F495812

General Info

Members Datasets Scaffolds Average Seq Length
1826 984 1334 84

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10130104|Ga0075369_101301041
Length 97
Sequence MNAVSPMAPSATRTVKLVYFAWVRERVGLPEETLDIPADLATIADLVRWLKARGEGYEAAFANEAVVRAALDQVHAKPHAALGNAREIAFFPPMTGG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
24 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
25 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
26 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2516143018 Ensifer sp. BR816 Isolate Nodule
30 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
31 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
34 2534681786 Brucella suis 92/29 Isolate Unclassified
35 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
36 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
37 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
38 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
39 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
40 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
41 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
42 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
43 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
44 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
45 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
46 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
47 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
48 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
49 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
50 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
51 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
52 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
53 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
54 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
55 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
56 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
57 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
58 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
59 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
60 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
61 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
62 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
63 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
64 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
65 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
66 2643221557 Ensifer sp. Root558 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
69 2643221607 Rhizobium sp. Root73 Isolate Unclassified
70 2643221610 Ensifer sp. Root74 Isolate Unclassified
71 2643221618 Ensifer sp. Root231 Isolate Unclassified
72 2643221626 Ensifer sp. Root31 Isolate Unclassified
73 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
74 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
75 2643221655 Ensifer sp. Root1252 Isolate Unclassified
76 2643221659 Ensifer sp. Root127 Isolate Unclassified
77 2643221668 Ensifer sp. Root423 Isolate Unclassified
78 2643221675 Ensifer sp. Root1298 Isolate Unclassified
79 2643221680 Ensifer sp. Root1312 Isolate Unclassified
80 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
81 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
82 2643221698 Ensifer sp. Root142 Isolate Unclassified
83 2643221712 Ensifer sp. Root258 Isolate Unclassified
84 2643221723 Ensifer sp. Root278 Isolate Unclassified
85 2643221726 Ensifer sp. Root954 Isolate Unclassified
86 2643221733 Bosea sp. Root381 Isolate Unclassified
87 2643221736 Bosea sp. Root483D1 Isolate Unclassified
88 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
89 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
90 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
91 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
92 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
93 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
94 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
95 2751185800 Brucella pituitosa AA2 Isolate Unclassified
96 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
97 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
98 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
99 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
100 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
101 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
102 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
103 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
104 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
105 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
106 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
107 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
108 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
109 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
110 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
111 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
112 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
113 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
114 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
115 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
116 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
117 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
118 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
119 2818991467 Bosea vestrisii 3192 Isolate Unclassified
120 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
121 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
122 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
123 2841760612 Bosea sp. Tri-49 Isolate Nodule
124 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
125 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
126 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
127 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
128 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
129 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
130 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
131 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
132 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
133 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
134 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
135 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
136 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
137 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
138 2844104063 Bosea sp. Tri-39 Isolate Nodule
139 2844163670 Ensifer sp. 1H6 Isolate Unclassified
140 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
141 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
142 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
143 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
144 2851182111 Bosea sp. Tri-44 Isolate Nodule
145 2851246043 Bosea sp. Tri-54 Isolate Nodule
146 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
147 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
148 2854911287 Brucella lupini LUP21 Isolate Unclassified
149 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
150 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
151 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
152 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
153 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
154 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
155 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
156 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
157 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
158 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
159 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
160 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
161 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
162 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
163 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
164 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
165 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
166 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
167 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
168 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
169 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
170 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
171 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
172 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
173 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
174 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
175 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
176 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
177 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
178 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
179 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
180 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
181 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
182 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
183 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
184 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
185 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
186 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
187 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
188 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
189 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
190 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
191 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
192 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
193 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
194 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
195 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
196 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
197 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
198 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
199 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
200 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
201 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
202 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
203 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
204 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
205 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
206 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
207 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
208 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
209 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
210 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
211 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
212 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
213 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
214 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
215 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
216 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
217 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
218 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
219 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
220 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
221 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
222 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
223 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
224 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
225 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
226 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
227 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
228 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
229 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
230 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
231 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
232 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
233 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
234 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
235 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
236 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
237 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
238 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
239 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
240 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
241 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
242 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
243 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
244 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
245 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
246 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
247 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
248 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
249 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
250 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
251 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
252 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
253 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
254 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
255 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
256 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
257 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
258 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
259 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
260 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
261 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
262 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
263 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
264 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
265 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
266 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
267 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
268 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
269 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
270 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
271 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
272 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
273 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
274 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
275 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
276 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
277 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
278 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
279 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
280 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
281 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
282 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
283 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
284 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
285 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
286 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
287 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
288 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
289 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
290 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
291 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
292 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
293 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
294 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
295 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
296 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
297 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
298 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
299 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
300 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
301 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
302 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
303 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
304 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
305 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
306 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
307 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
308 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
309 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
310 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
311 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
312 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
313 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
314 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
315 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
316 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
317 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
318 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
319 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
320 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
321 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
322 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
323 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
324 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
325 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
326 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
327 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
328 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
329 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
330 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
331 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
332 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
333 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
334 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
335 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
336 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
337 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
338 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
339 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
340 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
341 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
342 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
343 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
344 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
345 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
346 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
347 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
348 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
349 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
350 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
351 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
352 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
353 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
354 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
355 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
356 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
357 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
358 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
359 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
360 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
361 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
362 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
363 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
364 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
365 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
366 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
367 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
368 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
369 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
370 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
371 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
372 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
373 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
374 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
375 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
376 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
377 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
378 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
379 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
380 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
381 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
382 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
383 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
384 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
385 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
386 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
387 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
388 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
389 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
390 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
391 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
392 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
393 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
394 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
395 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
396 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
397 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
398 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
399 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
400 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
401 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
402 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
403 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
404 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
405 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
406 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
407 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
408 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
409 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
410 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
411 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
412 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
413 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
414 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
415 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
416 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
417 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
418 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
419 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
420 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
421 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
422 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
423 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
424 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
425 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
426 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
427 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
428 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
429 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
430 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
431 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
432 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
433 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
434 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
435 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
436 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
437 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
438 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
439 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
440 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
441 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
442 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
443 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
444 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
445 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
446 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
447 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
448 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
449 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
450 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
451 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
452 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
453 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
454 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
455 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
456 3004167301 Mesorhizobium loti 582 Isolate Unclassified
457 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
458 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
459 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
460 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
461 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
462 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
463 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
464 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
465 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
466 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
467 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
468 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
469 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
470 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
471 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
472 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
473 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
474 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
475 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
476 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
477 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
478 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
479 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
480 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
481 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
482 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
483 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
484 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
485 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
486 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
487 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
488 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
489 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
490 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
491 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
492 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
493 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
494 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
495 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
496 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
497 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
498 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
499 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
500 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
501 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
502 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
503 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
504 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
505 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
506 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
507 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
508 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
509 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
510 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
511 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
512 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
513 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
514 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
515 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
516 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
517 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
518 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
519 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
520 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
521 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
522 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
523 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
524 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
525 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
526 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
527 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
528 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
529 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
530 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
531 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
532 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
533 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
534 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
535 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
536 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
537 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
538 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
539 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
540 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
541 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
542 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
543 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
544 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
545 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
546 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
547 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
548 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
549 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
550 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
551 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
552 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
553 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
554 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
555 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
556 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
557 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
558 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
559 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
560 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
561 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
562 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
563 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
564 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
565 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
566 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
567 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
568 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
569 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
570 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
571 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
572 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
573 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
574 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
575 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
576 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
577 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
578 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
579 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
580 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
581 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
582 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
583 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
584 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
585 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
586 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
587 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
588 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
589 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
590 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
591 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
592 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
593 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
594 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
595 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
596 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
597 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
598 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
599 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
600 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
601 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
602 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
603 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
604 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
605 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
606 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
607 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
608 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
609 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
610 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
611 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
612 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
613 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
614 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
615 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
616 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
617 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
618 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
619 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
620 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
621 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
622 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
624 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
625 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
626 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
628 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
629 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
630 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
631 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
649 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
660 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
663 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
675 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
676 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
677 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
680 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
681 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
682 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
683 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
684 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
685 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
687 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
688 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
689 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
690 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
691 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
692 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
693 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
695 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
696 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
697 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
698 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
699 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
700 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
701 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
702 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
703 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
704 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
705 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
706 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
707 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
708 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
709 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
710 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
711 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
712 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
713 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
714 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
715 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
716 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
717 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
718 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
719 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
720 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
721 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
722 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
723 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
724 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
725 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
726 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
727 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
728 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
729 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
730 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
731 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
732 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
733 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
734 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
735 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
736 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
737 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
738 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
739 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
740 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
741 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
742 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
743 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
744 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
745 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
746 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
747 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
748 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
749 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
750 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
751 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
752 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
753 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
754 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
755 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
756 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
757 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
758 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
759 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
760 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
761 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
762 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
763 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
764 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
765 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
766 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
767 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
768 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
769 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
770 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
771 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
772 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
773 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
774 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
775 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
776 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
777 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
778 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
779 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
780 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
781 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
782 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
783 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
784 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
785 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
786 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
787 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
788 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
789 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
790 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
791 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
792 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
793 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
794 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
795 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
796 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
797 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
798 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
799 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
800 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
801 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
802 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
803 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
804 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
805 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
806 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
807 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
808 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
809 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
810 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
811 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
812 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
813 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
814 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
815 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
816 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
817 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
818 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
819 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
820 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
821 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
822 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
823 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
824 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
825 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
826 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
827 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
828 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
829 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
830 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
831 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
832 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
833 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
834 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
835 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
836 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
837 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
838 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
839 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
840 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
841 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
842 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
843 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
844 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
845 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
846 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
847 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
848 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
849 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
850 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
851 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
852 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
853 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
854 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
855 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
856 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
857 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
858 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
859 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
860 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
861 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
862 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
863 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
864 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
865 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
866 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
867 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
868 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
869 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
870 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
871 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
872 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
873 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
874 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
875 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
876 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
877 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
878 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
879 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
880 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
881 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
882 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
883 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
885 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
886 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
887 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
888 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
889 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
890 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
891 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
892 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
893 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
894 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
895 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
896 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
897 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
898 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
899 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
900 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
901 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
902 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
903 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
904 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
905 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
906 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
907 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
908 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
909 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
910 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
911 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
912 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
913 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
914 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
915 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
916 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
917 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
918 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
919 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
920 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
921 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
922 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
923 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
924 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
925 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
926 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
927 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
928 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
929 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
930 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
931 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
932 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
933 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
934 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
935 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
936 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
937 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
938 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
939 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
940 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
941 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
942 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
943 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
944 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
945 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
946 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
947 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
948 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
949 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
950 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
951 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
952 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
953 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
954 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
955 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
956 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
957 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
958 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
959 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
960 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
961 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
962 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
963 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
964 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
965 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
966 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
967 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
968 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
969 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
970 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
971 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
972 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
973 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
974 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
975 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
976 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
977 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
978 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
979 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
980 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
981 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
982 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
983 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
984 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.78
Metatranscriptomes 0.27
Isolates 26.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 21.91
Rhizoplane 3.23
Rhizosphere 52.68
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5265 2010549000 Bacteria 1234
2 JGI24740J21852_10000075 3300001979 Bacteria 33245
3 JGI24740J21852_10008525 3300001979 Bacteria 4079
4 JGI25155J39150_1000032 3300002704 Bacteria 105511
5 JGI25156J39149_1000129 3300002705 Bacteria 54812
6 JGI25156J39149_1005548 3300002705 Bacteria 3616
7 JGI25162J39368_1001169 3300002737 Bacteria 15592
8 JGI25162J39368_1001727 3300002737 Bacteria 10548
9 JGI25162J39368_1003463 3300002737 Bacteria 4530
10 JGI25154J39366_1000324 3300002738 Bacteria 27739
11 JGI25158J39367_1000210 3300002739 Bacteria 13780
12 JGI25157J39369_1000061 3300002741 Bacteria 105511
13 JGI25157J39369_1000624 3300002741 Bacteria 19993
14 JGI25159J45721_1000002 3300002987 Bacteria 289163
15 JGI25159J45721_1000136 3300002987 Bacteria 34768
16 JGI25159J45721_1004812 3300002987 Bacteria 4363
17 JGI25151J46595_10025237 3300003187 Bacteria 2421
18 JGI25151J46595_10034315 3300003187 Bacteria 1942
19 JGI25151J46595_10077075 3300003187 Bacteria 982
20 JGI25165J46597_1000028 3300003214 Bacteria 325146
21 JGI25165J46597_1000630 3300003214 Bacteria 29232
22 JGI25165J46597_1000944 3300003214 Bacteria 19880
23 rootH2_10025055 3300003320 Bacteria 4537
24 rootL2_10082663 3300003322 Bacteria 3939
25 rootH1_10117768 3300003323 Bacteria 2152
26 rootH1_10117786 3300003323 Bacteria 1654
27 JGI25160J50197_1000008 3300003354 Bacteria 289163
28 JGI25160J50197_1000015 3300003354 Bacteria 250902
29 JGI25160J50197_1000191 3300003354 Bacteria 51959
30 JGI25160J50197_1023350 3300003354 Bacteria 1785
31 JGI25161J50226_1000005 3300003374 Bacteria 292548
32 JGI25161J50226_1000489 3300003374 Bacteria 17865
33 JGI25161J50226_1000704 3300003374 Bacteria 13116
34 Ga0006562J51391_1007860 3300003578 Bacteria 2779
35 Ga0006562J51391_1097928 3300003578 Bacteria 1340
36 Ga0055539_1014217 3300003752 Bacteria 972
37 Ga0055542_1000989 3300003762 Bacteria 18379
38 Ga0055529_1002302 3300003763 Bacteria 3824
39 Ga0055526_1001505 3300003771 Bacteria 16503
40 Ga0055526_1013003 3300003771 Bacteria 3566
41 Ga0055526_1043655 3300003771 Bacteria 1089
42 Ga0055526_1063506 3300003771 Bacteria 776
43 Ga0055524_1001479 3300003775 Bacteria 13409
44 Ga0055524_1007611 3300003775 Bacteria 4579
45 Ga0055524_1009931 3300003775 Bacteria 3826
46 Ga0055524_1023880 3300003775 Bacteria 1956
47 Ga0055524_1040839 3300003775 Bacteria 1177
48 Ga0055536_1000984 3300003781 Bacteria 18060
49 Ga0055528_1000460 3300003790 Bacteria 32499
50 Ga0055528_1005249 3300003790 Bacteria 6079
51 Ga0055528_1026969 3300003790 Bacteria 1632
52 Ga0055528_1090666 3300003790 Bacteria 525
53 Ga0055531_10017167 3300003794 Bacteria 3071
54 Ga0055543_1000012 3300004625 Bacteria 186581
55 Ga0055543_1000040 3300004625 Bacteria 122485
56 Ga0055543_1001749 3300004625 Bacteria 8117
57 Ga0065165_1000015 3300005262 Bacteria 289201
58 Ga0065165_1000095 3300005262 Bacteria 145470
59 Ga0065165_1000125 3300005262 Bacteria 130283
60 Ga0065165_1003558 3300005262 Bacteria 10770
61 Ga0065165_1061053 3300005262 Bacteria 1033
62 Ga0065165_1112062 3300005262 Bacteria 670
63 Ga0070658_11449349 3300005327 Bacteria 596
64 Ga0070690_100054478 3300005330 Bacteria 2561
65 Ga0070690_100723783 3300005330 Bacteria 766
66 Ga0070670_100009220 3300005331 Bacteria 8432
67 Ga0070670_100656590 3300005331 Bacteria 941
68 Ga0070670_100829185 3300005331 Bacteria 836
69 Ga0068869_100804422 3300005334 Bacteria 808
70 Ga0068869_101297975 3300005334 Bacteria 642
71 Ga0070666_10148138 3300005335 Bacteria 1637
72 Ga0070680_100716936 3300005336 Bacteria 861
73 Ga0070680_100909786 3300005336 Bacteria 759
74 Ga0070682_100292531 3300005337 Bacteria 1192
75 Ga0070682_101026383 3300005337 Bacteria 686
76 Ga0068868_100295750 3300005338 Bacteria 1374
77 Ga0068868_100834536 3300005338 Bacteria 834
78 Ga0070660_100055967 3300005339 Bacteria 3050
79 Ga0070689_100014099 3300005340 Bacteria 5798
80 Ga0070689_100602971 3300005340 Bacteria 951
81 Ga0070687_100002628 3300005343 Bacteria 6792
82 Ga0070661_100375400 3300005344 Bacteria 1120
83 Ga0070661_100714655 3300005344 Bacteria 817
84 Ga0070668_100167676 3300005347 Bacteria 1786
85 Ga0070668_101217888 3300005347 Bacteria 682
86 Ga0070675_100104071 3300005354 Bacteria 2394
87 Ga0070675_100714828 3300005354 Bacteria 913
88 Ga0070671_100078659 3300005355 Bacteria 2756
89 Ga0070671_101750644 3300005355 Bacteria 552
90 Ga0070674_100117477 3300005356 Bacteria 1964
91 Ga0070674_100990778 3300005356 Bacteria 737
92 Ga0070674_102154929 3300005356 Bacteria 509
93 Ga0070673_100837545 3300005364 Bacteria 851
94 Ga0070673_101814591 3300005364 Bacteria 578
95 Ga0070673_102034949 3300005364 Bacteria 545
96 Ga0070688_100116761 3300005365 Bacteria 1782
97 Ga0070659_100315195 3300005366 Bacteria 1306
98 Ga0070659_100749590 3300005366 Bacteria 847
99 Ga0070667_100136430 3300005367 Bacteria 2145
100 Ga0070667_100750264 3300005367 Bacteria 905
101 Ga0070667_101115791 3300005367 Bacteria 737
102 Ga0070667_101470175 3300005367 Bacteria 640
103 Ga0070667_101576079 3300005367 Bacteria 617
104 Ga0070700_100300835 3300005441 Bacteria 1171
105 Ga0070708_101173899 3300005445 Bacteria 718
106 Ga0070663_100038200 3300005455 Bacteria 3348
107 Ga0070663_100052068 3300005455 Bacteria 2919
108 Ga0070663_100054895 3300005455 Bacteria 2850
109 Ga0070663_100349623 3300005455 Bacteria 1197
110 Ga0070663_100862676 3300005455 Bacteria 780
111 Ga0070663_101806730 3300005455 Bacteria 548
112 Ga0070678_100022607 3300005456 Bacteria 4172
113 Ga0070678_100329089 3300005456 Bacteria 1307
114 Ga0070678_100678395 3300005456 Bacteria 926
115 Ga0070662_100605516 3300005457 Bacteria 922
116 Ga0070662_101046303 3300005457 Bacteria 700
117 Ga0070681_10325145 3300005458 Bacteria 1447
118 Ga0068867_101568184 3300005459 Bacteria 615
119 Ga0068867_101869010 3300005459 Bacteria 566
120 Ga0070685_10637606 3300005466 Bacteria 771
121 Ga0070699_101768060 3300005518 Bacteria 566
122 Ga0070679_101446866 3300005530 Bacteria 634
123 Ga0070679_101817761 3300005530 Bacteria 558
124 Ga0068853_101184563 3300005539 Bacteria 737
125 Ga0070672_100074617 3300005543 Bacteria 2706
126 Ga0070686_100151471 3300005544 Bacteria 1625
127 Ga0070695_100866056 3300005545 Bacteria 728
128 Ga0070696_101653125 3300005546 Bacteria 551
129 Ga0070665_100012057 3300005548 Bacteria 8721
130 Ga0070665_100121404 3300005548 Bacteria 2615
131 Ga0070665_100226673 3300005548 Bacteria 1869
132 Ga0070665_100727811 3300005548 Bacteria 1005
133 Ga0070665_101541354 3300005548 Bacteria 673
134 Ga0070665_102538616 3300005548 Bacteria 514
135 Ga0070704_100686395 3300005549 Bacteria 907
136 Ga0068855_100832466 3300005563 Bacteria 979
137 Ga0068855_101351368 3300005563 Bacteria 736
138 Ga0068855_101360002 3300005563 Bacteria 733
139 Ga0068855_101494603 3300005563 Bacteria 694
140 Ga0070664_101367996 3300005564 Bacteria 669
141 Ga0068857_101095070 3300005577 Bacteria 769
142 Ga0068857_101336963 3300005577 Bacteria 696
143 Ga0068857_102475825 3300005577 Bacteria 510
144 Ga0068854_100136143 3300005578 Bacteria 1880
145 Ga0068854_100244926 3300005578 Bacteria 1429
146 Ga0068854_100777584 3300005578 Bacteria 833
147 Ga0068854_101708401 3300005578 Bacteria 575
148 Ga0068854_101798367 3300005578 Bacteria 562
149 Ga0068856_100070458 3300005614 Bacteria 3459
150 Ga0070702_100685868 3300005615 Bacteria 779
151 Ga0068852_100111240 3300005616 Bacteria 2490
152 Ga0068852_100682644 3300005616 Bacteria 1036
153 Ga0068852_102429860 3300005616 Bacteria 544
154 Ga0068859_100278386 3300005617 Bacteria 1766
155 Ga0068859_101337119 3300005617 Bacteria 790
156 Ga0068859_102599594 3300005617 Bacteria 557
157 Ga0068864_100004815 3300005618 Bacteria 11064
158 Ga0068864_100516260 3300005618 Bacteria 1151
159 Ga0068861_100314578 3300005719 Bacteria 1362
160 Ga0068861_100399749 3300005719 Bacteria 1219
161 Ga0068858_100161184 3300005842 Bacteria 2112
162 Ga0068858_100866151 3300005842 Bacteria 883
163 Ga0068860_100998293 3300005843 Bacteria 855
164 Ga0068862_100401566 3300005844 Bacteria 1282
165 Ga0068862_101058033 3300005844 Bacteria 805
166 Ga0081539_10001131 3300005985 Bacteria 48406
167 Ga0075365_10013889 3300006038 Bacteria 4831
168 Ga0075365_10024163 3300006038 Bacteria 3829
169 Ga0075365_10173955 3300006038 Bacteria 1503
170 Ga0075365_10356916 3300006038 Bacteria 1030
171 Ga0075365_10458027 3300006038 Bacteria 901
172 Ga0075365_10567237 3300006038 Bacteria 803
173 Ga0075365_10931011 3300006038 Bacteria 612
174 Ga0075365_11335457 3300006038 Bacteria 504
175 Ga0075368_10007739 3300006042 Bacteria 3803
176 Ga0075368_10267938 3300006042 Bacteria 732
177 Ga0075363_100073258 3300006048 Bacteria 1863
178 Ga0075363_100124627 3300006048 Bacteria 1441
179 Ga0075363_100251247 3300006048 Bacteria 1018
180 Ga0075363_101008530 3300006048 Bacteria 513
181 Ga0075364_10012041 3300006051 Bacteria 5276
182 Ga0075364_10553044 3300006051 Bacteria 787
183 Ga0075364_10793323 3300006051 Bacteria 646
184 Ga0075362_10002404 3300006177 Bacteria 6275
185 Ga0075362_10024220 3300006177 Bacteria 2574
186 Ga0075367_10037653 3300006178 Bacteria 2812
187 Ga0075367_10054745 3300006178 Bacteria 2366
188 Ga0075367_10169458 3300006178 Bacteria 1360
189 Ga0075367_10227761 3300006178 Bacteria 1167
190 Ga0075367_10424745 3300006178 Bacteria 842
191 Ga0075369_10006353 3300006186 Bacteria 4465
192 Ga0075369_10130104 3300006186 Bacteria 1143
193 Ga0075369_10180034 3300006186 Bacteria 972
194 Ga0075369_10239084 3300006186 Bacteria 842
195 Ga0075366_10213875 3300006195 Bacteria 1174
196 Ga0075366_10793893 3300006195 Bacteria 589
197 Ga0097621_101948134 3300006237 Bacteria 561
198 Ga0097621_102363655 3300006237 Bacteria 509
199 Ga0075370_10023755 3300006353 Bacteria 3380
200 Ga0075370_10079906 3300006353 Bacteria 1879
201 Ga0075370_10267047 3300006353 Bacteria 1015
202 Ga0075370_10497113 3300006353 Bacteria 736
203 Ga0068871_100579205 3300006358 Bacteria 1019
204 Ga0068871_100711248 3300006358 Bacteria 921
205 Ga0075428_100235851 3300006844 Bacteria 1974
206 Ga0068865_100504739 3300006881 Bacteria 1009
207 Ga0068865_100564251 3300006881 Bacteria 958
208 Ga0068865_101074993 3300006881 Bacteria 708
209 Ga0097620_100278387 3300006931 Bacteria 1766
210 Ga0097620_101336670 3300006931 Bacteria 790
211 Ga0097620_102599881 3300006931 Bacteria 557
212 Ga0105251_10008871 3300009011 Bacteria 6019
213 Ga0105244_10496521 3300009036 Bacteria 562
214 Ga0105240_10000032 3300009093 Bacteria 283907
215 Ga0105240_10381721 3300009093 Bacteria 1591
216 Ga0105240_10527204 3300009093 Bacteria 1310
217 Ga0111539_10286338 3300009094 Bacteria 1917
218 Ga0111539_11718509 3300009094 Bacteria 728
219 Ga0111539_11918052 3300009094 Bacteria 687
220 Ga0111539_12969398 3300009094 Bacteria 548
221 Ga0105245_10123083 3300009098 Bacteria 2425
222 Ga0105245_11845478 3300009098 Bacteria 657
223 Ga0105245_11854741 3300009098 Bacteria 656
224 Ga0105247_10054813 3300009101 Bacteria 2460
225 Ga0105247_10893303 3300009101 Bacteria 686
226 Ga0105247_11669274 3300009101 Bacteria 526
227 Ga0105243_10250889 3300009148 Bacteria 1580
228 Ga0105243_10546312 3300009148 Bacteria 1106
229 Ga0105243_11147000 3300009148 Bacteria 788
230 Ga0105243_11304643 3300009148 Bacteria 743
231 Ga0105243_12052874 3300009148 Bacteria 607
232 Ga0105242_10180889 3300009176 Bacteria 1860
233 Ga0105242_12183621 3300009176 Bacteria 599
234 Ga0105248_10015377 3300009177 Bacteria 8441
235 Ga0105248_10335817 3300009177 Bacteria 1702
236 Ga0105248_10660482 3300009177 Bacteria 1179
237 Ga0105248_12313296 3300009177 Bacteria 612
238 Ga0105237_10002365 3300009545 Bacteria 23399
239 Ga0105237_11856567 3300009545 Bacteria 610
240 Ga0105238_10092726 3300009551 Bacteria 3008
241 Ga0105249_10302469 3300009553 Bacteria 1605
242 Ga0105249_10865072 3300009553 Bacteria 970
243 Ga0123342_1042104 3300009766 Bacteria 1623
244 Ga0099796_10046910 3300010159 Bacteria 1485
245 Ga0105239_10012029 3300010375 Bacteria 9650
246 Ga0105239_10013157 3300010375 Bacteria 9193
247 Ga0105239_11075225 3300010375 Bacteria 926
248 Ga0105239_11341881 3300010375 Bacteria 825
249 Ga0105239_11747489 3300010375 Bacteria 720
250 Ga0105246_10368627 3300011119 Bacteria 1183
251 Ga0105246_10959503 3300011119 Bacteria 771
252 Ga0105246_12592543 3300011119 Bacteria 501
253 Ga0157314_1046160 3300012500 Bacteria 542
254 Ga0157313_1033713 3300012503 Bacteria 595
255 Ga0157373_10135794 3300013100 Bacteria 1729
256 Ga0157373_10777314 3300013100 Bacteria 705
257 Ga0157371_10891306 3300013102 Bacteria 674
258 Ga0157370_10003636 3300013104 Bacteria 18019
259 Ga0157370_10113036 3300013104 Bacteria 2538
260 Ga0157370_10305394 3300013104 Bacteria 1468
261 Ga0157370_10694141 3300013104 Bacteria 929
262 Ga0157370_10849273 3300013104 Bacteria 830
263 Ga0157369_10049860 3300013105 Bacteria 4536
264 Ga0157369_10185520 3300013105 Bacteria 2188
265 Ga0157369_10199521 3300013105 Bacteria 2100
266 Ga0171463_1001 3300013249 Bacteria 1406070
267 Ga0171462_1006 3300013250 Bacteria 432986
268 Ga0157374_10111656 3300013296 Bacteria 2630
269 Ga0157374_11011596 3300013296 Bacteria 850
270 Ga0157374_12037994 3300013296 Bacteria 600
271 Ga0157378_10256214 3300013297 Bacteria 1677
272 Ga0157378_10698258 3300013297 Bacteria 1034
273 Ga0157378_11290035 3300013297 Bacteria 771
274 Ga0163162_10021032 3300013306 Bacteria 6418
275 Ga0163162_10040362 3300013306 Bacteria 4667
276 Ga0163162_10226735 3300013306 Bacteria 1998
277 Ga0163162_10789499 3300013306 Bacteria 1067
278 Ga0157372_11527829 3300013307 Bacteria 769
279 Ga0157375_11269747 3300013308 Bacteria 865
280 Ga0157375_12450897 3300013308 Bacteria 623
281 Ga0157375_12996842 3300013308 Bacteria 564
282 Ga0157375_13218066 3300013308 Bacteria 545
283 Ga0157375_13631517 3300013308 Bacteria 513
284 Ga0163163_10559799 3300014325 Bacteria 1206
285 Ga0157380_10201489 3300014326 Bacteria 1766
286 Ga0157380_10663586 3300014326 Bacteria 1042
287 Ga0157380_11000817 3300014326 Bacteria 869
288 Ga0182008_10055587 3300014497 Bacteria 1957
289 Ga0182008_10075376 3300014497 Bacteria 1659
290 Ga0182008_10210516 3300014497 Bacteria 992
291 Ga0182008_10449140 3300014497 Bacteria 701
292 Ga0157377_10354396 3300014745 Bacteria 985
293 Ga0157379_10980218 3300014968 Bacteria 805
294 Ga0157379_11011881 3300014968 Bacteria 793
295 Ga0157376_10610420 3300014969 Bacteria 1087
296 Ga0157376_10850109 3300014969 Bacteria 928
297 Ga0157376_12094137 3300014969 Bacteria 604
298 Ga0182007_10000460 3300015262 Bacteria 24598
299 Ga0182005_1015635 3300015265 Bacteria 2115
300 Ga0183363_1412 3300015690 Bacteria 3458
301 Ga0163161_10516212 3300017792 Bacteria 975
302 Ga0163161_10715323 3300017792 Bacteria 835
303 Ga0163161_11229244 3300017792 Bacteria 649
304 Ga0163161_11933006 3300017792 Bacteria 525
305 Ga0214544_1000017 3300021320 Bacteria 193638
306 Ga0214542_1000006 3300021321 Bacteria 345164
307 Ga0214543_1000003 3300021327 Bacteria 692327
308 Ga0214543_1000014 3300021327 Bacteria 324986
309 Ga0213874_10014157 3300021377 Bacteria 2080
310 Ga0228711_1000001 3300022739 Bacteria 357377
311 Ga0228710_1000001 3300022740 Bacteria 314328
312 Ga0228598_1031096 3300024227 Bacteria 1051
313 Ga0209435_100042 3300025206 Bacteria 105563
314 Ga0209436_101739 3300025208 Bacteria 7155
315 Ga0209672_123228 3300025228 Bacteria 573
316 Ga0207427_113132 3300025231 Bacteria 817
317 Ga0209437_100033 3300025233 Bacteria 512520
318 Ga0209437_100075 3300025233 Bacteria 297202
319 Ga0207425_1025968 3300025245 Bacteria 1205
320 Ga0207425_1054664 3300025245 Bacteria 719
321 Ga0209646_1000145 3300025246 Bacteria 105563
322 Ga0209646_1008549 3300025246 Bacteria 1644
323 Ga0209646_1017574 3300025246 Bacteria 1053
324 Ga0209026_1000120 3300025250 Bacteria 130091
325 Ga0209026_1000160 3300025250 Bacteria 105563
326 Ga0209677_100845 3300025253 Bacteria 15183
327 Ga0209148_1000056 3300025254 Bacteria 363380
328 Ga0209148_1007473 3300025254 Bacteria 2269
329 Ga0209148_1037625 3300025254 Bacteria 685
330 Ga0209759_1000177 3300025256 Bacteria 105563
331 Ga0209759_1000288 3300025256 Bacteria 69733
332 Ga0209759_1046353 3300025256 Bacteria 704
333 Ga0209129_1000137 3300025258 Bacteria 123213
334 Ga0209129_1001697 3300025258 Bacteria 11899
335 Ga0209233_1000056 3300025261 Bacteria 438104
336 Ga0209233_1000064 3300025261 Bacteria 392156
337 Ga0209233_1000087 3300025261 Bacteria 325225
338 Ga0209233_1000209 3300025261 Bacteria 115124
339 Ga0209233_1004475 3300025261 Bacteria 4744
340 Ga0209455_1000777 3300025272 Bacteria 17856
341 Ga0209455_1021938 3300025272 Bacteria 1227
342 Ga0209673_1000319 3300025273 Bacteria 88129
343 Ga0209673_1001326 3300025273 Bacteria 24843
344 Ga0209673_1004666 3300025273 Bacteria 7240
345 Ga0209673_1066826 3300025273 Bacteria 872
346 Ga0209673_1100635 3300025273 Bacteria 622
347 Ga0209673_1102733 3300025273 Bacteria 612
348 Ga0209130_1000007 3300025284 Bacteria 591584
349 Ga0209130_1000018 3300025284 Bacteria 388301
350 Ga0209130_1000148 3300025284 Bacteria 109763
351 Ga0209130_1013563 3300025284 Bacteria 2082
352 Ga0209130_1022880 3300025284 Bacteria 1387
353 Ga0209675_1035650 3300025291 Bacteria 1133
354 Ga0209676_1000694 3300025292 Bacteria 47316
355 Ga0209676_1017727 3300025292 Bacteria 2509
356 Ga0209025_1000149 3300025294 Bacteria 173393
357 Ga0209025_1000580 3300025294 Bacteria 66332
358 Ga0209025_1009457 3300025294 Bacteria 6785
359 Ga0209025_1010350 3300025294 Bacteria 6330
360 Ga0209025_1015894 3300025294 Bacteria 4492
361 Ga0209025_1019505 3300025294 Bacteria 3767
362 Ga0209025_1026975 3300025294 Bacteria 2864
363 Ga0209025_1046050 3300025294 Bacteria 1800
364 Ga0209025_1117947 3300025294 Bacteria 799
365 Ga0209025_1147818 3300025294 Bacteria 654
366 Ga0209564_1000431 3300025295 Bacteria 72866
367 Ga0209564_1001106 3300025295 Bacteria 31905
368 Ga0209564_1001342 3300025295 Bacteria 26169
369 Ga0209564_1009309 3300025295 Bacteria 4694
370 Ga0209564_1050292 3300025295 Bacteria 1022
371 Ga0209564_1057945 3300025295 Bacteria 888
372 Ga0209758_1009477 3300025297 Bacteria 6043
373 Ga0209758_1031764 3300025297 Bacteria 2159
374 Ga0209758_1060745 3300025297 Bacteria 1249
375 Ga0209758_1075338 3300025297 Bacteria 1043
376 Ga0209758_1152389 3300025297 Bacteria 585
377 Ga0209050_1002170 3300025298 Bacteria 17758
378 Ga0209050_1073321 3300025298 Bacteria 755
379 Ga0209256_1000877 3300025299 Bacteria 37183
380 Ga0209256_1001068 3300025299 Bacteria 31760
381 Ga0209256_1001781 3300025299 Bacteria 20391
382 Ga0209256_1005328 3300025299 Bacteria 7477
383 Ga0209256_1005521 3300025299 Bacteria 7229
384 Ga0209256_1008937 3300025299 Bacteria 4509
385 Ga0207426_1000044 3300025302 Bacteria 428043
386 Ga0207426_1000064 3300025302 Bacteria 358276
387 Ga0207426_1000119 3300025302 Bacteria 221800
388 Ga0207426_1005259 3300025302 Bacteria 5969
389 Ga0209051_1015125 3300025303 Bacteria 3565
390 Ga0209051_1021615 3300025303 Bacteria 2731
391 Ga0209051_1022549 3300025303 Bacteria 2647
392 Ga0209051_1025554 3300025303 Bacteria 2399
393 Ga0209257_1005277 3300025304 Bacteria 9211
394 Ga0209257_1038965 3300025304 Bacteria 1433
395 Ga0209257_1084948 3300025304 Bacteria 803
396 Ga0209257_1128230 3300025304 Bacteria 584
397 Ga0207697_10506497 3300025315 Bacteria 533
398 Ga0207655_1136851 3300025728 Bacteria 791
399 Ga0207713_1016350 3300025735 Bacteria 3767
400 Ga0207682_10016410 3300025893 Bacteria 2888
401 Ga0207710_10713050 3300025900 Bacteria 526
402 Ga0207688_10142825 3300025901 Bacteria 1410
403 Ga0207688_10846381 3300025901 Bacteria 579
404 Ga0207680_10276331 3300025903 Bacteria 1166
405 Ga0207647_10285591 3300025904 Bacteria 941
406 Ga0207645_10021086 3300025907 Bacteria 4253
407 Ga0207645_10379884 3300025907 Bacteria 948
408 Ga0207643_10459258 3300025908 Bacteria 811
409 Ga0207705_10149112 3300025909 Bacteria 1751
410 Ga0207705_10585120 3300025909 Bacteria 868
411 Ga0207707_10275687 3300025912 Bacteria 1457
412 Ga0207695_10000024 3300025913 Bacteria 632311
413 Ga0207695_10068516 3300025913 Bacteria 3636
414 Ga0207695_10158443 3300025913 Bacteria 2197
415 Ga0207695_10991360 3300025913 Bacteria 720
416 Ga0207671_10000718 3300025914 Bacteria 42274
417 Ga0207663_10586278 3300025916 Bacteria 875
418 Ga0207662_10782504 3300025918 Bacteria 672
419 Ga0207657_10103856 3300025919 Bacteria 2355
420 Ga0207649_10744690 3300025920 Bacteria 762
421 Ga0207649_10894806 3300025920 Bacteria 696
422 Ga0207649_11198737 3300025920 Bacteria 600
423 Ga0207649_11578143 3300025920 Bacteria 519
424 Ga0207652_11019144 3300025921 Bacteria 727
425 Ga0207652_11596561 3300025921 Bacteria 556
426 Ga0207681_10555121 3300025923 Bacteria 946
427 Ga0207681_11555692 3300025923 Bacteria 554
428 Ga0207694_10472535 3300025924 Bacteria 1048
429 Ga0207650_10005961 3300025925 Bacteria 8320
430 Ga0207659_10893205 3300025926 Bacteria 764
431 Ga0207687_10156457 3300025927 Bacteria 1744
432 Ga0207644_10048295 3300025931 Bacteria 3042
433 Ga0207644_10051407 3300025931 Bacteria 2958
434 Ga0207644_11219243 3300025931 Bacteria 632
435 Ga0207690_10147147 3300025932 Bacteria 1742
436 Ga0207690_10803309 3300025932 Bacteria 777
437 Ga0207706_10145632 3300025933 Bacteria 2084
438 Ga0207706_10963393 3300025933 Bacteria 718
439 Ga0207706_10977684 3300025933 Bacteria 712
440 Ga0207706_11397420 3300025933 Bacteria 575
441 Ga0207686_10266629 3300025934 Bacteria 1258
442 Ga0207709_10150026 3300025935 Bacteria 1613
443 Ga0207709_10344727 3300025935 Bacteria 1122
444 Ga0207709_10977994 3300025935 Bacteria 691
445 Ga0207670_10003940 3300025936 Bacteria 7924
446 Ga0207669_10110122 3300025937 Bacteria 1843
447 Ga0207669_10344493 3300025937 Bacteria 1149
448 Ga0207704_11181416 3300025938 Bacteria 652
449 Ga0207691_10640451 3300025940 Bacteria 898
450 Ga0207711_10076090 3300025941 Bacteria 2922
451 Ga0207711_11662394 3300025941 Bacteria 582
452 Ga0207689_11319931 3300025942 Bacteria 606
453 Ga0207661_10637934 3300025944 Bacteria 979
454 Ga0207679_11020068 3300025945 Bacteria 759
455 Ga0207667_11057673 3300025949 Bacteria 796
456 Ga0207667_11308885 3300025949 Bacteria 701
457 Ga0207651_10205792 3300025960 Bacteria 1581
458 Ga0207651_10743365 3300025960 Bacteria 867
459 Ga0207651_10868605 3300025960 Bacteria 802
460 Ga0207712_10564920 3300025961 Bacteria 980
461 Ga0207712_11067324 3300025961 Bacteria 718
462 Ga0207668_10179167 3300025972 Bacteria 1670
463 Ga0207668_10671379 3300025972 Bacteria 909
464 Ga0207668_10864079 3300025972 Bacteria 804
465 Ga0207640_10150463 3300025981 Bacteria 1709
466 Ga0207640_10155131 3300025981 Bacteria 1687
467 Ga0207640_11304725 3300025981 Bacteria 648
468 Ga0207658_10129704 3300025986 Bacteria 2024
469 Ga0207658_10202043 3300025986 Bacteria 1660
470 Ga0207658_10313549 3300025986 Bacteria 1356
471 Ga0207658_10703577 3300025986 Bacteria 913
472 Ga0207658_11707178 3300025986 Bacteria 575
473 Ga0207677_10122790 3300026023 Bacteria 1957
474 Ga0207677_11279385 3300026023 Bacteria 673
475 Ga0207677_12065241 3300026023 Bacteria 530
476 Ga0207703_10483128 3300026035 Bacteria 1161
477 Ga0207703_10772864 3300026035 Bacteria 916
478 Ga0207639_10335608 3300026041 Bacteria 1346
479 Ga0207639_11494026 3300026041 Bacteria 634
480 Ga0207678_10058238 3300026067 Bacteria 3324
481 Ga0207678_10129738 3300026067 Bacteria 2150
482 Ga0207678_10525768 3300026067 Bacteria 1033
483 Ga0207678_10588475 3300026067 Bacteria 975
484 Ga0207678_10637871 3300026067 Bacteria 935
485 Ga0207678_10683760 3300026067 Bacteria 902
486 Ga0207708_10137301 3300026075 Bacteria 1916
487 Ga0207702_11714129 3300026078 Bacteria 621
488 Ga0207702_11837235 3300026078 Bacteria 598
489 Ga0207641_10636151 3300026088 Bacteria 1047
490 Ga0207648_10959821 3300026089 Bacteria 800
491 Ga0207676_10003179 3300026095 Bacteria 11705
492 Ga0207676_10523656 3300026095 Bacteria 1129
493 Ga0207674_11293015 3300026116 Bacteria 699
494 Ga0207674_11840489 3300026116 Bacteria 572
495 Ga0207675_100121294 3300026118 Bacteria 2474
496 Ga0207675_100765701 3300026118 Bacteria 977
497 Ga0207683_10012420 3300026121 Bacteria 7267
498 Ga0207683_10048163 3300026121 Bacteria 3733
499 Ga0207683_10177284 3300026121 Bacteria 1932
500 Ga0207683_10661389 3300026121 Bacteria 968
501 Ga0207698_10034126 3300026142 Bacteria 3706
502 Ga0209281_1000236 3300027111 Bacteria 113362
503 Ga0209281_1000266 3300027111 Bacteria 100574
504 Ga0209371_1001249 3300027312 Bacteria 18174
505 Ga0209282_1000007 3300027666 Bacteria 254917
506 Ga0209282_1401494 3300027666 Bacteria 538
507 Ga0209813_10183299 3300027866 Bacteria 767
508 Ga0209974_10068959 3300027876 Bacteria 1204
509 Ga0207428_10364317 3300027907 Bacteria 1062
510 Ga0268266_10014527 3300028379 Bacteria 6769
511 Ga0268266_10107861 3300028379 Bacteria 2463
512 Ga0268266_10209519 3300028379 Bacteria 1787
513 Ga0268266_10238826 3300028379 Bacteria 1676
514 Ga0268266_10698121 3300028379 Bacteria 978
515 Ga0268266_10823368 3300028379 Bacteria 897
516 Ga0268266_11366561 3300028379 Bacteria 684
517 Ga0268266_11417798 3300028379 Bacteria 670
518 Ga0268265_10816259 3300028380 Bacteria 910
519 Ga0268265_11158668 3300028380 Bacteria 769
520 Ga0268265_11583614 3300028380 Bacteria 660
521 Ga0268264_10858757 3300028381 Bacteria 909
522 Ga0307515_10010607 3300028794 Bacteria 17629
523 Ga0307515_10196211 3300028794 Bacteria 1910
524 Ga0307515_10533009 3300028794 Bacteria 784
525 Ga0268256_1000660 3300030500 Bacteria 26255
526 Ga0265330_10083771 3300031235 Bacteria 1372
527 Ga0265330_10171737 3300031235 Bacteria 919
528 Ga0265332_10158692 3300031238 Bacteria 945
529 Ga0265328_10062459 3300031239 Bacteria 1368
530 Ga0265328_10298263 3300031239 Bacteria 622
531 Ga0265325_10030702 3300031241 Bacteria 2880
532 Ga0265325_10090453 3300031241 Bacteria 1510
533 Ga0265325_10140843 3300031241 Bacteria 1147
534 Ga0265325_10225700 3300031241 Bacteria 856
535 Ga0265329_10149690 3300031242 Bacteria 756
536 Ga0265340_10001562 3300031247 Bacteria 13158
537 Ga0265340_10042630 3300031247 Bacteria 2227
538 Ga0265340_10043089 3300031247 Bacteria 2213
539 Ga0265340_10045419 3300031247 Bacteria 2146
540 Ga0265340_10045992 3300031247 Bacteria 2130
541 Ga0265340_10263442 3300031247 Bacteria 767
542 Ga0265339_10091947 3300031249 Bacteria 1589
543 Ga0265339_10156184 3300031249 Bacteria 1151
544 Ga0265339_10415584 3300031249 Bacteria 627
545 Ga0265339_10478538 3300031249 Bacteria 576
546 Ga0265331_10001287 3300031250 Bacteria 18686
547 Ga0265331_10089679 3300031250 Bacteria 1422
548 Ga0265331_10097138 3300031250 Bacteria 1358
549 Ga0265331_10368994 3300031250 Bacteria 643
550 Ga0265331_10555454 3300031250 Bacteria 518
551 Ga0265327_10000095 3300031251 Bacteria 194803
552 Ga0265316_10185929 3300031344 Bacteria 1545
553 Ga0265316_10930171 3300031344 Bacteria 607
554 Ga0307513_10006330 3300031456 Bacteria 15498
555 Ga0307513_10214632 3300031456 Bacteria 1752
556 Ga0307513_10309409 3300031456 Bacteria 1343
557 Ga0307408_100057540 3300031548 Bacteria 2823
558 Ga0307408_100135901 3300031548 Bacteria 1924
559 Ga0307408_101366534 3300031548 Bacteria 666
560 Ga0307408_101833211 3300031548 Bacteria 580
561 Ga0265313_10007558 3300031595 Bacteria 7388
562 Ga0265313_10019903 3300031595 Bacteria 3719
563 Ga0265313_10031991 3300031595 Bacteria 2692
564 Ga0265313_10112760 3300031595 Bacteria 1194
565 Ga0316575_10170132 3300031665 Bacteria 903
566 Ga0316579_10080566 3300031691 Bacteria 1550
567 Ga0265314_10037766 3300031711 Bacteria 3497
568 Ga0265314_10146472 3300031711 Bacteria 1454
569 Ga0265314_10162969 3300031711 Bacteria 1355
570 Ga0265314_10561813 3300031711 Bacteria 592
571 Ga0265342_10064019 3300031712 Bacteria 2159
572 Ga0265342_10170989 3300031712 Bacteria 1195
573 Ga0265342_10180588 3300031712 Bacteria 1156
574 Ga0265342_10624597 3300031712 Bacteria 542
575 Ga0307516_10104873 3300031730 Bacteria 2639
576 Ga0307405_10177698 3300031731 Bacteria 1525
577 Ga0307405_10191204 3300031731 Bacteria 1479
578 Ga0307405_10522614 3300031731 Bacteria 955
579 Ga0307405_11553399 3300031731 Bacteria 583
580 Ga0316577_10609486 3300031733 Bacteria 621
581 Ga0307413_10071775 3300031824 Bacteria 2183
582 Ga0307410_10108694 3300031852 Bacteria 2003
583 Ga0307406_10009795 3300031901 Bacteria 5391
584 Ga0307406_10086670 3300031901 Bacteria 2097
585 Ga0307406_10373811 3300031901 Bacteria 1121
586 Ga0307406_11177694 3300031901 Bacteria 665
587 Ga0307412_10273644 3300031911 Bacteria 1323
588 Ga0307412_10379300 3300031911 Bacteria 1144
589 Ga0307412_10421675 3300031911 Bacteria 1092
590 Ga0307412_11248577 3300031911 Bacteria 667
591 Ga0307412_11959248 3300031911 Bacteria 541
592 Ga0315914_1000006 3300031967 Bacteria 239817
593 Ga0307409_100097147 3300031995 Bacteria 2432
594 Ga0307409_100555550 3300031995 Bacteria 1128
595 Ga0307409_100788681 3300031995 Bacteria 957
596 Ga0307409_101005982 3300031995 Bacteria 852
597 Ga0307409_101022835 3300031995 Bacteria 845
598 Ga0307409_101337941 3300031995 Bacteria 742
599 Ga0307416_100206173 3300032002 Bacteria 1870
600 Ga0307416_100739011 3300032002 Bacteria 1076
601 Ga0307416_100786570 3300032002 Bacteria 1046
602 Ga0307416_102309240 3300032002 Bacteria 638
603 Ga0307414_11651350 3300032004 Bacteria 597
604 Ga0307411_10011705 3300032005 Bacteria 4750
605 Ga0307415_102358078 3300032126 Bacteria 523
606 Ga0316593_10308730 3300032168 Bacteria 600
607 Ga0315913_1000002 3300033430 Bacteria 241452
608 Ga0315915_1000001 3300033464 Bacteria 481518
609 Ga0373948_0044536 3300034817 Bacteria 938
610 Ga0373958_0116867 3300034819 Bacteria 641
611 Ga0373928_0044563 3300035084 Bacteria 1030
612 Ga0373929_0045814 3300035085 Bacteria 986
613 Ga0373929_0091196 3300035085 Bacteria 756
614 Ga0373944_0134099 3300035089 Bacteria 863
615 Ga0373923_0160968 3300035111 Bacteria 1024
616 Ga0373939_0065154 3300035114 Bacteria 1171
617 Ga0373941_0017338 3300035115 Bacteria 1972
618 Ga0373941_0022048 3300035115 Bacteria 1804
619 Ga0373941_0067397 3300035115 Bacteria 1180
620 Ga0373945_0194682 3300035116 Bacteria 839
621 Ga0373945_0314766 3300035116 Bacteria 673
622 Ga0373954_0149670 3300035118 Bacteria 1140
623 Ga0373960_0004122 3300035121 Bacteria 3322
624 Ga0373943_0040534 3300035170 Bacteria 2249
625 Ga0373946_0677114 3300035171 Bacteria 538
626 Ga0373955_0820692 3300035172 Bacteria 572
627 Ga0373942_0195710 3300035207 Bacteria 668
628 Ga0373942_0215262 3300035207 Bacteria 642
629 Ga0373961_0004785 3300035241 Bacteria 3255
630 Ga0373961_0034038 3300035241 Bacteria 1438
631 Ga0373962_0377996 3300035242 Bacteria 517
632 Ga0373931_0002120 3300035691 Bacteria 8740
633 Ga0373931_0013881 3300035691 Bacteria 3930
634 Ga0373931_0713394 3300035691 Bacteria 663
635 Ga0373935_0271890 3300035692 Bacteria 1191
636 Ga0373927_0027265 3300035695 Bacteria 3731
637 Ga0373937_1323102 3300036401 Bacteria 668
638 Ga0316582_0256716 3300036647 Bacteria 1198
639 Ga0316584_0842783 3300036712 Bacteria 620
640 Ga0373925_0374694 3300037068 Bacteria 1158
641 Ga0373925_0695920 3300037068 Bacteria 838
642 Ga0395899_0047689 3300037312 Bacteria 3189
643 Ga0395898_0049480 3300037466 Bacteria 4118
644 Ga0395898_0279979 3300037466 Bacteria 1591
645 Ga0395898_0355110 3300037466 Bacteria 1398
646 Ga0395905_0037309 3300037471 Bacteria 4564
647 Ga0395905_0052400 3300037471 Bacteria 3820
648 Ga0395901_0082006 3300038443 Bacteria 3369
649 Ga0395901_1155786 3300038443 Bacteria 742
650 Ga0436365_0366823 3300039437 Bacteria 547
651 Ga0436363_0775146 3300039450 Bacteria 11928
652 Ga0439436_0006455 3300041404 Bacteria 3600
653 Ga0439436_0149499 3300041404 Bacteria 658
654 Ga0439436_0207568 3300041404 Bacteria 562
655 Ga0439438_017861 3300041405 Bacteria 2031
656 Ga0439466_0130362 3300041411 Bacteria 774
657 Ga0439465_0001711 3300041413 Bacteria 7165
658 Ga0439465_0089399 3300041413 Bacteria 1052
659 Ga0439465_0102356 3300041413 Bacteria 990
660 Ga0451789_1320308 3300041443 Bacteria 531
661 Ga0451791_1932150 3300041451 Bacteria 579
662 Ga0451797_0392121 3300041453 Bacteria 844
663 Ga0451802_0083164 3300041460 Bacteria 716
664 Ga0451839_0636310 3300041496 Bacteria 580
665 Ga0451841_1019038 3300041498 Bacteria 858
666 Ga0451853_2943703 3300041512 Bacteria 583
667 Ga0439433_0078267 3300041999 Bacteria 802
668 Ga0439445_0166395 3300042004 Bacteria 645
669 Ga0439448_0225608 3300042005 Bacteria 659
670 Ga0439432_040707 3300042006 Bacteria 1474
671 Ga0439449_0001047 3300042007 Bacteria 10900
672 Ga0439462_0121485 3300042015 Bacteria 727
673 Ga0439462_0189933 3300042015 Bacteria 583
674 Ga0450920_036575 3300042122 Bacteria 974
675 Ga0450923_039887 3300042125 Bacteria 984
676 Ga0450906_008450 3300042145 Bacteria 1991
677 Ga0439458_0047121 3300042157 Bacteria 1057
678 Ga0450908_029936 3300042184 Bacteria 946
679 Ga0450909_080054 3300042185 Bacteria 528
680 Ga0439434_0020056 3300042435 Bacteria 2006
681 Ga0450918_001738 3300042531 Bacteria 4242
682 Ga0466972_0082447 3300044658 Bacteria 1530
683 Ga0466965_0132840 3300044683 Bacteria 1292
684 Ga0466965_0432222 3300044683 Bacteria 731
685 Ga0466966_0803263 3300044684 Bacteria 567
686 Ga0466963_0020949 3300044694 Bacteria 4119
687 Ga0466968_0455478 3300044735 Bacteria 633
688 Ga0466970_0107199 3300044765 Bacteria 1524
689 Ga0466957_0092513 3300044842 Bacteria 1897
690 Ga0466960_0025395 3300044901 Bacteria 2681
691 Ga0466960_0317440 3300044901 Bacteria 882
692 Ga0466960_0511477 3300044901 Bacteria 704
693 Ga0466960_0576090 3300044901 Bacteria 666
694 Ga0466959_0628274 3300045049 Bacteria 721
695 Ga0466967_0814156 3300045976 Bacteria 928
696 Ga0466967_0922145 3300045976 Bacteria 869
697 Ga0495627_150236 3300046453 Bacteria 650
698 Ga0495592_0046201 3300046454 Bacteria 3246
699 Ga0495592_0260565 3300046454 Bacteria 1142
700 Ga0495590_0220384 3300046457 Bacteria 701
701 Ga0495629_0026890 3300046459 Bacteria 4086
702 Ga0495638_0016460 3300046460 Bacteria 4953
703 Ga0495638_0046065 3300046460 Bacteria 2741
704 Ga0495638_0114859 3300046460 Bacteria 1596
705 Ga0495641_0539109 3300046461 Bacteria 533
706 Ga0495651_0552564 3300046462 Bacteria 731
707 Ga0495653_0078871 3300046463 Bacteria 2441
708 Ga0495653_0567504 3300046463 Bacteria 701
709 Ga0495650_0104198 3300046471 Bacteria 1061
710 Ga0495650_0219604 3300046471 Bacteria 655
711 Ga0495662_0031142 3300046476 Bacteria 2576
712 Ga0495664_0308462 3300046477 Bacteria 955
713 Ga0495596_0111419 3300046500 Bacteria 1063
714 Ga0495607_0400987 3300046501 Bacteria 624
715 Ga0495606_0010031 3300046507 Bacteria 7916
716 Ga0495606_0088887 3300046507 Bacteria 1904
717 Ga0495606_0203377 3300046507 Bacteria 1127
718 Ga0495610_0006212 3300046512 Bacteria 8290
719 Ga0495610_0063217 3300046512 Bacteria 1754
720 Ga0495610_0141051 3300046512 Bacteria 1037
721 Ga0495610_0214715 3300046512 Bacteria 780
722 Ga0495610_0240221 3300046512 Bacteria 722
723 Ga0495616_0283838 3300046513 Bacteria 703
724 Ga0495620_0150916 3300046515 Bacteria 906
725 Ga0495620_0263773 3300046515 Bacteria 656
726 Ga0495632_0218774 3300046519 Bacteria 862
727 Ga0495643_0027457 3300046522 Bacteria 3198
728 Ga0495643_0037538 3300046522 Bacteria 2656
729 Ga0495643_0044122 3300046522 Bacteria 2424
730 Ga0495643_0226322 3300046522 Bacteria 884
731 Ga0495644_0220612 3300046523 Bacteria 733
732 Ga0495648_0378833 3300046524 Bacteria 638
733 Ga0495648_0407376 3300046524 Bacteria 606
734 Ga0495652_0525183 3300046529 Bacteria 817
735 Ga0495587_0678349 3300046536 Bacteria 565
736 Ga0495621_0219587 3300046539 Bacteria 769
737 Ga0495597_0349024 3300046542 Bacteria 568
738 Ga0495645_0142971 3300046543 Bacteria 1668
739 Ga0495645_0838178 3300046543 Bacteria 549
740 Ga0495622_0106271 3300046557 Bacteria 1286
741 Ga0495656_0586067 3300046615 Bacteria 596
742 Ga0495668_0066336 3300046616 Bacteria 1986
743 Ga0495668_0140952 3300046616 Bacteria 1319
744 Ga0495668_0471569 3300046616 Bacteria 691
745 Ga0495668_0634570 3300046616 Bacteria 590
746 Ga0495634_0533571 3300046642 Bacteria 685
747 Ga0495625_0088160 3300046660 Bacteria 2150
748 Ga0495625_0133822 3300046660 Bacteria 1677
749 Ga0495625_0244218 3300046660 Bacteria 1168
750 Ga0495625_0377402 3300046660 Bacteria 890
751 Ga0495625_0529141 3300046660 Bacteria 717
752 Ga0495625_0554266 3300046660 Bacteria 696
753 Ga0495635_1037604 3300046663 Bacteria 521
754 Ga0495588_0048206 3300046674 Bacteria 2188
755 Ga0495657_0072858 3300046675 Bacteria 2239
756 Ga0495623_0257965 3300046679 Bacteria 978
757 Ga0495658_0120709 3300046683 Bacteria 1585
758 Ga0495613_0686622 3300046689 Bacteria 675
759 Ga0495624_0185559 3300046690 Bacteria 1266
760 Ga0495649_0438076 3300046694 Bacteria 654
761 Ga0495589_0108077 3300046794 Bacteria 1344
762 Ga0495600_0123827 3300046809 Bacteria 1681
763 Ga0495660_0032319 3300046810 Bacteria 2939
764 Ga0495660_0361697 3300046810 Bacteria 643
765 Ga0495604_0028877 3300047317 Bacteria 4413
766 Ga0495604_0422102 3300047317 Bacteria 875
767 Ga0495674_1327161 3300047319 Bacteria 539
768 Ga0495680_0418083 3300047322 Bacteria 923
769 Ga0495687_063971 3300047443 Bacteria 1504
770 Ga0495687_095090 3300047443 Bacteria 1131
771 Ga0495673_0214526 3300047469 Bacteria 715
772 Ga0495681_0080705 3300047470 Bacteria 1453
773 Ga0495686_0002844 3300047472 Bacteria 15625
774 Ga0495686_0011672 3300047472 Bacteria 6185
775 Ga0495686_0028624 3300047472 Bacteria 3628
776 Ga0495686_0317298 3300047472 Bacteria 855
777 Ga0495686_0510555 3300047472 Bacteria 632
778 Ga0495602_0660150 3300048088 Bacteria 713
779 Ga0495602_0902761 3300048088 Bacteria 588
780 Ga0495626_0025458 3300048091 Bacteria 2894
781 Ga0496100_0016492 3300048903 Bacteria 4339
782 Ga0496100_0767447 3300048903 Bacteria 755
783 Ga0496101_0291059 3300048904 Bacteria 1278
784 Ga0496101_0383035 3300048904 Bacteria 1106
785 Ga0496101_0405490 3300048904 Bacteria 1074
786 Ga0496101_0421716 3300048904 Bacteria 1052
787 Ga0496101_0680711 3300048904 Bacteria 812
788 Ga0496102_0199108 3300048905 Bacteria 1888
789 Ga0496102_0505898 3300048905 Bacteria 1130
790 Ga0496102_0866232 3300048905 Bacteria 825
791 Ga0496102_0909821 3300048905 Bacteria 801
792 Ga0496102_1039957 3300048905 Bacteria 739
793 Ga0496103_0043920 3300048906 Bacteria 2752
794 Ga0496104_0094490 3300048907 Bacteria 2860
795 Ga0496104_0546919 3300048907 Bacteria 1069
796 Ga0496104_0697772 3300048907 Bacteria 923
797 Ga0496104_1747712 3300048907 Bacteria 524
798 Ga0496105_0550856 3300048908 Bacteria 900
799 Ga0496105_0581033 3300048908 Bacteria 872
800 Ga0496105_0804237 3300048908 Bacteria 714
801 Ga0496105_0977184 3300048908 Bacteria 634
802 Ga0496106_0016430 3300048909 Bacteria 5476
803 Ga0496106_0224296 3300048909 Bacteria 1499
804 Ga0496106_1182545 3300048909 Bacteria 597
805 Ga0496107_0075565 3300048910 Bacteria 2452
806 Ga0496108_0096285 3300048911 Bacteria 2521
807 Ga0496108_0122367 3300048911 Bacteria 2232
808 Ga0496109_0023524 3300048912 Bacteria 5470
809 Ga0496109_0126970 3300048912 Bacteria 2378
810 Ga0496109_1903835 3300048912 Bacteria 527
811 Ga0496110_0056926 3300048913 Bacteria 3440
812 Ga0496110_0179413 3300048913 Bacteria 1923
813 Ga0496110_0986462 3300048913 Bacteria 750
814 Ga0496110_1096251 3300048913 Bacteria 704
815 Ga0496111_0127301 3300048914 Bacteria 1883
816 Ga0496111_0274367 3300048914 Bacteria 1251
817 Ga0496112_0052437 3300048915 Bacteria 4003
818 Ga0496112_0057193 3300048915 Bacteria 3839
819 Ga0496112_0142644 3300048915 Bacteria 2364
820 Ga0496112_0675681 3300048915 Bacteria 961
821 Ga0496112_1101560 3300048915 Bacteria 712
822 Ga0496112_1230459 3300048915 Bacteria 665
823 Ga0496113_0451804 3300048916 Bacteria 1032
824 Ga0496113_0683664 3300048916 Bacteria 820
825 Ga0496114_0076482 3300048917 Bacteria 2820
826 Ga0496114_0130392 3300048917 Bacteria 2170
827 Ga0496114_0422455 3300048917 Bacteria 1181
828 Ga0496114_0551466 3300048917 Bacteria 1018
829 Ga0496115_0169071 3300048918 Bacteria 1808
830 Ga0496115_0188617 3300048918 Bacteria 1703
831 Ga0496115_0782721 3300048918 Bacteria 744
832 Ga0496116_0036873 3300048919 Bacteria 3416
833 Ga0496116_0061983 3300048919 Bacteria 2417
834 Ga0496116_0067211 3300048919 Bacteria 2290
835 Ga0496116_0224656 3300048919 Bacteria 958
836 Ga0496117_0006751 3300048920 Bacteria 11463
837 Ga0496117_0014861 3300048920 Bacteria 6680
838 Ga0496117_0076186 3300048920 Bacteria 2225
839 Ga0496117_0080253 3300048920 Bacteria 2146
840 Ga0496117_0084069 3300048920 Bacteria 2078
841 Ga0496117_0466083 3300048920 Bacteria 621
842 Ga0496117_0500428 3300048920 Bacteria 589
843 Ga0496118_0003715 3300048921 Bacteria 18909
844 Ga0496118_0010030 3300048921 Bacteria 9443
845 Ga0496118_0082361 3300048921 Bacteria 2255
846 Ga0496118_0197134 3300048921 Bacteria 1197
847 Ga0496118_0197932 3300048921 Bacteria 1194
848 Ga0496119_0009045 3300048922 Bacteria 8634
849 Ga0496119_0036191 3300048922 Bacteria 3225
850 Ga0496119_0039161 3300048922 Bacteria 3049
851 Ga0496119_0042057 3300048922 Bacteria 2901
852 Ga0496119_0431032 3300048922 Bacteria 624
853 Ga0496120_0026604 3300048923 Bacteria 3570
854 Ga0496120_0062583 3300048923 Bacteria 2073
855 Ga0496120_0097153 3300048923 Bacteria 1563
856 Ga0496120_0117110 3300048923 Bacteria 1383
857 Ga0496120_0426736 3300048923 Bacteria 581
858 Ga0496121_0018097 3300048924 Bacteria 7128
859 Ga0496121_0045342 3300048924 Bacteria 3779
860 Ga0496121_0065852 3300048924 Bacteria 2945
861 Ga0496121_0074664 3300048924 Bacteria 2711
862 Ga0496121_0146696 3300048924 Bacteria 1742
863 Ga0496121_0265597 3300048924 Bacteria 1182
864 Ga0496122_0001107 3300048925 Bacteria 46550
865 Ga0496122_0016172 3300048925 Bacteria 7085
866 Ga0496122_0031570 3300048925 Bacteria 4405
867 Ga0496122_0034124 3300048925 Bacteria 4171
868 Ga0496122_0048526 3300048925 Bacteria 3262
869 Ga0496122_0248610 3300048925 Bacteria 996
870 Ga0496122_0320076 3300048925 Bacteria 825
871 Ga0496122_0579549 3300048925 Bacteria 529
872 Ga0496123_0000562 3300048926 Bacteria 63590
873 Ga0496123_0052247 3300048926 Bacteria 2714
874 Ga0496123_0097553 3300048926 Bacteria 1721
875 Ga0496123_0124906 3300048926 Bacteria 1438
876 Ga0496123_0140471 3300048926 Bacteria 1321
877 Ga0496123_0289706 3300048926 Bacteria 787
878 Ga0496124_0045730 3300048927 Bacteria 3752
879 Ga0496124_0054556 3300048927 Bacteria 3382
880 Ga0496124_0064786 3300048927 Bacteria 3050
881 Ga0496124_0076226 3300048927 Bacteria 2769
882 Ga0496124_0282531 3300048927 Bacteria 1209
883 Ga0496124_0377166 3300048927 Bacteria 993
884 Ga0496124_0443073 3300048927 Bacteria 888
885 Ga0496124_0483676 3300048927 Bacteria 835
886 Ga0496124_0491336 3300048927 Bacteria 826
887 Ga0496124_0677215 3300048927 Bacteria 657
888 Ga0496125_0001370 3300048928 Bacteria 35861
889 Ga0496125_0083675 3300048928 Bacteria 2426
890 Ga0496125_0121749 3300048928 Bacteria 1859
891 Ga0496125_0184448 3300048928 Bacteria 1385
892 Ga0496125_0391440 3300048928 Bacteria 815
893 Ga0496125_0405944 3300048928 Bacteria 795
894 Ga0496125_0413004 3300048928 Bacteria 785
895 Ga0496126_0000069 3300048929 Bacteria 246935
896 Ga0496126_0003015 3300048929 Bacteria 21841
897 Ga0496126_0103078 3300048929 Bacteria 2494
898 Ga0496126_0167746 3300048929 Bacteria 1872
899 Ga0496126_0192559 3300048929 Bacteria 1726
900 Ga0496126_0906626 3300048929 Bacteria 668
901 Ga0495678_267563 3300049459 Bacteria 503
902 Ga0501291_152841 3300049514 Bacteria 523
903 Ga0501299_054410 3300049522 Bacteria 834
904 Ga0501031_0000014 3300049568 Bacteria 127199
905 Ga0501031_0001971 3300049568 Bacteria 12963
906 Ga0501031_0105814 3300049568 Bacteria 1836
907 Ga0501031_0376889 3300049568 Bacteria 918
908 Ga0501031_0824410 3300049568 Bacteria 594
909 Ga0501031_0861417 3300049568 Bacteria 580
910 Ga0501032_0000015 3300049569 Bacteria 176755
911 Ga0501032_0000025 3300049569 Bacteria 138521
912 Ga0501032_0003745 3300049569 Bacteria 11530
913 Ga0501032_0024369 3300049569 Bacteria 4179
914 Ga0501032_0081191 3300049569 Bacteria 2157
915 Ga0501032_0088775 3300049569 Bacteria 2052
916 Ga0501032_0137807 3300049569 Bacteria 1608
917 Ga0501032_0396759 3300049569 Bacteria 886
918 Ga0501032_0414713 3300049569 Bacteria 864
919 Ga0501032_0521889 3300049569 Bacteria 758
920 Ga0501032_0717828 3300049569 Bacteria 633
921 Ga0501033_0000023 3300049570 Bacteria 176725
922 Ga0501033_0000229 3300049570 Bacteria 54036
923 Ga0501033_0001216 3300049570 Bacteria 23119
924 Ga0501033_0001969 3300049570 Bacteria 17888
925 Ga0501033_0005696 3300049570 Bacteria 9821
926 Ga0501033_0026545 3300049570 Bacteria 4359
927 Ga0501033_0028102 3300049570 Bacteria 4227
928 Ga0501033_0048896 3300049570 Bacteria 3140
929 Ga0501033_0072521 3300049570 Bacteria 2528
930 Ga0501033_0108891 3300049570 Bacteria 2018
931 Ga0501033_0187778 3300049570 Bacteria 1480
932 Ga0501033_0389184 3300049570 Bacteria 973
933 Ga0501033_0408738 3300049570 Bacteria 946
934 Ga0501033_0456493 3300049570 Bacteria 887
935 Ga0501033_0810880 3300049570 Bacteria 632
936 Ga0501034_0000073 3300049571 Bacteria 176737
937 Ga0501034_0001862 3300049571 Bacteria 26764
938 Ga0501034_0020231 3300049571 Bacteria 6796
939 Ga0501034_0060876 3300049571 Bacteria 3792
940 Ga0501034_0079454 3300049571 Bacteria 3283
941 Ga0501034_0122722 3300049571 Bacteria 2584
942 Ga0501034_0123215 3300049571 Bacteria 2578
943 Ga0501034_0139402 3300049571 Bacteria 2405
944 Ga0501034_0288655 3300049571 Bacteria 1579
945 Ga0501034_0291447 3300049571 Bacteria 1570
946 Ga0501034_0307254 3300049571 Bacteria 1521
947 Ga0501034_0378691 3300049571 Bacteria 1340
948 Ga0501034_0389914 3300049571 Bacteria 1317
949 Ga0501034_0395936 3300049571 Bacteria 1304
950 Ga0501034_0526172 3300049571 Bacteria 1094
951 Ga0501034_0697660 3300049571 Bacteria 914
952 Ga0501034_0698638 3300049571 Bacteria 913
953 Ga0501034_0793131 3300049571 Bacteria 840
954 Ga0501034_0847211 3300049571 Bacteria 804
955 Ga0501034_1231765 3300049571 Bacteria 626
956 Ga0501034_1600637 3300049571 Bacteria 524
957 Ga0501036_0000002 3300049572 Bacteria 293106
958 Ga0501036_0001402 3300049572 Bacteria 18518
959 Ga0501036_0006176 3300049572 Bacteria 9724
960 Ga0501036_0205069 3300049572 Bacteria 1658
961 Ga0501036_0224443 3300049572 Bacteria 1577
962 Ga0501036_0236010 3300049572 Bacteria 1534
963 Ga0501036_0277095 3300049572 Bacteria 1404
964 Ga0501036_0485729 3300049572 Bacteria 1028
965 Ga0501036_0593031 3300049572 Bacteria 919
966 Ga0501036_0899567 3300049572 Bacteria 726
967 Ga0501036_1110278 3300049572 Bacteria 646
968 Ga0501036_1172201 3300049572 Bacteria 626
969 Ga0501037_0000048 3300049573 Bacteria 113375
970 Ga0501037_0000176 3300049573 Bacteria 60011
971 Ga0501037_0000828 3300049573 Bacteria 23090
972 Ga0501037_0016939 3300049573 Bacteria 5362
973 Ga0501037_0036439 3300049573 Bacteria 3625
974 Ga0501037_0079088 3300049573 Bacteria 2386
975 Ga0501037_0099630 3300049573 Bacteria 2099
976 Ga0501037_0100166 3300049573 Bacteria 2092
977 Ga0501037_0119331 3300049573 Bacteria 1897
978 Ga0501037_0248906 3300049573 Bacteria 1244
979 Ga0501037_0885778 3300049573 Bacteria 586
980 Ga0501037_0899989 3300049573 Bacteria 580
981 Ga0501038_0000002 3300049574 Bacteria 330446
982 Ga0501038_0000862 3300049574 Bacteria 26891
983 Ga0501038_0002080 3300049574 Bacteria 18546
984 Ga0501038_0070054 3300049574 Bacteria 2978
985 Ga0501038_0139672 3300049574 Bacteria 1983
986 Ga0501038_0159284 3300049574 Bacteria 1836
987 Ga0501038_0180255 3300049574 Bacteria 1705
988 Ga0501038_0220923 3300049574 Bacteria 1512
989 Ga0501038_0251353 3300049574 Bacteria 1400
990 Ga0501038_0302664 3300049574 Bacteria 1254
991 Ga0501038_0338173 3300049574 Bacteria 1174
992 Ga0501038_0346042 3300049574 Bacteria 1158
993 Ga0501038_0449010 3300049574 Bacteria 992
994 Ga0501038_0468901 3300049574 Bacteria 966
995 Ga0501039_0000002 3300049575 Bacteria 375152
996 Ga0501039_0000003 3300049575 Bacteria 357424
997 Ga0501039_0003603 3300049575 Bacteria 11608
998 Ga0501039_0043673 3300049575 Bacteria 3461
999 Ga0501039_0130512 3300049575 Bacteria 1972
1000 Ga0501039_0160922 3300049575 Bacteria 1764
1001 Ga0501039_0389942 3300049575 Bacteria 1094
1002 Ga0501039_0520110 3300049575 Bacteria 934
1003 Ga0501039_0659405 3300049575 Bacteria 819
1004 Ga0501039_1091182 3300049575 Bacteria 619
1005 Ga0501040_0134996 3300049576 Bacteria 1737
1006 Ga0501040_0271230 3300049576 Bacteria 1211
1007 Ga0501041_0171474 3300049577 Bacteria 1358
1008 Ga0501041_0371871 3300049577 Bacteria 904
1009 Ga0501041_0402797 3300049577 Bacteria 867
1010 Ga0501042_0022915 3300049578 Bacteria 4363
1011 Ga0501042_0796869 3300049578 Bacteria 687
1012 Ga0501042_0848560 3300049578 Bacteria 665
1013 Ga0501043_0000051 3300049579 Bacteria 106957
1014 Ga0501043_0000114 3300049579 Bacteria 75782
1015 Ga0501043_0000298 3300049579 Bacteria 44905
1016 Ga0501043_0097713 3300049579 Bacteria 2308
1017 Ga0501043_0123911 3300049579 Bacteria 2026
1018 Ga0501043_0193524 3300049579 Bacteria 1581
1019 Ga0501043_0331146 3300049579 Bacteria 1159
1020 Ga0501043_0348760 3300049579 Bacteria 1125
1021 Ga0501043_0578768 3300049579 Bacteria 831
1022 Ga0501043_0592499 3300049579 Bacteria 820
1023 Ga0501043_0684458 3300049579 Bacteria 750
1024 Ga0501043_0689456 3300049579 Bacteria 747
1025 Ga0501043_0806801 3300049579 Bacteria 678
1026 Ga0501046_0002813 3300049580 Bacteria 16205
1027 Ga0501046_0210740 3300049580 Bacteria 1443
1028 Ga0501046_0222356 3300049580 Bacteria 1397
1029 Ga0501046_0435005 3300049580 Bacteria 944
1030 Ga0501046_0612252 3300049580 Bacteria 772
1031 Ga0501046_0743585 3300049580 Bacteria 689
1032 Ga0501046_1202505 3300049580 Bacteria 521
1033 Ga0501047_0000801 3300049581 Bacteria 32872
1034 Ga0501047_0003631 3300049581 Bacteria 14539
1035 Ga0501047_0007205 3300049581 Bacteria 10455
1036 Ga0501047_0024244 3300049581 Bacteria 5824
1037 Ga0501047_0037480 3300049581 Bacteria 4688
1038 Ga0501047_0056953 3300049581 Bacteria 3780
1039 Ga0501047_0066964 3300049581 Bacteria 3461
1040 Ga0501047_0126975 3300049581 Bacteria 2431
1041 Ga0501047_0135061 3300049581 Bacteria 2347
1042 Ga0501047_0160390 3300049581 Bacteria 2120
1043 Ga0501047_0296359 3300049581 Bacteria 1460
1044 Ga0501047_0314922 3300049581 Bacteria 1405
1045 Ga0501047_0317553 3300049581 Bacteria 1398
1046 Ga0501047_0397273 3300049581 Bacteria 1212
1047 Ga0501047_0538013 3300049581 Bacteria 993
1048 Ga0501047_0640339 3300049581 Bacteria 883
1049 Ga0501047_0713277 3300049581 Bacteria 820
1050 Ga0501047_0765362 3300049581 Bacteria 781
1051 Ga0501047_0821544 3300049581 Bacteria 744
1052 Ga0501047_0870283 3300049581 Bacteria 715
1053 Ga0501047_0957566 3300049581 Bacteria 669
1054 Ga0501047_1159146 3300049581 Bacteria 586
1055 Ga0501047_1261978 3300049581 Bacteria 553
1056 Ga0501047_1330168 3300049581 Bacteria 533
1057 Ga0501048_0005516 3300049582 Bacteria 9627
1058 Ga0501048_0020520 3300049582 Bacteria 4842
1059 Ga0501048_0637783 3300049582 Bacteria 765
1060 Ga0501048_0754454 3300049582 Bacteria 699
1061 Ga0501067_0002093 3300049583 Bacteria 10999
1062 Ga0501067_0025416 3300049583 Bacteria 3282
1063 Ga0501067_0085497 3300049583 Bacteria 1750
1064 Ga0501067_0148337 3300049583 Bacteria 1307
1065 Ga0501067_0277425 3300049583 Bacteria 933
1066 Ga0501068_0021421 3300049584 Bacteria 3774
1067 Ga0501068_0050259 3300049584 Bacteria 2520
1068 Ga0501068_0178750 3300049584 Bacteria 1341
1069 Ga0501068_0622087 3300049584 Bacteria 704
1070 Ga0501068_1194656 3300049584 Bacteria 504
1071 Ga0501069_0000016 3300049585 Bacteria 142565
1072 Ga0501069_0003777 3300049585 Bacteria 7790
1073 Ga0501069_0004450 3300049585 Bacteria 7237
1074 Ga0501069_0035566 3300049585 Bacteria 2745
1075 Ga0501069_0046007 3300049585 Bacteria 2419
1076 Ga0501069_0053290 3300049585 Bacteria 2253
1077 Ga0501069_0192208 3300049585 Bacteria 1181
1078 Ga0501069_0405145 3300049585 Bacteria 807
1079 Ga0501070_0000186 3300049586 Bacteria 58369
1080 Ga0501070_0000931 3300049586 Bacteria 26365
1081 Ga0501070_0006076 3300049586 Bacteria 10289
1082 Ga0501070_0006421 3300049586 Bacteria 10006
1083 Ga0501070_0011400 3300049586 Bacteria 7513
1084 Ga0501070_0025050 3300049586 Bacteria 5003
1085 Ga0501070_0107402 3300049586 Bacteria 2306
1086 Ga0501070_0126598 3300049586 Bacteria 2111
1087 Ga0501070_0246047 3300049586 Bacteria 1463
1088 Ga0501070_0255729 3300049586 Bacteria 1432
1089 Ga0501070_0289420 3300049586 Bacteria 1335
1090 Ga0501070_0474697 3300049586 Bacteria 1007
1091 Ga0501070_0531996 3300049586 Bacteria 942
1092 Ga0501070_0594590 3300049586 Bacteria 882
1093 Ga0501070_0621858 3300049586 Bacteria 860
1094 Ga0501070_0636116 3300049586 Bacteria 848
1095 Ga0501070_0690710 3300049586 Bacteria 808
1096 Ga0501070_0701238 3300049586 Bacteria 800
1097 Ga0501070_0927086 3300049586 Bacteria 678
1098 Ga0501071_0004977 3300049587 Bacteria 8488
1099 Ga0501071_0013894 3300049587 Bacteria 5498
1100 Ga0501071_0099158 3300049587 Bacteria 2147
1101 Ga0501071_0236158 3300049587 Bacteria 1378
1102 Ga0501071_0556507 3300049587 Bacteria 881
1103 Ga0501071_0866794 3300049587 Bacteria 696
1104 Ga0501071_1111468 3300049587 Bacteria 611
1105 Ga0501072_0381774 3300049588 Bacteria 1118
1106 Ga0501072_0473067 3300049588 Bacteria 992
1107 Ga0501072_0824625 3300049588 Bacteria 726
1108 Ga0501072_0982712 3300049588 Bacteria 658
1109 Ga0501073_0001927 3300049589 Bacteria 15444
1110 Ga0501073_0031080 3300049589 Bacteria 3811
1111 Ga0501073_0069860 3300049589 Bacteria 2447
1112 Ga0501073_0092940 3300049589 Bacteria 2096
1113 Ga0501073_0097234 3300049589 Bacteria 2045
1114 Ga0501073_0130012 3300049589 Bacteria 1745
1115 Ga0501073_0141309 3300049589 Bacteria 1668
1116 Ga0501073_0156523 3300049589 Bacteria 1579
1117 Ga0501073_0169919 3300049589 Bacteria 1509
1118 Ga0501073_0185341 3300049589 Bacteria 1440
1119 Ga0501073_0407456 3300049589 Bacteria 939
1120 Ga0501073_0410190 3300049589 Bacteria 936
1121 Ga0501073_0599732 3300049589 Bacteria 761
1122 Ga0501073_1164911 3300049589 Bacteria 529
1123 Ga0501074_0000831 3300049590 Bacteria 19586
1124 Ga0501074_0001818 3300049590 Bacteria 14602
1125 Ga0501074_0047325 3300049590 Bacteria 3110
1126 Ga0501074_0073258 3300049590 Bacteria 2461
1127 Ga0501074_0099182 3300049590 Bacteria 2085
1128 Ga0501074_0124714 3300049590 Bacteria 1842
1129 Ga0501074_0371372 3300049590 Bacteria 1015
1130 Ga0501074_0462062 3300049590 Bacteria 900
1131 Ga0501074_0464656 3300049590 Bacteria 897
1132 Ga0501074_0846314 3300049590 Bacteria 644
1133 Ga0501074_0875036 3300049590 Bacteria 632
1134 Ga0501074_1042126 3300049590 Bacteria 575
1135 Ga0501074_1045860 3300049590 Bacteria 574
1136 Ga0501074_1294738 3300049590 Bacteria 511
1137 Ga0501075_0092368 3300049591 Bacteria 2297
1138 Ga0501075_0561574 3300049591 Bacteria 871
1139 Ga0501076_0096701 3300049592 Bacteria 2379
1140 Ga0501076_0145684 3300049592 Bacteria 1926
1141 Ga0501076_0357653 3300049592 Bacteria 1199
1142 Ga0501076_0442465 3300049592 Bacteria 1070
1143 Ga0501076_0692037 3300049592 Bacteria 842
1144 Ga0501076_1281469 3300049592 Bacteria 603
1145 Ga0501077_0072866 3300049593 Bacteria 2176
1146 Ga0501077_0153358 3300049593 Bacteria 1462
1147 Ga0501077_0220110 3300049593 Bacteria 1206
1148 Ga0501077_0266593 3300049593 Bacteria 1089
1149 Ga0501077_0409219 3300049593 Bacteria 867
1150 Ga0501223_094886 3300049663 Bacteria 609
1151 Ga0501238_011525 3300049671 Bacteria 1188
1152 Ga0501079_0010606 3300049741 Bacteria 7011
1153 Ga0501079_0085851 3300049741 Bacteria 2436
1154 Ga0501079_0095573 3300049741 Bacteria 2303
1155 Ga0501079_0409423 3300049741 Bacteria 1064
1156 Ga0501079_0877373 3300049741 Bacteria 706
1157 Ga0501079_1328203 3300049741 Bacteria 566
1158 Ga0501080_0001450 3300049742 Bacteria 19946
1159 Ga0501080_0004427 3300049742 Bacteria 12498
1160 Ga0501080_0005392 3300049742 Bacteria 11401
1161 Ga0501080_0011492 3300049742 Bacteria 8106
1162 Ga0501080_0027959 3300049742 Bacteria 5244
1163 Ga0501080_0033685 3300049742 Bacteria 4782
1164 Ga0501080_0106323 3300049742 Bacteria 2601
1165 Ga0501080_0149501 3300049742 Bacteria 2159
1166 Ga0501080_0369916 3300049742 Bacteria 1292
1167 Ga0501080_0655661 3300049742 Bacteria 928
1168 Ga0501080_0737411 3300049742 Bacteria 867
1169 Ga0501080_0805636 3300049742 Bacteria 823
1170 Ga0501081_0750904 3300049743 Bacteria 733
1171 Ga0501081_0906220 3300049743 Bacteria 665
1172 Ga0501083_0000111 3300049744 Bacteria 55529
1173 Ga0501083_0001724 3300049744 Bacteria 14896
1174 Ga0501083_0003402 3300049744 Bacteria 11133
1175 Ga0501083_0061019 3300049744 Bacteria 2518
1176 Ga0501083_0150491 3300049744 Bacteria 1524
1177 Ga0501083_0267327 3300049744 Bacteria 1112
1178 Ga0501083_0267625 3300049744 Bacteria 1112
1179 Ga0501083_0287392 3300049744 Bacteria 1069
1180 Ga0501083_0615441 3300049744 Bacteria 706
1181 Ga0501083_0679520 3300049744 Bacteria 670
1182 Ga0501083_0701017 3300049744 Bacteria 658
1183 Ga0501083_0910504 3300049744 Bacteria 572
1184 Ga0501083_0929007 3300049744 Bacteria 566
1185 Ga0501083_1041056 3300049744 Bacteria 533
1186 Ga0501280_001370 3300049776 Bacteria 4580
1187 Ga0501035_0000022 3300049822 Bacteria 208622
1188 Ga0501035_0000102 3300049822 Bacteria 106915
1189 Ga0501035_0000690 3300049822 Bacteria 36838
1190 Ga0501035_0000752 3300049822 Bacteria 34903
1191 Ga0501035_0001093 3300049822 Bacteria 28434
1192 Ga0501035_0001914 3300049822 Bacteria 20905
1193 Ga0501035_0012136 3300049822 Bacteria 7968
1194 Ga0501035_0029146 3300049822 Bacteria 5033
1195 Ga0501035_0098972 3300049822 Bacteria 2560
1196 Ga0501035_0108729 3300049822 Bacteria 2431
1197 Ga0501035_0109655 3300049822 Bacteria 2419
1198 Ga0501035_0117013 3300049822 Bacteria 2332
1199 Ga0501035_0158230 3300049822 Bacteria 1962
1200 Ga0501035_0174693 3300049822 Bacteria 1854
1201 Ga0501035_0183865 3300049822 Bacteria 1800
1202 Ga0501035_0420319 3300049822 Bacteria 1110
1203 Ga0501035_0565260 3300049822 Bacteria 930
1204 Ga0501035_0664206 3300049822 Bacteria 844
1205 Ga0501035_0915627 3300049822 Bacteria 694
1206 Ga0501044_0000002 3300049823 Bacteria 375152
1207 Ga0501044_0000003 3300049823 Bacteria 345647
1208 Ga0501044_0000255 3300049823 Bacteria 67530
1209 Ga0501044_0002922 3300049823 Bacteria 19435
1210 Ga0501044_0016909 3300049823 Bacteria 7824
1211 Ga0501044_0021665 3300049823 Bacteria 6852
1212 Ga0501044_0022140 3300049823 Bacteria 6776
1213 Ga0501044_0049355 3300049823 Bacteria 4345
1214 Ga0501044_0070221 3300049823 Bacteria 3563
1215 Ga0501044_0082154 3300049823 Bacteria 3261
1216 Ga0501044_0089157 3300049823 Bacteria 3113
1217 Ga0501044_0098827 3300049823 Bacteria 2938
1218 Ga0501044_0131509 3300049823 Bacteria 2496
1219 Ga0501044_0156921 3300049823 Bacteria 2254
1220 Ga0501044_0164118 3300049823 Bacteria 2196
1221 Ga0501044_0296069 3300049823 Bacteria 1548
1222 Ga0501044_0500508 3300049823 Bacteria 1116
1223 Ga0501044_0640775 3300049823 Bacteria 952
1224 Ga0501044_0890514 3300049823 Bacteria 765
1225 Ga0501044_1144578 3300049823 Bacteria 647
1226 Ga0501044_1435774 3300049823 Bacteria 555
1227 Ga0501045_0005999 3300049824 Bacteria 8407
1228 Ga0501045_0048465 3300049824 Bacteria 3097
1229 Ga0501045_0270327 3300049824 Bacteria 1265
1230 Ga0501045_0448015 3300049824 Bacteria 960
1231 Ga0501045_0689354 3300049824 Bacteria 754
1232 Ga0501045_1285448 3300049824 Unclassified 533
1233 nmdc:mga03683_139460_c1 3300050489 Bacteria 1089
1234 nmdc:mga03n38_431760_c1 3300050490 Bacteria 730
1235 nmdc:mga03n38_633722_c1 3300050490 Bacteria 611
1236 nmdc:mga03n38_85051_c1 3300050490 Bacteria 1495
1237 nmdc:mga03n38_902838_c1 3300050490 Bacteria 519
1238 nmdc:mga00v17_115_c2 3300050491 Bacteria 47780
1239 nmdc:mga00v17_300630_c1 3300050491 Bacteria 1042
1240 nmdc:mga0yw44_102224_c1 3300050492 Bacteria 1827
1241 nmdc:mga0yw44_141277_c1 3300050492 Bacteria 1565
1242 nmdc:mga0yw44_184850_c1 3300050492 Bacteria 1373
1243 nmdc:mga0yw44_240571_c1 3300050492 Bacteria 1203
1244 nmdc:mga0yw44_332942_c1 3300050492 Bacteria 1020
1245 nmdc:mga0yw44_66004_c1 3300050492 Bacteria 2232
1246 nmdc:mga0yw44_81368_c1 3300050492 Bacteria 2030
1247 nmdc:mga0k408_36900_c1 3300050493 Bacteria 1346
1248 nmdc:mga0k408_658257_c1 3300050493 Bacteria 615
1249 nmdc:mga06z11_197649_c1 3300050494 Bacteria 1166
1250 nmdc:mga06z11_222987_c1 3300050494 Bacteria 1102
1251 nmdc:mga06z11_23123_c1 3300050494 Bacteria 2914
1252 nmdc:mga06z11_66941_c1 3300050494 Bacteria 1890
1253 nmdc:mga06z11_821366_c1 3300050494 Bacteria 566
1254 nmdc:mga04h51_33389_c1 3300050495 Bacteria 1638
1255 nmdc:mga07m45_229620_c1 3300050496 Bacteria 1080
1256 nmdc:mga07m45_28926_c1 3300050496 Bacteria 3060
1257 nmdc:mga07m45_845887_c1 3300050496 Bacteria 524
1258 nmdc:mga08y16_453195_c1 3300050511 Bacteria 1308
1259 nmdc:mga0sz30_16635_c1 3300050516 Bacteria 2923
1260 nmdc:mga0sz30_193405_c1 3300050516 Bacteria 903
1261 nmdc:mga0sz30_263223_c1 3300050516 Bacteria 768
1262 nmdc:mga0sz30_39361_c1 3300050516 Bacteria 1357
1263 nmdc:mga0sz30_77891_c1 3300050516 Bacteria 914
1264 Ga0495612_0137474 3300053078 Bacteria 1058
1265 Ga0495655_0111615 3300053083 Bacteria 822
1266 Ga0495655_0277816 3300053083 Bacteria 570
1267 Ga0495595_0539691 3300053084 Bacteria 595
1268 Ga0495619_0041037 3300053085 Bacteria 3026
1269 Ga0500643_010419 3300053087 Bacteria 3461
1270 Ga0500644_0014616 3300053088 Bacteria 2220
1271 Ga0500646_0218015 3300053090 Bacteria 661
1272 Ga0500651_0400215 3300053093 Bacteria 771
1273 Ga0500562_148309 3300053108 Bacteria 639
1274 Ga0500592_074338 3300053116 Bacteria 562
1275 Ga0500595_037747 3300053119 Bacteria 1574
1276 Ga0500607_264271 3300053121 Bacteria 671
1277 Ga0500618_012633 3300053125 Bacteria 2205
1278 Ga0500621_166484 3300053126 Bacteria 812
1279 Ga0500642_0460303 3300053130 Bacteria 544
1280 Ga0500658_0103484 3300053134 Bacteria 1245
1281 Ga0500559_0318752 3300053136 Bacteria 729
1282 Ga0500568_0000143 3300053139 Bacteria 63442
1283 Ga0500568_0003084 3300053139 Bacteria 9512
1284 Ga0500568_0314746 3300053139 Bacteria 568
1285 Ga0500568_0365473 3300053139 Bacteria 523
1286 Ga0500590_001637 3300053148 Bacteria 9350
1287 Ga0500604_0132226 3300053151 Bacteria 839
1288 Ga0500616_0001190 3300053153 Bacteria 26447
1289 Ga0500616_0059686 3300053153 Bacteria 1980
1290 Ga0500616_0133505 3300053153 Bacteria 1170
1291 Ga0500616_0140386 3300053153 Bacteria 1130
1292 Ga0500620_003773 3300053155 Bacteria 3285
1293 Ga0500622_0000364 3300053156 Bacteria 43740
1294 Ga0500622_0000757 3300053156 Bacteria 28152
1295 Ga0500622_0231560 3300053156 Bacteria 822
1296 Ga0500624_093001 3300053157 Bacteria 613
1297 Ga0500627_0127639 3300053158 Bacteria 1148
1298 Ga0500627_0166663 3300053158 Bacteria 993
1299 Ga0500627_0228484 3300053158 Bacteria 828
1300 Ga0500627_0295216 3300053158 Bacteria 708
1301 Ga0500627_0299371 3300053158 Bacteria 702
1302 Ga0500627_0346384 3300053158 Bacteria 641
1303 Ga0500633_0005625 3300053160 Bacteria 2997
1304 Ga0500634_0002302 3300053161 Bacteria 7985
1305 Ga0500634_0404040 3300053161 Bacteria 504
1306 Ga0500636_0008368 3300053177 Bacteria 6001
1307 Ga0500611_050029 3300053727 Bacteria 954
1308 Ga0500645_036989 3300053730 Bacteria 1451
1309 Ga0500645_180497 3300053730 Bacteria 574
1310 Ga0500565_078516 3300053734 Bacteria 524
1311 Ga0501084_0011781 3300054114 Bacteria 7239
1312 Ga0501084_0029187 3300054114 Bacteria 4613
1313 Ga0501084_0318848 3300054114 Bacteria 1313
1314 Ga0501084_0425202 3300054114 Bacteria 1123
1315 Ga0501084_0540056 3300054114 Bacteria 985
1316 Ga0501084_0863401 3300054114 Bacteria 761
1317 Ga0501084_1043279 3300054114 Bacteria 687
1318 Ga0501084_1214317 3300054114 Bacteria 632
1319 Ga0501084_1331957 3300054114 Bacteria 602
1320 Ga0501084_1551807 3300054114 Bacteria 554
1321 Ga0587088_130745 3300059508 Bacteria 590
1322 Ga0587068_110313 3300059641 Bacteria 587
1323 Ga0501082_0006649 3300060353 Bacteria 10004
1324 Ga0501082_0016167 3300060353 Bacteria 6421
1325 Ga0501082_0028296 3300060353 Bacteria 4830
1326 Ga0501082_0153547 3300060353 Bacteria 2000
1327 Ga0501082_0175464 3300060353 Bacteria 1863
1328 Ga0501082_0201294 3300060353 Bacteria 1732
1329 Ga0501082_0294964 3300060353 Bacteria 1412
1330 Ga0501082_0321173 3300060353 Bacteria 1349
1331 Ga0501082_0397747 3300060353 Bacteria 1202
1332 Ga0501082_0476446 3300060353 Bacteria 1091
1333 Ga0501082_1495677 3300060353 Bacteria 590
1334 Ga0530510_0447622 3300061734 Bacteria 976

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3004289098 3004292461 77
2 iso_pu_bacteria 2503198000 2503203262 79
3 iso_pu_bacteria 2937843397 2937846817 79
4 iso_pu_bacteria 3000017691 3000019832 79
5 iso_pu_bacteria 8054563764 8054564132 79
6 3300049583 Ga0501067_0002093 Ga0501067_0002093_8272_8514 80
7 3300049590 Ga0501074_0846314 Ga0501074_0846314_193_435 80
8 3300049592 Ga0501076_0357653 Ga0501076_0357653_473_715 80
9 3300049741 Ga0501079_0877373 Ga0501079_0877373_117_359 80
10 3300049744 Ga0501083_0061019 Ga0501083_0061019_1339_1581 80
11 3300054114 Ga0501084_0029187 Ga0501084_0029187_804_1046 80
12 3300054114 Ga0501084_0540056 Ga0501084_0540056_266_520 80
13 3300060353 Ga0501082_0016167 Ga0501082_0016167_3916_4158 80
14 3300061734 Ga0530510_0447622 Ga0530510_0447622_494_736 80
15 iso_pu_bacteria 2510917022 2511137065 80
16 iso_pu_bacteria 2524023209 2524460613 80
17 iso_pu_bacteria 2582581307 2585273225 80
18 iso_pu_bacteria 2582581316 2585329605 80
19 iso_pu_bacteria 2585427531 2585559475 80
20 iso_pu_bacteria 2585427609 2585905149 80
21 iso_pu_bacteria 2585428125 2587979736 80
22 iso_pu_bacteria 2615840698 2616553973 80
23 iso_pu_bacteria 2617270742 2617386742 80
24 iso_pu_bacteria 2643221582 2643918747 80
25 iso_pu_bacteria 2757320392 2757571746 80
26 iso_pu_bacteria 2765235802 2765465230 80
27 iso_pu_bacteria 2775506902 2776271915 80
28 iso_pu_bacteria 2775506904 2776279568 80
29 iso_pu_bacteria 2842298080 2842302417 80
30 iso_pu_bacteria 2842357229 2842360850 80
31 iso_pu_bacteria 2842482326 2842482884 80
32 iso_pu_bacteria 2842509118 2842509758 80
33 iso_pu_bacteria 2891373044 2891376994 80
34 iso_pu_bacteria 2904578770 2904581400 80
35 iso_pu_bacteria 2919119836 2919122636 80
36 iso_pu_bacteria 2937822353 2937829324 80
37 iso_pu_bacteria 3002141150 3002143370 80
38 iso_pu_bacteria 8003570095 8003570614 80
39 iso_pu_bacteria 8024486573 8024489725 80
40 3300013306 Ga0163162_10021032 Ga0163162_100210323 81
41 3300046616 Ga0495668_0634570 Ga0495668_0634570_25_270 81
42 iso_pu_bacteria 2508501123 2509116523 81
43 iso_pu_bacteria 2508501127 2509141442 81
44 iso_pu_bacteria 2509276018 2509371799 81
45 iso_pu_bacteria 2509276022 2509397694 81
46 iso_pu_bacteria 2510065059 2510318948 81
47 iso_pu_bacteria 2512875016 2512929854 81
48 iso_pu_bacteria 2512875024 2512964629 81
49 iso_pu_bacteria 2513237164 2514033271 81
50 iso_pu_bacteria 2513237305 2514418483 81
51 iso_pu_bacteria 2534681786 2535484444 81
52 iso_pu_bacteria 2582581308 2585278940 81
53 iso_pu_bacteria 2582581315 2585325445 81
54 iso_pu_bacteria 2585427527 2585530737 81
55 iso_pu_bacteria 2585427530 2585554917 81
56 iso_pu_bacteria 2585427608 2585902146 81
57 iso_pu_bacteria 2588253730 2588515450 81
58 iso_pu_bacteria 2597489875 2597814985 81
59 iso_pu_bacteria 2615840626 2616305787 81
60 iso_pu_bacteria 2643221595 2643985308 81
61 iso_pu_bacteria 2643221627 2644155056 81
62 iso_pu_bacteria 2667528174 2671115273 81
63 iso_pu_bacteria 2687453392 2688600100 81
64 iso_pu_bacteria 2693429783 2694633634 81
65 iso_pu_bacteria 2693429784 2694640027 81
66 iso_pu_bacteria 2721755686 2723577340 81
67 iso_pu_bacteria 2751185800 2753359010 81
68 iso_pu_bacteria 2756170246 2756673340 81
69 iso_pu_bacteria 2758568016 2758641247 81
70 iso_pu_bacteria 2775507266 2778177518 81
71 iso_pu_bacteria 2791355123 2792749084 81
72 iso_pu_bacteria 2818991448 2819611563 81
73 iso_pu_bacteria 2818991453 2819639216 81
74 iso_pu_bacteria 2838029111 2838031462 81
75 iso_pu_bacteria 2838736955 2838741191 81
76 iso_pu_bacteria 2841840854 2841844912 81
77 iso_pu_bacteria 2842140634 2842144634 81
78 iso_pu_bacteria 2842475841 2842477942 81
79 iso_pu_bacteria 2842502639 2842504751 81
80 iso_pu_bacteria 2844002411 2844005799 81
81 iso_pu_bacteria 2844009547 2844015411 81
82 iso_pu_bacteria 2847670302 2847671771 81
83 iso_pu_bacteria 2852387548 2852389111 81
84 iso_pu_bacteria 2854896431 2854897218 81
85 iso_pu_bacteria 2854911287 2854914529 81
86 iso_pu_bacteria 2856314179 2856318499 81
87 iso_pu_bacteria 2856320880 2856324445 81
88 iso_pu_bacteria 2856328259 2856333353 81
89 iso_pu_bacteria 2856334872 2856337564 81
90 iso_pu_bacteria 2856342000 2856346849 81
91 iso_pu_bacteria 2857349434 2857355915 81
92 iso_pu_bacteria 2857367948 2857368651 81
93 iso_pu_bacteria 2869162929 2869164983 81
94 iso_pu_bacteria 2869169390 2869174810 81
95 iso_pu_bacteria 2869234852 2869239383 81
96 iso_pu_bacteria 2869242130 2869247650 81
97 iso_pu_bacteria 2869249662 2869252501 81
98 iso_pu_bacteria 2869256925 2869260219 81
99 iso_pu_bacteria 2869264136 2869268891 81
100 iso_pu_bacteria 2869271264 2869271716 81
101 iso_pu_bacteria 2869278585 2869281559 81
102 iso_pu_bacteria 2871435913 2871437060 81
103 iso_pu_bacteria 2871451962 2871455188 81
104 iso_pu_bacteria 2871459585 2871462232 81
105 iso_pu_bacteria 2871466892 2871468827 81
106 iso_pu_bacteria 2871481445 2871488413 81
107 iso_pu_bacteria 2874109183 2874113402 81
108 iso_pu_bacteria 2874116593 2874120081 81
109 iso_pu_bacteria 2874123672 2874127507 81
110 iso_pu_bacteria 2874131515 2874138806 81
111 iso_pu_bacteria 2874139085 2874140779 81
112 iso_pu_bacteria 2874162495 2874163434 81
113 iso_pu_bacteria 2874168670 2874175490 81
114 iso_pu_bacteria 2876363079 2876366583 81
115 iso_pu_bacteria 2876386047 2876388146 81
116 iso_pu_bacteria 2876399893 2876401250 81
117 iso_pu_bacteria 2876406927 2876409293 81
118 iso_pu_bacteria 2876420981 2876424613 81
119 iso_pu_bacteria 2878035449 2878037835 81
120 iso_pu_bacteria 2878730984 2878734023 81
121 iso_pu_bacteria 2878738818 2878742558 81
122 iso_pu_bacteria 2878774303 2878779899 81
123 iso_pu_bacteria 2878781027 2878785845 81
124 iso_pu_bacteria 2882632389 2882635088 81
125 iso_pu_bacteria 2885312484 2885316426 81
126 iso_pu_bacteria 2888337043 2888341266 81
127 iso_pu_bacteria 2888343758 2888348460 81
128 iso_pu_bacteria 2899803654 2899803810 81
129 iso_pu_bacteria 2903448605 2903452757 81
130 iso_pu_bacteria 2903513507 2903518819 81
131 iso_pu_bacteria 2903521522 2903524451 81
132 iso_pu_bacteria 2903528002 2903530081 81
133 iso_pu_bacteria 2906363423 2906367895 81
134 iso_pu_bacteria 2906370794 2906372651 81
135 iso_pu_bacteria 2906386501 2906389836 81
136 iso_pu_bacteria 2906393657 2906394895 81
137 iso_pu_bacteria 2906401398 2906406818 81
138 iso_pu_bacteria 2906408224 2906412858 81
139 iso_pu_bacteria 2906414383 2906418536 81
140 iso_pu_bacteria 2906427513 2906431592 81
141 iso_pu_bacteria 2919408235 2919409344 81
142 iso_pu_bacteria 2922151315 2922157930 81
143 iso_pu_bacteria 2922172374 2922176839 81
144 iso_pu_bacteria 2922178524 2922184697 81
145 iso_pu_bacteria 2924710171 2924711539 81
146 iso_pu_bacteria 2924733363 2924735351 81
147 iso_pu_bacteria 2924741084 2924742338 81
148 iso_pu_bacteria 2924748358 2924754554 81
149 iso_pu_bacteria 2924754689 2924756813 81
150 iso_pu_bacteria 2924762789 2924764672 81
151 iso_pu_bacteria 2924776078 2924780358 81
152 iso_pu_bacteria 2937848649 2937852379 81
153 iso_pu_bacteria 2937861824 2937862560 81
154 iso_pu_bacteria 2937868953 2937875458 81
155 iso_pu_bacteria 2937877337 2937882881 81
156 iso_pu_bacteria 2937972304 2937973148 81
157 iso_pu_bacteria 2937980651 2937984655 81
158 iso_pu_bacteria 2958034702 2958037520 81
159 iso_pu_bacteria 2958041894 2958047232 81
160 iso_pu_bacteria 2958064165 2958068704 81
161 iso_pu_bacteria 2958084443 2958090006 81
162 iso_pu_bacteria 2958108152 2958110503 81
163 iso_pu_bacteria 2958122699 2958123517 81
164 iso_pu_bacteria 2958137437 2958142351 81
165 iso_pu_bacteria 2958144490 2958151298 81
166 iso_pu_bacteria 2958158011 2958160052 81
167 iso_pu_bacteria 2961136820 2961144480 81
168 iso_pu_bacteria 2961183825 2961189984 81
169 iso_pu_bacteria 2963644680 2963649378 81
170 iso_pu_bacteria 2965025482 2965030625 81
171 iso_pu_bacteria 2965032056 2965037754 81
172 iso_pu_bacteria 2965040258 2965046882 81
173 iso_pu_bacteria 2965047637 2965050893 81
174 iso_pu_bacteria 2965089291 2965095911 81
175 iso_pu_bacteria 2965102966 2965108034 81
176 iso_pu_bacteria 2965110997 2965111246 81
177 iso_pu_bacteria 2968016561 2968019645 81
178 iso_pu_bacteria 2968083720 2968084538 81
179 iso_pu_bacteria 2968138860 2968144111 81
180 iso_pu_bacteria 2970469710 2970472966 81
181 iso_pu_bacteria 2970489779 2970492111 81
182 iso_pu_bacteria 2970510686 2970512547 81
183 iso_pu_bacteria 2970524798 2970529737 81
184 iso_pu_bacteria 2970532167 2970532395 81
185 iso_pu_bacteria 2970540015 2970541867 81
186 iso_pu_bacteria 2970547951 2970551076 81
187 iso_pu_bacteria 2970593180 2970596162 81
188 iso_pu_bacteria 2970619444 2970621647 81
189 iso_pu_bacteria 2970627176 2970627405 81
190 iso_pu_bacteria 2977828996 2977829332 81
191 iso_pu_bacteria 2977851361 2977854049 81
192 iso_pu_bacteria 2977858184 2977861680 81
193 iso_pu_bacteria 2977872689 2977876162 81
194 iso_pu_bacteria 2977898635 2977902840 81
195 iso_pu_bacteria 2977907340 2977915035 81
196 iso_pu_bacteria 2977915119 2977917724 81
197 iso_pu_bacteria 2977922695 2977927199 81
198 iso_pu_bacteria 2977935797 2977937041 81
199 iso_pu_bacteria 2977950692 2977956671 81
200 iso_pu_bacteria 2977957713 2977960775 81
201 iso_pu_bacteria 2977986579 2977990545 81
202 iso_pu_bacteria 2979772303 2979777379 81
203 iso_pu_bacteria 2979793036 2979797798 81
204 iso_pu_bacteria 2987636660 2987639729 81
205 iso_pu_bacteria 2987645492 2987648438 81
206 iso_pu_bacteria 2987666974 2987667475 81
207 iso_pu_bacteria 2987673487 2987674712 81
208 iso_pu_bacteria 2996348954 2996351913 81
209 iso_pu_bacteria 2996386984 2996392398 81
210 iso_pu_bacteria 3000135777 3000141816 81
211 iso_pu_bacteria 3004167301 3004170864 81
212 iso_pu_bacteria 3004195979 3004197332 81
213 iso_pu_bacteria 3004203850 3004207302 81
214 iso_pu_bacteria 3004211236 3004214670 81
215 iso_pu_bacteria 3004218560 3004219353 81
216 iso_pu_bacteria 3004232784 3004235602 81
217 iso_pu_bacteria 3004239961 3004247405 81
218 iso_pu_bacteria 3004248173 3004251214 81
219 iso_pu_bacteria 3004268573 3004272192 81
220 iso_pu_bacteria 3004275668 3004278611 81
221 iso_pu_bacteria 3005416602 3005417174 81
222 iso_pu_bacteria 637000159 637079597 81
223 iso_pu_bacteria 649633066 649874577 81
224 iso_pu_bacteria 8004300914 8004307084 81
225 iso_pu_bacteria 8004312739 8004319406 81
226 iso_pu_bacteria 8004361976 8004369376 81
227 iso_pu_bacteria 8004445564 8004446578 81
228 iso_pu_bacteria 8004695233 8004700116 81
229 iso_pu_bacteria 8004727605 8004731358 81
230 iso_pu_bacteria 8005314921 8005315235 81
231 iso_pu_bacteria 8005484373 8005485595 81
232 iso_pu_bacteria 8005645114 8005649881 81
233 iso_pu_bacteria 8005682033 8005684534 81
234 iso_pu_bacteria 8018150411 8018152521 81
235 iso_pu_bacteria 8046767195 8046767710 81
236 iso_pu_bacteria 8054558443 8054562080 81
237 iso_pu_bacteria 8055617313 8055622671 81
238 iso_pu_bacteria 8057575449 8057582164 81
239 3300048912 Ga0496109_1903835 Ga0496109_1903835_43_297 82
240 iso_pu_bacteria 2508501122 2509108556 82
241 iso_pu_bacteria 2509276019 2509374417 82
242 iso_pu_bacteria 2510065057 2510307209 82
243 iso_pu_bacteria 2511231052 2511501057 82
244 iso_pu_bacteria 2512047086 2512532465 82
245 iso_pu_bacteria 2512875026 2512972196 82
246 iso_pu_bacteria 2513237086 2513582832 82
247 iso_pu_bacteria 2513237089 2513603275 82
248 iso_pu_bacteria 2513237091 2513618987 82
249 iso_pu_bacteria 2513237140 2513881056 82
250 iso_pu_bacteria 2513237143 2513902292 82
251 iso_pu_bacteria 2513237156 2513983881 82
252 iso_pu_bacteria 2513237159 2514001920 82
253 iso_pu_bacteria 2513237160 2514004730 82
254 iso_pu_bacteria 2515154107 2515608167 82
255 iso_pu_bacteria 2516143018 2516208918 82
256 iso_pu_bacteria 2516653046 2516892338 82
257 iso_pu_bacteria 2517487022 2517569138 82
258 iso_pu_bacteria 2524023207 2524451095 82
259 iso_pu_bacteria 2551306084 2551680478 82
260 iso_pu_bacteria 2551306085 2551683865 82
261 iso_pu_bacteria 2551306086 2551695309 82
262 iso_pu_bacteria 2551306087 2551704081 82
263 iso_pu_bacteria 2551306089 2551709737 82
264 iso_pu_bacteria 2551306090 2551722571 82
265 iso_pu_bacteria 2551306091 2551727263 82
266 iso_pu_bacteria 2551306092 2551737883 82
267 iso_pu_bacteria 2551306093 2551743479 82
268 iso_pu_bacteria 2558860100 2558863444 82
269 iso_pu_bacteria 2582581283 2585165599 82
270 iso_pu_bacteria 2582581306 2585266125 82
271 iso_pu_bacteria 2582581865 2585387125 82
272 iso_pu_bacteria 2582581866 2585392755 82
273 iso_pu_bacteria 2599185156 2599333723 82
274 iso_pu_bacteria 2599185352 2600191974 82
275 iso_pu_bacteria 2643221557 2643807161 82
276 iso_pu_bacteria 2643221607 2644046523 82
277 iso_pu_bacteria 2643221610 2644069573 82
278 iso_pu_bacteria 2643221618 2644108951 82
279 iso_pu_bacteria 2643221626 2644151473 82
280 iso_pu_bacteria 2643221636 2644202229 82
281 iso_pu_bacteria 2643221655 2644311607 82
282 iso_pu_bacteria 2643221659 2644329865 82
283 iso_pu_bacteria 2643221668 2644380543 82
284 iso_pu_bacteria 2643221675 2644420727 82
285 iso_pu_bacteria 2643221680 2644454252 82
286 iso_pu_bacteria 2643221686 2644479313 82
287 iso_pu_bacteria 2643221689 2644502361 82
288 iso_pu_bacteria 2643221698 2644546539 82
289 iso_pu_bacteria 2643221712 2644617406 82
290 iso_pu_bacteria 2643221723 2644675608 82
291 iso_pu_bacteria 2643221726 2644689589 82
292 iso_pu_bacteria 2657244999 2657683224 82
293 iso_pu_bacteria 2690316117 2692316786 82
294 iso_pu_bacteria 2751185821 2753460846 82
295 iso_pu_bacteria 2791355082 2792584203 82
296 iso_pu_bacteria 2791355091 2792622646 82
297 iso_pu_bacteria 2791355092 2792628433 82
298 iso_pu_bacteria 2791355094 2792638306 82
299 iso_pu_bacteria 2791355253 2793282341 82
300 iso_pu_bacteria 2802428858 2802717782 82
301 iso_pu_bacteria 2802428859 2802723289 82
302 iso_pu_bacteria 2802428860 2802733152 82
303 iso_pu_bacteria 2802428861 2802736266 82
304 iso_pu_bacteria 2802428862 2802743524 82
305 iso_pu_bacteria 2802428863 2802750763 82
306 iso_pu_bacteria 2802429268 2804751387 82
307 iso_pu_bacteria 2838074704 2838076481 82
308 iso_pu_bacteria 2842521101 2842526308 82
309 iso_pu_bacteria 2842922631 2842924839 82
310 iso_pu_bacteria 2844163670 2844168475 82
311 iso_pu_bacteria 2847417321 2847418148 82
312 iso_pu_bacteria 2848992105 2848993123 82
313 iso_pu_bacteria 2850079185 2850080517 82
314 iso_pu_bacteria 2855825444 2855831410 82
315 iso_pu_bacteria 2855839649 2855840534 82
316 iso_pu_bacteria 2855872281 2855878898 82
317 iso_pu_bacteria 2858800743 2858801062 82
318 iso_pu_bacteria 2896384573 2896386681 82
319 iso_pu_bacteria 2913295892 2913297405 82
320 iso_pu_bacteria 2915980308 2915986262 82
321 iso_pu_bacteria 2915986958 2915988466 82
322 iso_pu_bacteria 2915993759 2915996173 82
323 iso_pu_bacteria 2916000859 2916002078 82
324 iso_pu_bacteria 2916007675 2916014019 82
325 iso_pu_bacteria 2916014648 2916015411 82
326 iso_pu_bacteria 2916021584 2916025139 82
327 iso_pu_bacteria 2916028427 2916032624 82
328 iso_pu_bacteria 2916035215 2916040263 82
329 iso_pu_bacteria 2916041962 2916042458 82
330 iso_pu_bacteria 2916048683 2916052551 82
331 iso_pu_bacteria 2916055098 2916055272 82
332 iso_pu_bacteria 2916061851 2916062912 82
333 iso_pu_bacteria 2916068649 2916076100 82
334 iso_pu_bacteria 2916076590 2916077632 82
335 iso_pu_bacteria 2920760137 2920762835 82
336 iso_pu_bacteria 2920822456 2920823885 82
337 iso_pu_bacteria 2921201388 2921204353 82
338 iso_pu_bacteria 2921208531 2921209985 82
339 iso_pu_bacteria 2921237296 2921240058 82
340 iso_pu_bacteria 2921244191 2921246181 82
341 iso_pu_bacteria 2921250672 2921251043 82
342 iso_pu_bacteria 2921257292 2921257872 82
343 iso_pu_bacteria 2921263974 2921264149 82
344 iso_pu_bacteria 2921282425 2921286234 82
345 iso_pu_bacteria 2921289301 2921294844 82
346 iso_pu_bacteria 2921296804 2921299759 82
347 iso_pu_bacteria 2924144063 2924146600 82
348 iso_pu_bacteria 2924150972 2924151184 82
349 iso_pu_bacteria 2924158325 2924160661 82
350 iso_pu_bacteria 2924165586 2924171699 82
351 iso_pu_bacteria 2924172951 2924177538 82
352 iso_pu_bacteria 2924179722 2924185904 82
353 iso_pu_bacteria 2924186466 2924187089 82
354 iso_pu_bacteria 2924193448 2924198150 82
355 iso_pu_bacteria 2924200457 2924203007 82
356 iso_pu_bacteria 2924207177 2924212646 82
357 iso_pu_bacteria 2924214083 2924220180 82
358 iso_pu_bacteria 2924221636 2924226748 82
359 iso_pu_bacteria 2924228884 2924230277 82
360 iso_pu_bacteria 2936996657 2937001015 82
361 iso_pu_bacteria 2937002841 2937004303 82
362 iso_pu_bacteria 2937009748 2937011056 82
363 iso_pu_bacteria 2937016420 2937019388 82
364 iso_pu_bacteria 2937023124 2937028488 82
365 iso_pu_bacteria 2937029754 2937029777 82
366 iso_pu_bacteria 2937036028 2937036803 82
367 iso_pu_bacteria 2937042894 2937048331 82
368 iso_pu_bacteria 2937049772 2937052063 82
369 iso_pu_bacteria 2937056579 2937059159 82
370 iso_pu_bacteria 2937063883 2937067853 82
371 iso_pu_bacteria 2937071275 2937073956 82
372 iso_pu_bacteria 2937078374 2937082883 82
373 iso_pu_bacteria 2937084907 2937090513 82
374 iso_pu_bacteria 2937091812 2937095677 82
375 iso_pu_bacteria 2937098957 2937104130 82
376 iso_pu_bacteria 2937106411 2937110747 82
377 iso_pu_bacteria 2937113482 2937113954 82
378 iso_pu_bacteria 2937119839 2937125451 82
379 iso_pu_bacteria 2937126314 2937129019 82
380 iso_pu_bacteria 2941499720 2941500174 82
381 iso_pu_bacteria 2957375807 2957379936 82
382 iso_pu_bacteria 2957382221 2957385815 82
383 iso_pu_bacteria 2957388812 2957389044 82
384 iso_pu_bacteria 2957395598 2957398348 82
385 iso_pu_bacteria 2957402308 2957407521 82
386 iso_pu_bacteria 2957408893 2957411627 82
387 iso_pu_bacteria 2957415311 2957418896 82
388 iso_pu_bacteria 2957422303 2957423188 82
389 iso_pu_bacteria 2957430029 2957432526 82
390 iso_pu_bacteria 2957437181 2957438783 82
391 iso_pu_bacteria 2957443900 2957446508 82
392 iso_pu_bacteria 2957450854 2957456600 82
393 iso_pu_bacteria 2957457609 2957463326 82
394 iso_pu_bacteria 2957464669 2957466645 82
395 iso_pu_bacteria 2957471148 2957473160 82
396 iso_pu_bacteria 2957478035 2957479932 82
397 iso_pu_bacteria 2957484790 2957485735 82
398 iso_pu_bacteria 2957491536 2957496242 82
399 iso_pu_bacteria 2957498199 2957505367 82
400 iso_pu_bacteria 2957505466 2957506173 82
401 iso_pu_bacteria 2960584000 2960588746 82
402 iso_pu_bacteria 2960591022 2960595662 82
403 iso_pu_bacteria 2960597568 2960601619 82
404 iso_pu_bacteria 2960603979 2960608575 82
405 iso_pu_bacteria 2960610863 2960617357 82
406 iso_pu_bacteria 2960617483 2960617788 82
407 iso_pu_bacteria 2960624210 2960625342 82
408 iso_pu_bacteria 2960631154 2960633136 82
409 iso_pu_bacteria 2960637947 2960643177 82
410 iso_pu_bacteria 2960645483 2960645884 82
411 iso_pu_bacteria 2960652885 2960658023 82
412 iso_pu_bacteria 2960660292 2960666492 82
413 iso_pu_bacteria 2960667422 2960668679 82
414 iso_pu_bacteria 2960674078 2960676939 82
415 iso_pu_bacteria 2960680706 2960684251 82
416 iso_pu_bacteria 2960687367 2960687704 82
417 iso_pu_bacteria 2960693952 2960696779 82
418 iso_pu_bacteria 2964607997 2964608719 82
419 iso_pu_bacteria 2964615318 2964616345 82
420 iso_pu_bacteria 2964621998 2964628880 82
421 iso_pu_bacteria 2964628898 2964635396 82
422 iso_pu_bacteria 2964636051 2964642552 82
423 iso_pu_bacteria 2964643177 2964646938 82
424 iso_pu_bacteria 2964649959 2964656323 82
425 iso_pu_bacteria 2964656573 2964659210 82
426 iso_pu_bacteria 2964663802 2964665563 82
427 iso_pu_bacteria 2964670856 2964674954 82
428 iso_pu_bacteria 2964678106 2964679398 82
429 iso_pu_bacteria 2964685014 2964685506 82
430 iso_pu_bacteria 2964691889 2964692126 82
431 iso_pu_bacteria 2964698721 2964703505 82
432 iso_pu_bacteria 2964705432 2964705906 82
433 iso_pu_bacteria 2964712639 2964714329 82
434 iso_pu_bacteria 2964719344 2964720826 82
435 iso_pu_bacteria 2967664464 2967668692 82
436 iso_pu_bacteria 2967671571 2967677126 82
437 iso_pu_bacteria 2967678726 2967681131 82
438 iso_pu_bacteria 2967686174 2967687123 82
439 iso_pu_bacteria 2967693043 2967693333 82
440 iso_pu_bacteria 2967699805 2967701242 82
441 iso_pu_bacteria 2967706974 2967714300 82
442 iso_pu_bacteria 2967714385 2967716441 82
443 iso_pu_bacteria 2967721400 2967723341 82
444 iso_pu_bacteria 2967728569 2967734645 82
445 iso_pu_bacteria 2967735183 2967735531 82
446 iso_pu_bacteria 2967742019 2967742755 82
447 iso_pu_bacteria 2967748971 2967754518 82
448 iso_pu_bacteria 2967755722 2967756982 82
449 iso_pu_bacteria 2967762386 2967764519 82
450 iso_pu_bacteria 2967769361 2967771693 82
451 iso_pu_bacteria 2967775926 2967776714 82
452 iso_pu_bacteria 2970019648 2970020526 82
453 iso_pu_bacteria 2970026789 2970032666 82
454 iso_pu_bacteria 2970033650 2970035745 82
455 iso_pu_bacteria 2970040964 2970041626 82
456 iso_pu_bacteria 2970047711 2970050494 82
457 iso_pu_bacteria 2970054988 2970057907 82
458 iso_pu_bacteria 2970061556 2970067773 82
459 iso_pu_bacteria 2970068827 2970075522 82
460 iso_pu_bacteria 2970076120 2970081382 82
461 iso_pu_bacteria 2970082768 2970085362 82
462 iso_pu_bacteria 2970088815 2970091626 82
463 iso_pu_bacteria 2970095765 2970100942 82
464 iso_pu_bacteria 2970102677 2970105088 82
465 iso_pu_bacteria 2970109326 2970114574 82
466 iso_pu_bacteria 2970116247 2970122595 82
467 iso_pu_bacteria 2970122695 2970124369 82
468 iso_pu_bacteria 2970129317 2970129605 82
469 iso_pu_bacteria 2970136068 2970137311 82
470 iso_pu_bacteria 2970143518 2970144462 82
471 iso_pu_bacteria 2970149975 2970155814 82
472 iso_pu_bacteria 2970156795 2970159800 82
473 iso_pu_bacteria 2970164137 2970166836 82
474 iso_pu_bacteria 2970170962 2970176013 82
475 iso_pu_bacteria 2970177841 2970182249 82
476 iso_pu_bacteria 2970184632 2970190902 82
477 iso_pu_bacteria 2970191845 2970194293 82
478 iso_pu_bacteria 2977516862 2977517985 82
479 iso_pu_bacteria 2977523885 2977529791 82
480 iso_pu_bacteria 2977530762 2977531988 82
481 iso_pu_bacteria 2977537788 2977538075 82
482 iso_pu_bacteria 2977544691 2977546004 82
483 iso_pu_bacteria 2977551784 2977552075 82
484 iso_pu_bacteria 2977558990 2977562796 82
485 iso_pu_bacteria 2977565890 2977566300 82
486 iso_pu_bacteria 2977572785 2977576520 82
487 iso_pu_bacteria 2977579622 2977585717 82
488 iso_pu_bacteria 643692032 643825123 82
489 iso_pu_bacteria 648276728 648736452 82
490 iso_pu_bacteria 8003992118 8003993033 82
491 iso_pu_bacteria 8003999396 8004000272 82
492 iso_pu_bacteria 8049293176 8049293961 82
493 2010549000 RicEn_C5265 RicEn_93940 83
494 3300001979 JGI24740J21852_10000075 JGI24740J21852_100000752 83
495 3300001979 JGI24740J21852_10008525 JGI24740J21852_100085252 83
496 3300002704 JGI25155J39150_1000032 JGI25155J39150_100003224 83
497 3300002705 JGI25156J39149_1000129 JGI25156J39149_100012924 83
498 3300002705 JGI25156J39149_1005548 JGI25156J39149_10055483 83
499 3300002737 JGI25162J39368_1001169 JGI25162J39368_100116918 83
500 3300002737 JGI25162J39368_1001727 JGI25162J39368_100172711 83
501 3300002737 JGI25162J39368_1003463 JGI25162J39368_10034636 83
502 3300002738 JGI25154J39366_1000324 JGI25154J39366_10003244 83
503 3300002739 JGI25158J39367_1000210 JGI25158J39367_10002108 83
504 3300002741 JGI25157J39369_1000061 JGI25157J39369_100006124 83
505 3300002741 JGI25157J39369_1000624 JGI25157J39369_100062418 83
506 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002191 83
507 3300002987 JGI25159J45721_1000136 JGI25159J45721_100013626 83
508 3300002987 JGI25159J45721_1004812 JGI25159J45721_10048121 83
509 3300003187 JGI25151J46595_10025237 JGI25151J46595_100252372 83
510 3300003187 JGI25151J46595_10034315 JGI25151J46595_100343153 83
511 3300003187 JGI25151J46595_10077075 JGI25151J46595_100770752 83
512 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028141 83
513 3300003214 JGI25165J46597_1000630 JGI25165J46597_100063021 83
514 3300003214 JGI25165J46597_1000944 JGI25165J46597_100094418 83
515 3300003320 rootH2_10025055 rootH2_100250557 83
516 3300003322 rootL2_10082663 rootL2_100826633 83
517 3300003323 rootH1_10117768 rootH1_101177683 83
518 3300003323 rootH1_10117786 rootH1_101177863 83
519 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008191 83
520 3300003354 JGI25160J50197_1000015 JGI25160J50197_100001537 83
521 3300003354 JGI25160J50197_1000191 JGI25160J50197_100019127 83
522 3300003354 JGI25160J50197_1023350 JGI25160J50197_10233503 83
523 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005204 83
524 3300003374 JGI25161J50226_1000489 JGI25161J50226_100048911 83
525 3300003374 JGI25161J50226_1000704 JGI25161J50226_10007049 83
526 3300003578 Ga0006562J51391_1007860 Ga0006562J51391_10078603 83
527 3300003578 Ga0006562J51391_1097928 Ga0006562J51391_10979282 83
528 3300003752 Ga0055539_1014217 Ga0055539_10142172 83
529 3300003762 Ga0055542_1000989 Ga0055542_10009892 83
530 3300003763 Ga0055529_1002302 Ga0055529_10023025 83
531 3300003771 Ga0055526_1001505 Ga0055526_100150513 83
532 3300003771 Ga0055526_1013003 Ga0055526_10130032 83
533 3300003771 Ga0055526_1043655 Ga0055526_10436552 83
534 3300003771 Ga0055526_1063506 Ga0055526_10635062 83
535 3300003775 Ga0055524_1001479 Ga0055524_100147911 83
536 3300003775 Ga0055524_1007611 Ga0055524_10076117 83
537 3300003775 Ga0055524_1009931 Ga0055524_10099314 83
538 3300003775 Ga0055524_1023880 Ga0055524_10238803 83
539 3300003775 Ga0055524_1040839 Ga0055524_10408392 83
540 3300003781 Ga0055536_1000984 Ga0055536_100098410 83
541 3300003790 Ga0055528_1000460 Ga0055528_10004607 83
542 3300003790 Ga0055528_1005249 Ga0055528_10052493 83
543 3300003790 Ga0055528_1026969 Ga0055528_10269693 83
544 3300003790 Ga0055528_1090666 Ga0055528_10906661 83
545 3300003794 Ga0055531_10017167 Ga0055531_100171675 83
546 3300004625 Ga0055543_1000012 Ga0055543_100001238 83
547 3300004625 Ga0055543_1000040 Ga0055543_100004051 83
548 3300004625 Ga0055543_1001749 Ga0055543_10017493 83
549 3300005262 Ga0065165_1000015 Ga0065165_1000015192 83
550 3300005262 Ga0065165_1000095 Ga0065165_100009515 83
551 3300005262 Ga0065165_1000125 Ga0065165_1000125103 83
552 3300005262 Ga0065165_1003558 Ga0065165_100355811 83
553 3300005262 Ga0065165_1061053 Ga0065165_10610532 83
554 3300005262 Ga0065165_1112062 Ga0065165_11120621 83
555 3300005327 Ga0070658_11449349 Ga0070658_114493491 83
556 3300005330 Ga0070690_100054478 Ga0070690_1000544784 83
557 3300005330 Ga0070690_100723783 Ga0070690_1007237831 83
558 3300005331 Ga0070670_100009220 Ga0070670_1000092203 83
559 3300005331 Ga0070670_100656590 Ga0070670_1006565902 83
560 3300005331 Ga0070670_100829185 Ga0070670_1008291852 83
561 3300005334 Ga0068869_100804422 Ga0068869_1008044222 83
562 3300005334 Ga0068869_101297975 Ga0068869_1012979752 83
563 3300005335 Ga0070666_10148138 Ga0070666_101481382 83
564 3300005336 Ga0070680_100716936 Ga0070680_1007169362 83
565 3300005336 Ga0070680_100909786 Ga0070680_1009097861 83
566 3300005337 Ga0070682_100292531 Ga0070682_1002925313 83
567 3300005337 Ga0070682_101026383 Ga0070682_1010263832 83
568 3300005338 Ga0068868_100295750 Ga0068868_1002957503 83
569 3300005338 Ga0068868_100834536 Ga0068868_1008345362 83
570 3300005339 Ga0070660_100055967 Ga0070660_1000559672 83
571 3300005340 Ga0070689_100014099 Ga0070689_1000140993 83
572 3300005340 Ga0070689_100602971 Ga0070689_1006029712 83
573 3300005343 Ga0070687_100002628 Ga0070687_1000026282 83
574 3300005344 Ga0070661_100375400 Ga0070661_1003754002 83
575 3300005344 Ga0070661_100714655 Ga0070661_1007146552 83
576 3300005347 Ga0070668_100167676 Ga0070668_1001676761 83
577 3300005347 Ga0070668_101217888 Ga0070668_1012178882 83
578 3300005354 Ga0070675_100104071 Ga0070675_1001040713 83
579 3300005354 Ga0070675_100714828 Ga0070675_1007148282 83
580 3300005355 Ga0070671_100078659 Ga0070671_1000786593 83
581 3300005355 Ga0070671_101750644 Ga0070671_1017506441 83
582 3300005356 Ga0070674_100117477 Ga0070674_1001174773 83
583 3300005356 Ga0070674_100990778 Ga0070674_1009907782 83
584 3300005356 Ga0070674_102154929 Ga0070674_1021549292 83
585 3300005364 Ga0070673_100837545 Ga0070673_1008375452 83
586 3300005364 Ga0070673_101814591 Ga0070673_1018145912 83
587 3300005364 Ga0070673_102034949 Ga0070673_1020349491 83
588 3300005365 Ga0070688_100116761 Ga0070688_1001167612 83
589 3300005366 Ga0070659_100315195 Ga0070659_1003151953 83
590 3300005366 Ga0070659_100749590 Ga0070659_1007495902 83
591 3300005367 Ga0070667_100136430 Ga0070667_1001364302 83
592 3300005367 Ga0070667_100750264 Ga0070667_1007502641 83
593 3300005367 Ga0070667_101115791 Ga0070667_1011157912 83
594 3300005367 Ga0070667_101470175 Ga0070667_1014701752 83
595 3300005367 Ga0070667_101576079 Ga0070667_1015760792 83
596 3300005441 Ga0070700_100300835 Ga0070700_1003008351 83
597 3300005445 Ga0070708_101173899 Ga0070708_1011738992 83
598 3300005455 Ga0070663_100038200 Ga0070663_1000382003 83
599 3300005455 Ga0070663_100052068 Ga0070663_1000520683 83
600 3300005455 Ga0070663_100054895 Ga0070663_1000548953 83
601 3300005455 Ga0070663_100349623 Ga0070663_1003496232 83
602 3300005455 Ga0070663_100862676 Ga0070663_1008626761 83
603 3300005455 Ga0070663_101806730 Ga0070663_1018067302 83
604 3300005456 Ga0070678_100022607 Ga0070678_1000226075 83
605 3300005456 Ga0070678_100329089 Ga0070678_1003290891 83
606 3300005456 Ga0070678_100678395 Ga0070678_1006783952 83
607 3300005457 Ga0070662_100605516 Ga0070662_1006055162 83
608 3300005457 Ga0070662_101046303 Ga0070662_1010463032 83
609 3300005458 Ga0070681_10325145 Ga0070681_103251452 83
610 3300005459 Ga0068867_101568184 Ga0068867_1015681842 83
611 3300005459 Ga0068867_101869010 Ga0068867_1018690102 83
612 3300005466 Ga0070685_10637606 Ga0070685_106376062 83
613 3300005518 Ga0070699_101768060 Ga0070699_1017680601 83
614 3300005530 Ga0070679_101446866 Ga0070679_1014468662 83
615 3300005530 Ga0070679_101817761 Ga0070679_1018177612 83
616 3300005539 Ga0068853_101184563 Ga0068853_1011845632 83
617 3300005543 Ga0070672_100074617 Ga0070672_1000746172 83
618 3300005544 Ga0070686_100151471 Ga0070686_1001514711 83
619 3300005545 Ga0070695_100866056 Ga0070695_1008660562 83
620 3300005546 Ga0070696_101653125 Ga0070696_1016531252 83
621 3300005548 Ga0070665_100012057 Ga0070665_1000120578 83
622 3300005548 Ga0070665_100121404 Ga0070665_1001214044 83
623 3300005548 Ga0070665_100226673 Ga0070665_1002266732 83
624 3300005548 Ga0070665_100727811 Ga0070665_1007278112 83
625 3300005548 Ga0070665_101541354 Ga0070665_1015413541 83
626 3300005548 Ga0070665_102538616 Ga0070665_1025386161 83
627 3300005549 Ga0070704_100686395 Ga0070704_1006863952 83
628 3300005563 Ga0068855_100832466 Ga0068855_1008324662 83
629 3300005563 Ga0068855_101351368 Ga0068855_1013513682 83
630 3300005563 Ga0068855_101360002 Ga0068855_1013600022 83
631 3300005563 Ga0068855_101494603 Ga0068855_1014946032 83
632 3300005564 Ga0070664_101367996 Ga0070664_1013679962 83
633 3300005577 Ga0068857_101095070 Ga0068857_1010950702 83
634 3300005577 Ga0068857_101336963 Ga0068857_1013369631 83
635 3300005577 Ga0068857_102475825 Ga0068857_1024758252 83
636 3300005578 Ga0068854_100136143 Ga0068854_1001361434 83
637 3300005578 Ga0068854_100244926 Ga0068854_1002449263 83
638 3300005578 Ga0068854_100777584 Ga0068854_1007775842 83
639 3300005578 Ga0068854_101708401 Ga0068854_1017084012 83
640 3300005578 Ga0068854_101798367 Ga0068854_1017983672 83
641 3300005614 Ga0068856_100070458 Ga0068856_1000704582 83
642 3300005615 Ga0070702_100685868 Ga0070702_1006858682 83
643 3300005616 Ga0068852_100111240 Ga0068852_1001112405 83
644 3300005616 Ga0068852_100682644 Ga0068852_1006826441 83
645 3300005616 Ga0068852_102429860 Ga0068852_1024298602 83
646 3300005617 Ga0068859_100278386 Ga0068859_1002783862 83
647 3300005617 Ga0068859_101337119 Ga0068859_1013371192 83
648 3300005617 Ga0068859_102599594 Ga0068859_1025995941 83
649 3300005618 Ga0068864_100004815 Ga0068864_1000048153 83
650 3300005618 Ga0068864_100516260 Ga0068864_1005162603 83
651 3300005719 Ga0068861_100314578 Ga0068861_1003145783 83
652 3300005719 Ga0068861_100399749 Ga0068861_1003997493 83
653 3300005842 Ga0068858_100161184 Ga0068858_1001611843 83
654 3300005842 Ga0068858_100866151 Ga0068858_1008661512 83
655 3300005843 Ga0068860_100998293 Ga0068860_1009982932 83
656 3300005844 Ga0068862_100401566 Ga0068862_1004015662 83
657 3300005844 Ga0068862_101058033 Ga0068862_1010580332 83
658 3300005985 Ga0081539_10001131 Ga0081539_1000113119 83
659 3300006038 Ga0075365_10013889 Ga0075365_100138896 83
660 3300006038 Ga0075365_10024163 Ga0075365_100241633 83
661 3300006038 Ga0075365_10173955 Ga0075365_101739552 83
662 3300006038 Ga0075365_10356916 Ga0075365_103569162 83
663 3300006038 Ga0075365_10458027 Ga0075365_104580271 83
664 3300006038 Ga0075365_10567237 Ga0075365_105672372 83
665 3300006038 Ga0075365_10931011 Ga0075365_109310112 83
666 3300006038 Ga0075365_11335457 Ga0075365_113354572 83
667 3300006042 Ga0075368_10007739 Ga0075368_100077393 83
668 3300006042 Ga0075368_10267938 Ga0075368_102679382 83
669 3300006048 Ga0075363_100073258 Ga0075363_1000732583 83
670 3300006048 Ga0075363_100124627 Ga0075363_1001246273 83
671 3300006048 Ga0075363_100251247 Ga0075363_1002512471 83
672 3300006048 Ga0075363_101008530 Ga0075363_1010085302 83
673 3300006051 Ga0075364_10012041 Ga0075364_100120415 83
674 3300006051 Ga0075364_10553044 Ga0075364_105530442 83
675 3300006051 Ga0075364_10793323 Ga0075364_107933231 83
676 3300006177 Ga0075362_10002404 Ga0075362_1000240410 83
677 3300006177 Ga0075362_10024220 Ga0075362_100242202 83
678 3300006178 Ga0075367_10037653 Ga0075367_100376531 83
679 3300006178 Ga0075367_10054745 Ga0075367_100547454 83
680 3300006178 Ga0075367_10169458 Ga0075367_101694582 83
681 3300006178 Ga0075367_10227761 Ga0075367_102277612 83
682 3300006178 Ga0075367_10424745 Ga0075367_104247451 83
683 3300006186 Ga0075369_10006353 Ga0075369_100063534 83
684 3300006186 Ga0075369_10130104 Ga0075369_101301041 83
685 3300006186 Ga0075369_10180034 Ga0075369_101800342 83
686 3300006186 Ga0075369_10239084 Ga0075369_102390842 83
687 3300006195 Ga0075366_10213875 Ga0075366_102138752 83
688 3300006195 Ga0075366_10793893 Ga0075366_107938931 83
689 3300006237 Ga0097621_101948134 Ga0097621_1019481342 83
690 3300006237 Ga0097621_102363655 Ga0097621_1023636552 83
691 3300006353 Ga0075370_10023755 Ga0075370_100237555 83
692 3300006353 Ga0075370_10079906 Ga0075370_100799063 83
693 3300006353 Ga0075370_10267047 Ga0075370_102670473 83
694 3300006353 Ga0075370_10497113 Ga0075370_104971132 83
695 3300006358 Ga0068871_100579205 Ga0068871_1005792052 83
696 3300006358 Ga0068871_100711248 Ga0068871_1007112482 83
697 3300006844 Ga0075428_100235851 Ga0075428_1002358514 83
698 3300006881 Ga0068865_100504739 Ga0068865_1005047392 83
699 3300006881 Ga0068865_100564251 Ga0068865_1005642512 83
700 3300006881 Ga0068865_101074993 Ga0068865_1010749932 83
701 3300006931 Ga0097620_100278387 Ga0097620_1002783872 83
702 3300006931 Ga0097620_101336670 Ga0097620_1013366702 83
703 3300006931 Ga0097620_102599881 Ga0097620_1025998812 83
704 3300009011 Ga0105251_10008871 Ga0105251_100088714 83
705 3300009036 Ga0105244_10496521 Ga0105244_104965212 83
706 3300009093 Ga0105240_10000032 Ga0105240_10000032182 83
707 3300009093 Ga0105240_10381721 Ga0105240_103817213 83
708 3300009093 Ga0105240_10527204 Ga0105240_105272043 83
709 3300009094 Ga0111539_10286338 Ga0111539_102863383 83
710 3300009094 Ga0111539_11718509 Ga0111539_117185092 83
711 3300009094 Ga0111539_11918052 Ga0111539_119180522 83
712 3300009094 Ga0111539_12969398 Ga0111539_129693982 83
713 3300009098 Ga0105245_10123083 Ga0105245_101230833 83
714 3300009098 Ga0105245_11845478 Ga0105245_118454782 83
715 3300009098 Ga0105245_11854741 Ga0105245_118547412 83
716 3300009101 Ga0105247_10054813 Ga0105247_100548132 83
717 3300009101 Ga0105247_10893303 Ga0105247_108933032 83
718 3300009101 Ga0105247_11669274 Ga0105247_116692741 83
719 3300009148 Ga0105243_10250889 Ga0105243_102508892 83
720 3300009148 Ga0105243_10546312 Ga0105243_105463122 83
721 3300009148 Ga0105243_11147000 Ga0105243_111470002 83
722 3300009148 Ga0105243_11304643 Ga0105243_113046432 83
723 3300009148 Ga0105243_12052874 Ga0105243_120528742 83
724 3300009176 Ga0105242_10180889 Ga0105242_101808893 83
725 3300009176 Ga0105242_12183621 Ga0105242_121836212 83
726 3300009177 Ga0105248_10015377 Ga0105248_100153777 83
727 3300009177 Ga0105248_10335817 Ga0105248_103358172 83
728 3300009177 Ga0105248_10660482 Ga0105248_106604823 83
729 3300009177 Ga0105248_12313296 Ga0105248_123132962 83
730 3300009545 Ga0105237_10002365 Ga0105237_100023659 83
731 3300009545 Ga0105237_11856567 Ga0105237_118565671 83
732 3300009551 Ga0105238_10092726 Ga0105238_100927264 83
733 3300009553 Ga0105249_10302469 Ga0105249_103024692 83
734 3300009553 Ga0105249_10865072 Ga0105249_108650722 83
735 3300009766 Ga0123342_1042104 Ga0123342_10421043 83
736 3300010159 Ga0099796_10046910 Ga0099796_100469102 83
737 3300010375 Ga0105239_10012029 Ga0105239_1001202912 83
738 3300010375 Ga0105239_10013157 Ga0105239_100131578 83
739 3300010375 Ga0105239_11075225 Ga0105239_110752252 83
740 3300010375 Ga0105239_11341881 Ga0105239_113418811 83
741 3300010375 Ga0105239_11747489 Ga0105239_117474892 83
742 3300011119 Ga0105246_10368627 Ga0105246_103686272 83
743 3300011119 Ga0105246_10959503 Ga0105246_109595032 83
744 3300011119 Ga0105246_12592543 Ga0105246_125925431 83
745 3300012500 Ga0157314_1046160 Ga0157314_10461602 83
746 3300012503 Ga0157313_1033713 Ga0157313_10337132 83
747 3300013100 Ga0157373_10135794 Ga0157373_101357943 83
748 3300013100 Ga0157373_10777314 Ga0157373_107773142 83
749 3300013102 Ga0157371_10891306 Ga0157371_108913062 83
750 3300013104 Ga0157370_10003636 Ga0157370_1000363612 83
751 3300013104 Ga0157370_10113036 Ga0157370_101130364 83
752 3300013104 Ga0157370_10305394 Ga0157370_103053942 83
753 3300013104 Ga0157370_10694141 Ga0157370_106941412 83
754 3300013104 Ga0157370_10849273 Ga0157370_108492732 83
755 3300013105 Ga0157369_10049860 Ga0157369_100498604 83
756 3300013105 Ga0157369_10185520 Ga0157369_101855203 83
757 3300013105 Ga0157369_10199521 Ga0157369_101995212 83
758 3300013249 Ga0171463_1001 Ga0171463_1001181 83
759 3300013250 Ga0171462_1006 Ga0171462_1006247 83
760 3300013296 Ga0157374_10111656 Ga0157374_101116562 83
761 3300013296 Ga0157374_11011596 Ga0157374_110115962 83
762 3300013296 Ga0157374_12037994 Ga0157374_120379942 83
763 3300013297 Ga0157378_10256214 Ga0157378_102562142 83
764 3300013297 Ga0157378_10698258 Ga0157378_106982583 83
765 3300013297 Ga0157378_11290035 Ga0157378_112900352 83
766 3300013306 Ga0163162_10040362 Ga0163162_100403624 83
767 3300013306 Ga0163162_10226735 Ga0163162_102267353 83
768 3300013306 Ga0163162_10789499 Ga0163162_107894992 83
769 3300013307 Ga0157372_11527829 Ga0157372_115278292 83
770 3300013308 Ga0157375_11269747 Ga0157375_112697472 83
771 3300013308 Ga0157375_12450897 Ga0157375_124508972 83
772 3300013308 Ga0157375_12996842 Ga0157375_129968422 83
773 3300013308 Ga0157375_13218066 Ga0157375_132180662 83
774 3300013308 Ga0157375_13631517 Ga0157375_136315171 83
775 3300014325 Ga0163163_10559799 Ga0163163_105597993 83
776 3300014326 Ga0157380_10201489 Ga0157380_102014891 83
777 3300014326 Ga0157380_10663586 Ga0157380_106635862 83
778 3300014326 Ga0157380_11000817 Ga0157380_110008172 83
779 3300014497 Ga0182008_10055587 Ga0182008_100555873 83
780 3300014497 Ga0182008_10075376 Ga0182008_100753762 83
781 3300014497 Ga0182008_10210516 Ga0182008_102105162 83
782 3300014497 Ga0182008_10449140 Ga0182008_104491402 83
783 3300014745 Ga0157377_10354396 Ga0157377_103543962 83
784 3300014968 Ga0157379_10980218 Ga0157379_109802182 83
785 3300014968 Ga0157379_11011881 Ga0157379_110118811 83
786 3300014969 Ga0157376_10610420 Ga0157376_106104202 83
787 3300014969 Ga0157376_10850109 Ga0157376_108501092 83
788 3300014969 Ga0157376_12094137 Ga0157376_120941371 83
789 3300015262 Ga0182007_10000460 Ga0182007_1000046019 83
790 3300015265 Ga0182005_1015635 Ga0182005_10156353 83
791 3300015690 Ga0183363_1412 Ga0183363_14126 83
792 3300017792 Ga0163161_10516212 Ga0163161_105162122 83
793 3300017792 Ga0163161_10715323 Ga0163161_107153232 83
794 3300017792 Ga0163161_11229244 Ga0163161_112292441 83
795 3300017792 Ga0163161_11933006 Ga0163161_119330061 83
796 3300021320 Ga0214544_1000017 Ga0214544_1000017149 83
797 3300021321 Ga0214542_1000006 Ga0214542_100000681 83
798 3300021327 Ga0214543_1000003 Ga0214543_1000003518 83
799 3300021327 Ga0214543_1000014 Ga0214543_1000014242 83
800 3300021377 Ga0213874_10014157 Ga0213874_100141572 83
801 3300022739 Ga0228711_1000001 Ga0228711_100000124 83
802 3300022740 Ga0228710_1000001 Ga0228710_1000001301 83
803 3300024227 Ga0228598_1031096 Ga0228598_10310962 83
804 3300025206 Ga0209435_100042 Ga0209435_10004225 83
805 3300025208 Ga0209436_101739 Ga0209436_1017393 83
806 3300025228 Ga0209672_123228 Ga0209672_1232281 83
807 3300025231 Ga0207427_113132 Ga0207427_1131322 83
808 3300025233 Ga0209437_100033 Ga0209437_100033311 83
809 3300025233 Ga0209437_100075 Ga0209437_100075195 83
810 3300025245 Ga0207425_1025968 Ga0207425_10259682 83
811 3300025245 Ga0207425_1054664 Ga0207425_10546641 83
812 3300025246 Ga0209646_1000145 Ga0209646_100014525 83
813 3300025246 Ga0209646_1008549 Ga0209646_10085492 83
814 3300025246 Ga0209646_1017574 Ga0209646_10175742 83
815 3300025250 Ga0209026_1000120 Ga0209026_100012055 83
816 3300025250 Ga0209026_1000160 Ga0209026_100016025 83
817 3300025253 Ga0209677_100845 Ga0209677_10084510 83
818 3300025254 Ga0209148_1000056 Ga0209148_1000056262 83
819 3300025254 Ga0209148_1007473 Ga0209148_10074732 83
820 3300025254 Ga0209148_1037625 Ga0209148_10376252 83
821 3300025256 Ga0209759_1000177 Ga0209759_100017725 83
822 3300025256 Ga0209759_1000288 Ga0209759_100028850 83
823 3300025256 Ga0209759_1046353 Ga0209759_10463532 83
824 3300025258 Ga0209129_1000137 Ga0209129_100013712 83
825 3300025258 Ga0209129_1001697 Ga0209129_10016976 83
826 3300025261 Ga0209233_1000056 Ga0209233_100005621 83
827 3300025261 Ga0209233_1000064 Ga0209233_1000064111 83
828 3300025261 Ga0209233_1000087 Ga0209233_1000087142 83
829 3300025261 Ga0209233_1000209 Ga0209233_100020997 83
830 3300025261 Ga0209233_1004475 Ga0209233_10044752 83
831 3300025272 Ga0209455_1000777 Ga0209455_100077716 83
832 3300025272 Ga0209455_1021938 Ga0209455_10219382 83
833 3300025273 Ga0209673_1000319 Ga0209673_100031937 83
834 3300025273 Ga0209673_1001326 Ga0209673_100132621 83
835 3300025273 Ga0209673_1004666 Ga0209673_10046668 83
836 3300025273 Ga0209673_1066826 Ga0209673_10668262 83
837 3300025273 Ga0209673_1100635 Ga0209673_11006352 83
838 3300025273 Ga0209673_1102733 Ga0209673_11027332 83
839 3300025284 Ga0209130_1000007 Ga0209130_1000007111 83
840 3300025284 Ga0209130_1000018 Ga0209130_1000018233 83
841 3300025284 Ga0209130_1000148 Ga0209130_1000148107 83
842 3300025284 Ga0209130_1013563 Ga0209130_10135633 83
843 3300025284 Ga0209130_1022880 Ga0209130_10228803 83
844 3300025291 Ga0209675_1035650 Ga0209675_10356501 83
845 3300025292 Ga0209676_1000694 Ga0209676_100069430 83
846 3300025292 Ga0209676_1017727 Ga0209676_10177271 83
847 3300025294 Ga0209025_1000149 Ga0209025_1000149113 83
848 3300025294 Ga0209025_1000580 Ga0209025_100058020 83
849 3300025294 Ga0209025_1009457 Ga0209025_10094576 83
850 3300025294 Ga0209025_1010350 Ga0209025_10103503 83
851 3300025294 Ga0209025_1015894 Ga0209025_10158943 83
852 3300025294 Ga0209025_1019505 Ga0209025_10195052 83
853 3300025294 Ga0209025_1026975 Ga0209025_10269753 83
854 3300025294 Ga0209025_1046050 Ga0209025_10460502 83
855 3300025294 Ga0209025_1117947 Ga0209025_11179472 83
856 3300025294 Ga0209025_1147818 Ga0209025_11478181 83
857 3300025295 Ga0209564_1000431 Ga0209564_100043128 83
858 3300025295 Ga0209564_1001106 Ga0209564_100110616 83
859 3300025295 Ga0209564_1001342 Ga0209564_100134220 83
860 3300025295 Ga0209564_1009309 Ga0209564_10093092 83
861 3300025295 Ga0209564_1050292 Ga0209564_10502922 83
862 3300025295 Ga0209564_1057945 Ga0209564_10579452 83
863 3300025297 Ga0209758_1009477 Ga0209758_10094778 83
864 3300025297 Ga0209758_1031764 Ga0209758_10317643 83
865 3300025297 Ga0209758_1060745 Ga0209758_10607452 83
866 3300025297 Ga0209758_1075338 Ga0209758_10753383 83
867 3300025297 Ga0209758_1152389 Ga0209758_11523892 83
868 3300025298 Ga0209050_1002170 Ga0209050_100217011 83
869 3300025298 Ga0209050_1073321 Ga0209050_10733212 83
870 3300025299 Ga0209256_1000877 Ga0209256_100087721 83
871 3300025299 Ga0209256_1001068 Ga0209256_10010688 83
872 3300025299 Ga0209256_1001781 Ga0209256_10017817 83
873 3300025299 Ga0209256_1005328 Ga0209256_10053284 83
874 3300025299 Ga0209256_1005521 Ga0209256_10055212 83
875 3300025299 Ga0209256_1008937 Ga0209256_10089371 83
876 3300025302 Ga0207426_1000044 Ga0207426_1000044156 83
877 3300025302 Ga0207426_1000064 Ga0207426_1000064111 83
878 3300025302 Ga0207426_1000119 Ga0207426_1000119179 83
879 3300025302 Ga0207426_1005259 Ga0207426_10052594 83
880 3300025303 Ga0209051_1015125 Ga0209051_10151255 83
881 3300025303 Ga0209051_1021615 Ga0209051_10216152 83
882 3300025303 Ga0209051_1022549 Ga0209051_10225493 83
883 3300025303 Ga0209051_1025554 Ga0209051_10255543 83
884 3300025304 Ga0209257_1005277 Ga0209257_100527711 83
885 3300025304 Ga0209257_1038965 Ga0209257_10389652 83
886 3300025304 Ga0209257_1084948 Ga0209257_10849482 83
887 3300025304 Ga0209257_1128230 Ga0209257_11282302 83
888 3300025315 Ga0207697_10506497 Ga0207697_105064972 83
889 3300025728 Ga0207655_1136851 Ga0207655_11368512 83
890 3300025735 Ga0207713_1016350 Ga0207713_10163504 83
891 3300025893 Ga0207682_10016410 Ga0207682_100164105 83
892 3300025900 Ga0207710_10713050 Ga0207710_107130502 83
893 3300025901 Ga0207688_10142825 Ga0207688_101428252 83
894 3300025901 Ga0207688_10846381 Ga0207688_108463812 83
895 3300025903 Ga0207680_10276331 Ga0207680_102763313 83
896 3300025904 Ga0207647_10285591 Ga0207647_102855912 83
897 3300025907 Ga0207645_10021086 Ga0207645_100210865 83
898 3300025907 Ga0207645_10379884 Ga0207645_103798842 83
899 3300025908 Ga0207643_10459258 Ga0207643_104592582 83
900 3300025909 Ga0207705_10149112 Ga0207705_101491123 83
901 3300025909 Ga0207705_10585120 Ga0207705_105851202 83
902 3300025912 Ga0207707_10275687 Ga0207707_102756872 83
903 3300025913 Ga0207695_10000024 Ga0207695_10000024183 83
904 3300025913 Ga0207695_10068516 Ga0207695_100685163 83
905 3300025913 Ga0207695_10158443 Ga0207695_101584432 83
906 3300025913 Ga0207695_10991360 Ga0207695_109913601 83
907 3300025914 Ga0207671_10000718 Ga0207671_1000071818 83
908 3300025916 Ga0207663_10586278 Ga0207663_105862782 83
909 3300025918 Ga0207662_10782504 Ga0207662_107825042 83
910 3300025919 Ga0207657_10103856 Ga0207657_101038563 83
911 3300025920 Ga0207649_10744690 Ga0207649_107446902 83
912 3300025920 Ga0207649_10894806 Ga0207649_108948062 83
913 3300025920 Ga0207649_11198737 Ga0207649_111987372 83
914 3300025920 Ga0207649_11578143 Ga0207649_115781432 83
915 3300025921 Ga0207652_11019144 Ga0207652_110191442 83
916 3300025921 Ga0207652_11596561 Ga0207652_115965611 83
917 3300025923 Ga0207681_10555121 Ga0207681_105551213 83
918 3300025923 Ga0207681_11555692 Ga0207681_115556921 83
919 3300025924 Ga0207694_10472535 Ga0207694_104725352 83
920 3300025925 Ga0207650_10005961 Ga0207650_100059613 83
921 3300025926 Ga0207659_10893205 Ga0207659_108932052 83
922 3300025927 Ga0207687_10156457 Ga0207687_101564573 83
923 3300025931 Ga0207644_10048295 Ga0207644_100482952 83
924 3300025931 Ga0207644_10051407 Ga0207644_100514072 83
925 3300025931 Ga0207644_11219243 Ga0207644_112192432 83
926 3300025932 Ga0207690_10147147 Ga0207690_101471473 83
927 3300025932 Ga0207690_10803309 Ga0207690_108033092 83
928 3300025933 Ga0207706_10145632 Ga0207706_101456323 83
929 3300025933 Ga0207706_10963393 Ga0207706_109633932 83
930 3300025933 Ga0207706_10977684 Ga0207706_109776842 83
931 3300025933 Ga0207706_11397420 Ga0207706_113974202 83
932 3300025934 Ga0207686_10266629 Ga0207686_102666293 83
933 3300025935 Ga0207709_10150026 Ga0207709_101500261 83
934 3300025935 Ga0207709_10344727 Ga0207709_103447272 83
935 3300025935 Ga0207709_10977994 Ga0207709_109779941 83
936 3300025936 Ga0207670_10003940 Ga0207670_100039403 83
937 3300025937 Ga0207669_10110122 Ga0207669_101101222 83
938 3300025937 Ga0207669_10344493 Ga0207669_103444932 83
939 3300025938 Ga0207704_11181416 Ga0207704_111814161 83
940 3300025940 Ga0207691_10640451 Ga0207691_106404512 83
941 3300025941 Ga0207711_10076090 Ga0207711_100760903 83
942 3300025941 Ga0207711_11662394 Ga0207711_116623942 83
943 3300025942 Ga0207689_11319931 Ga0207689_113199312 83
944 3300025944 Ga0207661_10637934 Ga0207661_106379342 83
945 3300025945 Ga0207679_11020068 Ga0207679_110200682 83
946 3300025949 Ga0207667_11057673 Ga0207667_110576732 83
947 3300025949 Ga0207667_11308885 Ga0207667_113088852 83
948 3300025960 Ga0207651_10205792 Ga0207651_102057922 83
949 3300025960 Ga0207651_10743365 Ga0207651_107433652 83
950 3300025960 Ga0207651_10868605 Ga0207651_108686052 83
951 3300025961 Ga0207712_10564920 Ga0207712_105649202 83
952 3300025961 Ga0207712_11067324 Ga0207712_110673242 83
953 3300025972 Ga0207668_10179167 Ga0207668_101791673 83
954 3300025972 Ga0207668_10671379 Ga0207668_106713792 83
955 3300025972 Ga0207668_10864079 Ga0207668_108640792 83
956 3300025981 Ga0207640_10150463 Ga0207640_101504632 83
957 3300025981 Ga0207640_10155131 Ga0207640_101551313 83
958 3300025981 Ga0207640_11304725 Ga0207640_113047252 83
959 3300025986 Ga0207658_10129704 Ga0207658_101297043 83
960 3300025986 Ga0207658_10202043 Ga0207658_102020433 83
961 3300025986 Ga0207658_10313549 Ga0207658_103135492 83
962 3300025986 Ga0207658_10703577 Ga0207658_107035772 83
963 3300025986 Ga0207658_11707178 Ga0207658_117071782 83
964 3300026023 Ga0207677_10122790 Ga0207677_101227903 83
965 3300026023 Ga0207677_11279385 Ga0207677_112793852 83
966 3300026023 Ga0207677_12065241 Ga0207677_120652412 83
967 3300026035 Ga0207703_10483128 Ga0207703_104831282 83
968 3300026035 Ga0207703_10772864 Ga0207703_107728642 83
969 3300026041 Ga0207639_10335608 Ga0207639_103356082 83
970 3300026041 Ga0207639_11494026 Ga0207639_114940262 83
971 3300026067 Ga0207678_10058238 Ga0207678_100582385 83
972 3300026067 Ga0207678_10129738 Ga0207678_101297383 83
973 3300026067 Ga0207678_10525768 Ga0207678_105257682 83
974 3300026067 Ga0207678_10588475 Ga0207678_105884752 83
975 3300026067 Ga0207678_10637871 Ga0207678_106378712 83
976 3300026067 Ga0207678_10683760 Ga0207678_106837602 83
977 3300026075 Ga0207708_10137301 Ga0207708_101373013 83
978 3300026078 Ga0207702_11714129 Ga0207702_117141292 83
979 3300026078 Ga0207702_11837235 Ga0207702_118372352 83
980 3300026088 Ga0207641_10636151 Ga0207641_106361511 83
981 3300026089 Ga0207648_10959821 Ga0207648_109598212 83
982 3300026095 Ga0207676_10003179 Ga0207676_100031793 83
983 3300026095 Ga0207676_10523656 Ga0207676_105236562 83
984 3300026116 Ga0207674_11293015 Ga0207674_112930152 83
985 3300026116 Ga0207674_11840489 Ga0207674_118404892 83
986 3300026118 Ga0207675_100121294 Ga0207675_1001212943 83
987 3300026118 Ga0207675_100765701 Ga0207675_1007657012 83
988 3300026121 Ga0207683_10012420 Ga0207683_100124205 83
989 3300026121 Ga0207683_10048163 Ga0207683_100481632 83
990 3300026121 Ga0207683_10177284 Ga0207683_101772844 83
991 3300026121 Ga0207683_10661389 Ga0207683_106613892 83
992 3300026142 Ga0207698_10034126 Ga0207698_100341266 83
993 3300027111 Ga0209281_1000236 Ga0209281_100023629 83
994 3300027111 Ga0209281_1000266 Ga0209281_100026675 83
995 3300027312 Ga0209371_1001249 Ga0209371_100124913 83
996 3300027666 Ga0209282_1000007 Ga0209282_1000007229 83
997 3300027666 Ga0209282_1401494 Ga0209282_14014941 83
998 3300027866 Ga0209813_10183299 Ga0209813_101832992 83
999 3300027876 Ga0209974_10068959 Ga0209974_100689592 83
1000 3300027907 Ga0207428_10364317 Ga0207428_103643172 83
1001 3300028379 Ga0268266_10014527 Ga0268266_100145277 83
1002 3300028379 Ga0268266_10107861 Ga0268266_101078613 83
1003 3300028379 Ga0268266_10209519 Ga0268266_102095193 83
1004 3300028379 Ga0268266_10238826 Ga0268266_102388263 83
1005 3300028379 Ga0268266_10698121 Ga0268266_106981212 83
1006 3300028379 Ga0268266_10823368 Ga0268266_108233682 83
1007 3300028379 Ga0268266_11366561 Ga0268266_113665612 83
1008 3300028379 Ga0268266_11417798 Ga0268266_114177982 83
1009 3300028380 Ga0268265_10816259 Ga0268265_108162592 83
1010 3300028380 Ga0268265_11158668 Ga0268265_111586682 83
1011 3300028380 Ga0268265_11583614 Ga0268265_115836141 83
1012 3300028381 Ga0268264_10858757 Ga0268264_108587572 83
1013 3300028794 Ga0307515_10010607 Ga0307515_1001060718 83
1014 3300028794 Ga0307515_10196211 Ga0307515_101962111 83
1015 3300028794 Ga0307515_10533009 Ga0307515_105330092 83
1016 3300030500 Ga0268256_1000660 Ga0268256_10006608 83
1017 3300031235 Ga0265330_10083771 Ga0265330_100837712 83
1018 3300031235 Ga0265330_10171737 Ga0265330_101717372 83
1019 3300031238 Ga0265332_10158692 Ga0265332_101586922 83
1020 3300031239 Ga0265328_10062459 Ga0265328_100624592 83
1021 3300031239 Ga0265328_10298263 Ga0265328_102982632 83
1022 3300031241 Ga0265325_10030702 Ga0265325_100307023 83
1023 3300031241 Ga0265325_10090453 Ga0265325_100904531 83
1024 3300031241 Ga0265325_10140843 Ga0265325_101408432 83
1025 3300031241 Ga0265325_10225700 Ga0265325_102257002 83
1026 3300031242 Ga0265329_10149690 Ga0265329_101496902 83
1027 3300031247 Ga0265340_10001562 Ga0265340_1000156214 83
1028 3300031247 Ga0265340_10042630 Ga0265340_100426302 83
1029 3300031247 Ga0265340_10043089 Ga0265340_100430892 83
1030 3300031247 Ga0265340_10045419 Ga0265340_100454193 83
1031 3300031247 Ga0265340_10045992 Ga0265340_100459923 83
1032 3300031247 Ga0265340_10263442 Ga0265340_102634422 83
1033 3300031249 Ga0265339_10091947 Ga0265339_100919472 83
1034 3300031249 Ga0265339_10156184 Ga0265339_101561842 83
1035 3300031249 Ga0265339_10415584 Ga0265339_104155842 83
1036 3300031249 Ga0265339_10478538 Ga0265339_104785382 83
1037 3300031250 Ga0265331_10001287 Ga0265331_1000128721 83
1038 3300031250 Ga0265331_10089679 Ga0265331_100896793 83
1039 3300031250 Ga0265331_10097138 Ga0265331_100971382 83
1040 3300031250 Ga0265331_10368994 Ga0265331_103689942 83
1041 3300031250 Ga0265331_10555454 Ga0265331_105554541 83
1042 3300031251 Ga0265327_10000095 Ga0265327_10000095128 83
1043 3300031344 Ga0265316_10185929 Ga0265316_101859293 83
1044 3300031344 Ga0265316_10930171 Ga0265316_109301712 83
1045 3300031456 Ga0307513_10006330 Ga0307513_100063306 83
1046 3300031456 Ga0307513_10214632 Ga0307513_102146322 83
1047 3300031456 Ga0307513_10309409 Ga0307513_103094092 83
1048 3300031548 Ga0307408_100057540 Ga0307408_1000575404 83
1049 3300031548 Ga0307408_100135901 Ga0307408_1001359012 83
1050 3300031548 Ga0307408_101366534 Ga0307408_1013665342 83
1051 3300031548 Ga0307408_101833211 Ga0307408_1018332112 83
1052 3300031595 Ga0265313_10007558 Ga0265313_100075583 83
1053 3300031595 Ga0265313_10019903 Ga0265313_100199032 83
1054 3300031595 Ga0265313_10031991 Ga0265313_100319913 83
1055 3300031595 Ga0265313_10112760 Ga0265313_101127602 83
1056 3300031665 Ga0316575_10170132 Ga0316575_101701322 83
1057 3300031691 Ga0316579_10080566 Ga0316579_100805662 83
1058 3300031711 Ga0265314_10037766 Ga0265314_100377665 83
1059 3300031711 Ga0265314_10146472 Ga0265314_101464721 83
1060 3300031711 Ga0265314_10162969 Ga0265314_101629693 83
1061 3300031711 Ga0265314_10561813 Ga0265314_105618131 83
1062 3300031712 Ga0265342_10064019 Ga0265342_100640193 83
1063 3300031712 Ga0265342_10170989 Ga0265342_101709892 83
1064 3300031712 Ga0265342_10180588 Ga0265342_101805883 83
1065 3300031712 Ga0265342_10624597 Ga0265342_106245971 83
1066 3300031730 Ga0307516_10104873 Ga0307516_101048732 83
1067 3300031731 Ga0307405_10177698 Ga0307405_101776982 83
1068 3300031731 Ga0307405_10191204 Ga0307405_101912043 83
1069 3300031731 Ga0307405_10522614 Ga0307405_105226143 83
1070 3300031731 Ga0307405_11553399 Ga0307405_115533992 83
1071 3300031733 Ga0316577_10609486 Ga0316577_106094862 83
1072 3300031824 Ga0307413_10071775 Ga0307413_100717753 83
1073 3300031852 Ga0307410_10108694 Ga0307410_101086942 83
1074 3300031901 Ga0307406_10009795 Ga0307406_100097956 83
1075 3300031901 Ga0307406_10086670 Ga0307406_100866703 83
1076 3300031901 Ga0307406_10373811 Ga0307406_103738111 83
1077 3300031901 Ga0307406_11177694 Ga0307406_111776942 83
1078 3300031911 Ga0307412_10273644 Ga0307412_102736442 83
1079 3300031911 Ga0307412_10379300 Ga0307412_103793003 83
1080 3300031911 Ga0307412_10421675 Ga0307412_104216752 83
1081 3300031911 Ga0307412_11248577 Ga0307412_112485772 83
1082 3300031911 Ga0307412_11959248 Ga0307412_119592482 83
1083 3300031967 Ga0315914_1000006 Ga0315914_100000614 83
1084 3300031995 Ga0307409_100097147 Ga0307409_1000971473 83
1085 3300031995 Ga0307409_100555550 Ga0307409_1005555502 83
1086 3300031995 Ga0307409_100788681 Ga0307409_1007886812 83
1087 3300031995 Ga0307409_101005982 Ga0307409_1010059822 83
1088 3300031995 Ga0307409_101022835 Ga0307409_1010228352 83
1089 3300031995 Ga0307409_101337941 Ga0307409_1013379412 83
1090 3300032002 Ga0307416_100206173 Ga0307416_1002061732 83
1091 3300032002 Ga0307416_100739011 Ga0307416_1007390112 83
1092 3300032002 Ga0307416_100786570 Ga0307416_1007865702 83
1093 3300032002 Ga0307416_102309240 Ga0307416_1023092402 83
1094 3300032004 Ga0307414_11651350 Ga0307414_116513502 83
1095 3300032005 Ga0307411_10011705 Ga0307411_100117054 83
1096 3300032126 Ga0307415_102358078 Ga0307415_1023580782 83
1097 3300032168 Ga0316593_10308730 Ga0316593_103087302 83
1098 3300033430 Ga0315913_1000002 Ga0315913_1000002228 83
1099 3300033464 Ga0315915_1000001 Ga0315915_1000001258 83
1100 3300034817 Ga0373948_0044536 Ga0373948_0044536_313_573 83
1101 3300034819 Ga0373958_0116867 Ga0373958_0116867_171_431 83
1102 3300035084 Ga0373928_0044563 Ga0373928_0044563_382_642 83
1103 3300035085 Ga0373929_0045814 Ga0373929_0045814_518_778 83
1104 3300035085 Ga0373929_0091196 Ga0373929_0091196_225_485 83
1105 3300035089 Ga0373944_0134099 Ga0373944_0134099_244_495 83
1106 3300035111 Ga0373923_0160968 Ga0373923_0160968_228_479 83
1107 3300035114 Ga0373939_0065154 Ga0373939_0065154_621_881 83
1108 3300035115 Ga0373941_0017338 Ga0373941_0017338_162_422 83
1109 3300035115 Ga0373941_0022048 Ga0373941_0022048_699_950 83
1110 3300035115 Ga0373941_0067397 Ga0373941_0067397_482_742 83
1111 3300035116 Ga0373945_0194682 Ga0373945_0194682_286_537 83
1112 3300035116 Ga0373945_0314766 Ga0373945_0314766_303_554 83
1113 3300035118 Ga0373954_0149670 Ga0373954_0149670_319_570 83
1114 3300035121 Ga0373960_0004122 Ga0373960_0004122_1294_1554 83
1115 3300035170 Ga0373943_0040534 Ga0373943_0040534_1689_1940 83
1116 3300035171 Ga0373946_0677114 Ga0373946_0677114_58_315 83
1117 3300035172 Ga0373955_0820692 Ga0373955_0820692_227_478 83
1118 3300035207 Ga0373942_0195710 Ga0373942_0195710_118_378 83
1119 3300035207 Ga0373942_0215262 Ga0373942_0215262_287_538 83
1120 3300035241 Ga0373961_0004785 Ga0373961_0004785_2077_2337 83
1121 3300035241 Ga0373961_0034038 Ga0373961_0034038_282_533 83
1122 3300035242 Ga0373962_0377996 Ga0373962_0377996_78_338 83
1123 3300035691 Ga0373931_0002120 Ga0373931_0002120_2027_2287 83
1124 3300035691 Ga0373931_0013881 Ga0373931_0013881_1413_1673 83
1125 3300035691 Ga0373931_0713394 Ga0373931_0713394_360_617 83
1126 3300035692 Ga0373935_0271890 Ga0373935_0271890_288_539 83
1127 3300035695 Ga0373927_0027265 Ga0373927_0027265_1536_1787 83
1128 3300036401 Ga0373937_1323102 Ga0373937_1323102_350_601 83
1129 3300036647 Ga0316582_0256716 Ga0316582_0256716_545_799 83
1130 3300036712 Ga0316584_0842783 Ga0316584_0842783_280_534 83
1131 3300037068 Ga0373925_0374694 Ga0373925_0374694_625_876 83
1132 3300037068 Ga0373925_0695920 Ga0373925_0695920_450_710 83
1133 3300037312 Ga0395899_0047689 Ga0395899_0047689_1203_1454 83
1134 3300037466 Ga0395898_0049480 Ga0395898_0049480_2155_2406 83
1135 3300037466 Ga0395898_0279979 Ga0395898_0279979_31_288 83
1136 3300037466 Ga0395898_0355110 Ga0395898_0355110_693_944 83
1137 3300037471 Ga0395905_0037309 Ga0395905_0037309_933_1184 83
1138 3300037471 Ga0395905_0052400 Ga0395905_0052400_2383_2640 83
1139 3300038443 Ga0395901_0082006 Ga0395901_0082006_2908_3165 83
1140 3300038443 Ga0395901_1155786 Ga0395901_1155786_365_655 83
1141 3300039437 Ga0436365_0366823 Ga0436365_0366823_226_477 83
1142 3300039450 Ga0436363_0775146 Ga0436363_0775146_9974_10225 83
1143 3300041404 Ga0439436_0006455 Ga0439436_0006455_1505_1765 83
1144 3300041404 Ga0439436_0149499 Ga0439436_0149499_104_364 83
1145 3300041404 Ga0439436_0207568 Ga0439436_0207568_78_335 83
1146 3300041405 Ga0439438_017861 Ga0439438_017861_1042_1302 83
1147 3300041411 Ga0439466_0130362 Ga0439466_0130362_37_297 83
1148 3300041413 Ga0439465_0001711 Ga0439465_0001711_741_1001 83
1149 3300041413 Ga0439465_0089399 Ga0439465_0089399_762_1016 83
1150 3300041413 Ga0439465_0102356 Ga0439465_0102356_135_389 83
1151 3300041443 Ga0451789_1320308 Ga0451789_1320308_185_439 83
1152 3300041451 Ga0451791_1932150 Ga0451791_1932150_196_453 83
1153 3300041453 Ga0451797_0392121 Ga0451797_0392121_69_326 83
1154 3300041460 Ga0451802_0083164 Ga0451802_0083164_321_575 83
1155 3300041496 Ga0451839_0636310 Ga0451839_0636310_46_321 83
1156 3300041498 Ga0451841_1019038 Ga0451841_1019038_188_445 83
1157 3300041512 Ga0451853_2943703 Ga0451853_2943703_168_443 83
1158 3300041999 Ga0439433_0078267 Ga0439433_0078267_496_747 83
1159 3300042004 Ga0439445_0166395 Ga0439445_0166395_210_470 83
1160 3300042005 Ga0439448_0225608 Ga0439448_0225608_110_367 83
1161 3300042006 Ga0439432_040707 Ga0439432_040707_149_409 83
1162 3300042007 Ga0439449_0001047 Ga0439449_0001047_5110_5370 83
1163 3300042015 Ga0439462_0121485 Ga0439462_0121485_146_406 83
1164 3300042015 Ga0439462_0189933 Ga0439462_0189933_138_398 83
1165 3300042122 Ga0450920_036575 Ga0450920_036575_97_357 83
1166 3300042125 Ga0450923_039887 Ga0450923_039887_106_366 83
1167 3300042145 Ga0450906_008450 Ga0450906_008450_410_670 83
1168 3300042157 Ga0439458_0047121 Ga0439458_0047121_648_905 83
1169 3300042184 Ga0450908_029936 Ga0450908_029936_432_692 83
1170 3300042185 Ga0450909_080054 Ga0450909_080054_254_514 83
1171 3300042435 Ga0439434_0020056 Ga0439434_0020056_1296_1556 83
1172 3300042531 Ga0450918_001738 Ga0450918_001738_2594_2854 83
1173 3300044658 Ga0466972_0082447 Ga0466972_0082447_182_439 83
1174 3300044683 Ga0466965_0132840 Ga0466965_0132840_62_319 83
1175 3300044683 Ga0466965_0432222 Ga0466965_0432222_69_326 83
1176 3300044684 Ga0466966_0803263 Ga0466966_0803263_262_519 83
1177 3300044694 Ga0466963_0020949 Ga0466963_0020949_1143_1400 83
1178 3300044735 Ga0466968_0455478 Ga0466968_0455478_190_447 83
1179 3300044765 Ga0466970_0107199 Ga0466970_0107199_1069_1326 83
1180 3300044842 Ga0466957_0092513 Ga0466957_0092513_221_478 83
1181 3300044901 Ga0466960_0025395 Ga0466960_0025395_1747_2004 83
1182 3300044901 Ga0466960_0317440 Ga0466960_0317440_194_445 83
1183 3300044901 Ga0466960_0511477 Ga0466960_0511477_333_590 83
1184 3300044901 Ga0466960_0576090 Ga0466960_0576090_195_446 83
1185 3300045049 Ga0466959_0628274 Ga0466959_0628274_364_621 83
1186 3300045976 Ga0466967_0814156 Ga0466967_0814156_423_680 83
1187 3300045976 Ga0466967_0922145 Ga0466967_0922145_35_292 83
1188 3300046453 Ga0495627_150236 Ga0495627_150236_200_454 83
1189 3300046454 Ga0495592_0046201 Ga0495592_0046201_1184_1438 83
1190 3300046454 Ga0495592_0260565 Ga0495592_0260565_100_351 83
1191 3300046457 Ga0495590_0220384 Ga0495590_0220384_152_409 83
1192 3300046459 Ga0495629_0026890 Ga0495629_0026890_51_305 83
1193 3300046460 Ga0495638_0016460 Ga0495638_0016460_1971_2228 83
1194 3300046460 Ga0495638_0046065 Ga0495638_0046065_70_327 83
1195 3300046460 Ga0495638_0114859 Ga0495638_0114859_307_564 83
1196 3300046461 Ga0495641_0539109 Ga0495641_0539109_133_384 83
1197 3300046462 Ga0495651_0552564 Ga0495651_0552564_411_665 83
1198 3300046463 Ga0495653_0078871 Ga0495653_0078871_1901_2152 83
1199 3300046463 Ga0495653_0567504 Ga0495653_0567504_272_526 83
1200 3300046471 Ga0495650_0104198 Ga0495650_0104198_505_759 83
1201 3300046471 Ga0495650_0219604 Ga0495650_0219604_370_624 83
1202 3300046476 Ga0495662_0031142 Ga0495662_0031142_160_414 83
1203 3300046477 Ga0495664_0308462 Ga0495664_0308462_223_474 83
1204 3300046500 Ga0495596_0111419 Ga0495596_0111419_756_1013 83
1205 3300046501 Ga0495607_0400987 Ga0495607_0400987_134_388 83
1206 3300046507 Ga0495606_0010031 Ga0495606_0010031_3531_3785 83
1207 3300046507 Ga0495606_0088887 Ga0495606_0088887_1173_1427 83
1208 3300046507 Ga0495606_0203377 Ga0495606_0203377_429_683 83
1209 3300046512 Ga0495610_0006212 Ga0495610_0006212_5968_6222 83
1210 3300046512 Ga0495610_0063217 Ga0495610_0063217_1003_1260 83
1211 3300046512 Ga0495610_0141051 Ga0495610_0141051_330_584 83
1212 3300046512 Ga0495610_0214715 Ga0495610_0214715_101_382 83
1213 3300046512 Ga0495610_0240221 Ga0495610_0240221_100_357 83
1214 3300046513 Ga0495616_0283838 Ga0495616_0283838_301_555 83
1215 3300046515 Ga0495620_0150916 Ga0495620_0150916_104_358 83
1216 3300046515 Ga0495620_0263773 Ga0495620_0263773_357_611 83
1217 3300046519 Ga0495632_0218774 Ga0495632_0218774_502_756 83
1218 3300046522 Ga0495643_0027457 Ga0495643_0027457_2672_2929 83
1219 3300046522 Ga0495643_0037538 Ga0495643_0037538_1215_1469 83
1220 3300046522 Ga0495643_0044122 Ga0495643_0044122_429_710 83
1221 3300046522 Ga0495643_0226322 Ga0495643_0226322_431_685 83
1222 3300046523 Ga0495644_0220612 Ga0495644_0220612_469_720 83
1223 3300046524 Ga0495648_0378833 Ga0495648_0378833_254_508 83
1224 3300046524 Ga0495648_0407376 Ga0495648_0407376_269_526 83
1225 3300046529 Ga0495652_0525183 Ga0495652_0525183_441_695 83
1226 3300046536 Ga0495587_0678349 Ga0495587_0678349_132_386 83
1227 3300046539 Ga0495621_0219587 Ga0495621_0219587_460_711 83
1228 3300046542 Ga0495597_0349024 Ga0495597_0349024_22_276 83
1229 3300046543 Ga0495645_0142971 Ga0495645_0142971_1211_1462 83
1230 3300046543 Ga0495645_0838178 Ga0495645_0838178_89_340 83
1231 3300046557 Ga0495622_0106271 Ga0495622_0106271_774_1028 83
1232 3300046615 Ga0495656_0586067 Ga0495656_0586067_79_330 83
1233 3300046616 Ga0495668_0066336 Ga0495668_0066336_1502_1759 83
1234 3300046616 Ga0495668_0140952 Ga0495668_0140952_25_282 83
1235 3300046616 Ga0495668_0471569 Ga0495668_0471569_97_354 83
1236 3300046642 Ga0495634_0533571 Ga0495634_0533571_63_317 83
1237 3300046660 Ga0495625_0088160 Ga0495625_0088160_124_384 83
1238 3300046660 Ga0495625_0133822 Ga0495625_0133822_1258_1512 83
1239 3300046660 Ga0495625_0244218 Ga0495625_0244218_808_1089 83
1240 3300046660 Ga0495625_0377402 Ga0495625_0377402_386_643 83
1241 3300046660 Ga0495625_0529141 Ga0495625_0529141_239_496 83
1242 3300046660 Ga0495625_0554266 Ga0495625_0554266_168_422 83
1243 3300046663 Ga0495635_1037604 Ga0495635_1037604_10_261 83
1244 3300046674 Ga0495588_0048206 Ga0495588_0048206_1575_1829 83
1245 3300046675 Ga0495657_0072858 Ga0495657_0072858_1809_2063 83
1246 3300046679 Ga0495623_0257965 Ga0495623_0257965_89_343 83
1247 3300046683 Ga0495658_0120709 Ga0495658_0120709_1030_1284 83
1248 3300046689 Ga0495613_0686622 Ga0495613_0686622_39_293 83
1249 3300046690 Ga0495624_0185559 Ga0495624_0185559_895_1149 83
1250 3300046694 Ga0495649_0438076 Ga0495649_0438076_242_499 83
1251 3300046794 Ga0495589_0108077 Ga0495589_0108077_858_1115 83
1252 3300046809 Ga0495600_0123827 Ga0495600_0123827_840_1094 83
1253 3300046810 Ga0495660_0032319 Ga0495660_0032319_2323_2580 83
1254 3300046810 Ga0495660_0361697 Ga0495660_0361697_370_627 83
1255 3300047317 Ga0495604_0028877 Ga0495604_0028877_3546_3800 83
1256 3300047317 Ga0495604_0422102 Ga0495604_0422102_160_411 83
1257 3300047319 Ga0495674_1327161 Ga0495674_1327161_103_357 83
1258 3300047322 Ga0495680_0418083 Ga0495680_0418083_625_876 83
1259 3300047443 Ga0495687_063971 Ga0495687_063971_1198_1455 83
1260 3300047443 Ga0495687_095090 Ga0495687_095090_95_352 83
1261 3300047469 Ga0495673_0214526 Ga0495673_0214526_23_274 83
1262 3300047470 Ga0495681_0080705 Ga0495681_0080705_886_1143 83
1263 3300047472 Ga0495686_0002844 Ga0495686_0002844_14087_14341 83
1264 3300047472 Ga0495686_0011672 Ga0495686_0011672_5628_5882 83
1265 3300047472 Ga0495686_0028624 Ga0495686_0028624_727_981 83
1266 3300047472 Ga0495686_0317298 Ga0495686_0317298_368_625 83
1267 3300047472 Ga0495686_0510555 Ga0495686_0510555_110_391 83
1268 3300048088 Ga0495602_0660150 Ga0495602_0660150_101_352 83
1269 3300048088 Ga0495602_0902761 Ga0495602_0902761_40_294 83
1270 3300048091 Ga0495626_0025458 Ga0495626_0025458_1661_1918 83
1271 3300048903 Ga0496100_0016492 Ga0496100_0016492_3506_3766 83
1272 3300048903 Ga0496100_0767447 Ga0496100_0767447_117_374 83
1273 3300048904 Ga0496101_0291059 Ga0496101_0291059_178_429 83
1274 3300048904 Ga0496101_0383035 Ga0496101_0383035_809_1069 83
1275 3300048904 Ga0496101_0405490 Ga0496101_0405490_189_443 83
1276 3300048904 Ga0496101_0421716 Ga0496101_0421716_570_827 83
1277 3300048904 Ga0496101_0680711 Ga0496101_0680711_527_778 83
1278 3300048905 Ga0496102_0199108 Ga0496102_0199108_1541_1801 83
1279 3300048905 Ga0496102_0505898 Ga0496102_0505898_196_453 83
1280 3300048905 Ga0496102_0866232 Ga0496102_0866232_297_554 83
1281 3300048905 Ga0496102_0909821 Ga0496102_0909821_73_330 83
1282 3300048905 Ga0496102_1039957 Ga0496102_1039957_97_354 83
1283 3300048906 Ga0496103_0043920 Ga0496103_0043920_25_282 83
1284 3300048907 Ga0496104_0094490 Ga0496104_0094490_1727_1987 83
1285 3300048907 Ga0496104_0546919 Ga0496104_0546919_342_599 83
1286 3300048907 Ga0496104_0697772 Ga0496104_0697772_252_503 83
1287 3300048907 Ga0496104_1747712 Ga0496104_1747712_215_466 83
1288 3300048908 Ga0496105_0550856 Ga0496105_0550856_98_349 83
1289 3300048908 Ga0496105_0581033 Ga0496105_0581033_320_577 83
1290 3300048908 Ga0496105_0804237 Ga0496105_0804237_15_275 83
1291 3300048908 Ga0496105_0977184 Ga0496105_0977184_203_457 83
1292 3300048909 Ga0496106_0016430 Ga0496106_0016430_3100_3354 83
1293 3300048909 Ga0496106_0224296 Ga0496106_0224296_390_650 83
1294 3300048909 Ga0496106_1182545 Ga0496106_1182545_300_557 83
1295 3300048910 Ga0496107_0075565 Ga0496107_0075565_1440_1700 83
1296 3300048911 Ga0496108_0096285 Ga0496108_0096285_366_626 83
1297 3300048911 Ga0496108_0122367 Ga0496108_0122367_1381_1641 83
1298 3300048912 Ga0496109_0023524 Ga0496109_0023524_2103_2363 83
1299 3300048912 Ga0496109_0126970 Ga0496109_0126970_731_991 83
1300 3300048913 Ga0496110_0056926 Ga0496110_0056926_822_1082 83
1301 3300048913 Ga0496110_0179413 Ga0496110_0179413_1450_1710 83
1302 3300048913 Ga0496110_0986462 Ga0496110_0986462_229_480 83
1303 3300048913 Ga0496110_1096251 Ga0496110_1096251_312_569 83
1304 3300048914 Ga0496111_0127301 Ga0496111_0127301_901_1161 83
1305 3300048914 Ga0496111_0274367 Ga0496111_0274367_682_939 83
1306 3300048915 Ga0496112_0052437 Ga0496112_0052437_1760_2017 83
1307 3300048915 Ga0496112_0057193 Ga0496112_0057193_3246_3506 83
1308 3300048915 Ga0496112_0142644 Ga0496112_0142644_1387_1647 83
1309 3300048915 Ga0496112_0675681 Ga0496112_0675681_316_576 83
1310 3300048915 Ga0496112_1101560 Ga0496112_1101560_215_475 83
1311 3300048915 Ga0496112_1230459 Ga0496112_1230459_165_425 83
1312 3300048916 Ga0496113_0451804 Ga0496113_0451804_480_740 83
1313 3300048916 Ga0496113_0683664 Ga0496113_0683664_522_779 83
1314 3300048917 Ga0496114_0076482 Ga0496114_0076482_1974_2234 83
1315 3300048917 Ga0496114_0130392 Ga0496114_0130392_90_344 83
1316 3300048917 Ga0496114_0422455 Ga0496114_0422455_828_1085 83
1317 3300048917 Ga0496114_0551466 Ga0496114_0551466_604_855 83
1318 3300048918 Ga0496115_0169071 Ga0496115_0169071_1483_1749 83
1319 3300048918 Ga0496115_0188617 Ga0496115_0188617_698_958 83
1320 3300048918 Ga0496115_0782721 Ga0496115_0782721_385_642 83
1321 3300048919 Ga0496116_0036873 Ga0496116_0036873_2953_3207 83
1322 3300048919 Ga0496116_0061983 Ga0496116_0061983_639_896 83
1323 3300048919 Ga0496116_0067211 Ga0496116_0067211_1868_2122 83
1324 3300048919 Ga0496116_0224656 Ga0496116_0224656_341_595 83
1325 3300048920 Ga0496117_0006751 Ga0496117_0006751_9728_9982 83
1326 3300048920 Ga0496117_0014861 Ga0496117_0014861_216_470 83
1327 3300048920 Ga0496117_0076186 Ga0496117_0076186_1505_1792 83
1328 3300048920 Ga0496117_0080253 Ga0496117_0080253_1007_1264 83
1329 3300048920 Ga0496117_0084069 Ga0496117_0084069_1376_1666 83
1330 3300048920 Ga0496117_0466083 Ga0496117_0466083_217_471 83
1331 3300048920 Ga0496117_0500428 Ga0496117_0500428_289_546 83
1332 3300048921 Ga0496118_0003715 Ga0496118_0003715_17771_18025 83
1333 3300048921 Ga0496118_0010030 Ga0496118_0010030_8086_8343 83
1334 3300048921 Ga0496118_0082361 Ga0496118_0082361_1339_1626 83
1335 3300048921 Ga0496118_0197134 Ga0496118_0197134_606_863 83
1336 3300048921 Ga0496118_0197932 Ga0496118_0197932_104_394 83
1337 3300048922 Ga0496119_0009045 Ga0496119_0009045_6412_6669 83
1338 3300048922 Ga0496119_0036191 Ga0496119_0036191_205_462 83
1339 3300048922 Ga0496119_0039161 Ga0496119_0039161_2233_2490 83
1340 3300048922 Ga0496119_0042057 Ga0496119_0042057_2016_2273 83
1341 3300048922 Ga0496119_0431032 Ga0496119_0431032_183_440 83
1342 3300048923 Ga0496120_0026604 Ga0496120_0026604_867_1124 83
1343 3300048923 Ga0496120_0062583 Ga0496120_0062583_367_624 83
1344 3300048923 Ga0496120_0097153 Ga0496120_0097153_1207_1497 83
1345 3300048923 Ga0496120_0117110 Ga0496120_0117110_678_935 83
1346 3300048923 Ga0496120_0426736 Ga0496120_0426736_263_517 83
1347 3300048924 Ga0496121_0018097 Ga0496121_0018097_2423_2680 83
1348 3300048924 Ga0496121_0045342 Ga0496121_0045342_317_571 83
1349 3300048924 Ga0496121_0065852 Ga0496121_0065852_143_397 83
1350 3300048924 Ga0496121_0074664 Ga0496121_0074664_1313_1591 83
1351 3300048924 Ga0496121_0146696 Ga0496121_0146696_1286_1540 83
1352 3300048924 Ga0496121_0265597 Ga0496121_0265597_793_1050 83
1353 3300048925 Ga0496122_0001107 Ga0496122_0001107_19377_19631 83
1354 3300048925 Ga0496122_0016172 Ga0496122_0016172_6294_6584 83
1355 3300048925 Ga0496122_0031570 Ga0496122_0031570_1448_1705 83
1356 3300048925 Ga0496122_0034124 Ga0496122_0034124_83_376 83
1357 3300048925 Ga0496122_0048526 Ga0496122_0048526_2753_3007 83
1358 3300048925 Ga0496122_0248610 Ga0496122_0248610_604_861 83
1359 3300048925 Ga0496122_0320076 Ga0496122_0320076_551_805 83
1360 3300048925 Ga0496122_0579549 Ga0496122_0579549_101_358 83
1361 3300048926 Ga0496123_0000562 Ga0496123_0000562_26948_27202 83
1362 3300048926 Ga0496123_0052247 Ga0496123_0052247_76_333 83
1363 3300048926 Ga0496123_0097553 Ga0496123_0097553_1173_1460 83
1364 3300048926 Ga0496123_0124906 Ga0496123_0124906_323_580 83
1365 3300048926 Ga0496123_0140471 Ga0496123_0140471_147_404 83
1366 3300048926 Ga0496123_0289706 Ga0496123_0289706_418_708 83
1367 3300048927 Ga0496124_0045730 Ga0496124_0045730_581_835 83
1368 3300048927 Ga0496124_0054556 Ga0496124_0054556_321_578 83
1369 3300048927 Ga0496124_0064786 Ga0496124_0064786_1266_1532 83
1370 3300048927 Ga0496124_0076226 Ga0496124_0076226_2438_2692 83
1371 3300048927 Ga0496124_0282531 Ga0496124_0282531_224_481 83
1372 3300048927 Ga0496124_0377166 Ga0496124_0377166_571_825 83
1373 3300048927 Ga0496124_0443073 Ga0496124_0443073_484_738 83
1374 3300048927 Ga0496124_0483676 Ga0496124_0483676_242_529 83
1375 3300048927 Ga0496124_0491336 Ga0496124_0491336_14_304 83
1376 3300048927 Ga0496124_0677215 Ga0496124_0677215_181_435 83
1377 3300048928 Ga0496125_0001370 Ga0496125_0001370_8917_9171 83
1378 3300048928 Ga0496125_0083675 Ga0496125_0083675_983_1240 83
1379 3300048928 Ga0496125_0121749 Ga0496125_0121749_1541_1795 83
1380 3300048928 Ga0496125_0184448 Ga0496125_0184448_184_441 83
1381 3300048928 Ga0496125_0391440 Ga0496125_0391440_521_778 83
1382 3300048928 Ga0496125_0405944 Ga0496125_0405944_315_572 83
1383 3300048928 Ga0496125_0413004 Ga0496125_0413004_490_747 83
1384 3300048929 Ga0496126_0000069 Ga0496126_0000069_71446_71700 83
1385 3300048929 Ga0496126_0003015 Ga0496126_0003015_8715_8969 83
1386 3300048929 Ga0496126_0103078 Ga0496126_0103078_96_353 83
1387 3300048929 Ga0496126_0167746 Ga0496126_0167746_748_1005 83
1388 3300048929 Ga0496126_0192559 Ga0496126_0192559_631_888 83
1389 3300048929 Ga0496126_0906626 Ga0496126_0906626_282_539 83
1390 3300049459 Ga0495678_267563 Ga0495678_267563_78_332 83
1391 3300049514 Ga0501291_152841 Ga0501291_152841_57_314 83
1392 3300049522 Ga0501299_054410 Ga0501299_054410_376_627 83
1393 3300049568 Ga0501031_0000014 Ga0501031_0000014_110907_111158 83
1394 3300049568 Ga0501031_0001971 Ga0501031_0001971_11801_12052 83
1395 3300049568 Ga0501031_0105814 Ga0501031_0105814_373_624 83
1396 3300049568 Ga0501031_0376889 Ga0501031_0376889_649_900 83
1397 3300049568 Ga0501031_0824410 Ga0501031_0824410_104_355 83
1398 3300049568 Ga0501031_0861417 Ga0501031_0861417_248_538 83
1399 3300049569 Ga0501032_0000015 Ga0501032_0000015_110907_111158 83
1400 3300049569 Ga0501032_0000025 Ga0501032_0000025_51713_51967 83
1401 3300049569 Ga0501032_0003745 Ga0501032_0003745_9270_9521 83
1402 3300049569 Ga0501032_0024369 Ga0501032_0024369_138_389 83
1403 3300049569 Ga0501032_0081191 Ga0501032_0081191_1573_1824 83
1404 3300049569 Ga0501032_0088775 Ga0501032_0088775_1134_1409 83
1405 3300049569 Ga0501032_0137807 Ga0501032_0137807_1262_1537 83
1406 3300049569 Ga0501032_0396759 Ga0501032_0396759_444_695 83
1407 3300049569 Ga0501032_0414713 Ga0501032_0414713_300_590 83
1408 3300049569 Ga0501032_0521889 Ga0501032_0521889_270_551 83
1409 3300049569 Ga0501032_0717828 Ga0501032_0717828_71_325 83
1410 3300049570 Ga0501033_0000023 Ga0501033_0000023_110907_111158 83
1411 3300049570 Ga0501033_0000229 Ga0501033_0000229_1153_1407 83
1412 3300049570 Ga0501033_0001216 Ga0501033_0001216_6350_6625 83
1413 3300049570 Ga0501033_0001969 Ga0501033_0001969_9427_9708 83
1414 3300049570 Ga0501033_0005696 Ga0501033_0005696_2010_2261 83
1415 3300049570 Ga0501033_0026545 Ga0501033_0026545_661_942 83
1416 3300049570 Ga0501033_0028102 Ga0501033_0028102_148_399 83
1417 3300049570 Ga0501033_0048896 Ga0501033_0048896_2556_2807 83
1418 3300049570 Ga0501033_0072521 Ga0501033_0072521_674_928 83
1419 3300049570 Ga0501033_0108891 Ga0501033_0108891_1387_1677 83
1420 3300049570 Ga0501033_0187778 Ga0501033_0187778_562_837 83
1421 3300049570 Ga0501033_0389184 Ga0501033_0389184_483_734 83
1422 3300049570 Ga0501033_0408738 Ga0501033_0408738_615_872 83
1423 3300049570 Ga0501033_0456493 Ga0501033_0456493_134_388 83
1424 3300049570 Ga0501033_0810880 Ga0501033_0810880_264_545 83
1425 3300049571 Ga0501034_0000073 Ga0501034_0000073_65580_65831 83
1426 3300049571 Ga0501034_0001862 Ga0501034_0001862_8356_8610 83
1427 3300049571 Ga0501034_0020231 Ga0501034_0020231_4321_4572 83
1428 3300049571 Ga0501034_0060876 Ga0501034_0060876_1061_1312 83
1429 3300049571 Ga0501034_0079454 Ga0501034_0079454_1859_2110 83
1430 3300049571 Ga0501034_0122722 Ga0501034_0122722_1304_1555 83
1431 3300049571 Ga0501034_0123215 Ga0501034_0123215_1431_1682 83
1432 3300049571 Ga0501034_0139402 Ga0501034_0139402_541_792 83
1433 3300049571 Ga0501034_0288655 Ga0501034_0288655_770_1045 83
1434 3300049571 Ga0501034_0291447 Ga0501034_0291447_378_668 83
1435 3300049571 Ga0501034_0307254 Ga0501034_0307254_667_918 83
1436 3300049571 Ga0501034_0378691 Ga0501034_0378691_806_1060 83
1437 3300049571 Ga0501034_0389914 Ga0501034_0389914_694_975 83
1438 3300049571 Ga0501034_0395936 Ga0501034_0395936_94_348 83
1439 3300049571 Ga0501034_0526172 Ga0501034_0526172_152_406 83
1440 3300049571 Ga0501034_0697660 Ga0501034_0697660_457_708 83
1441 3300049571 Ga0501034_0698638 Ga0501034_0698638_178_429 83
1442 3300049571 Ga0501034_0793131 Ga0501034_0793131_419_673 83
1443 3300049571 Ga0501034_0847211 Ga0501034_0847211_220_471 83
1444 3300049571 Ga0501034_1231765 Ga0501034_1231765_298_549 83
1445 3300049571 Ga0501034_1600637 Ga0501034_1600637_50_340 83
1446 3300049572 Ga0501036_0000002 Ga0501036_0000002_110907_111158 83
1447 3300049572 Ga0501036_0001402 Ga0501036_0001402_1140_1394 83
1448 3300049572 Ga0501036_0006176 Ga0501036_0006176_8300_8551 83
1449 3300049572 Ga0501036_0205069 Ga0501036_0205069_1366_1617 83
1450 3300049572 Ga0501036_0224443 Ga0501036_0224443_562_813 83
1451 3300049572 Ga0501036_0236010 Ga0501036_0236010_224_475 83
1452 3300049572 Ga0501036_0277095 Ga0501036_0277095_912_1187 83
1453 3300049572 Ga0501036_0485729 Ga0501036_0485729_414_671 83
1454 3300049572 Ga0501036_0593031 Ga0501036_0593031_441_695 83
1455 3300049572 Ga0501036_0899567 Ga0501036_0899567_142_393 83
1456 3300049572 Ga0501036_1110278 Ga0501036_1110278_110_361 83
1457 3300049572 Ga0501036_1172201 Ga0501036_1172201_234_485 83
1458 3300049573 Ga0501037_0000048 Ga0501037_0000048_65598_65849 83
1459 3300049573 Ga0501037_0000176 Ga0501037_0000176_47406_47660 83
1460 3300049573 Ga0501037_0000828 Ga0501037_0000828_3644_3919 83
1461 3300049573 Ga0501037_0016939 Ga0501037_0016939_1302_1553 83
1462 3300049573 Ga0501037_0036439 Ga0501037_0036439_779_1030 83
1463 3300049573 Ga0501037_0079088 Ga0501037_0079088_334_585 83
1464 3300049573 Ga0501037_0099630 Ga0501037_0099630_208_498 83
1465 3300049573 Ga0501037_0100166 Ga0501037_0100166_1331_1585 83
1466 3300049573 Ga0501037_0119331 Ga0501037_0119331_1365_1640 83
1467 3300049573 Ga0501037_0248906 Ga0501037_0248906_915_1205 83
1468 3300049573 Ga0501037_0885778 Ga0501037_0885778_20_271 83
1469 3300049573 Ga0501037_0899989 Ga0501037_0899989_192_443 83
1470 3300049574 Ga0501038_0000002 Ga0501038_0000002_155311_155562 83
1471 3300049574 Ga0501038_0000862 Ga0501038_0000862_9331_9585 83
1472 3300049574 Ga0501038_0002080 Ga0501038_0002080_9715_9966 83
1473 3300049574 Ga0501038_0070054 Ga0501038_0070054_1883_2134 83
1474 3300049574 Ga0501038_0139672 Ga0501038_0139672_571_822 83
1475 3300049574 Ga0501038_0159284 Ga0501038_0159284_655_906 83
1476 3300049574 Ga0501038_0180255 Ga0501038_0180255_435_710 83
1477 3300049574 Ga0501038_0220923 Ga0501038_0220923_499_789 83
1478 3300049574 Ga0501038_0251353 Ga0501038_0251353_941_1192 83
1479 3300049574 Ga0501038_0302664 Ga0501038_0302664_670_921 83
1480 3300049574 Ga0501038_0338173 Ga0501038_0338173_866_1117 83
1481 3300049574 Ga0501038_0346042 Ga0501038_0346042_376_627 83
1482 3300049574 Ga0501038_0449010 Ga0501038_0449010_149_400 83
1483 3300049574 Ga0501038_0468901 Ga0501038_0468901_489_743 83
1484 3300049575 Ga0501039_0000002 Ga0501039_0000002_192951_193202 83
1485 3300049575 Ga0501039_0000003 Ga0501039_0000003_114155_114409 83
1486 3300049575 Ga0501039_0003603 Ga0501039_0003603_8948_9199 83
1487 3300049575 Ga0501039_0043673 Ga0501039_0043673_1041_1292 83
1488 3300049575 Ga0501039_0130512 Ga0501039_0130512_254_505 83
1489 3300049575 Ga0501039_0160922 Ga0501039_0160922_93_344 83
1490 3300049575 Ga0501039_0389942 Ga0501039_0389942_788_1063 83
1491 3300049575 Ga0501039_0520110 Ga0501039_0520110_115_369 83
1492 3300049575 Ga0501039_0659405 Ga0501039_0659405_255_536 83
1493 3300049575 Ga0501039_1091182 Ga0501039_1091182_304_558 83
1494 3300049576 Ga0501040_0134996 Ga0501040_0134996_176_433 83
1495 3300049576 Ga0501040_0271230 Ga0501040_0271230_90_341 83
1496 3300049577 Ga0501041_0171474 Ga0501041_0171474_1001_1255 83
1497 3300049577 Ga0501041_0371871 Ga0501041_0371871_58_315 83
1498 3300049577 Ga0501041_0402797 Ga0501041_0402797_94_345 83
1499 3300049578 Ga0501042_0022915 Ga0501042_0022915_970_1221 83
1500 3300049578 Ga0501042_0796869 Ga0501042_0796869_296_547 83
1501 3300049578 Ga0501042_0848560 Ga0501042_0848560_54_308 83
1502 3300049579 Ga0501043_0000051 Ga0501043_0000051_1151_1405 83
1503 3300049579 Ga0501043_0000114 Ga0501043_0000114_68656_68931 83
1504 3300049579 Ga0501043_0000298 Ga0501043_0000298_7032_7283 83
1505 3300049579 Ga0501043_0097713 Ga0501043_0097713_523_777 83
1506 3300049579 Ga0501043_0123911 Ga0501043_0123911_474_725 83
1507 3300049579 Ga0501043_0193524 Ga0501043_0193524_225_476 83
1508 3300049579 Ga0501043_0331146 Ga0501043_0331146_239_490 83
1509 3300049579 Ga0501043_0348760 Ga0501043_0348760_185_475 83
1510 3300049579 Ga0501043_0578768 Ga0501043_0578768_164_439 83
1511 3300049579 Ga0501043_0592499 Ga0501043_0592499_515_766 83
1512 3300049579 Ga0501043_0684458 Ga0501043_0684458_209_490 83
1513 3300049579 Ga0501043_0689456 Ga0501043_0689456_131_412 83
1514 3300049579 Ga0501043_0806801 Ga0501043_0806801_140_391 83
1515 3300049580 Ga0501046_0002813 Ga0501046_0002813_9147_9398 83
1516 3300049580 Ga0501046_0210740 Ga0501046_0210740_153_407 83
1517 3300049580 Ga0501046_0222356 Ga0501046_0222356_960_1217 83
1518 3300049580 Ga0501046_0435005 Ga0501046_0435005_670_921 83
1519 3300049580 Ga0501046_0612252 Ga0501046_0612252_470_760 83
1520 3300049580 Ga0501046_0743585 Ga0501046_0743585_92_343 83
1521 3300049580 Ga0501046_1202505 Ga0501046_1202505_254_505 83
1522 3300049581 Ga0501047_0000801 Ga0501047_0000801_3367_3618 83
1523 3300049581 Ga0501047_0003631 Ga0501047_0003631_4646_4897 83
1524 3300049581 Ga0501047_0007205 Ga0501047_0007205_10146_10421 83
1525 3300049581 Ga0501047_0024244 Ga0501047_0024244_82_333 83
1526 3300049581 Ga0501047_0037480 Ga0501047_0037480_2571_2852 83
1527 3300049581 Ga0501047_0056953 Ga0501047_0056953_2264_2515 83
1528 3300049581 Ga0501047_0066964 Ga0501047_0066964_2454_2705 83
1529 3300049581 Ga0501047_0126975 Ga0501047_0126975_1642_1893 83
1530 3300049581 Ga0501047_0135061 Ga0501047_0135061_234_524 83
1531 3300049581 Ga0501047_0160390 Ga0501047_0160390_297_548 83
1532 3300049581 Ga0501047_0296359 Ga0501047_0296359_688_939 83
1533 3300049581 Ga0501047_0314922 Ga0501047_0314922_717_968 83
1534 3300049581 Ga0501047_0317553 Ga0501047_0317553_540_794 83
1535 3300049581 Ga0501047_0397273 Ga0501047_0397273_442_693 83
1536 3300049581 Ga0501047_0538013 Ga0501047_0538013_86_337 83
1537 3300049581 Ga0501047_0640339 Ga0501047_0640339_256_507 83
1538 3300049581 Ga0501047_0713277 Ga0501047_0713277_385_636 83
1539 3300049581 Ga0501047_0765362 Ga0501047_0765362_314_565 83
1540 3300049581 Ga0501047_0821544 Ga0501047_0821544_310_576 83
1541 3300049581 Ga0501047_0870283 Ga0501047_0870283_384_635 83
1542 3300049581 Ga0501047_0957566 Ga0501047_0957566_250_531 83
1543 3300049581 Ga0501047_1159146 Ga0501047_1159146_277_528 83
1544 3300049581 Ga0501047_1261978 Ga0501047_1261978_233_523 83
1545 3300049581 Ga0501047_1330168 Ga0501047_1330168_10_300 83
1546 3300049582 Ga0501048_0005516 Ga0501048_0005516_1100_1351 83
1547 3300049582 Ga0501048_0020520 Ga0501048_0020520_1497_1748 83
1548 3300049582 Ga0501048_0637783 Ga0501048_0637783_165_416 83
1549 3300049582 Ga0501048_0754454 Ga0501048_0754454_246_497 83
1550 3300049583 Ga0501067_0025416 Ga0501067_0025416_2544_2795 83
1551 3300049583 Ga0501067_0085497 Ga0501067_0085497_681_932 83
1552 3300049583 Ga0501067_0148337 Ga0501067_0148337_281_571 83
1553 3300049583 Ga0501067_0277425 Ga0501067_0277425_652_903 83
1554 3300049584 Ga0501068_0021421 Ga0501068_0021421_2350_2601 83
1555 3300049584 Ga0501068_0050259 Ga0501068_0050259_2061_2336 83
1556 3300049584 Ga0501068_0178750 Ga0501068_0178750_546_797 83
1557 3300049584 Ga0501068_0622087 Ga0501068_0622087_323_574 83
1558 3300049584 Ga0501068_1194656 Ga0501068_1194656_94_351 83
1559 3300049585 Ga0501069_0000016 Ga0501069_0000016_7291_7566 83
1560 3300049585 Ga0501069_0003777 Ga0501069_0003777_7109_7384 83
1561 3300049585 Ga0501069_0004450 Ga0501069_0004450_921_1172 83
1562 3300049585 Ga0501069_0035566 Ga0501069_0035566_336_617 83
1563 3300049585 Ga0501069_0046007 Ga0501069_0046007_609_884 83
1564 3300049585 Ga0501069_0053290 Ga0501069_0053290_1582_1833 83
1565 3300049585 Ga0501069_0192208 Ga0501069_0192208_285_536 83
1566 3300049585 Ga0501069_0405145 Ga0501069_0405145_13_294 83
1567 3300049586 Ga0501070_0000186 Ga0501070_0000186_41405_41680 83
1568 3300049586 Ga0501070_0000931 Ga0501070_0000931_9154_9435 83
1569 3300049586 Ga0501070_0006076 Ga0501070_0006076_8312_8563 83
1570 3300049586 Ga0501070_0006421 Ga0501070_0006421_4898_5173 83
1571 3300049586 Ga0501070_0011400 Ga0501070_0011400_2854_3105 83
1572 3300049586 Ga0501070_0025050 Ga0501070_0025050_334_585 83
1573 3300049586 Ga0501070_0107402 Ga0501070_0107402_1104_1379 83
1574 3300049586 Ga0501070_0126598 Ga0501070_0126598_1334_1609 83
1575 3300049586 Ga0501070_0246047 Ga0501070_0246047_850_1101 83
1576 3300049586 Ga0501070_0255729 Ga0501070_0255729_231_482 83
1577 3300049586 Ga0501070_0289420 Ga0501070_0289420_477_728 83
1578 3300049586 Ga0501070_0474697 Ga0501070_0474697_464_745 83
1579 3300049586 Ga0501070_0531996 Ga0501070_0531996_517_768 83
1580 3300049586 Ga0501070_0594590 Ga0501070_0594590_479_730 83
1581 3300049586 Ga0501070_0621858 Ga0501070_0621858_158_415 83
1582 3300049586 Ga0501070_0636116 Ga0501070_0636116_267_548 83
1583 3300049586 Ga0501070_0690710 Ga0501070_0690710_530_781 83
1584 3300049586 Ga0501070_0701238 Ga0501070_0701238_166_456 83
1585 3300049586 Ga0501070_0927086 Ga0501070_0927086_242_493 83
1586 3300049587 Ga0501071_0004977 Ga0501071_0004977_766_1017 83
1587 3300049587 Ga0501071_0013894 Ga0501071_0013894_4890_5165 83
1588 3300049587 Ga0501071_0099158 Ga0501071_0099158_1410_1667 83
1589 3300049587 Ga0501071_0236158 Ga0501071_0236158_625_876 83
1590 3300049587 Ga0501071_0556507 Ga0501071_0556507_308_598 83
1591 3300049587 Ga0501071_0866794 Ga0501071_0866794_151_426 83
1592 3300049587 Ga0501071_1111468 Ga0501071_1111468_147_410 83
1593 3300049588 Ga0501072_0381774 Ga0501072_0381774_479_730 83
1594 3300049588 Ga0501072_0473067 Ga0501072_0473067_669_920 83
1595 3300049588 Ga0501072_0824625 Ga0501072_0824625_30_281 83
1596 3300049588 Ga0501072_0982712 Ga0501072_0982712_341_592 83
1597 3300049589 Ga0501073_0001927 Ga0501073_0001927_1859_2110 83
1598 3300049589 Ga0501073_0031080 Ga0501073_0031080_1125_1376 83
1599 3300049589 Ga0501073_0069860 Ga0501073_0069860_545_796 83
1600 3300049589 Ga0501073_0092940 Ga0501073_0092940_165_446 83
1601 3300049589 Ga0501073_0097234 Ga0501073_0097234_1396_1647 83
1602 3300049589 Ga0501073_0130012 Ga0501073_0130012_951_1202 83
1603 3300049589 Ga0501073_0141309 Ga0501073_0141309_586_837 83
1604 3300049589 Ga0501073_0156523 Ga0501073_0156523_861_1136 83
1605 3300049589 Ga0501073_0169919 Ga0501073_0169919_1139_1390 83
1606 3300049589 Ga0501073_0185341 Ga0501073_0185341_724_999 83
1607 3300049589 Ga0501073_0407456 Ga0501073_0407456_188_439 83
1608 3300049589 Ga0501073_0410190 Ga0501073_0410190_584_835 83
1609 3300049589 Ga0501073_0599732 Ga0501073_0599732_70_327 83
1610 3300049589 Ga0501073_1164911 Ga0501073_1164911_38_295 83
1611 3300049590 Ga0501074_0000831 Ga0501074_0000831_7814_8065 83
1612 3300049590 Ga0501074_0001818 Ga0501074_0001818_8027_8302 83
1613 3300049590 Ga0501074_0047325 Ga0501074_0047325_1921_2172 83
1614 3300049590 Ga0501074_0073258 Ga0501074_0073258_283_534 83
1615 3300049590 Ga0501074_0099182 Ga0501074_0099182_212_493 83
1616 3300049590 Ga0501074_0124714 Ga0501074_0124714_1001_1252 83
1617 3300049590 Ga0501074_0371372 Ga0501074_0371372_373_663 83
1618 3300049590 Ga0501074_0462062 Ga0501074_0462062_280_531 83
1619 3300049590 Ga0501074_0464656 Ga0501074_0464656_385_636 83
1620 3300049590 Ga0501074_0875036 Ga0501074_0875036_24_281 83
1621 3300049590 Ga0501074_1042126 Ga0501074_1042126_194_475 83
1622 3300049590 Ga0501074_1045860 Ga0501074_1045860_307_558 83
1623 3300049590 Ga0501074_1294738 Ga0501074_1294738_159_410 83
1624 3300049591 Ga0501075_0092368 Ga0501075_0092368_537_794 83
1625 3300049591 Ga0501075_0561574 Ga0501075_0561574_397_648 83
1626 3300049592 Ga0501076_0096701 Ga0501076_0096701_351_602 83
1627 3300049592 Ga0501076_0145684 Ga0501076_0145684_785_1042 83
1628 3300049592 Ga0501076_0442465 Ga0501076_0442465_404_655 83
1629 3300049592 Ga0501076_0692037 Ga0501076_0692037_140_391 83
1630 3300049592 Ga0501076_1281469 Ga0501076_1281469_100_351 83
1631 3300049593 Ga0501077_0072866 Ga0501077_0072866_1213_1464 83
1632 3300049593 Ga0501077_0153358 Ga0501077_0153358_958_1209 83
1633 3300049593 Ga0501077_0220110 Ga0501077_0220110_338_589 83
1634 3300049593 Ga0501077_0266593 Ga0501077_0266593_720_977 83
1635 3300049593 Ga0501077_0409219 Ga0501077_0409219_470_721 83
1636 3300049663 Ga0501223_094886 Ga0501223_094886_75_326 83
1637 3300049671 Ga0501238_011525 Ga0501238_011525_19_270 83
1638 3300049741 Ga0501079_0010606 Ga0501079_0010606_2143_2394 83
1639 3300049741 Ga0501079_0085851 Ga0501079_0085851_304_555 83
1640 3300049741 Ga0501079_0095573 Ga0501079_0095573_1299_1574 83
1641 3300049741 Ga0501079_0409423 Ga0501079_0409423_761_1012 83
1642 3300049741 Ga0501079_1328203 Ga0501079_1328203_130_381 83
1643 3300049742 Ga0501080_0001450 Ga0501080_0001450_18249_18530 83
1644 3300049742 Ga0501080_0004427 Ga0501080_0004427_11222_11497 83
1645 3300049742 Ga0501080_0005392 Ga0501080_0005392_1508_1759 83
1646 3300049742 Ga0501080_0011492 Ga0501080_0011492_2838_3113 83
1647 3300049742 Ga0501080_0027959 Ga0501080_0027959_598_849 83
1648 3300049742 Ga0501080_0033685 Ga0501080_0033685_2195_2470 83
1649 3300049742 Ga0501080_0106323 Ga0501080_0106323_1813_2064 83
1650 3300049742 Ga0501080_0149501 Ga0501080_0149501_452_703 83
1651 3300049742 Ga0501080_0369916 Ga0501080_0369916_706_957 83
1652 3300049742 Ga0501080_0655661 Ga0501080_0655661_247_498 83
1653 3300049742 Ga0501080_0737411 Ga0501080_0737411_513_794 83
1654 3300049742 Ga0501080_0805636 Ga0501080_0805636_520_771 83
1655 3300049743 Ga0501081_0750904 Ga0501081_0750904_150_401 83
1656 3300049743 Ga0501081_0906220 Ga0501081_0906220_70_321 83
1657 3300049744 Ga0501083_0000111 Ga0501083_0000111_8091_8366 83
1658 3300049744 Ga0501083_0001724 Ga0501083_0001724_9112_9363 83
1659 3300049744 Ga0501083_0003402 Ga0501083_0003402_1858_2109 83
1660 3300049744 Ga0501083_0150491 Ga0501083_0150491_61_351 83
1661 3300049744 Ga0501083_0267327 Ga0501083_0267327_203_454 83
1662 3300049744 Ga0501083_0267625 Ga0501083_0267625_145_396 83
1663 3300049744 Ga0501083_0287392 Ga0501083_0287392_773_1024 83
1664 3300049744 Ga0501083_0615441 Ga0501083_0615441_389_640 83
1665 3300049744 Ga0501083_0679520 Ga0501083_0679520_271_522 83
1666 3300049744 Ga0501083_0701017 Ga0501083_0701017_340_591 83
1667 3300049744 Ga0501083_0910504 Ga0501083_0910504_281_532 83
1668 3300049744 Ga0501083_0929007 Ga0501083_0929007_90_341 83
1669 3300049744 Ga0501083_1041056 Ga0501083_1041056_227_478 83
1670 3300049776 Ga0501280_001370 Ga0501280_001370_2852_3106 83
1671 3300049822 Ga0501035_0000022 Ga0501035_0000022_74703_74954 83
1672 3300049822 Ga0501035_0000102 Ga0501035_0000102_105551_105805 83
1673 3300049822 Ga0501035_0000690 Ga0501035_0000690_33128_33409 83
1674 3300049822 Ga0501035_0000752 Ga0501035_0000752_14388_14678 83
1675 3300049822 Ga0501035_0001093 Ga0501035_0001093_2689_2964 83
1676 3300049822 Ga0501035_0001914 Ga0501035_0001914_9034_9309 83
1677 3300049822 Ga0501035_0012136 Ga0501035_0012136_5433_5723 83
1678 3300049822 Ga0501035_0029146 Ga0501035_0029146_984_1235 83
1679 3300049822 Ga0501035_0098972 Ga0501035_0098972_1793_2047 83
1680 3300049822 Ga0501035_0108729 Ga0501035_0108729_618_869 83
1681 3300049822 Ga0501035_0109655 Ga0501035_0109655_64_315 83
1682 3300049822 Ga0501035_0117013 Ga0501035_0117013_908_1159 83
1683 3300049822 Ga0501035_0158230 Ga0501035_0158230_392_673 83
1684 3300049822 Ga0501035_0174693 Ga0501035_0174693_487_738 83
1685 3300049822 Ga0501035_0183865 Ga0501035_0183865_418_669 83
1686 3300049822 Ga0501035_0420319 Ga0501035_0420319_280_531 83
1687 3300049822 Ga0501035_0565260 Ga0501035_0565260_345_596 83
1688 3300049822 Ga0501035_0664206 Ga0501035_0664206_207_497 83
1689 3300049822 Ga0501035_0915627 Ga0501035_0915627_35_310 83
1690 3300049823 Ga0501044_0000002 Ga0501044_0000002_181951_182202 83
1691 3300049823 Ga0501044_0000003 Ga0501044_0000003_81893_82168 83
1692 3300049823 Ga0501044_0000255 Ga0501044_0000255_29538_29789 83
1693 3300049823 Ga0501044_0002922 Ga0501044_0002922_4745_5026 83
1694 3300049823 Ga0501044_0016909 Ga0501044_0016909_1380_1631 83
1695 3300049823 Ga0501044_0021665 Ga0501044_0021665_2810_3100 83
1696 3300049823 Ga0501044_0022140 Ga0501044_0022140_334_585 83
1697 3300049823 Ga0501044_0049355 Ga0501044_0049355_2885_3139 83
1698 3300049823 Ga0501044_0070221 Ga0501044_0070221_759_1010 83
1699 3300049823 Ga0501044_0082154 Ga0501044_0082154_2737_3012 83
1700 3300049823 Ga0501044_0089157 Ga0501044_0089157_693_947 83
1701 3300049823 Ga0501044_0098827 Ga0501044_0098827_2262_2543 83
1702 3300049823 Ga0501044_0131509 Ga0501044_0131509_629_919 83
1703 3300049823 Ga0501044_0156921 Ga0501044_0156921_607_858 83
1704 3300049823 Ga0501044_0164118 Ga0501044_0164118_909_1199 83
1705 3300049823 Ga0501044_0296069 Ga0501044_0296069_700_951 83
1706 3300049823 Ga0501044_0500508 Ga0501044_0500508_536_811 83
1707 3300049823 Ga0501044_0640775 Ga0501044_0640775_379_630 83
1708 3300049823 Ga0501044_0890514 Ga0501044_0890514_492_743 83
1709 3300049823 Ga0501044_1144578 Ga0501044_1144578_255_509 83
1710 3300049823 Ga0501044_1435774 Ga0501044_1435774_158_439 83
1711 3300049824 Ga0501045_0005999 Ga0501045_0005999_5917_6168 83
1712 3300049824 Ga0501045_0048465 Ga0501045_0048465_2225_2482 83
1713 3300049824 Ga0501045_0270327 Ga0501045_0270327_667_918 83
1714 3300049824 Ga0501045_0448015 Ga0501045_0448015_577_828 83
1715 3300049824 Ga0501045_0689354 Ga0501045_0689354_264_515 83
1716 3300049824 Ga0501045_1285448 Ga0501045_1285448_116_367 83
1717 3300050489 nmdc:mga03683_139460_c1 nmdc:mga03683_139460_c1_236_493 83
1718 3300050490 nmdc:mga03n38_431760_c1 nmdc:mga03n38_431760_c1_309_566 83
1719 3300050490 nmdc:mga03n38_633722_c1 nmdc:mga03n38_633722_c1_60_317 83
1720 3300050490 nmdc:mga03n38_85051_c1 nmdc:mga03n38_85051_c1_141_395 83
1721 3300050490 nmdc:mga03n38_902838_c1 nmdc:mga03n38_902838_c1_110_370 83
1722 3300050491 nmdc:mga00v17_115_c2 nmdc:mga00v17_115_c2_44886_45146 83
1723 3300050491 nmdc:mga00v17_300630_c1 nmdc:mga00v17_300630_c1_107_364 83
1724 3300050492 nmdc:mga0yw44_102224_c1 nmdc:mga0yw44_102224_c1_784_1041 83
1725 3300050492 nmdc:mga0yw44_141277_c1 nmdc:mga0yw44_141277_c1_634_894 83
1726 3300050492 nmdc:mga0yw44_184850_c1 nmdc:mga0yw44_184850_c1_1043_1297 83
1727 3300050492 nmdc:mga0yw44_240571_c1 nmdc:mga0yw44_240571_c1_245_502 83
1728 3300050492 nmdc:mga0yw44_332942_c1 nmdc:mga0yw44_332942_c1_528_782 83
1729 3300050492 nmdc:mga0yw44_66004_c1 nmdc:mga0yw44_66004_c1_22_279 83
1730 3300050492 nmdc:mga0yw44_81368_c1 nmdc:mga0yw44_81368_c1_47_307 83
1731 3300050493 nmdc:mga0k408_36900_c1 nmdc:mga0k408_36900_c1_695_949 83
1732 3300050493 nmdc:mga0k408_658257_c1 nmdc:mga0k408_658257_c1_343_600 83
1733 3300050494 nmdc:mga06z11_197649_c1 nmdc:mga06z11_197649_c1_476_754 83
1734 3300050494 nmdc:mga06z11_222987_c1 nmdc:mga06z11_222987_c1_184_441 83
1735 3300050494 nmdc:mga06z11_23123_c1 nmdc:mga06z11_23123_c1_1022_1276 83
1736 3300050494 nmdc:mga06z11_66941_c1 nmdc:mga06z11_66941_c1_1623_1877 83
1737 3300050494 nmdc:mga06z11_821366_c1 nmdc:mga06z11_821366_c1_71_322 83
1738 3300050495 nmdc:mga04h51_33389_c1 nmdc:mga04h51_33389_c1_384_638 83
1739 3300050496 nmdc:mga07m45_229620_c1 nmdc:mga07m45_229620_c1_736_990 83
1740 3300050496 nmdc:mga07m45_28926_c1 nmdc:mga07m45_28926_c1_1363_1620 83
1741 3300050496 nmdc:mga07m45_845887_c1 nmdc:mga07m45_845887_c1_193_453 83
1742 3300050511 nmdc:mga08y16_453195_c1 nmdc:mga08y16_453195_c1_159_419 83
1743 3300050516 nmdc:mga0sz30_16635_c1 nmdc:mga0sz30_16635_c1_340_594 83
1744 3300050516 nmdc:mga0sz30_193405_c1 nmdc:mga0sz30_193405_c1_236_493 83
1745 3300050516 nmdc:mga0sz30_263223_c1 nmdc:mga0sz30_263223_c1_83_340 83
1746 3300050516 nmdc:mga0sz30_39361_c1 nmdc:mga0sz30_39361_c1_966_1259 83
1747 3300050516 nmdc:mga0sz30_77891_c1 nmdc:mga0sz30_77891_c1_384_662 83
1748 3300053078 Ga0495612_0137474 Ga0495612_0137474_676_927 83
1749 3300053083 Ga0495655_0111615 Ga0495655_0111615_539_796 83
1750 3300053083 Ga0495655_0277816 Ga0495655_0277816_258_518 83
1751 3300053084 Ga0495595_0539691 Ga0495595_0539691_206_457 83
1752 3300053085 Ga0495619_0041037 Ga0495619_0041037_1536_1787 83
1753 3300053087 Ga0500643_010419 Ga0500643_010419_522_776 83
1754 3300053088 Ga0500644_0014616 Ga0500644_0014616_1182_1439 83
1755 3300053090 Ga0500646_0218015 Ga0500646_0218015_258_509 83
1756 3300053093 Ga0500651_0400215 Ga0500651_0400215_205_459 83
1757 3300053108 Ga0500562_148309 Ga0500562_148309_283_549 83
1758 3300053116 Ga0500592_074338 Ga0500592_074338_89_349 83
1759 3300053119 Ga0500595_037747 Ga0500595_037747_882_1139 83
1760 3300053121 Ga0500607_264271 Ga0500607_264271_122_403 83
1761 3300053125 Ga0500618_012633 Ga0500618_012633_113_376 83
1762 3300053126 Ga0500621_166484 Ga0500621_166484_275_532 83
1763 3300053130 Ga0500642_0460303 Ga0500642_0460303_157_423 83
1764 3300053134 Ga0500658_0103484 Ga0500658_0103484_821_1075 83
1765 3300053136 Ga0500559_0318752 Ga0500559_0318752_145_399 83
1766 3300053139 Ga0500568_0000143 Ga0500568_0000143_34526_34792 83
1767 3300053139 Ga0500568_0003084 Ga0500568_0003084_1291_1545 83
1768 3300053139 Ga0500568_0314746 Ga0500568_0314746_22_276 83
1769 3300053139 Ga0500568_0365473 Ga0500568_0365473_202_459 83
1770 3300053148 Ga0500590_001637 Ga0500590_001637_1350_1604 83
1771 3300053151 Ga0500604_0132226 Ga0500604_0132226_306_560 83
1772 3300053153 Ga0500616_0001190 Ga0500616_0001190_9247_9504 83
1773 3300053153 Ga0500616_0059686 Ga0500616_0059686_637_918 83
1774 3300053153 Ga0500616_0133505 Ga0500616_0133505_121_375 83
1775 3300053153 Ga0500616_0140386 Ga0500616_0140386_226_480 83
1776 3300053155 Ga0500620_003773 Ga0500620_003773_134_391 83
1777 3300053156 Ga0500622_0000364 Ga0500622_0000364_33048_33305 83
1778 3300053156 Ga0500622_0000757 Ga0500622_0000757_2039_2293 83
1779 3300053156 Ga0500622_0231560 Ga0500622_0231560_377_634 83
1780 3300053157 Ga0500624_093001 Ga0500624_093001_287_541 83
1781 3300053158 Ga0500627_0127639 Ga0500627_0127639_59_316 83
1782 3300053158 Ga0500627_0166663 Ga0500627_0166663_26_283 83
1783 3300053158 Ga0500627_0228484 Ga0500627_0228484_75_332 83
1784 3300053158 Ga0500627_0295216 Ga0500627_0295216_400_660 83
1785 3300053158 Ga0500627_0299371 Ga0500627_0299371_31_288 83
1786 3300053158 Ga0500627_0346384 Ga0500627_0346384_281_541 83
1787 3300053160 Ga0500633_0005625 Ga0500633_0005625_211_465 83
1788 3300053161 Ga0500634_0002302 Ga0500634_0002302_5292_5546 83
1789 3300053161 Ga0500634_0404040 Ga0500634_0404040_118_399 83
1790 3300053177 Ga0500636_0008368 Ga0500636_0008368_1386_1667 83
1791 3300053727 Ga0500611_050029 Ga0500611_050029_567_818 83
1792 3300053730 Ga0500645_036989 Ga0500645_036989_202_453 83
1793 3300053730 Ga0500645_180497 Ga0500645_180497_39_296 83
1794 3300053734 Ga0500565_078516 Ga0500565_078516_231_485 83
1795 3300054114 Ga0501084_0011781 Ga0501084_0011781_5341_5592 83
1796 3300054114 Ga0501084_0318848 Ga0501084_0318848_993_1244 83
1797 3300054114 Ga0501084_0425202 Ga0501084_0425202_50_301 83
1798 3300054114 Ga0501084_0863401 Ga0501084_0863401_247_498 83
1799 3300054114 Ga0501084_1043279 Ga0501084_1043279_299_550 83
1800 3300054114 Ga0501084_1214317 Ga0501084_1214317_70_327 83
1801 3300054114 Ga0501084_1331957 Ga0501084_1331957_165_440 83
1802 3300054114 Ga0501084_1551807 Ga0501084_1551807_248_499 83
1803 3300059508 Ga0587088_130745 Ga0587088_130745_254_508 83
1804 3300059641 Ga0587068_110313 Ga0587068_110313_230_484 83
1805 3300060353 Ga0501082_0006649 Ga0501082_0006649_5022_5273 83
1806 3300060353 Ga0501082_0028296 Ga0501082_0028296_1412_1663 83
1807 3300060353 Ga0501082_0153547 Ga0501082_0153547_597_872 83
1808 3300060353 Ga0501082_0175464 Ga0501082_0175464_1241_1492 83
1809 3300060353 Ga0501082_0201294 Ga0501082_0201294_349_600 83
1810 3300060353 Ga0501082_0294964 Ga0501082_0294964_96_347 83
1811 3300060353 Ga0501082_0321173 Ga0501082_0321173_557_814 83
1812 3300060353 Ga0501082_0397747 Ga0501082_0397747_438_689 83
1813 3300060353 Ga0501082_0476446 Ga0501082_0476446_12_302 83
1814 3300060353 Ga0501082_1495677 Ga0501082_1495677_237_488 83
1815 iso_pu_bacteria 2513237351 2514588156 83
1816 iso_pu_bacteria 2643221733 2644731719 83
1817 iso_pu_bacteria 2643221736 2644745220 83
1818 iso_pu_bacteria 2818991467 2819719297 83
1819 iso_pu_bacteria 2841760612 2841760724 83
1820 iso_pu_bacteria 2841911363 2841915795 83
1821 iso_pu_bacteria 2841917233 2841921824 83
1822 iso_pu_bacteria 2844104063 2844106381 83
1823 iso_pu_bacteria 2851182111 2851187331 83
1824 iso_pu_bacteria 2851246043 2851246737 83
1825 iso_pu_bacteria 2917699015 2917704511 83
1826 iso_pu_bacteria 8057529695 8057531067 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

17

97

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8762 1 83
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8663 1 83
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8295 2 83
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.7986 2 83
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.7857 2 83
ID Description Score Start End Superfamily
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8759 1 78 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8678 2 83 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8446 1 78 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8386 2 83 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8324 2 83 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A531KZU9-F1-model_v4 deleted 0.9985 1 79
AF-A0A531ML93-F1-model_v4 Molybdopterin converting factor subunit 1 0.996 1 79
AF-A0A529KCI5-F1-model_v4 Molybdopterin converting factor subunit 1 0.9954 1 80
AF-A0A4U6CC69-F1-model_v4 Molybdopterin converting factor subunit 1 0.9928 1 83
AF-A0A1V8RJ62-F1-model_v4 Molybdopterin converting factor subunit 1 0.9884 1 83

Feature Viewer

pLDDT pTM Quality
95.36 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map