 | Ga0207703_10772864 | Ga0207703_107728642 | 83 |
| 969 | 3300026041 | Ga0207639_10335608 | Ga0207639_103356082 | 83 |
| 970 | 3300026041 | Ga0207639_11494026 | Ga0207639_114940262 | 83 |
| 971 | 3300026067 | Ga0207678_10058238 | Ga0207678_100582385 | 83 |
| 972 | 3300026067 | Ga0207678_10129738 | Ga0207678_101297383 | 83 |
| 973 | 3300026067 | Ga0207678_10525768 | Ga0207678_105257682 | 83 |
| 974 | 3300026067 | Ga0207678_10588475 | Ga0207678_105884752 | 83 |
| 975 | 3300026067 | Ga0207678_10637871 | Ga0207678_106378712 | 83 |
| 976 | 3300026067 | Ga0207678_10683760 | Ga0207678_106837602 | 83 |
| 977 | 3300026075 | Ga0207708_10137301 | Ga0207708_101373013 | 83 |
| 978 | 3300026078 | Ga0207702_11714129 | Ga0207702_117141292 | 83 |
| 979 | 3300026078 | Ga0207702_11837235 | Ga0207702_118372352 | 83 |
| 980 | 3300026088 | Ga0207641_10636151 | Ga0207641_106361511 | 83 |
| 981 | 3300026089 | Ga0207648_10959821 | Ga0207648_109598212 | 83 |
| 982 | 3300026095 | Ga0207676_10003179 | Ga0207676_100031793 | 83 |
| 983 | 3300026095 | Ga0207676_10523656 | Ga0207676_105236562 | 83 |
| 984 | 3300026116 | Ga0207674_11293015 | Ga0207674_112930152 | 83 |
| 985 | 3300026116 | Ga0207674_11840489 | Ga0207674_118404892 | 83 |
| 986 | 3300026118 | Ga0207675_100121294 | Ga0207675_1001212943 | 83 |
| 987 | 3300026118 | Ga0207675_100765701 | Ga0207675_1007657012 | 83 |
| 988 | 3300026121 | Ga0207683_10012420 | Ga0207683_100124205 | 83 |
| 989 | 3300026121 | Ga0207683_10048163 | Ga0207683_100481632 | 83 |
| 990 | 3300026121 | Ga0207683_10177284 | Ga0207683_101772844 | 83 |
| 991 | 3300026121 | Ga0207683_10661389 | Ga0207683_106613892 | 83 |
| 992 | 3300026142 | Ga0207698_10034126 | Ga0207698_100341266 | 83 |
| 993 | 3300027111 | Ga0209281_1000236 | Ga0209281_100023629 | 83 |
| 994 | 3300027111 | Ga0209281_1000266 | Ga0209281_100026675 | 83 |
| 995 | 3300027312 | Ga0209371_1001249 | Ga0209371_100124913 | 83 |
| 996 | 3300027666 | Ga0209282_1000007 | Ga0209282_1000007229 | 83 |
| 997 | 3300027666 | Ga0209282_1401494 | Ga0209282_14014941 | 83 |
| 998 | 3300027866 | Ga0209813_10183299 | Ga0209813_101832992 | 83 |
| 999 | 3300027876 | Ga0209974_10068959 | Ga0209974_100689592 | 83 |
| 1000 | 3300027907 | Ga0207428_10364317 | Ga0207428_103643172 | 83 |
| 1001 | 3300028379 | Ga0268266_10014527 | Ga0268266_100145277 | 83 |
| 1002 | 3300028379 | Ga0268266_10107861 | Ga0268266_101078613 | 83 |
| 1003 | 3300028379 | Ga0268266_10209519 | Ga0268266_102095193 | 83 |
| 1004 | 3300028379 | Ga0268266_10238826 | Ga0268266_102388263 | 83 |
| 1005 | 3300028379 | Ga0268266_10698121 | Ga0268266_106981212 | 83 |
| 1006 | 3300028379 | Ga0268266_10823368 | Ga0268266_108233682 | 83 |
| 1007 | 3300028379 | Ga0268266_11366561 | Ga0268266_113665612 | 83 |
| 1008 | 3300028379 | Ga0268266_11417798 | Ga0268266_114177982 | 83 |
| 1009 | 3300028380 | Ga0268265_10816259 | Ga0268265_108162592 | 83 |
| 1010 | 3300028380 | Ga0268265_11158668 | Ga0268265_111586682 | 83 |
| 1011 | 3300028380 | Ga0268265_11583614 | Ga0268265_115836141 | 83 |
| 1012 | 3300028381 | Ga0268264_10858757 | Ga0268264_108587572 | 83 |
| 1013 | 3300028794 | Ga0307515_10010607 | Ga0307515_1001060718 | 83 |
| 1014 | 3300028794 | Ga0307515_10196211 | Ga0307515_101962111 | 83 |
| 1015 | 3300028794 | Ga0307515_10533009 | Ga0307515_105330092 | 83 |
| 1016 | 3300030500 | Ga0268256_1000660 | Ga0268256_10006608 | 83 |
| 1017 | 3300031235 | Ga0265330_10083771 | Ga0265330_100837712 | 83 |
| 1018 | 3300031235 | Ga0265330_10171737 | Ga0265330_101717372 | 83 |
| 1019 | 3300031238 | Ga0265332_10158692 | Ga0265332_101586922 | 83 |
| 1020 | 3300031239 | Ga0265328_10062459 | Ga0265328_100624592 | 83 |
| 1021 | 3300031239 | Ga0265328_10298263 | Ga0265328_102982632 | 83 |
| 1022 | 3300031241 | Ga0265325_10030702 | Ga0265325_100307023 | 83 |
| 1023 | 3300031241 | Ga0265325_10090453 | Ga0265325_100904531 | 83 |
| 1024 | 3300031241 | Ga0265325_10140843 | Ga0265325_101408432 | 83 |
| 1025 | 3300031241 | Ga0265325_10225700 | Ga0265325_102257002 | 83 |
| 1026 | 3300031242 | Ga0265329_10149690 | Ga0265329_101496902 | 83 |
| 1027 | 3300031247 | Ga0265340_10001562 | Ga0265340_1000156214 | 83 |
| 1028 | 3300031247 | Ga0265340_10042630 | Ga0265340_100426302 | 83 |
| 1029 | 3300031247 | Ga0265340_10043089 | Ga0265340_100430892 | 83 |
| 1030 | 3300031247 | Ga0265340_10045419 | Ga0265340_100454193 | 83 |
| 1031 | 3300031247 | Ga0265340_10045992 | Ga0265340_100459923 | 83 |
| 1032 | 3300031247 | Ga0265340_10263442 | Ga0265340_102634422 | 83 |
| 1033 | 3300031249 | Ga0265339_10091947 | Ga0265339_100919472 | 83 |
| 1034 | 3300031249 | Ga0265339_10156184 | Ga0265339_101561842 | 83 |
| 1035 | 3300031249 | Ga0265339_10415584 | Ga0265339_104155842 | 83 |
| 1036 | 3300031249 | Ga0265339_10478538 | Ga0265339_104785382 | 83 |
| 1037 | 3300031250 | Ga0265331_10001287 | Ga0265331_1000128721 | 83 |
| 1038 | 3300031250 | Ga0265331_10089679 | Ga0265331_100896793 | 83 |
| 1039 | 3300031250 | Ga0265331_10097138 | Ga0265331_100971382 | 83 |
| 1040 | 3300031250 | Ga0265331_10368994 | Ga0265331_103689942 | 83 |
| 1041 | 3300031250 | Ga0265331_10555454 | Ga0265331_105554541 | 83 |
| 1042 | 3300031251 | Ga0265327_10000095 | Ga0265327_10000095128 | 83 |
| 1043 | 3300031344 | Ga0265316_10185929 | Ga0265316_101859293 | 83 |
| 1044 | 3300031344 | Ga0265316_10930171 | Ga0265316_109301712 | 83 |
| 1045 | 3300031456 | Ga0307513_10006330 | Ga0307513_100063306 | 83 |
| 1046 | 3300031456 | Ga0307513_10214632 | Ga0307513_102146322 | 83 |
| 1047 | 3300031456 | Ga0307513_10309409 | Ga0307513_103094092 | 83 |
| 1048 | 3300031548 | Ga0307408_100057540 | Ga0307408_1000575404 | 83 |
| 1049 | 3300031548 | Ga0307408_100135901 | Ga0307408_1001359012 | 83 |
| 1050 | 3300031548 | Ga0307408_101366534 | Ga0307408_1013665342 | 83 |
| 1051 | 3300031548 | Ga0307408_101833211 | Ga0307408_1018332112 | 83 |
| 1052 | 3300031595 | Ga0265313_10007558 | Ga0265313_100075583 | 83 |
| 1053 | 3300031595 | Ga0265313_10019903 | Ga0265313_100199032 | 83 |
| 1054 | 3300031595 | Ga0265313_10031991 | Ga0265313_100319913 | 83 |
| 1055 | 3300031595 | Ga0265313_10112760 | Ga0265313_101127602 | 83 |
| 1056 | 3300031665 | Ga0316575_10170132 | Ga0316575_101701322 | 83 |
| 1057 | 3300031691 | Ga0316579_10080566 | Ga0316579_100805662 | 83 |
| 1058 | 3300031711 | Ga0265314_10037766 | Ga0265314_100377665 | 83 |
| 1059 | 3300031711 | Ga0265314_10146472 | Ga0265314_101464721 | 83 |
| 1060 | 3300031711 | Ga0265314_10162969 | Ga0265314_101629693 | 83 |
| 1061 | 3300031711 | Ga0265314_10561813 | Ga0265314_105618131 | 83 |
| 1062 | 3300031712 | Ga0265342_10064019 | Ga0265342_100640193 | 83 |
| 1063 | 3300031712 | Ga0265342_10170989 | Ga0265342_101709892 | 83 |
| 1064 | 3300031712 | Ga0265342_10180588 | Ga0265342_101805883 | 83 |
| 1065 | 3300031712 | Ga0265342_10624597 | Ga0265342_106245971 | 83 |
| 1066 | 3300031730 | Ga0307516_10104873 | Ga0307516_101048732 | 83 |
| 1067 | 3300031731 | Ga0307405_10177698 | Ga0307405_101776982 | 83 |
| 1068 | 3300031731 | Ga0307405_10191204 | Ga0307405_101912043 | 83 |
| 1069 | 3300031731 | Ga0307405_10522614 | Ga0307405_105226143 | 83 |
| 1070 | 3300031731 | Ga0307405_11553399 | Ga0307405_115533992 | 83 |
| 1071 | 3300031733 | Ga0316577_10609486 | Ga0316577_106094862 | 83 |
| 1072 | 3300031824 | Ga0307413_10071775 | Ga0307413_100717753 | 83 |
| 1073 | 3300031852 | Ga0307410_10108694 | Ga0307410_101086942 | 83 |
| 1074 | 3300031901 | Ga0307406_10009795 | Ga0307406_100097956 | 83 |
| 1075 | 3300031901 | Ga0307406_10086670 | Ga0307406_100866703 | 83 |
| 1076 | 3300031901 | Ga0307406_10373811 | Ga0307406_103738111 | 83 |
| 1077 | 3300031901 | Ga0307406_11177694 | Ga0307406_111776942 | 83 |
| 1078 | 3300031911 | Ga0307412_10273644 | Ga0307412_102736442 | 83 |
| 1079 | 3300031911 | Ga0307412_10379300 | Ga0307412_103793003 | 83 |
| 1080 | 3300031911 | Ga0307412_10421675 | Ga0307412_104216752 | 83 |
| 1081 | 3300031911 | Ga0307412_11248577 | Ga0307412_112485772 | 83 |
| 1082 | 3300031911 | Ga0307412_11959248 | Ga0307412_119592482 | 83 |
| 1083 | 3300031967 | Ga0315914_1000006 | Ga0315914_100000614 | 83 |
| 1084 | 3300031995 | Ga0307409_100097147 | Ga0307409_1000971473 | 83 |
| 1085 | 3300031995 | Ga0307409_100555550 | Ga0307409_1005555502 | 83 |
| 1086 | 3300031995 | Ga0307409_100788681 | Ga0307409_1007886812 | 83 |
| 1087 | 3300031995 | Ga0307409_101005982 | Ga0307409_1010059822 | 83 |
| 1088 | 3300031995 | Ga0307409_101022835 | Ga0307409_1010228352 | 83 |
| 1089 | 3300031995 | Ga0307409_101337941 | Ga0307409_1013379412 | 83 |
| 1090 | 3300032002 | Ga0307416_100206173 | Ga0307416_1002061732 | 83 |
| 1091 | 3300032002 | Ga0307416_100739011 | Ga0307416_1007390112 | 83 |
| 1092 | 3300032002 | Ga0307416_100786570 | Ga0307416_1007865702 | 83 |
| 1093 | 3300032002 | Ga0307416_102309240 | Ga0307416_1023092402 | 83 |
| 1094 | 3300032004 | Ga0307414_11651350 | Ga0307414_116513502 | 83 |
| 1095 | 3300032005 | Ga0307411_10011705 | Ga0307411_100117054 | 83 |
| 1096 | 3300032126 | Ga0307415_102358078 | Ga0307415_1023580782 | 83 |
| 1097 | 3300032168 | Ga0316593_10308730 | Ga0316593_103087302 | 83 |
| 1098 | 3300033430 | Ga0315913_1000002 | Ga0315913_1000002228 | 83 |
| 1099 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001258 | 83 |
| 1100 | 3300034817 | Ga0373948_0044536 | Ga0373948_0044536_313_573 | 83 |
| 1101 | 3300034819 | Ga0373958_0116867 | Ga0373958_0116867_171_431 | 83 |
| 1102 | 3300035084 | Ga0373928_0044563 | Ga0373928_0044563_382_642 | 83 |
| 1103 | 3300035085 | Ga0373929_0045814 | Ga0373929_0045814_518_778 | 83 |
| 1104 | 3300035085 | Ga0373929_0091196 | Ga0373929_0091196_225_485 | 83 |
| 1105 | 3300035089 | Ga0373944_0134099 | Ga0373944_0134099_244_495 | 83 |
| 1106 | 3300035111 | Ga0373923_0160968 | Ga0373923_0160968_228_479 | 83 |
| 1107 | 3300035114 | Ga0373939_0065154 | Ga0373939_0065154_621_881 | 83 |
| 1108 | 3300035115 | Ga0373941_0017338 | Ga0373941_0017338_162_422 | 83 |
| 1109 | 3300035115 | Ga0373941_0022048 | Ga0373941_0022048_699_950 | 83 |
| 1110 | 3300035115 | Ga0373941_0067397 | Ga0373941_0067397_482_742 | 83 |
| 1111 | 3300035116 | Ga0373945_0194682 | Ga0373945_0194682_286_537 | 83 |
| 1112 | 3300035116 | Ga0373945_0314766 | Ga0373945_0314766_303_554 | 83 |
| 1113 | 3300035118 | Ga0373954_0149670 | Ga0373954_0149670_319_570 | 83 |
| 1114 | 3300035121 | Ga0373960_0004122 | Ga0373960_0004122_1294_1554 | 83 |
| 1115 | 3300035170 | Ga0373943_0040534 | Ga0373943_0040534_1689_1940 | 83 |
| 1116 | 3300035171 | Ga0373946_0677114 | Ga0373946_0677114_58_315 | 83 |
| 1117 | 3300035172 | Ga0373955_0820692 | Ga0373955_0820692_227_478 | 83 |
| 1118 | 3300035207 | Ga0373942_0195710 | Ga0373942_0195710_118_378 | 83 |
| 1119 | 3300035207 | Ga0373942_0215262 | Ga0373942_0215262_287_538 | 83 |
| 1120 | 3300035241 | Ga0373961_0004785 | Ga0373961_0004785_2077_2337 | 83 |
| 1121 | 3300035241 | Ga0373961_0034038 | Ga0373961_0034038_282_533 | 83 |
| 1122 | 3300035242 | Ga0373962_0377996 | Ga0373962_0377996_78_338 | 83 |
| 1123 | 3300035691 | Ga0373931_0002120 | Ga0373931_0002120_2027_2287 | 83 |
| 1124 | 3300035691 | Ga0373931_0013881 | Ga0373931_0013881_1413_1673 | 83 |
| 1125 | 3300035691 | Ga0373931_0713394 | Ga0373931_0713394_360_617 | 83 |
| 1126 | 3300035692 | Ga0373935_0271890 | Ga0373935_0271890_288_539 | 83 |
| 1127 | 3300035695 | Ga0373927_0027265 | Ga0373927_0027265_1536_1787 | 83 |
| 1128 | 3300036401 | Ga0373937_1323102 | Ga0373937_1323102_350_601 | 83 |
| 1129 | 3300036647 | Ga0316582_0256716 | Ga0316582_0256716_545_799 | 83 |
| 1130 | 3300036712 | Ga0316584_0842783 | Ga0316584_0842783_280_534 | 83 |
| 1131 | 3300037068 | Ga0373925_0374694 | Ga0373925_0374694_625_876 | 83 |
| 1132 | 3300037068 | Ga0373925_0695920 | Ga0373925_0695920_450_710 | 83 |
| 1133 | 3300037312 | Ga0395899_0047689 | Ga0395899_0047689_1203_1454 | 83 |
| 1134 | 3300037466 | Ga0395898_0049480 | Ga0395898_0049480_2155_2406 | 83 |
| 1135 | 3300037466 | Ga0395898_0279979 | Ga0395898_0279979_31_288 | 83 |
| 1136 | 3300037466 | Ga0395898_0355110 | Ga0395898_0355110_693_944 | 83 |
| 1137 | 3300037471 | Ga0395905_0037309 | Ga0395905_0037309_933_1184 | 83 |
| 1138 | 3300037471 | Ga0395905_0052400 | Ga0395905_0052400_2383_2640 | 83 |
| 1139 | 3300038443 | Ga0395901_0082006 | Ga0395901_0082006_2908_3165 | 83 |
| 1140 | 3300038443 | Ga0395901_1155786 | Ga0395901_1155786_365_655 | 83 |
| 1141 | 3300039437 | Ga0436365_0366823 | Ga0436365_0366823_226_477 | 83 |
| 1142 | 3300039450 | Ga0436363_0775146 | Ga0436363_0775146_9974_10225 | 83 |
| 1143 | 3300041404 | Ga0439436_0006455 | Ga0439436_0006455_1505_1765 | 83 |
| 1144 | 3300041404 | Ga0439436_0149499 | Ga0439436_0149499_104_364 | 83 |
| 1145 | 3300041404 | Ga0439436_0207568 | Ga0439436_0207568_78_335 | 83 |
| 1146 | 3300041405 | Ga0439438_017861 | Ga0439438_017861_1042_1302 | 83 |
| 1147 | 3300041411 | Ga0439466_0130362 | Ga0439466_0130362_37_297 | 83 |
| 1148 | 3300041413 | Ga0439465_0001711 | Ga0439465_0001711_741_1001 | 83 |
| 1149 | 3300041413 | Ga0439465_0089399 | Ga0439465_0089399_762_1016 | 83 |
| 1150 | 3300041413 | Ga0439465_0102356 | Ga0439465_0102356_135_389 | 83 |
| 1151 | 3300041443 | Ga0451789_1320308 | Ga0451789_1320308_185_439 | 83 |
| 1152 | 3300041451 | Ga0451791_1932150 | Ga0451791_1932150_196_453 | 83 |
| 1153 | 3300041453 | Ga0451797_0392121 | Ga0451797_0392121_69_326 | 83 |
| 1154 | 3300041460 | Ga0451802_0083164 | Ga0451802_0083164_321_575 | 83 |
| 1155 | 3300041496 | Ga0451839_0636310 | Ga0451839_0636310_46_321 | 83 |
| 1156 | 3300041498 | Ga0451841_1019038 | Ga0451841_1019038_188_445 | 83 |
| 1157 | 3300041512 | Ga0451853_2943703 | Ga0451853_2943703_168_443 | 83 |
| 1158 | 3300041999 | Ga0439433_0078267 | Ga0439433_0078267_496_747 | 83 |
| 1159 | 3300042004 | Ga0439445_0166395 | Ga0439445_0166395_210_470 | 83 |
| 1160 | 3300042005 | Ga0439448_0225608 | Ga0439448_0225608_110_367 | 83 |
| 1161 | 3300042006 | Ga0439432_040707 | Ga0439432_040707_149_409 | 83 |
| 1162 | 3300042007 | Ga0439449_0001047 | Ga0439449_0001047_5110_5370 | 83 |
| 1163 | 3300042015 | Ga0439462_0121485 | Ga0439462_0121485_146_406 | 83 |
| 1164 | 3300042015 | Ga0439462_0189933 | Ga0439462_0189933_138_398 | 83 |
| 1165 | 3300042122 | Ga0450920_036575 | Ga0450920_036575_97_357 | 83 |
| 1166 | 3300042125 | Ga0450923_039887 | Ga0450923_039887_106_366 | 83 |
| 1167 | 3300042145 | Ga0450906_008450 | Ga0450906_008450_410_670 | 83 |
| 1168 | 3300042157 | Ga0439458_0047121 | Ga0439458_0047121_648_905 | 83 |
| 1169 | 3300042184 | Ga0450908_029936 | Ga0450908_029936_432_692 | 83 |
| 1170 | 3300042185 | Ga0450909_080054 | Ga0450909_080054_254_514 | 83 |
| 1171 | 3300042435 | Ga0439434_0020056 | Ga0439434_0020056_1296_1556 | 83 |
| 1172 | 3300042531 | Ga0450918_001738 | Ga0450918_001738_2594_2854 | 83 |
| 1173 | 3300044658 | Ga0466972_0082447 | Ga0466972_0082447_182_439 | 83 |
| 1174 | 3300044683 | Ga0466965_0132840 | Ga0466965_0132840_62_319 | 83 |
| 1175 | 3300044683 | Ga0466965_0432222 | Ga0466965_0432222_69_326 | 83 |
| 1176 | 3300044684 | Ga0466966_0803263 | Ga0466966_0803263_262_519 | 83 |
| 1177 | 3300044694 | Ga0466963_0020949 | Ga0466963_0020949_1143_1400 | 83 |
| 1178 | 3300044735 | Ga0466968_0455478 | Ga0466968_0455478_190_447 | 83 |
| 1179 | 3300044765 | Ga0466970_0107199 | Ga0466970_0107199_1069_1326 | 83 |
| 1180 | 3300044842 | Ga0466957_0092513 | Ga0466957_0092513_221_478 | 83 |
| 1181 | 3300044901 | Ga0466960_0025395 | Ga0466960_0025395_1747_2004 | 83 |
| 1182 | 3300044901 | Ga0466960_0317440 | Ga0466960_0317440_194_445 | 83 |
| 1183 | 3300044901 | Ga0466960_0511477 | Ga0466960_0511477_333_590 | 83 |
| 1184 | 3300044901 | Ga0466960_0576090 | Ga0466960_0576090_195_446 | 83 |
| 1185 | 3300045049 | Ga0466959_0628274 | Ga0466959_0628274_364_621 | 83 |
| 1186 | 3300045976 | Ga0466967_0814156 | Ga0466967_0814156_423_680 | 83 |
| 1187 | 3300045976 | Ga0466967_0922145 | Ga0466967_0922145_35_292 | 83 |
| 1188 | 3300046453 | Ga0495627_150236 | Ga0495627_150236_200_454 | 83 |
| 1189 | 3300046454 | Ga0495592_0046201 | Ga0495592_0046201_1184_1438 | 83 |
| 1190 | 3300046454 | Ga0495592_0260565 | Ga0495592_0260565_100_351 | 83 |
| 1191 | 3300046457 | Ga0495590_0220384 | Ga0495590_0220384_152_409 | 83 |
| 1192 | 3300046459 | Ga0495629_0026890 | Ga0495629_0026890_51_305 | 83 |
| 1193 | 3300046460 | Ga0495638_0016460 | Ga0495638_0016460_1971_2228 | 83 |
| 1194 | 3300046460 | Ga0495638_0046065 | Ga0495638_0046065_70_327 | 83 |
| 1195 | 3300046460 | Ga0495638_0114859 | Ga0495638_0114859_307_564 | 83 |
| 1196 | 3300046461 | Ga0495641_0539109 | Ga0495641_0539109_133_384 | 83 |
| 1197 | 3300046462 | Ga0495651_0552564 | Ga0495651_0552564_411_665 | 83 |
| 1198 | 3300046463 | Ga0495653_0078871 | Ga0495653_0078871_1901_2152 | 83 |
| 1199 | 3300046463 | Ga0495653_0567504 | Ga0495653_0567504_272_526 | 83 |
| 1200 | 3300046471 | Ga0495650_0104198 | Ga0495650_0104198_505_759 | 83 |
| 1201 | 3300046471 | Ga0495650_0219604 | Ga0495650_0219604_370_624 | 83 |
| 1202 | 3300046476 | Ga0495662_0031142 | Ga0495662_0031142_160_414 | 83 |
| 1203 | 3300046477 | Ga0495664_0308462 | Ga0495664_0308462_223_474 | 83 |
| 1204 | 3300046500 | Ga0495596_0111419 | Ga0495596_0111419_756_1013 | 83 |
| 1205 | 3300046501 | Ga0495607_0400987 | Ga0495607_0400987_134_388 | 83 |
| 1206 | 3300046507 | Ga0495606_0010031 | Ga0495606_0010031_3531_3785 | 83 |
| 1207 | 3300046507 | Ga0495606_0088887 | Ga0495606_0088887_1173_1427 | 83 |
| 1208 | 3300046507 | Ga0495606_0203377 | Ga0495606_0203377_429_683 | 83 |
| 1209 | 3300046512 | Ga0495610_0006212 | Ga0495610_0006212_5968_6222 | 83 |
| 1210 | 3300046512 | Ga0495610_0063217 | Ga0495610_0063217_1003_1260 | 83 |
| 1211 | 3300046512 | Ga0495610_0141051 | Ga0495610_0141051_330_584 | 83 |
| 1212 | 3300046512 | Ga0495610_0214715 | Ga0495610_0214715_101_382 | 83 |
| 1213 | 3300046512 | Ga0495610_0240221 | Ga0495610_0240221_100_357 | 83 |
| 1214 | 3300046513 | Ga0495616_0283838 | Ga0495616_0283838_301_555 | 83 |
| 1215 | 3300046515 | Ga0495620_0150916 | Ga0495620_0150916_104_358 | 83 |
| 1216 | 3300046515 | Ga0495620_0263773 | Ga0495620_0263773_357_611 | 83 |
| 1217 | 3300046519 | Ga0495632_0218774 | Ga0495632_0218774_502_756 | 83 |
| 1218 | 3300046522 | Ga0495643_0027457 | Ga0495643_0027457_2672_2929 | 83 |
| 1219 | 3300046522 | Ga0495643_0037538 | Ga0495643_0037538_1215_1469 | 83 |
| 1220 | 3300046522 | Ga0495643_0044122 | Ga0495643_0044122_429_710 | 83 |
| 1221 | 3300046522 | Ga0495643_0226322 | Ga0495643_0226322_431_685 | 83 |
| 1222 | 3300046523 | Ga0495644_0220612 | Ga0495644_0220612_469_720 | 83 |
| 1223 | 3300046524 | Ga0495648_0378833 | Ga0495648_0378833_254_508 | 83 |
| 1224 | 3300046524 | Ga0495648_0407376 | Ga0495648_0407376_269_526 | 83 |
| 1225 | 3300046529 | Ga0495652_0525183 | Ga0495652_0525183_441_695 | 83 |
| 1226 | 3300046536 | Ga0495587_0678349 | Ga0495587_0678349_132_386 | 83 |
| 1227 | 3300046539 | Ga0495621_0219587 | Ga0495621_0219587_460_711 | 83 |
| 1228 | 3300046542 | Ga0495597_0349024 | Ga0495597_0349024_22_276 | 83 |
| 1229 | 3300046543 | Ga0495645_0142971 | Ga0495645_0142971_1211_1462 | 83 |
| 1230 | 3300046543 | Ga0495645_0838178 | Ga0495645_0838178_89_340 | 83 |
| 1231 | 3300046557 | Ga0495622_0106271 | Ga0495622_0106271_774_1028 | 83 |
| 1232 | 3300046615 | Ga0495656_0586067 | Ga0495656_0586067_79_330 | 83 |
| 1233 | 3300046616 | Ga0495668_0066336 | Ga0495668_0066336_1502_1759 | 83 |
| 1234 | 3300046616 | Ga0495668_0140952 | Ga0495668_0140952_25_282 | 83 |
| 1235 | 3300046616 | Ga0495668_0471569 | Ga0495668_0471569_97_354 | 83 |
| 1236 | 3300046642 | Ga0495634_0533571 | Ga0495634_0533571_63_317 | 83 |
| 1237 | 3300046660 | Ga0495625_0088160 | Ga0495625_0088160_124_384 | 83 |
| 1238 | 3300046660 | Ga0495625_0133822 | Ga0495625_0133822_1258_1512 | 83 |
| 1239 | 3300046660 | Ga0495625_0244218 | Ga0495625_0244218_808_1089 | 83 |
| 1240 | 3300046660 | Ga0495625_0377402 | Ga0495625_0377402_386_643 | 83 |
| 1241 | 3300046660 | Ga0495625_0529141 | Ga0495625_0529141_239_496 | 83 |
| 1242 | 3300046660 | Ga0495625_0554266 | Ga0495625_0554266_168_422 | 83 |
| 1243 | 3300046663 | Ga0495635_1037604 | Ga0495635_1037604_10_261 | 83 |
| 1244 | 3300046674 | Ga0495588_0048206 | Ga0495588_0048206_1575_1829 | 83 |
| 1245 | 3300046675 | Ga0495657_0072858 | Ga0495657_0072858_1809_2063 | 83 |
| 1246 | 3300046679 | Ga0495623_0257965 | Ga0495623_0257965_89_343 | 83 |
| 1247 | 3300046683 | Ga0495658_0120709 | Ga0495658_0120709_1030_1284 | 83 |
| 1248 | 3300046689 | Ga0495613_0686622 | Ga0495613_0686622_39_293 | 83 |
| 1249 | 3300046690 | Ga0495624_0185559 | Ga0495624_0185559_895_1149 | 83 |
| 1250 | 3300046694 | Ga0495649_0438076 | Ga0495649_0438076_242_499 | 83 |
| 1251 | 3300046794 | Ga0495589_0108077 | Ga0495589_0108077_858_1115 | 83 |
| 1252 | 3300046809 | Ga0495600_0123827 | Ga0495600_0123827_840_1094 | 83 |
| 1253 | 3300046810 | Ga0495660_0032319 | Ga0495660_0032319_2323_2580 | 83 |
| 1254 | 3300046810 | Ga0495660_0361697 | Ga0495660_0361697_370_627 | 83 |
| 1255 | 3300047317 | Ga0495604_0028877 | Ga0495604_0028877_3546_3800 | 83 |
| 1256 | 3300047317 | Ga0495604_0422102 | Ga0495604_0422102_160_411 | 83 |
| 1257 | 3300047319 | Ga0495674_1327161 | Ga0495674_1327161_103_357 | 83 |
| 1258 | 3300047322 | Ga0495680_0418083 | Ga0495680_0418083_625_876 | 83 |
| 1259 | 3300047443 | Ga0495687_063971 | Ga0495687_063971_1198_1455 | 83 |
| 1260 | 3300047443 | Ga0495687_095090 | Ga0495687_095090_95_352 | 83 |
| 1261 | 3300047469 | Ga0495673_0214526 | Ga0495673_0214526_23_274 | 83 |
| 1262 | 3300047470 | Ga0495681_0080705 | Ga0495681_0080705_886_1143 | 83 |
| 1263 | 3300047472 | Ga0495686_0002844 | Ga0495686_0002844_14087_14341 | 83 |
| 1264 | 3300047472 | Ga0495686_0011672 | Ga0495686_0011672_5628_5882 | 83 |
| 1265 | 3300047472 | Ga0495686_0028624 | Ga0495686_0028624_727_981 | 83 |
| 1266 | 3300047472 | Ga0495686_0317298 | Ga0495686_0317298_368_625 | 83 |
| 1267 | 3300047472 | Ga0495686_0510555 | Ga0495686_0510555_110_391 | 83 |
| 1268 | 3300048088 | Ga0495602_0660150 | Ga0495602_0660150_101_352 | 83 |
| 1269 | 3300048088 | Ga0495602_0902761 | Ga0495602_0902761_40_294 | 83 |
| 1270 | 3300048091 | Ga0495626_0025458 | Ga0495626_0025458_1661_1918 | 83 |
| 1271 | 3300048903 | Ga0496100_0016492 | Ga0496100_0016492_3506_3766 | 83 |
| 1272 | 3300048903 | Ga0496100_0767447 | Ga0496100_0767447_117_374 | 83 |
| 1273 | 3300048904 | Ga0496101_0291059 | Ga0496101_0291059_178_429 | 83 |
| 1274 | 3300048904 | Ga0496101_0383035 | Ga0496101_0383035_809_1069 | 83 |
| 1275 | 3300048904 | Ga0496101_0405490 | Ga0496101_0405490_189_443 | 83 |
| 1276 | 3300048904 | Ga0496101_0421716 | Ga0496101_0421716_570_827 | 83 |
| 1277 | 3300048904 | Ga0496101_0680711 | Ga0496101_0680711_527_778 | 83 |
| 1278 | 3300048905 | Ga0496102_0199108 | Ga0496102_0199108_1541_1801 | 83 |
| 1279 | 3300048905 | Ga0496102_0505898 | Ga0496102_0505898_196_453 | 83 |
| 1280 | 3300048905 | Ga0496102_0866232 | Ga0496102_0866232_297_554 | 83 |
| 1281 | 3300048905 | Ga0496102_0909821 | Ga0496102_0909821_73_330 | 83 |
| 1282 | 3300048905 | Ga0496102_1039957 | Ga0496102_1039957_97_354 | 83 |
| 1283 | 3300048906 | Ga0496103_0043920 | Ga0496103_0043920_25_282 | 83 |
| 1284 | 3300048907 | Ga0496104_0094490 | Ga0496104_0094490_1727_1987 | 83 |
| 1285 | 3300048907 | Ga0496104_0546919 | Ga0496104_0546919_342_599 | 83 |
| 1286 | 3300048907 | Ga0496104_0697772 | Ga0496104_0697772_252_503 | 83 |
| 1287 | 3300048907 | Ga0496104_1747712 | Ga0496104_1747712_215_466 | 83 |
| 1288 | 3300048908 | Ga0496105_0550856 | Ga0496105_0550856_98_349 | 83 |
| 1289 | 3300048908 | Ga0496105_0581033 | Ga0496105_0581033_320_577 | 83 |
| 1290 | 3300048908 | Ga0496105_0804237 | Ga0496105_0804237_15_275 | 83 |
| 1291 | 3300048908 | Ga0496105_0977184 | Ga0496105_0977184_203_457 | 83 |
| 1292 | 3300048909 | Ga0496106_0016430 | Ga0496106_0016430_3100_3354 | 83 |
| 1293 | 3300048909 | Ga0496106_0224296 | Ga0496106_0224296_390_650 | 83 |
| 1294 | 3300048909 | Ga0496106_1182545 | Ga0496106_1182545_300_557 | 83 |
| 1295 | 3300048910 | Ga0496107_0075565 | Ga0496107_0075565_1440_1700 | 83 |
| 1296 | 3300048911 | Ga0496108_0096285 | Ga0496108_0096285_366_626 | 83 |
| 1297 | 3300048911 | Ga0496108_0122367 | Ga0496108_0122367_1381_1641 | 83 |
| 1298 | 3300048912 | Ga0496109_0023524 | Ga0496109_0023524_2103_2363 | 83 |
| 1299 | 3300048912 | Ga0496109_0126970 | Ga0496109_0126970_731_991 | 83 |
| 1300 | 3300048913 | Ga0496110_0056926 | Ga0496110_0056926_822_1082 | 83 |
| 1301 | 3300048913 | Ga0496110_0179413 | Ga0496110_0179413_1450_1710 | 83 |
| 1302 | 3300048913 | Ga0496110_0986462 | Ga0496110_0986462_229_480 | 83 |
| 1303 | 3300048913 | Ga0496110_1096251 | Ga0496110_1096251_312_569 | 83 |
| 1304 | 3300048914 | Ga0496111_0127301 | Ga0496111_0127301_901_1161 | 83 |
| 1305 | 3300048914 | Ga0496111_0274367 | Ga0496111_0274367_682_939 | 83 |
| 1306 | 3300048915 | Ga0496112_0052437 | Ga0496112_0052437_1760_2017 | 83 |
| 1307 | 3300048915 | Ga0496112_0057193 | Ga0496112_0057193_3246_3506 | 83 |
| 1308 | 3300048915 | Ga0496112_0142644 | Ga0496112_0142644_1387_1647 | 83 |
| 1309 | 3300048915 | Ga0496112_0675681 | Ga0496112_0675681_316_576 | 83 |
| 1310 | 3300048915 | Ga0496112_1101560 | Ga0496112_1101560_215_475 | 83 |
| 1311 | 3300048915 | Ga0496112_1230459 | Ga0496112_1230459_165_425 | 83 |
| 1312 | 3300048916 | Ga0496113_0451804 | Ga0496113_0451804_480_740 | 83 |
| 1313 | 3300048916 | Ga0496113_0683664 | Ga0496113_0683664_522_779 | 83 |
| 1314 | 3300048917 | Ga0496114_0076482 | Ga0496114_0076482_1974_2234 | 83 |
| 1315 | 3300048917 | Ga0496114_0130392 | Ga0496114_0130392_90_344 | 83 |
| 1316 | 3300048917 | Ga0496114_0422455 | Ga0496114_0422455_828_1085 | 83 |
| 1317 | 3300048917 | Ga0496114_0551466 | Ga0496114_0551466_604_855 | 83 |
| 1318 | 3300048918 | Ga0496115_0169071 | Ga0496115_0169071_1483_1749 | 83 |
| 1319 | 3300048918 | Ga0496115_0188617 | Ga0496115_0188617_698_958 | 83 |
| 1320 | 3300048918 | Ga0496115_0782721 | Ga0496115_0782721_385_642 | 83 |
| 1321 | 3300048919 | Ga0496116_0036873 | Ga0496116_0036873_2953_3207 | 83 |
| 1322 | 3300048919 | Ga0496116_0061983 | Ga0496116_0061983_639_896 | 83 |
| 1323 | 3300048919 | Ga0496116_0067211 | Ga0496116_0067211_1868_2122 | 83 |
| 1324 | 3300048919 | Ga0496116_0224656 | Ga0496116_0224656_341_595 | 83 |
| 1325 | 3300048920 | Ga0496117_0006751 | Ga0496117_0006751_9728_9982 | 83 |
| 1326 | 3300048920 | Ga0496117_0014861 | Ga0496117_0014861_216_470 | 83 |
| 1327 | 3300048920 | Ga0496117_0076186 | Ga0496117_0076186_1505_1792 | 83 |
| 1328 | 3300048920 | Ga0496117_0080253 | Ga0496117_0080253_1007_1264 | 83 |
| 1329 | 3300048920 | Ga0496117_0084069 | Ga0496117_0084069_1376_1666 | 83 |
| 1330 | 3300048920 | Ga0496117_0466083 | Ga0496117_0466083_217_471 | 83 |
| 1331 | 3300048920 | Ga0496117_0500428 | Ga0496117_0500428_289_546 | 83 |
| 1332 | 3300048921 | Ga0496118_0003715 | Ga0496118_0003715_17771_18025 | 83 |
| 1333 | 3300048921 | Ga0496118_0010030 | Ga0496118_0010030_8086_8343 | 83 |
| 1334 | 3300048921 | Ga0496118_0082361 | Ga0496118_0082361_1339_1626 | 83 |
| 1335 | 3300048921 | Ga0496118_0197134 | Ga0496118_0197134_606_863 | 83 |
| 1336 | 3300048921 | Ga0496118_0197932 | Ga0496118_0197932_104_394 | 83 |
| 1337 | 3300048922 | Ga0496119_0009045 | Ga0496119_0009045_6412_6669 | 83 |
| 1338 | 3300048922 | Ga0496119_0036191 | Ga0496119_0036191_205_462 | 83 |
| 1339 | 3300048922 | Ga0496119_0039161 | Ga0496119_0039161_2233_2490 | 83 |
| 1340 | 3300048922 | Ga0496119_0042057 | Ga0496119_0042057_2016_2273 | 83 |
| 1341 | 3300048922 | Ga0496119_0431032 | Ga0496119_0431032_183_440 | 83 |
| 1342 | 3300048923 | Ga0496120_0026604 | Ga0496120_0026604_867_1124 | 83 |
| 1343 | 3300048923 | Ga0496120_0062583 | Ga0496120_0062583_367_624 | 83 |
| 1344 | 3300048923 | Ga0496120_0097153 | Ga0496120_0097153_1207_1497 | 83 |
| 1345 | 3300048923 | Ga0496120_0117110 | Ga0496120_0117110_678_935 | 83 |
| 1346 | 3300048923 | Ga0496120_0426736 | Ga0496120_0426736_263_517 | 83 |
| 1347 | 3300048924 | Ga0496121_0018097 | Ga0496121_0018097_2423_2680 | 83 |
| 1348 | 3300048924 | Ga0496121_0045342 | Ga0496121_0045342_317_571 | 83 |
| 1349 | 3300048924 | Ga0496121_0065852 | Ga0496121_0065852_143_397 | 83 |
| 1350 | 3300048924 | Ga0496121_0074664 | Ga0496121_0074664_1313_1591 | 83 |
| 1351 | 3300048924 | Ga0496121_0146696 | Ga0496121_0146696_1286_1540 | 83 |
| 1352 | 3300048924 | Ga0496121_0265597 | Ga0496121_0265597_793_1050 | 83 |
| 1353 | 3300048925 | Ga0496122_0001107 | Ga0496122_0001107_19377_19631 | 83 |
| 1354 | 3300048925 | Ga0496122_0016172 | Ga0496122_0016172_6294_6584 | 83 |
| 1355 | 3300048925 | Ga0496122_0031570 | Ga0496122_0031570_1448_1705 | 83 |
| 1356 | 3300048925 | Ga0496122_0034124 | Ga0496122_0034124_83_376 | 83 |
| 1357 | 3300048925 | Ga0496122_0048526 | Ga0496122_0048526_2753_3007 | 83 |
| 1358 | 3300048925 | Ga0496122_0248610 | Ga0496122_0248610_604_861 | 83 |
| 1359 | 3300048925 | Ga0496122_0320076 | Ga0496122_0320076_551_805 | 83 |
| 1360 | 3300048925 | Ga0496122_0579549 | Ga0496122_0579549_101_358 | 83 |
| 1361 | 3300048926 | Ga0496123_0000562 | Ga0496123_0000562_26948_27202 | 83 |
| 1362 | 3300048926 | Ga0496123_0052247 | Ga0496123_0052247_76_333 | 83 |
| 1363 | 3300048926 | Ga0496123_0097553 | Ga0496123_0097553_1173_1460 | 83 |
| 1364 | 3300048926 | Ga0496123_0124906 | Ga0496123_0124906_323_580 | 83 |
| 1365 | 3300048926 | Ga0496123_0140471 | Ga0496123_0140471_147_404 | 83 |
| 1366 | 3300048926 | Ga0496123_0289706 | Ga0496123_0289706_418_708 | 83 |
| 1367 | 3300048927 | Ga0496124_0045730 | Ga0496124_0045730_581_835 | 83 |
| 1368 | 3300048927 | Ga0496124_0054556 | Ga0496124_0054556_321_578 | 83 |
| 1369 | 3300048927 | Ga0496124_0064786 | Ga0496124_0064786_1266_1532 | 83 |
| 1370 | 3300048927 | Ga0496124_0076226 | Ga0496124_0076226_2438_2692 | 83 |
| 1371 | 3300048927 | Ga0496124_0282531 | Ga0496124_0282531_224_481 | 83 |
| 1372 | 3300048927 | Ga0496124_0377166 | Ga0496124_0377166_571_825 | 83 |
| 1373 | 3300048927 | Ga0496124_0443073 | Ga0496124_0443073_484_738 | 83 |
| 1374 | 3300048927 | Ga0496124_0483676 | Ga0496124_0483676_242_529 | 83 |
| 1375 | 3300048927 | Ga0496124_0491336 | Ga0496124_0491336_14_304 | 83 |
| 1376 | 3300048927 | Ga0496124_0677215 | Ga0496124_0677215_181_435 | 83 |
| 1377 | 3300048928 | Ga0496125_0001370 | Ga0496125_0001370_8917_9171 | 83 |
| 1378 | 3300048928 | Ga0496125_0083675 | Ga0496125_0083675_983_1240 | 83 |
| 1379 | 3300048928 | Ga0496125_0121749 | Ga0496125_0121749_1541_1795 | 83 |
| 1380 | 3300048928 | Ga0496125_0184448 | Ga0496125_0184448_184_441 | 83 |
| 1381 | 3300048928 | Ga0496125_0391440 | Ga0496125_0391440_521_778 | 83 |
| 1382 | 3300048928 | Ga0496125_0405944 | Ga0496125_0405944_315_572 | 83 |
| 1383 | 3300048928 | Ga0496125_0413004 | Ga0496125_0413004_490_747 | 83 |
| 1384 | 3300048929 | Ga0496126_0000069 | Ga0496126_0000069_71446_71700 | 83 |
| 1385 | 3300048929 | Ga0496126_0003015 | Ga0496126_0003015_8715_8969 | 83 |
| 1386 | 3300048929 | Ga0496126_0103078 | Ga0496126_0103078_96_353 | 83 |
| 1387 | 3300048929 | Ga0496126_0167746 | Ga0496126_0167746_748_1005 | 83 |
| 1388 | 3300048929 | Ga0496126_0192559 | Ga0496126_0192559_631_888 | 83 |
| 1389 | 3300048929 | Ga0496126_0906626 | Ga0496126_0906626_282_539 | 83 |
| 1390 | 3300049459 | Ga0495678_267563 | Ga0495678_267563_78_332 | 83 |
| 1391 | 3300049514 | Ga0501291_152841 | Ga0501291_152841_57_314 | 83 |
| 1392 | 3300049522 | Ga0501299_054410 | Ga0501299_054410_376_627 | 83 |
| 1393 | 3300049568 | Ga0501031_0000014 | Ga0501031_0000014_110907_111158 | 83 |
| 1394 | 3300049568 | Ga0501031_0001971 | Ga0501031_0001971_11801_12052 | 83 |
| 1395 | 3300049568 | Ga0501031_0105814 | Ga0501031_0105814_373_624 | 83 |
| 1396 | 3300049568 | Ga0501031_0376889 | Ga0501031_0376889_649_900 | 83 |
| 1397 | 3300049568 | Ga0501031_0824410 | Ga0501031_0824410_104_355 | 83 |
| 1398 | 3300049568 | Ga0501031_0861417 | Ga0501031_0861417_248_538 | 83 |
| 1399 | 3300049569 | Ga0501032_0000015 | Ga0501032_0000015_110907_111158 | 83 |
| 1400 | 3300049569 | Ga0501032_0000025 | Ga0501032_0000025_51713_51967 | 83 |
| 1401 | 3300049569 | Ga0501032_0003745 | Ga0501032_0003745_9270_9521 | 83 |
| 1402 | 3300049569 | Ga0501032_0024369 | Ga0501032_0024369_138_389 | 83 |
| 1403 | 3300049569 | Ga0501032_0081191 | Ga0501032_0081191_1573_1824 | 83 |
| 1404 | 3300049569 | Ga0501032_0088775 | Ga0501032_0088775_1134_1409 | 83 |
| 1405 | 3300049569 | Ga0501032_0137807 | Ga0501032_0137807_1262_1537 | 83 |
| 1406 | 3300049569 | Ga0501032_0396759 | Ga0501032_0396759_444_695 | 83 |
| 1407 | 3300049569 | Ga0501032_0414713 | Ga0501032_0414713_300_590 | 83 |
| 1408 | 3300049569 | Ga0501032_0521889 | Ga0501032_0521889_270_551 | 83 |
| 1409 | 3300049569 | Ga0501032_0717828 | Ga0501032_0717828_71_325 | 83 |
| 1410 | 3300049570 | Ga0501033_0000023 | Ga0501033_0000023_110907_111158 | 83 |
| 1411 | 3300049570 | Ga0501033_0000229 | Ga0501033_0000229_1153_1407 | 83 |
| 1412 | 3300049570 | Ga0501033_0001216 | Ga0501033_0001216_6350_6625 | 83 |
| 1413 | 3300049570 | Ga0501033_0001969 | Ga0501033_0001969_9427_9708 | 83 |
| 1414 | 3300049570 | Ga0501033_0005696 | Ga0501033_0005696_2010_2261 | 83 |
| 1415 | 3300049570 | Ga0501033_0026545 | Ga0501033_0026545_661_942 | 83 |
| 1416 | 3300049570 | Ga0501033_0028102 | Ga0501033_0028102_148_399 | 83 |
| 1417 | 3300049570 | Ga0501033_0048896 | Ga0501033_0048896_2556_2807 | 83 |
| 1418 | 3300049570 | Ga0501033_0072521 | Ga0501033_0072521_674_928 | 83 |
| 1419 | 3300049570 | Ga0501033_0108891 | Ga0501033_0108891_1387_1677 | 83 |
| 1420 | 3300049570 | Ga0501033_0187778 | Ga0501033_0187778_562_837 | 83 |
| 1421 | 3300049570 | Ga0501033_0389184 | Ga0501033_0389184_483_734 | 83 |
| 1422 | 3300049570 | Ga0501033_0408738 | Ga0501033_0408738_615_872 | 83 |
| 1423 | 3300049570 | Ga0501033_0456493 | Ga0501033_0456493_134_388 | 83 |
| 1424 | 3300049570 | Ga0501033_0810880 | Ga0501033_0810880_264_545 | 83 |
| 1425 | 3300049571 | Ga0501034_0000073 | Ga0501034_0000073_65580_65831 | 83 |
| 1426 | 3300049571 | Ga0501034_0001862 | Ga0501034_0001862_8356_8610 | 83 |
| 1427 | 3300049571 | Ga0501034_0020231 | Ga0501034_0020231_4321_4572 | 83 |
| 1428 | 3300049571 | Ga0501034_0060876 | Ga0501034_0060876_1061_1312 | 83 |
| 1429 | 3300049571 | Ga0501034_0079454 | Ga0501034_0079454_1859_2110 | 83 |
| 1430 | 3300049571 | Ga0501034_0122722 | Ga0501034_0122722_1304_1555 | 83 |
| 1431 | 3300049571 | Ga0501034_0123215 | Ga0501034_0123215_1431_1682 | 83 |
| 1432 | 3300049571 | Ga0501034_0139402 | Ga0501034_0139402_541_792 | 83 |
| 1433 | 3300049571 | Ga0501034_0288655 | Ga0501034_0288655_770_1045 | 83 |
| 1434 | 3300049571 | Ga0501034_0291447 | Ga0501034_0291447_378_668 | 83 |
| 1435 | 3300049571 | Ga0501034_0307254 | Ga0501034_0307254_667_918 | 83 |
| 1436 | 3300049571 | Ga0501034_0378691 | Ga0501034_0378691_806_1060 | 83 |
| 1437 | 3300049571 | Ga0501034_0389914 | Ga0501034_0389914_694_975 | 83 |
| 1438 | 3300049571 | Ga0501034_0395936 | Ga0501034_0395936_94_348 | 83 |
| 1439 | 3300049571 | Ga0501034_0526172 | Ga0501034_0526172_152_406 | 83 |
| 1440 | 3300049571 | Ga0501034_0697660 | Ga0501034_0697660_457_708 | 83 |
| 1441 | 3300049571 | Ga0501034_0698638 | Ga0501034_0698638_178_429 | 83 |
| 1442 | 3300049571 | Ga0501034_0793131 | Ga0501034_0793131_419_673 | 83 |
| 1443 | 3300049571 | Ga0501034_0847211 | Ga0501034_0847211_220_471 | 83 |
| 1444 | 3300049571 | Ga0501034_1231765 | Ga0501034_1231765_298_549 | 83 |
| 1445 | 3300049571 | Ga0501034_1600637 | Ga0501034_1600637_50_340 | 83 |
| 1446 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_110907_111158 | 83 |
| 1447 | 3300049572 | Ga0501036_0001402 | Ga0501036_0001402_1140_1394 | 83 |
| 1448 | 3300049572 | Ga0501036_0006176 | Ga0501036_0006176_8300_8551 | 83 |
| 1449 | 3300049572 | Ga0501036_0205069 | Ga0501036_0205069_1366_1617 | 83 |
| 1450 | 3300049572 | Ga0501036_0224443 | Ga0501036_0224443_562_813 | 83 |
| 1451 | 3300049572 | Ga0501036_0236010 | Ga0501036_0236010_224_475 | 83 |
| 1452 | 3300049572 | Ga0501036_0277095 | Ga0501036_0277095_912_1187 | 83 |
| 1453 | 3300049572 | Ga0501036_0485729 | Ga0501036_0485729_414_671 | 83 |
| 1454 | 3300049572 | Ga0501036_0593031 | Ga0501036_0593031_441_695 | 83 |
| 1455 | 3300049572 | Ga0501036_0899567 | Ga0501036_0899567_142_393 | 83 |
| 1456 | 3300049572 | Ga0501036_1110278 | Ga0501036_1110278_110_361 | 83 |
| 1457 | 3300049572 | Ga0501036_1172201 | Ga0501036_1172201_234_485 | 83 |
| 1458 | 3300049573 | Ga0501037_0000048 | Ga0501037_0000048_65598_65849 | 83 |
| 1459 | 3300049573 | Ga0501037_0000176 | Ga0501037_0000176_47406_47660 | 83 |
| 1460 | 3300049573 | Ga0501037_0000828 | Ga0501037_0000828_3644_3919 | 83 |
| 1461 | 3300049573 | Ga0501037_0016939 | Ga0501037_0016939_1302_1553 | 83 |
| 1462 | 3300049573 | Ga0501037_0036439 | Ga0501037_0036439_779_1030 | 83 |
| 1463 | 3300049573 | Ga0501037_0079088 | Ga0501037_0079088_334_585 | 83 |
| 1464 | 3300049573 | Ga0501037_0099630 | Ga0501037_0099630_208_498 | 83 |
| 1465 | 3300049573 | Ga0501037_0100166 | Ga0501037_0100166_1331_1585 | 83 |
| 1466 | 3300049573 | Ga0501037_0119331 | Ga0501037_0119331_1365_1640 | 83 |
| 1467 | 3300049573 | Ga0501037_0248906 | Ga0501037_0248906_915_1205 | 83 |
| 1468 | 3300049573 | Ga0501037_0885778 | Ga0501037_0885778_20_271 | 83 |
| 1469 | 3300049573 | Ga0501037_0899989 | Ga0501037_0899989_192_443 | 83 |
| 1470 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_155311_155562 | 83 |
| 1471 | 3300049574 | Ga0501038_0000862 | Ga0501038_0000862_9331_9585 | 83 |
| 1472 | 3300049574 | Ga0501038_0002080 | Ga0501038_0002080_9715_9966 | 83 |
| 1473 | 3300049574 | Ga0501038_0070054 | Ga0501038_0070054_1883_2134 | 83 |
| 1474 | 3300049574 | Ga0501038_0139672 | Ga0501038_0139672_571_822 | 83 |
| 1475 | 3300049574 | Ga0501038_0159284 | Ga0501038_0159284_655_906 | 83 |
| 1476 | 3300049574 | Ga0501038_0180255 | Ga0501038_0180255_435_710 | 83 |
| 1477 | 3300049574 | Ga0501038_0220923 | Ga0501038_0220923_499_789 | 83 |
| 1478 | 3300049574 | Ga0501038_0251353 | Ga0501038_0251353_941_1192 | 83 |
| 1479 | 3300049574 | Ga0501038_0302664 | Ga0501038_0302664_670_921 | 83 |
| 1480 | 3300049574 | Ga0501038_0338173 | Ga0501038_0338173_866_1117 | 83 |
| 1481 | 3300049574 | Ga0501038_0346042 | Ga0501038_0346042_376_627 | 83 |
| 1482 | 3300049574 | Ga0501038_0449010 | Ga0501038_0449010_149_400 | 83 |
| 1483 | 3300049574 | Ga0501038_0468901 | Ga0501038_0468901_489_743 | 83 |
| 1484 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_192951_193202 | 83 |
| 1485 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_114155_114409 | 83 |
| 1486 | 3300049575 | Ga0501039_0003603 | Ga0501039_0003603_8948_9199 | 83 |
| 1487 | 3300049575 | Ga0501039_0043673 | Ga0501039_0043673_1041_1292 | 83 |
| 1488 | 3300049575 | Ga0501039_0130512 | Ga0501039_0130512_254_505 | 83 |
| 1489 | 3300049575 | Ga0501039_0160922 | Ga0501039_0160922_93_344 | 83 |
| 1490 | 3300049575 | Ga0501039_0389942 | Ga0501039_0389942_788_1063 | 83 |
| 1491 | 3300049575 | Ga0501039_0520110 | Ga0501039_0520110_115_369 | 83 |
| 1492 | 3300049575 | Ga0501039_0659405 | Ga0501039_0659405_255_536 | 83 |
| 1493 | 3300049575 | Ga0501039_1091182 | Ga0501039_1091182_304_558 | 83 |
| 1494 | 3300049576 | Ga0501040_0134996 | Ga0501040_0134996_176_433 | 83 |
| 1495 | 3300049576 | Ga0501040_0271230 | Ga0501040_0271230_90_341 | 83 |
| 1496 | 3300049577 | Ga0501041_0171474 | Ga0501041_0171474_1001_1255 | 83 |
| 1497 | 3300049577 | Ga0501041_0371871 | Ga0501041_0371871_58_315 | 83 |
| 1498 | 3300049577 | Ga0501041_0402797 | Ga0501041_0402797_94_345 | 83 |
| 1499 | 3300049578 | Ga0501042_0022915 | Ga0501042_0022915_970_1221 | 83 |
| 1500 | 3300049578 | Ga0501042_0796869 | Ga0501042_0796869_296_547 | 83 |
| 1501 | 3300049578 | Ga0501042_0848560 | Ga0501042_0848560_54_308 | 83 |
| 1502 | 3300049579 | Ga0501043_0000051 | Ga0501043_0000051_1151_1405 | 83 |
| 1503 | 3300049579 | Ga0501043_0000114 | Ga0501043_0000114_68656_68931 | 83 |
| 1504 | 3300049579 | Ga0501043_0000298 | Ga0501043_0000298_7032_7283 | 83 |
| 1505 | 3300049579 | Ga0501043_0097713 | Ga0501043_0097713_523_777 | 83 |
| 1506 | 3300049579 | Ga0501043_0123911 | Ga0501043_0123911_474_725 | 83 |
| 1507 | 3300049579 | Ga0501043_0193524 | Ga0501043_0193524_225_476 | 83 |
| 1508 | 3300049579 | Ga0501043_0331146 | Ga0501043_0331146_239_490 | 83 |
| 1509 | 3300049579 | Ga0501043_0348760 | Ga0501043_0348760_185_475 | 83 |
| 1510 | 3300049579 | Ga0501043_0578768 | Ga0501043_0578768_164_439 | 83 |
| 1511 | 3300049579 | Ga0501043_0592499 | Ga0501043_0592499_515_766 | 83 |
| 1512 | 3300049579 | Ga0501043_0684458 | Ga0501043_0684458_209_490 | 83 |
| 1513 | 3300049579 | Ga0501043_0689456 | Ga0501043_0689456_131_412 | 83 |
| 1514 | 3300049579 | Ga0501043_0806801 | Ga0501043_0806801_140_391 | 83 |
| 1515 | 3300049580 | Ga0501046_0002813 | Ga0501046_0002813_9147_9398 | 83 |
| 1516 | 3300049580 | Ga0501046_0210740 | Ga0501046_0210740_153_407 | 83 |
| 1517 | 3300049580 | Ga0501046_0222356 | Ga0501046_0222356_960_1217 | 83 |
| 1518 | 3300049580 | Ga0501046_0435005 | Ga0501046_0435005_670_921 | 83 |
| 1519 | 3300049580 | Ga0501046_0612252 | Ga0501046_0612252_470_760 | 83 |
| 1520 | 3300049580 | Ga0501046_0743585 | Ga0501046_0743585_92_343 | 83 |
| 1521 | 3300049580 | Ga0501046_1202505 | Ga0501046_1202505_254_505 | 83 |
| 1522 | 3300049581 | Ga0501047_0000801 | Ga0501047_0000801_3367_3618 | 83 |
| 1523 | 3300049581 | Ga0501047_0003631 | Ga0501047_0003631_4646_4897 | 83 |
| 1524 | 3300049581 | Ga0501047_0007205 | Ga0501047_0007205_10146_10421 | 83 |
| 1525 | 3300049581 | Ga0501047_0024244 | Ga0501047_0024244_82_333 | 83 |
| 1526 | 3300049581 | Ga0501047_0037480 | Ga0501047_0037480_2571_2852 | 83 |
| 1527 | 3300049581 | Ga0501047_0056953 | Ga0501047_0056953_2264_2515 | 83 |
| 1528 | 3300049581 | Ga0501047_0066964 | Ga0501047_0066964_2454_2705 | 83 |
| 1529 | 3300049581 | Ga0501047_0126975 | Ga0501047_0126975_1642_1893 | 83 |
| 1530 | 3300049581 | Ga0501047_0135061 | Ga0501047_0135061_234_524 | 83 |
| 1531 | 3300049581 | Ga0501047_0160390 | Ga0501047_0160390_297_548 | 83 |
| 1532 | 3300049581 | Ga0501047_0296359 | Ga0501047_0296359_688_939 | 83 |
| 1533 | 3300049581 | Ga0501047_0314922 | Ga0501047_0314922_717_968 | 83 |
| 1534 | 3300049581 | Ga0501047_0317553 | Ga0501047_0317553_540_794 | 83 |
| 1535 | 3300049581 | Ga0501047_0397273 | Ga0501047_0397273_442_693 | 83 |
| 1536 | 3300049581 | Ga0501047_0538013 | Ga0501047_0538013_86_337 | 83 |
| 1537 | 3300049581 | Ga0501047_0640339 | Ga0501047_0640339_256_507 | 83 |
| 1538 | 3300049581 | Ga0501047_0713277 | Ga0501047_0713277_385_636 | 83 |
| 1539 | 3300049581 | Ga0501047_0765362 | Ga0501047_0765362_314_565 | 83 |
| 1540 | 3300049581 | Ga0501047_0821544 | Ga0501047_0821544_310_576 | 83 |
| 1541 | 3300049581 | Ga0501047_0870283 | Ga0501047_0870283_384_635 | 83 |
| 1542 | 3300049581 | Ga0501047_0957566 | Ga0501047_0957566_250_531 | 83 |
| 1543 | 3300049581 | Ga0501047_1159146 | Ga0501047_1159146_277_528 | 83 |
| 1544 | 3300049581 | Ga0501047_1261978 | Ga0501047_1261978_233_523 | 83 |
| 1545 | 3300049581 | Ga0501047_1330168 | Ga0501047_1330168_10_300 | 83 |
| 1546 | 3300049582 | Ga0501048_0005516 | Ga0501048_0005516_1100_1351 | 83 |
| 1547 | 3300049582 | Ga0501048_0020520 | Ga0501048_0020520_1497_1748 | 83 |
| 1548 | 3300049582 | Ga0501048_0637783 | Ga0501048_0637783_165_416 | 83 |
| 1549 | 3300049582 | Ga0501048_0754454 | Ga0501048_0754454_246_497 | 83 |
| 1550 | 3300049583 | Ga0501067_0025416 | Ga0501067_0025416_2544_2795 | 83 |
| 1551 | 3300049583 | Ga0501067_0085497 | Ga0501067_0085497_681_932 | 83 |
| 1552 | 3300049583 | Ga0501067_0148337 | Ga0501067_0148337_281_571 | 83 |
| 1553 | 3300049583 | Ga0501067_0277425 | Ga0501067_0277425_652_903 | 83 |
| 1554 | 3300049584 | Ga0501068_0021421 | Ga0501068_0021421_2350_2601 | 83 |
| 1555 | 3300049584 | Ga0501068_0050259 | Ga0501068_0050259_2061_2336 | 83 |
| 1556 | 3300049584 | Ga0501068_0178750 | Ga0501068_0178750_546_797 | 83 |
| 1557 | 3300049584 | Ga0501068_0622087 | Ga0501068_0622087_323_574 | 83 |
| 1558 | 3300049584 | Ga0501068_1194656 | Ga0501068_1194656_94_351 | 83 |
| 1559 | 3300049585 | Ga0501069_0000016 | Ga0501069_0000016_7291_7566 | 83 |
| 1560 | 3300049585 | Ga0501069_0003777 | Ga0501069_0003777_7109_7384 | 83 |
| 1561 | 3300049585 | Ga0501069_0004450 | Ga0501069_0004450_921_1172 | 83 |
| 1562 | 3300049585 | Ga0501069_0035566 | Ga0501069_0035566_336_617 | 83 |
| 1563 | 3300049585 | Ga0501069_0046007 | Ga0501069_0046007_609_884 | 83 |
| 1564 | 3300049585 | Ga0501069_0053290 | Ga0501069_0053290_1582_1833 | 83 |
| 1565 | 3300049585 | Ga0501069_0192208 | Ga0501069_0192208_285_536 | 83 |
| 1566 | 3300049585 | Ga0501069_0405145 | Ga0501069_0405145_13_294 | 83 |
| 1567 | 3300049586 | Ga0501070_0000186 | Ga0501070_0000186_41405_41680 | 83 |
| 1568 | 3300049586 | Ga0501070_0000931 | Ga0501070_0000931_9154_9435 | 83 |
| 1569 | 3300049586 | Ga0501070_0006076 | Ga0501070_0006076_8312_8563 | 83 |
| 1570 | 3300049586 | Ga0501070_0006421 | Ga0501070_0006421_4898_5173 | 83 |
| 1571 | 3300049586 | Ga0501070_0011400 | Ga0501070_0011400_2854_3105 | 83 |
| 1572 | 3300049586 | Ga0501070_0025050 | Ga0501070_0025050_334_585 | 83 |
| 1573 | 3300049586 | Ga0501070_0107402 | Ga0501070_0107402_1104_1379 | 83 |
| 1574 | 3300049586 | Ga0501070_0126598 | Ga0501070_0126598_1334_1609 | 83 |
| 1575 | 3300049586 | Ga0501070_0246047 | Ga0501070_0246047_850_1101 | 83 |
| 1576 | 3300049586 | Ga0501070_0255729 | Ga0501070_0255729_231_482 | 83 |
| 1577 | 3300049586 | Ga0501070_0289420 | Ga0501070_0289420_477_728 | 83 |
| 1578 | 3300049586 | Ga0501070_0474697 | Ga0501070_0474697_464_745 | 83 |
| 1579 | 3300049586 | Ga0501070_0531996 | Ga0501070_0531996_517_768 | 83 |
| 1580 | 3300049586 | Ga0501070_0594590 | Ga0501070_0594590_479_730 | 83 |
| 1581 | 3300049586 | Ga0501070_0621858 | Ga0501070_0621858_158_415 | 83 |
| 1582 | 3300049586 | Ga0501070_0636116 | Ga0501070_0636116_267_548 | 83 |
| 1583 | 3300049586 | Ga0501070_0690710 | Ga0501070_0690710_530_781 | 83 |
| 1584 | 3300049586 | Ga0501070_0701238 | Ga0501070_0701238_166_456 | 83 |
| 1585 | 3300049586 | Ga0501070_0927086 | Ga0501070_0927086_242_493 | 83 |
| 1586 | 3300049587 | Ga0501071_0004977 | Ga0501071_0004977_766_1017 | 83 |
| 1587 | 3300049587 | Ga0501071_0013894 | Ga0501071_0013894_4890_5165 | 83 |
| 1588 | 3300049587 | Ga0501071_0099158 | Ga0501071_0099158_1410_1667 | 83 |
| 1589 | 3300049587 | Ga0501071_0236158 | Ga0501071_0236158_625_876 | 83 |
| 1590 | 3300049587 | Ga0501071_0556507 | Ga0501071_0556507_308_598 | 83 |
| 1591 | 3300049587 | Ga0501071_0866794 | Ga0501071_0866794_151_426 | 83 |
| 1592 | 3300049587 | Ga0501071_1111468 | Ga0501071_1111468_147_410 | 83 |
| 1593 | 3300049588 | Ga0501072_0381774 | Ga0501072_0381774_479_730 | 83 |
| 1594 | 3300049588 | Ga0501072_0473067 | Ga0501072_0473067_669_920 | 83 |
| 1595 | 3300049588 | Ga0501072_0824625 | Ga0501072_0824625_30_281 | 83 |
| 1596 | 3300049588 | Ga0501072_0982712 | Ga0501072_0982712_341_592 | 83 |
| 1597 | 3300049589 | Ga0501073_0001927 | Ga0501073_0001927_1859_2110 | 83 |
| 1598 | 3300049589 | Ga0501073_0031080 | Ga0501073_0031080_1125_1376 | 83 |
| 1599 | 3300049589 | Ga0501073_0069860 | Ga0501073_0069860_545_796 | 83 |
| 1600 | 3300049589 | Ga0501073_0092940 | Ga0501073_0092940_165_446 | 83 |
| 1601 | 3300049589 | Ga0501073_0097234 | Ga0501073_0097234_1396_1647 | 83 |
| 1602 | 3300049589 | Ga0501073_0130012 | Ga0501073_0130012_951_1202 | 83 |
| 1603 | 3300049589 | Ga0501073_0141309 | Ga0501073_0141309_586_837 | 83 |
| 1604 | 3300049589 | Ga0501073_0156523 | Ga0501073_0156523_861_1136 | 83 |
| 1605 | 3300049589 | Ga0501073_0169919 | Ga0501073_0169919_1139_1390 | 83 |
| 1606 | 3300049589 | Ga0501073_0185341 | Ga0501073_0185341_724_999 | 83 |
| 1607 | 3300049589 | Ga0501073_0407456 | Ga0501073_0407456_188_439 | 83 |
| 1608 | 3300049589 | Ga0501073_0410190 | Ga0501073_0410190_584_835 | 83 |
| 1609 | 3300049589 | Ga0501073_0599732 | Ga0501073_0599732_70_327 | 83 |
| 1610 | 3300049589 | Ga0501073_1164911 | Ga0501073_1164911_38_295 | 83 |
| 1611 | 3300049590 | Ga0501074_0000831 | Ga0501074_0000831_7814_8065 | 83 |
| 1612 | 3300049590 | Ga0501074_0001818 | Ga0501074_0001818_8027_8302 | 83 |
| 1613 | 3300049590 | Ga0501074_0047325 | Ga0501074_0047325_1921_2172 | 83 |
| 1614 | 3300049590 | Ga0501074_0073258 | Ga0501074_0073258_283_534 | 83 |
| 1615 | 3300049590 | Ga0501074_0099182 | Ga0501074_0099182_212_493 | 83 |
| 1616 | 3300049590 | Ga0501074_0124714 | Ga0501074_0124714_1001_1252 | 83 |
| 1617 | 3300049590 | Ga0501074_0371372 | Ga0501074_0371372_373_663 | 83 |
| 1618 | 3300049590 | Ga0501074_0462062 | Ga0501074_0462062_280_531 | 83 |
| 1619 | 3300049590 | Ga0501074_0464656 | Ga0501074_0464656_385_636 | 83 |
| 1620 | 3300049590 | Ga0501074_0875036 | Ga0501074_0875036_24_281 | 83 |
| 1621 | 3300049590 | Ga0501074_1042126 | Ga0501074_1042126_194_475 | 83 |
| 1622 | 3300049590 | Ga0501074_1045860 | Ga0501074_1045860_307_558 | 83 |
| 1623 | 3300049590 | Ga0501074_1294738 | Ga0501074_1294738_159_410 | 83 |
| 1624 | 3300049591 | Ga0501075_0092368 | Ga0501075_0092368_537_794 | 83 |
| 1625 | 3300049591 | Ga0501075_0561574 | Ga0501075_0561574_397_648 | 83 |
| 1626 | 3300049592 | Ga0501076_0096701 | Ga0501076_0096701_351_602 | 83 |
| 1627 | 3300049592 | Ga0501076_0145684 | Ga0501076_0145684_785_1042 | 83 |
| 1628 | 3300049592 | Ga0501076_0442465 | Ga0501076_0442465_404_655 | 83 |
| 1629 | 3300049592 | Ga0501076_0692037 | Ga0501076_0692037_140_391 | 83 |
| 1630 | 3300049592 | Ga0501076_1281469 | Ga0501076_1281469_100_351 | 83 |
| 1631 | 3300049593 | Ga0501077_0072866 | Ga0501077_0072866_1213_1464 | 83 |
| 1632 | 3300049593 | Ga0501077_0153358 | Ga0501077_0153358_958_1209 | 83 |
| 1633 | 3300049593 | Ga0501077_0220110 | Ga0501077_0220110_338_589 | 83 |
| 1634 | 3300049593 | Ga0501077_0266593 | Ga0501077_0266593_720_977 | 83 |
| 1635 | 3300049593 | Ga0501077_0409219 | Ga0501077_0409219_470_721 | 83 |
| 1636 | 3300049663 | Ga0501223_094886 | Ga0501223_094886_75_326 | 83 |
| 1637 | 3300049671 | Ga0501238_011525 | Ga0501238_011525_19_270 | 83 |
| 1638 | 3300049741 | Ga0501079_0010606 | Ga0501079_0010606_2143_2394 | 83 |
| 1639 | 3300049741 | Ga0501079_0085851 | Ga0501079_0085851_304_555 | 83 |
| 1640 | 3300049741 | Ga0501079_0095573 | Ga0501079_0095573_1299_1574 | 83 |
| 1641 | 3300049741 | Ga0501079_0409423 | Ga0501079_0409423_761_1012 | 83 |
| 1642 | 3300049741 | Ga0501079_1328203 | Ga0501079_1328203_130_381 | 83 |
| 1643 | 3300049742 | Ga0501080_0001450 | Ga0501080_0001450_18249_18530 | 83 |
| 1644 | 3300049742 | Ga0501080_0004427 | Ga0501080_0004427_11222_11497 | 83 |
| 1645 | 3300049742 | Ga0501080_0005392 | Ga0501080_0005392_1508_1759 | 83 |
| 1646 | 3300049742 | Ga0501080_0011492 | Ga0501080_0011492_2838_3113 | 83 |
| 1647 | 3300049742 | Ga0501080_0027959 | Ga0501080_0027959_598_849 | 83 |
| 1648 | 3300049742 | Ga0501080_0033685 | Ga0501080_0033685_2195_2470 | 83 |
| 1649 | 3300049742 | Ga0501080_0106323 | Ga0501080_0106323_1813_2064 | 83 |
| 1650 | 3300049742 | Ga0501080_0149501 | Ga0501080_0149501_452_703 | 83 |
| 1651 | 3300049742 | Ga0501080_0369916 | Ga0501080_0369916_706_957 | 83 |
| 1652 | 3300049742 | Ga0501080_0655661 | Ga0501080_0655661_247_498 | 83 |
| 1653 | 3300049742 | Ga0501080_0737411 | Ga0501080_0737411_513_794 | 83 |
| 1654 | 3300049742 | Ga0501080_0805636 | Ga0501080_0805636_520_771 | 83 |
| 1655 | 3300049743 | Ga0501081_0750904 | Ga0501081_0750904_150_401 | 83 |
| 1656 | 3300049743 | Ga0501081_0906220 | Ga0501081_0906220_70_321 | 83 |
| 1657 | 3300049744 | Ga0501083_0000111 | Ga0501083_0000111_8091_8366 | 83 |
| 1658 | 3300049744 | Ga0501083_0001724 | Ga0501083_0001724_9112_9363 | 83 |
| 1659 | 3300049744 | Ga0501083_0003402 | Ga0501083_0003402_1858_2109 | 83 |
| 1660 | 3300049744 | Ga0501083_0150491 | Ga0501083_0150491_61_351 | 83 |
| 1661 | 3300049744 | Ga0501083_0267327 | Ga0501083_0267327_203_454 | 83 |
| 1662 | 3300049744 | Ga0501083_0267625 | Ga0501083_0267625_145_396 | 83 |
| 1663 | 3300049744 | Ga0501083_0287392 | Ga0501083_0287392_773_1024 | 83 |
| 1664 | 3300049744 | Ga0501083_0615441 | Ga0501083_0615441_389_640 | 83 |
| 1665 | 3300049744 | Ga0501083_0679520 | Ga0501083_0679520_271_522 | 83 |
| 1666 | 3300049744 | Ga0501083_0701017 | Ga0501083_0701017_340_591 | 83 |
| 1667 | 3300049744 | Ga0501083_0910504 | Ga0501083_0910504_281_532 | 83 |
| 1668 | 3300049744 | Ga0501083_0929007 | Ga0501083_0929007_90_341 | 83 |
| 1669 | 3300049744 | Ga0501083_1041056 | Ga0501083_1041056_227_478 | 83 |
| 1670 | 3300049776 | Ga0501280_001370 | Ga0501280_001370_2852_3106 | 83 |
| 1671 | 3300049822 | Ga0501035_0000022 | Ga0501035_0000022_74703_74954 | 83 |
| 1672 | 3300049822 | Ga0501035_0000102 | Ga0501035_0000102_105551_105805 | 83 |
| 1673 | 3300049822 | Ga0501035_0000690 | Ga0501035_0000690_33128_33409 | 83 |
| 1674 | 3300049822 | Ga0501035_0000752 | Ga0501035_0000752_14388_14678 | 83 |
| 1675 | 3300049822 | Ga0501035_0001093 | Ga0501035_0001093_2689_2964 | 83 |
| 1676 | 3300049822 | Ga0501035_0001914 | Ga0501035_0001914_9034_9309 | 83 |
| 1677 | 3300049822 | Ga0501035_0012136 | Ga0501035_0012136_5433_5723 | 83 |
| 1678 | 3300049822 | Ga0501035_0029146 | Ga0501035_0029146_984_1235 | 83 |
| 1679 | 3300049822 | Ga0501035_0098972 | Ga0501035_0098972_1793_2047 | 83 |
| 1680 | 3300049822 | Ga0501035_0108729 | Ga0501035_0108729_618_869 | 83 |
| 1681 | 3300049822 | Ga0501035_0109655 | Ga0501035_0109655_64_315 | 83 |
| 1682 | 3300049822 | Ga0501035_0117013 | Ga0501035_0117013_908_1159 | 83 |
| 1683 | 3300049822 | Ga0501035_0158230 | Ga0501035_0158230_392_673 | 83 |
| 1684 | 3300049822 | Ga0501035_0174693 | Ga0501035_0174693_487_738 | 83 |
| 1685 | 3300049822 | Ga0501035_0183865 | Ga0501035_0183865_418_669 | 83 |
| 1686 | 3300049822 | Ga0501035_0420319 | Ga0501035_0420319_280_531 | 83 |
| 1687 | 3300049822 | Ga0501035_0565260 | Ga0501035_0565260_345_596 | 83 |
| 1688 | 3300049822 | Ga0501035_0664206 | Ga0501035_0664206_207_497 | 83 |
| 1689 | 3300049822 | Ga0501035_0915627 | Ga0501035_0915627_35_310 | 83 |
| 1690 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_181951_182202 | 83 |
| 1691 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_81893_82168 | 83 |
| 1692 | 3300049823 | Ga0501044_0000255 | Ga0501044_0000255_29538_29789 | 83 |
| 1693 | 3300049823 | Ga0501044_0002922 | Ga0501044_0002922_4745_5026 | 83 |
| 1694 | 3300049823 | Ga0501044_0016909 | Ga0501044_0016909_1380_1631 | 83 |
| 1695 | 3300049823 | Ga0501044_0021665 | Ga0501044_0021665_2810_3100 | 83 |
| 1696 | 3300049823 | Ga0501044_0022140 | Ga0501044_0022140_334_585 | 83 |
| 1697 | 3300049823 | Ga0501044_0049355 | Ga0501044_0049355_2885_3139 | 83 |
| 1698 | 3300049823 | Ga0501044_0070221 | Ga0501044_0070221_759_1010 | 83 |
| 1699 | 3300049823 | Ga0501044_0082154 | Ga0501044_0082154_2737_3012 | 83 |
| 1700 | 3300049823 | Ga0501044_0089157 | Ga0501044_0089157_693_947 | 83 |
| 1701 | 3300049823 | Ga0501044_0098827 | Ga0501044_0098827_2262_2543 | 83 |
| 1702 | 3300049823 | Ga0501044_0131509 | Ga0501044_0131509_629_919 | 83 |
| 1703 | 3300049823 | Ga0501044_0156921 | Ga0501044_0156921_607_858 | 83 |
| 1704 | 3300049823 | Ga0501044_0164118 | Ga0501044_0164118_909_1199 | 83 |
| 1705 | 3300049823 | Ga0501044_0296069 | Ga0501044_0296069_700_951 | 83 |
| 1706 | 3300049823 | Ga0501044_0500508 | Ga0501044_0500508_536_811 | 83 |
| 1707 | 3300049823 | Ga0501044_0640775 | Ga0501044_0640775_379_630 | 83 |
| 1708 | 3300049823 | Ga0501044_0890514 | Ga0501044_0890514_492_743 | 83 |
| 1709 | 3300049823 | Ga0501044_1144578 | Ga0501044_1144578_255_509 | 83 |
| 1710 | 3300049823 | Ga0501044_1435774 | Ga0501044_1435774_158_439 | 83 |
| 1711 | 3300049824 | Ga0501045_0005999 | Ga0501045_0005999_5917_6168 | 83 |
| 1712 | 3300049824 | Ga0501045_0048465 | Ga0501045_0048465_2225_2482 | 83 |
| 1713 | 3300049824 | Ga0501045_0270327 | Ga0501045_0270327_667_918 | 83 |
| 1714 | 3300049824 | Ga0501045_0448015 | Ga0501045_0448015_577_828 | 83 |
| 1715 | 3300049824 | Ga0501045_0689354 | Ga0501045_0689354_264_515 | 83 |
| 1716 | 3300049824 | Ga0501045_1285448 | Ga0501045_1285448_116_367 | 83 |
| 1717 | 3300050489 | nmdc:mga03683_139460_c1 | nmdc:mga03683_139460_c1_236_493 | 83 |
| 1718 | 3300050490 | nmdc:mga03n38_431760_c1 | nmdc:mga03n38_431760_c1_309_566 | 83 |
| 1719 | 3300050490 | nmdc:mga03n38_633722_c1 | nmdc:mga03n38_633722_c1_60_317 | 83 |
| 1720 | 3300050490 | nmdc:mga03n38_85051_c1 | nmdc:mga03n38_85051_c1_141_395 | 83 |
| 1721 | 3300050490 | nmdc:mga03n38_902838_c1 | nmdc:mga03n38_902838_c1_110_370 | 83 |
| 1722 | 3300050491 | nmdc:mga00v17_115_c2 | nmdc:mga00v17_115_c2_44886_45146 | 83 |
| 1723 | 3300050491 | nmdc:mga00v17_300630_c1 | nmdc:mga00v17_300630_c1_107_364 | 83 |
| 1724 | 3300050492 | nmdc:mga0yw44_102224_c1 | nmdc:mga0yw44_102224_c1_784_1041 | 83 |
| 1725 | 3300050492 | nmdc:mga0yw44_141277_c1 | nmdc:mga0yw44_141277_c1_634_894 | 83 |
| 1726 | 3300050492 | nmdc:mga0yw44_184850_c1 | nmdc:mga0yw44_184850_c1_1043_1297 | 83 |
| 1727 | 3300050492 | nmdc:mga0yw44_240571_c1 | nmdc:mga0yw44_240571_c1_245_502 | 83 |
| 1728 | 3300050492 | nmdc:mga0yw44_332942_c1 | nmdc:mga0yw44_332942_c1_528_782 | 83 |
| 1729 | 3300050492 | nmdc:mga0yw44_66004_c1 | nmdc:mga0yw44_66004_c1_22_279 | 83 |
| 1730 | 3300050492 | nmdc:mga0yw44_81368_c1 | nmdc:mga0yw44_81368_c1_47_307 | 83 |
| 1731 | 3300050493 | nmdc:mga0k408_36900_c1 | nmdc:mga0k408_36900_c1_695_949 | 83 |
| 1732 | 3300050493 | nmdc:mga0k408_658257_c1 | nmdc:mga0k408_658257_c1_343_600 | 83 |
| 1733 | 3300050494 | nmdc:mga06z11_197649_c1 | nmdc:mga06z11_197649_c1_476_754 | 83 |
| 1734 | 3300050494 | nmdc:mga06z11_222987_c1 | nmdc:mga06z11_222987_c1_184_441 | 83 |
| 1735 | 3300050494 | nmdc:mga06z11_23123_c1 | nmdc:mga06z11_23123_c1_1022_1276 | 83 |
| 1736 | 3300050494 | nmdc:mga06z11_66941_c1 | nmdc:mga06z11_66941_c1_1623_1877 | 83 |
| 1737 | 3300050494 | nmdc:mga06z11_821366_c1 | nmdc:mga06z11_821366_c1_71_322 | 83 |
| 1738 | 3300050495 | nmdc:mga04h51_33389_c1 | nmdc:mga04h51_33389_c1_384_638 | 83 |
| 1739 | 3300050496 | nmdc:mga07m45_229620_c1 | nmdc:mga07m45_229620_c1_736_990 | 83 |
| 1740 | 3300050496 | nmdc:mga07m45_28926_c1 | nmdc:mga07m45_28926_c1_1363_1620 | 83 |
| 1741 | 3300050496 | nmdc:mga07m45_845887_c1 | nmdc:mga07m45_845887_c1_193_453 | 83 |
| 1742 | 3300050511 | nmdc:mga08y16_453195_c1 | nmdc:mga08y16_453195_c1_159_419 | 83 |
| 1743 | 3300050516 | nmdc:mga0sz30_16635_c1 | nmdc:mga0sz30_16635_c1_340_594 | 83 |
| 1744 | 3300050516 | nmdc:mga0sz30_193405_c1 | nmdc:mga0sz30_193405_c1_236_493 | 83 |
| 1745 | 3300050516 | nmdc:mga0sz30_263223_c1 | nmdc:mga0sz30_263223_c1_83_340 | 83 |
| 1746 | 3300050516 | nmdc:mga0sz30_39361_c1 | nmdc:mga0sz30_39361_c1_966_1259 | 83 |
| 1747 | 3300050516 | nmdc:mga0sz30_77891_c1 | nmdc:mga0sz30_77891_c1_384_662 | 83 |
| 1748 | 3300053078 | Ga0495612_0137474 | Ga0495612_0137474_676_927 | 83 |
| 1749 | 3300053083 | Ga0495655_0111615 | Ga0495655_0111615_539_796 | 83 |
| 1750 | 3300053083 | Ga0495655_0277816 | Ga0495655_0277816_258_518 | 83 |
| 1751 | 3300053084 | Ga0495595_0539691 | Ga0495595_0539691_206_457 | 83 |
| 1752 | 3300053085 | Ga0495619_0041037 | Ga0495619_0041037_1536_1787 | 83 |
| 1753 | 3300053087 | Ga0500643_010419 | Ga0500643_010419_522_776 | 83 |
| 1754 | 3300053088 | Ga0500644_0014616 | Ga0500644_0014616_1182_1439 | 83 |
| 1755 | 3300053090 | Ga0500646_0218015 | Ga0500646_0218015_258_509 | 83 |
| 1756 | 3300053093 | Ga0500651_0400215 | Ga0500651_0400215_205_459 | 83 |
| 1757 | 3300053108 | Ga0500562_148309 | Ga0500562_148309_283_549 | 83 |
| 1758 | 3300053116 | Ga0500592_074338 | Ga0500592_074338_89_349 | 83 |
| 1759 | 3300053119 | Ga0500595_037747 | Ga0500595_037747_882_1139 | 83 |
| 1760 | 3300053121 | Ga0500607_264271 | Ga0500607_264271_122_403 | 83 |
| 1761 | 3300053125 | Ga0500618_012633 | Ga0500618_012633_113_376 | 83 |
| 1762 | 3300053126 | Ga0500621_166484 | Ga0500621_166484_275_532 | 83 |
| 1763 | 3300053130 | Ga0500642_0460303 | Ga0500642_0460303_157_423 | 83 |
| 1764 | 3300053134 | Ga0500658_0103484 | Ga0500658_0103484_821_1075 | 83 |
| 1765 | 3300053136 | Ga0500559_0318752 | Ga0500559_0318752_145_399 | 83 |
| 1766 | 3300053139 | Ga0500568_0000143 | Ga0500568_0000143_34526_34792 | 83 |
| 1767 | 3300053139 | Ga0500568_0003084 | Ga0500568_0003084_1291_1545 | 83 |
| 1768 | 3300053139 | Ga0500568_0314746 | Ga0500568_0314746_22_276 | 83 |
| 1769 | 3300053139 | Ga0500568_0365473 | Ga0500568_0365473_202_459 | 83 |
| 1770 | 3300053148 | Ga0500590_001637 | Ga0500590_001637_1350_1604 | 83 |
| 1771 | 3300053151 | Ga0500604_0132226 | Ga0500604_0132226_306_560 | 83 |
| 1772 | 3300053153 | Ga0500616_0001190 | Ga0500616_0001190_9247_9504 | 83 |
| 1773 | 3300053153 | Ga0500616_0059686 | Ga0500616_0059686_637_918 | 83 |
| 1774 | 3300053153 | Ga0500616_0133505 | Ga0500616_0133505_121_375 | 83 |
| 1775 | 3300053153 | Ga0500616_0140386 | Ga0500616_0140386_226_480 | 83 |
| 1776 | 3300053155 | Ga0500620_003773 | Ga0500620_003773_134_391 | 83 |
| 1777 | 3300053156 | Ga0500622_0000364 | Ga0500622_0000364_33048_33305 | 83 |
| 1778 | 3300053156 | Ga0500622_0000757 | Ga0500622_0000757_2039_2293 | 83 |
| 1779 | 3300053156 | Ga0500622_0231560 | Ga0500622_0231560_377_634 | 83 |
| 1780 | 3300053157 | Ga0500624_093001 | Ga0500624_093001_287_541 | 83 |
| 1781 | 3300053158 | Ga0500627_0127639 | Ga0500627_0127639_59_316 | 83 |
| 1782 | 3300053158 | Ga0500627_0166663 | Ga0500627_0166663_26_283 | 83 |
| 1783 | 3300053158 | Ga0500627_0228484 | Ga0500627_0228484_75_332 | 83 |
| 1784 | 3300053158 | Ga0500627_0295216 | Ga0500627_0295216_400_660 | 83 |
| 1785 | 3300053158 | Ga0500627_0299371 | Ga0500627_0299371_31_288 | 83 |
| 1786 | 3300053158 | Ga0500627_0346384 | Ga0500627_0346384_281_541 | 83 |
| 1787 | 3300053160 | Ga0500633_0005625 | Ga0500633_0005625_211_465 | 83 |
| 1788 | 3300053161 | Ga0500634_0002302 | Ga0500634_0002302_5292_5546 | 83 |
| 1789 | 3300053161 | Ga0500634_0404040 | Ga0500634_0404040_118_399 | 83 |
| 1790 | 3300053177 | Ga0500636_0008368 | Ga0500636_0008368_1386_1667 | 83 |
| 1791 | 3300053727 | Ga0500611_050029 | Ga0500611_050029_567_818 | 83 |
| 1792 | 3300053730 | Ga0500645_036989 | Ga0500645_036989_202_453 | 83 |
| 1793 | 3300053730 | Ga0500645_180497 | Ga0500645_180497_39_296 | 83 |
| 1794 | 3300053734 | Ga0500565_078516 | Ga0500565_078516_231_485 | 83 |
| 1795 | 3300054114 | Ga0501084_0011781 | Ga0501084_0011781_5341_5592 | 83 |
| 1796 | 3300054114 | Ga0501084_0318848 | Ga0501084_0318848_993_1244 | 83 |
| 1797 | 3300054114 | Ga0501084_0425202 | Ga0501084_0425202_50_301 | 83 |
| 1798 | 3300054114 | Ga0501084_0863401 | Ga0501084_0863401_247_498 | 83 |
| 1799 | 3300054114 | Ga0501084_1043279 | Ga0501084_1043279_299_550 | 83 |
| 1800 | 3300054114 | Ga0501084_1214317 | Ga0501084_1214317_70_327 | 83 |
| 1801 | 3300054114 | Ga0501084_1331957 | Ga0501084_1331957_165_440 | 83 |
| 1802 | 3300054114 | Ga0501084_1551807 | Ga0501084_1551807_248_499 | 83 |
| 1803 | 3300059508 | Ga0587088_130745 | Ga0587088_130745_254_508 | 83 |
| 1804 | 3300059641 | Ga0587068_110313 | Ga0587068_110313_230_484 | 83 |
| 1805 | 3300060353 | Ga0501082_0006649 | Ga0501082_0006649_5022_5273 | 83 |
| 1806 | 3300060353 | Ga0501082_0028296 | Ga0501082_0028296_1412_1663 | 83 |
| 1807 | 3300060353 | Ga0501082_0153547 | Ga0501082_0153547_597_872 | 83 |
| 1808 | 3300060353 | Ga0501082_0175464 | Ga0501082_0175464_1241_1492 | 83 |
| 1809 | 3300060353 | Ga0501082_0201294 | Ga0501082_0201294_349_600 | 83 |
| 1810 | 3300060353 | Ga0501082_0294964 | Ga0501082_0294964_96_347 | 83 |
| 1811 | 3300060353 | Ga0501082_0321173 | Ga0501082_0321173_557_814 | 83 |
| 1812 | 3300060353 | Ga0501082_0397747 | Ga0501082_0397747_438_689 | 83 |
| 1813 | 3300060353 | Ga0501082_0476446 | Ga0501082_0476446_12_302 | 83 |
| 1814 | 3300060353 | Ga0501082_1495677 | Ga0501082_1495677_237_488 | 83 |
| 1815 | iso_pu_bacteria | 2513237351 | 2514588156 | 83 |
| 1816 | iso_pu_bacteria | 2643221733 | 2644731719 | 83 |
| 1817 | iso_pu_bacteria | 2643221736 | 2644745220 | 83 |
| 1818 | iso_pu_bacteria | 2818991467 | 2819719297 | 83 |
| 1819 | iso_pu_bacteria | 2841760612 | 2841760724 | 83 |
| 1820 | iso_pu_bacteria | 2841911363 | 2841915795 | 83 |
| 1821 | iso_pu_bacteria | 2841917233 | 2841921824 | 83 |
| 1822 | iso_pu_bacteria | 2844104063 | 2844106381 | 83 |
| 1823 | iso_pu_bacteria | 2851182111 | 2851187331 | 83 |
| 1824 | iso_pu_bacteria | 2851246043 | 2851246737 | 83 |
| 1825 | iso_pu_bacteria | 2917699015 | 2917704511 | 83 |
| 1826 | iso_pu_bacteria | 8057529695 | 8057531067 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8762 | 1 | 83 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8663 | 1 | 83 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8295 | 2 | 83 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.7986 | 2 | 83 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.7857 | 2 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8759 | 1 | 78 | 3.10.20.30 |
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8678 | 2 | 83 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8446 | 1 | 78 | 3.10.20.30 |
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8386 | 2 | 83 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8324 | 2 | 83 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531KZU9-F1-model_v4 | deleted | 0.9985 | 1 | 79 |
|
| AF-A0A531ML93-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.996 | 1 | 79 |
|
| AF-A0A529KCI5-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9954 | 1 | 80 |
|
| AF-A0A4U6CC69-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9928 | 1 | 83 |
|
| AF-A0A1V8RJ62-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9884 | 1 | 83 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar