F495805
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1823 | 921 | 1365 | 570 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0000282|Ga0373927_0000282_2201_4090 |
| Length | 629 |
| Sequence | MNYKGHVPCSVVFVGDPGDHQACASFRQAILRLRLPISFTVSSERFAGIRRTIERRVPMKKLRSQEWFGRQDKMGFLYRSWMQNQGRPHDLFEGRPVIGICNTWSELTPCNGHFRELADFVKRGVWEAGGFPLEFPVMSLGETLLRPTAMLFRNLASMDVEESIRGNPLDGVVLLMGCDKTTPSLLMGAASCDLPTIGLSGGPMLSGKFHGHDLGSGTGVWQMCERVSSGEMKLAEFFEAESCMHRSKGHCMTMGTASTMASMVEALGISLPGNAAIPAVDARRNVLAQMTGRRIVQMVQEDLRMSSILTRTAFENAIRANAAIGGSTNAVIHLIAIAGRIGVPLALDDFDRLGSALPCLVDLQPSGQYLMEDFFYAGGLPAVLRELAEAGVLDRDALTVNGKTIGENIADAPCWNRSVIHTFSDPFKPRAGITVLRGNLAPNGAVIKLSAASPHLLQHRGRAVVFDSIEDFHSRINDEALDIDESCVMVLKNCGPRGYPGMAEVGNMPLPPKLLRKGVTDMVRISDARMSGTAYGTVVLHISPEAAAGGPLALVQSGDMVALDVAQRVIRLDVDDATLAARRSKWTSPSLPARGWERLYVEHVQQAHLGADLDFLVGHSGARVARDSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 4 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 11 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 15 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 16 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 17 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 18 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 21 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 22 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 23 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 24 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 25 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 26 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 27 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 28 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 29 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 30 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 31 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 32 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 33 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 34 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 35 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 36 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 37 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 38 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 39 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 40 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 41 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 42 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 43 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 44 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 45 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 46 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 47 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 48 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 49 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 50 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 51 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 52 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 53 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 54 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 55 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 56 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 57 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 58 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 59 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 60 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 61 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 62 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 63 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 64 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 65 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 66 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 67 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 68 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 69 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 70 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 71 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 72 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 73 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 74 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 75 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 76 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 77 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 78 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 79 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 80 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 81 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 82 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 83 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 84 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 85 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 86 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 87 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 88 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 89 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 90 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 91 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 92 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 93 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 94 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 95 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 96 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 97 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 98 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 99 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 100 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 101 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 102 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 103 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 104 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 105 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 106 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 107 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 108 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 109 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 110 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 111 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 112 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 113 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 114 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 115 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 116 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 117 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 118 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 119 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 120 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 121 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 122 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 123 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 124 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 125 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 126 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 127 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 128 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 129 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 130 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 131 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 132 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 133 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 134 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 135 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 136 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 137 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 138 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 139 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 140 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 141 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 142 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 143 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 144 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 145 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 146 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 147 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 148 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 149 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 150 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 151 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 152 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 153 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 154 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 155 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 156 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 157 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 158 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 159 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 160 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 161 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 162 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 163 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 164 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 165 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 166 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 167 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 168 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 169 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 170 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 171 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 172 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 173 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 174 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 175 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 176 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 177 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 178 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 179 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 180 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 181 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 182 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 183 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 184 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 185 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 186 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 187 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 188 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 189 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 190 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 191 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 192 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 193 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 194 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 195 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 196 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 197 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 198 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 199 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 200 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 201 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 202 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 203 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 204 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 205 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 206 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 207 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 208 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 209 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 210 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 211 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 212 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 213 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 214 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 215 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 216 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 217 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 218 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 219 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 220 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 221 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 222 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 223 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 224 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 225 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 226 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 227 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 228 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 229 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 230 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 231 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 232 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 233 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 234 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 235 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 236 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 237 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 238 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 239 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 240 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 241 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 242 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 243 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 244 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 245 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 246 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 247 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 248 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 249 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 250 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 251 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 252 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 253 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 254 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 255 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 256 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 257 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 258 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 259 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 260 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 261 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 262 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 263 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 264 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 265 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 266 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 267 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 268 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 269 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 270 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 271 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 272 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 273 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 274 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 275 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 276 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 277 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 278 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 279 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 280 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 281 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 282 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 283 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 284 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 285 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 286 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 287 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 288 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 289 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 290 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 291 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 292 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 293 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 294 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 295 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 296 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 297 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 298 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 299 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 300 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 301 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 302 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 303 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 304 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 305 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 306 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 307 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 308 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 309 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 310 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 311 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 312 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 313 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 314 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 315 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 316 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 317 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 318 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 319 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 320 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 321 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 322 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 323 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 324 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 325 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 326 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 327 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 328 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 329 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 330 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 331 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 332 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 333 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 334 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 335 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 336 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 337 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 338 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 339 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 340 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 341 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 342 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 343 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 344 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 345 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 346 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 347 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 348 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 349 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 350 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 351 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 352 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 353 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 354 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 355 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 356 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 357 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 358 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 359 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 360 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 361 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 362 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 363 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 364 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 365 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 366 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 367 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 368 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 369 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 370 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 371 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 372 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 373 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 374 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 375 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 376 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 377 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 378 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 379 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 380 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 381 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 382 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 383 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 384 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 385 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 386 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 387 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 388 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 389 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 390 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 391 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 392 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 393 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 394 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 395 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 396 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 397 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 398 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 399 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 400 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 401 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 402 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 403 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 404 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 405 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 406 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 407 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 408 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 409 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 410 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 411 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 412 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 413 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 414 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 415 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 416 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 417 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 418 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 419 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 420 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 421 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 422 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 423 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 424 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 425 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 426 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 427 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 428 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 429 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 430 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 431 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 432 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 433 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 434 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 435 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 436 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 437 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 438 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 439 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 440 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 441 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 442 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 443 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 444 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 445 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 446 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 447 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 448 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 449 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 450 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 451 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 452 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 453 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 454 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 456 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 457 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 458 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 459 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 460 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 461 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 462 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 463 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 464 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 465 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 466 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 467 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 468 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 469 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 470 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 471 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 472 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 474 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 475 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 476 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 477 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 478 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 479 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 480 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 481 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 482 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 483 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 484 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 485 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 486 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 487 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 488 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 489 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 490 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 491 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 492 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 493 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 494 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 495 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 496 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 497 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 498 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 499 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 500 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 501 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 502 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 503 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 504 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 505 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 506 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 507 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 508 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 509 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 510 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 511 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 512 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 513 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 514 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 515 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 517 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 518 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 519 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 520 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 521 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 522 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 523 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 525 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 526 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 527 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 528 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 529 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 531 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 533 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 534 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 535 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 538 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 539 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 541 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 542 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 543 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 544 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 545 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 548 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 550 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 553 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 557 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 558 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 559 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 561 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 562 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 563 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 564 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 565 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 566 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 567 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 568 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 569 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 570 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 577 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 578 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 581 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 584 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 585 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 586 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 589 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 590 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 592 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 594 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 595 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 656 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 658 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 661 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 662 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 666 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 667 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 668 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 669 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 670 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 671 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 672 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 673 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 674 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 675 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 676 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 677 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 678 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 679 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 680 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 681 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 682 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 683 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 684 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 685 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 686 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 687 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 688 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 689 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 690 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 691 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 692 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 693 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 694 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 695 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 696 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 697 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 698 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 699 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 700 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 701 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 702 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 703 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 704 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 705 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 706 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 707 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 708 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 709 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 710 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 711 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 712 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 713 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 714 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 715 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 716 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 717 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 718 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 719 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 720 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 721 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 722 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 723 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 724 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 725 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 726 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 727 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 728 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 729 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 730 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 731 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 732 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 733 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 734 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 735 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 736 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 737 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 738 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 739 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 740 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 741 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 742 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 743 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 744 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 745 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 746 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 747 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 748 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 749 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 750 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 751 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 752 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 753 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 754 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 755 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 808 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 809 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 810 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 811 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 812 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 813 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 814 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 815 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 816 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 817 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 818 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 819 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 820 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 821 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 822 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 823 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 824 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 825 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 826 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 827 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 828 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 829 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 830 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 831 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 832 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 833 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 834 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 835 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 836 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 837 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 839 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 840 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 841 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 842 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 843 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 844 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 845 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 846 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 847 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 848 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 849 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 850 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 851 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 852 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 853 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 854 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 855 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 856 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 857 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 858 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 859 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 860 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 861 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 862 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 863 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 864 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 865 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 866 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 867 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 868 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 869 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 870 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 871 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 872 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 873 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 874 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 875 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 876 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 877 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 878 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 879 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 880 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 882 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 883 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 884 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 885 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 886 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 887 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 888 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 889 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 890 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 891 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 892 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 893 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 894 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 895 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 896 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 897 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 898 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 899 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 900 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 901 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 902 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 903 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 904 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 905 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 906 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 907 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 908 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 909 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 910 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 911 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 912 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 913 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 914 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 915 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 916 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 917 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 918 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 919 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 920 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 921 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.33 |
| Metatranscriptomes | 0.55 |
| Isolates | 25.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.13 |
| Nodule | 20.46 |
| Rhizoplane | 2.14 |
| Rhizosphere | 63.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_295801 | 2162886007 | Bacteria | 2176 |
| 2 | JGI24740J21852_10000201 | 3300001979 | Bacteria | 24790 |
| 3 | JGI24739J22299_10001200 | 3300001989 | Bacteria | 9693 |
| 4 | JGI24739J22299_10005441 | 3300001989 | Bacteria | 4838 |
| 5 | JGI24737J22298_10001648 | 3300001990 | Bacteria | 7969 |
| 6 | JGI25155J39150_1000014 | 3300002704 | Bacteria | 196159 |
| 7 | JGI25156J39149_1000083 | 3300002705 | Bacteria | 70138 |
| 8 | JGI25156J39149_1003633 | 3300002705 | Bacteria | 4970 |
| 9 | JGI25162J39368_1000532 | 3300002737 | Bacteria | 28366 |
| 10 | JGI25162J39368_1002261 | 3300002737 | Bacteria | 7807 |
| 11 | JGI25162J39368_1003823 | 3300002737 | Bacteria | 3967 |
| 12 | JGI25154J39366_1000052 | 3300002738 | Bacteria | 120209 |
| 13 | JGI25154J39366_1000080 | 3300002738 | Bacteria | 89374 |
| 14 | JGI25154J39366_1000139 | 3300002738 | Bacteria | 56829 |
| 15 | JGI25157J39369_1000110 | 3300002741 | Bacteria | 69643 |
| 16 | JGI25157J39369_1000256 | 3300002741 | Bacteria | 39240 |
| 17 | JGI25157J39369_1001300 | 3300002741 | Bacteria | 10003 |
| 18 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 19 | JGI25159J45721_1000251 | 3300002987 | Bacteria | 25319 |
| 20 | JGI25151J46595_10000586 | 3300003187 | Bacteria | 32351 |
| 21 | JGI25151J46595_10001193 | 3300003187 | Bacteria | 18647 |
| 22 | JGI25165J46597_1000641 | 3300003214 | Bacteria | 28973 |
| 23 | JGI25165J46597_1000692 | 3300003214 | Bacteria | 26996 |
| 24 | JGI25165J46597_1001949 | 3300003214 | Bacteria | 8120 |
| 25 | JGI25153J46596_10002621 | 3300003215 | Bacteria | 10289 |
| 26 | rootH1_10027701 | 3300003316 | Bacteria | 3466 |
| 27 | rootH1_10078771 | 3300003316 | Bacteria | 2953 |
| 28 | rootH1_10000759 | 3300003323 | Bacteria | 51501 |
| 29 | rootH1_10001237 | 3300003323 | Bacteria | 16036 |
| 30 | rootH1_10019846 | 3300003323 | Bacteria | 13232 |
| 31 | rootH1_10091236 | 3300003323 | Bacteria | 6919 |
| 32 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 33 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 34 | JGI25160J50197_1002128 | 3300003354 | Bacteria | 9395 |
| 35 | JGI25160J50197_1005585 | 3300003354 | Bacteria | 5208 |
| 36 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 37 | JGI25161J50226_1002682 | 3300003374 | Bacteria | 4421 |
| 38 | Ga0055539_1001711 | 3300003752 | Bacteria | 3868 |
| 39 | Ga0055533_1002287 | 3300003756 | Bacteria | 4447 |
| 40 | Ga0055525_1000043 | 3300003759 | Bacteria | 268656 |
| 41 | Ga0055527_1000305 | 3300003760 | Bacteria | 27630 |
| 42 | Ga0055527_1000393 | 3300003760 | Bacteria | 18682 |
| 43 | Ga0055535_1000652 | 3300003761 | Bacteria | 27630 |
| 44 | Ga0055535_1000974 | 3300003761 | Bacteria | 18682 |
| 45 | Ga0055542_1000672 | 3300003762 | Bacteria | 27630 |
| 46 | Ga0055542_1000970 | 3300003762 | Bacteria | 18685 |
| 47 | Ga0055529_1000620 | 3300003763 | Bacteria | 26580 |
| 48 | Ga0055529_1000818 | 3300003763 | Bacteria | 18682 |
| 49 | Ga0055526_1000723 | 3300003771 | Bacteria | 24955 |
| 50 | Ga0055526_1010357 | 3300003771 | Bacteria | 4351 |
| 51 | Ga0055526_1019460 | 3300003771 | Bacteria | 2473 |
| 52 | Ga0055524_1022102 | 3300003775 | Bacteria | 2088 |
| 53 | Ga0055536_1000219 | 3300003781 | Bacteria | 46718 |
| 54 | Ga0055536_1003998 | 3300003781 | Bacteria | 7700 |
| 55 | Ga0055534_1001363 | 3300003784 | Bacteria | 9779 |
| 56 | Ga0055528_1000246 | 3300003790 | Bacteria | 45702 |
| 57 | Ga0055530_10003361 | 3300003791 | Bacteria | 9163 |
| 58 | Ga0055530_10013503 | 3300003791 | Bacteria | 2783 |
| 59 | Ga0055531_10000048 | 3300003794 | Bacteria | 131142 |
| 60 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 61 | Ga0055543_1000089 | 3300004625 | Bacteria | 79924 |
| 62 | Ga0055543_1000102 | 3300004625 | Bacteria | 73861 |
| 63 | Ga0055543_1009724 | 3300004625 | Bacteria | 2049 |
| 64 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 65 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 66 | Ga0065165_1000124 | 3300005262 | Bacteria | 130515 |
| 67 | Ga0065165_1004243 | 3300005262 | Bacteria | 9096 |
| 68 | Ga0065704_10103010 | 3300005289 | Bacteria | 2186 |
| 69 | Ga0065712_10015539 | 3300005290 | Bacteria | 2213 |
| 70 | Ga0070658_10000053 | 3300005327 | Bacteria | 116207 |
| 71 | Ga0070658_10021249 | 3300005327 | Bacteria | 5201 |
| 72 | Ga0070658_10025804 | 3300005327 | Bacteria | 4711 |
| 73 | Ga0070658_10034021 | 3300005327 | Bacteria | 4101 |
| 74 | Ga0070658_10096835 | 3300005327 | Bacteria | 2436 |
| 75 | Ga0070676_10000108 | 3300005328 | Bacteria | 30064 |
| 76 | Ga0070676_10008665 | 3300005328 | Bacteria | 5487 |
| 77 | Ga0070676_10016033 | 3300005328 | Bacteria | 4138 |
| 78 | Ga0070683_100001109 | 3300005329 | Bacteria | 20315 |
| 79 | Ga0070683_100007379 | 3300005329 | Bacteria | 9289 |
| 80 | Ga0070683_100011555 | 3300005329 | Bacteria | 7641 |
| 81 | Ga0070683_100038807 | 3300005329 | Bacteria | 4367 |
| 82 | Ga0070683_100043783 | 3300005329 | Bacteria | 4125 |
| 83 | Ga0070683_100119600 | 3300005329 | Bacteria | 2488 |
| 84 | Ga0070690_100048350 | 3300005330 | Bacteria | 2708 |
| 85 | Ga0070670_100001436 | 3300005331 | Bacteria | 19172 |
| 86 | Ga0070670_100002168 | 3300005331 | Bacteria | 16128 |
| 87 | Ga0070670_100044896 | 3300005331 | Bacteria | 3798 |
| 88 | Ga0070670_100097870 | 3300005331 | Bacteria | 2524 |
| 89 | Ga0070677_10006483 | 3300005333 | Bacteria | 3889 |
| 90 | Ga0068869_100001825 | 3300005334 | Bacteria | 12787 |
| 91 | Ga0068869_100015842 | 3300005334 | Bacteria | 5070 |
| 92 | Ga0068869_100030435 | 3300005334 | Bacteria | 3789 |
| 93 | Ga0068869_100090464 | 3300005334 | Bacteria | 2300 |
| 94 | Ga0070666_10000052 | 3300005335 | Bacteria | 99095 |
| 95 | Ga0070666_10013814 | 3300005335 | Bacteria | 5131 |
| 96 | Ga0070666_10031350 | 3300005335 | Bacteria | 3509 |
| 97 | Ga0070680_100011873 | 3300005336 | Bacteria | 6757 |
| 98 | Ga0070680_100027164 | 3300005336 | Bacteria | 4584 |
| 99 | Ga0070682_100006411 | 3300005337 | Bacteria | 6610 |
| 100 | Ga0070682_100012555 | 3300005337 | Bacteria | 4858 |
| 101 | Ga0070682_100049077 | 3300005337 | Bacteria | 2631 |
| 102 | Ga0068868_100000489 | 3300005338 | Bacteria | 26346 |
| 103 | Ga0068868_100003695 | 3300005338 | Bacteria | 10685 |
| 104 | Ga0068868_100008536 | 3300005338 | Bacteria | 7336 |
| 105 | Ga0068868_100041896 | 3300005338 | Bacteria | 3570 |
| 106 | Ga0068868_100083497 | 3300005338 | Bacteria | 2564 |
| 107 | Ga0070660_100009031 | 3300005339 | Bacteria | 6994 |
| 108 | Ga0070660_100009871 | 3300005339 | Bacteria | 6732 |
| 109 | Ga0070660_100046674 | 3300005339 | Bacteria | 3321 |
| 110 | Ga0070689_100016986 | 3300005340 | Bacteria | 5338 |
| 111 | Ga0070689_100068108 | 3300005340 | Bacteria | 2776 |
| 112 | Ga0070689_100127268 | 3300005340 | Bacteria | 2039 |
| 113 | Ga0070687_100006553 | 3300005343 | Bacteria | 4779 |
| 114 | Ga0070687_100059207 | 3300005343 | Bacteria | 2016 |
| 115 | Ga0070687_100072953 | 3300005343 | Bacteria | 1848 |
| 116 | Ga0070661_100013472 | 3300005344 | Bacteria | 5740 |
| 117 | Ga0070661_100019540 | 3300005344 | Bacteria | 4829 |
| 118 | Ga0070668_100002293 | 3300005347 | Bacteria | 14111 |
| 119 | Ga0070669_100019673 | 3300005353 | Bacteria | 4823 |
| 120 | Ga0070675_100000808 | 3300005354 | Bacteria | 22032 |
| 121 | Ga0070675_100010177 | 3300005354 | Bacteria | 7336 |
| 122 | Ga0070675_100010314 | 3300005354 | Bacteria | 7293 |
| 123 | Ga0070675_100061126 | 3300005354 | Bacteria | 3110 |
| 124 | Ga0070671_100000766 | 3300005355 | Bacteria | 23072 |
| 125 | Ga0070671_100002005 | 3300005355 | Bacteria | 15645 |
| 126 | Ga0070671_100002043 | 3300005355 | Bacteria | 15557 |
| 127 | Ga0070674_100003032 | 3300005356 | Bacteria | 9343 |
| 128 | Ga0070674_100014891 | 3300005356 | Bacteria | 4842 |
| 129 | Ga0070673_100000760 | 3300005364 | Bacteria | 17933 |
| 130 | Ga0070673_100003789 | 3300005364 | Bacteria | 9488 |
| 131 | Ga0070688_100046559 | 3300005365 | Bacteria | 2686 |
| 132 | Ga0070659_100004754 | 3300005366 | Bacteria | 9704 |
| 133 | Ga0070659_100012803 | 3300005366 | Bacteria | 6228 |
| 134 | Ga0070659_100032329 | 3300005366 | Bacteria | 4057 |
| 135 | Ga0070667_100000008 | 3300005367 | Bacteria | 285591 |
| 136 | Ga0070667_100076809 | 3300005367 | Bacteria | 2851 |
| 137 | Ga0070709_10008330 | 3300005434 | Bacteria | 5692 |
| 138 | Ga0070709_10013525 | 3300005434 | Bacteria | 4591 |
| 139 | Ga0070709_10029392 | 3300005434 | Bacteria | 3287 |
| 140 | Ga0070714_100000027 | 3300005435 | Bacteria | 141750 |
| 141 | Ga0070714_100009506 | 3300005435 | Bacteria | 7647 |
| 142 | Ga0070714_100100823 | 3300005435 | Bacteria | 2543 |
| 143 | Ga0070714_100107899 | 3300005435 | Bacteria | 2461 |
| 144 | Ga0070713_100000070 | 3300005436 | Bacteria | 64658 |
| 145 | Ga0070713_100010524 | 3300005436 | Bacteria | 6686 |
| 146 | Ga0070713_100025593 | 3300005436 | Bacteria | 4617 |
| 147 | Ga0070713_100092697 | 3300005436 | Bacteria | 2601 |
| 148 | Ga0070713_100124868 | 3300005436 | Bacteria | 2262 |
| 149 | Ga0070710_10023423 | 3300005437 | Bacteria | 3246 |
| 150 | Ga0070701_10027034 | 3300005438 | Bacteria | 2806 |
| 151 | Ga0070711_100000078 | 3300005439 | Bacteria | 54188 |
| 152 | Ga0070711_100001722 | 3300005439 | Bacteria | 12135 |
| 153 | Ga0070711_100008573 | 3300005439 | Bacteria | 6269 |
| 154 | Ga0070711_100010683 | 3300005439 | Bacteria | 5689 |
| 155 | Ga0070705_100002145 | 3300005440 | Bacteria | 10031 |
| 156 | Ga0070700_100016261 | 3300005441 | Bacteria | 4236 |
| 157 | Ga0070663_100020181 | 3300005455 | Bacteria | 4408 |
| 158 | Ga0070663_100049380 | 3300005455 | Bacteria | 2987 |
| 159 | Ga0070678_100010861 | 3300005456 | Bacteria | 5585 |
| 160 | Ga0070678_100064235 | 3300005456 | Bacteria | 2719 |
| 161 | Ga0070678_100150125 | 3300005456 | Bacteria | 1876 |
| 162 | Ga0070662_100002343 | 3300005457 | Bacteria | 11649 |
| 163 | Ga0070662_100010712 | 3300005457 | Bacteria | 6036 |
| 164 | Ga0070662_100010906 | 3300005457 | Bacteria | 5987 |
| 165 | Ga0070662_100030839 | 3300005457 | Bacteria | 3756 |
| 166 | Ga0070681_10002731 | 3300005458 | Bacteria | 16262 |
| 167 | Ga0070681_10009647 | 3300005458 | Bacteria | 9496 |
| 168 | Ga0070681_10016790 | 3300005458 | Bacteria | 7309 |
| 169 | Ga0070681_10054169 | 3300005458 | Bacteria | 3997 |
| 170 | Ga0068867_100013463 | 3300005459 | Bacteria | 5794 |
| 171 | Ga0068867_100015107 | 3300005459 | Bacteria | 5474 |
| 172 | Ga0068867_100048551 | 3300005459 | Bacteria | 3123 |
| 173 | Ga0070685_10019728 | 3300005466 | Bacteria | 3642 |
| 174 | Ga0070685_10058711 | 3300005466 | Bacteria | 2244 |
| 175 | Ga0070706_100017407 | 3300005467 | Bacteria | 6632 |
| 176 | Ga0070698_100016910 | 3300005471 | Bacteria | 7691 |
| 177 | Ga0070679_100001049 | 3300005530 | Bacteria | 24084 |
| 178 | Ga0070679_100002199 | 3300005530 | Bacteria | 17619 |
| 179 | Ga0070679_100003313 | 3300005530 | Bacteria | 14753 |
| 180 | Ga0070679_100128575 | 3300005530 | Bacteria | 2515 |
| 181 | Ga0070684_100000495 | 3300005535 | Bacteria | 27122 |
| 182 | Ga0070684_100002184 | 3300005535 | Bacteria | 14445 |
| 183 | Ga0070684_100002631 | 3300005535 | Bacteria | 13264 |
| 184 | Ga0070684_100003551 | 3300005535 | Bacteria | 11721 |
| 185 | Ga0070684_100004494 | 3300005535 | Bacteria | 10615 |
| 186 | Ga0070684_100052722 | 3300005535 | Bacteria | 3538 |
| 187 | Ga0068853_100002085 | 3300005539 | Bacteria | 14821 |
| 188 | Ga0068853_100002841 | 3300005539 | Bacteria | 13127 |
| 189 | Ga0068853_100034021 | 3300005539 | Bacteria | 4324 |
| 190 | Ga0068853_100042327 | 3300005539 | Bacteria | 3894 |
| 191 | Ga0068853_100078638 | 3300005539 | Bacteria | 2883 |
| 192 | Ga0068853_100153353 | 3300005539 | Bacteria | 2075 |
| 193 | Ga0070672_100001253 | 3300005543 | Bacteria | 15629 |
| 194 | Ga0070672_100001412 | 3300005543 | Bacteria | 14833 |
| 195 | Ga0070672_100001924 | 3300005543 | Bacteria | 13036 |
| 196 | Ga0070672_100007962 | 3300005543 | Bacteria | 7239 |
| 197 | Ga0070672_100012236 | 3300005543 | Bacteria | 6014 |
| 198 | Ga0070672_100086476 | 3300005543 | Bacteria | 2521 |
| 199 | Ga0070672_100110485 | 3300005543 | Bacteria | 2240 |
| 200 | Ga0070695_100047737 | 3300005545 | Bacteria | 2736 |
| 201 | Ga0070696_100004763 | 3300005546 | Bacteria | 9063 |
| 202 | Ga0070693_100033350 | 3300005547 | Bacteria | 2841 |
| 203 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 204 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 205 | Ga0070665_100002302 | 3300005548 | Bacteria | 21191 |
| 206 | Ga0070665_100004515 | 3300005548 | Bacteria | 14591 |
| 207 | Ga0070665_100131384 | 3300005548 | Bacteria | 2506 |
| 208 | Ga0070704_100037227 | 3300005549 | Bacteria | 3322 |
| 209 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 210 | Ga0068855_100006138 | 3300005563 | Bacteria | 14646 |
| 211 | Ga0068855_100013875 | 3300005563 | Bacteria | 9717 |
| 212 | Ga0068855_100021735 | 3300005563 | Bacteria | 7695 |
| 213 | Ga0068855_100033174 | 3300005563 | Bacteria | 6164 |
| 214 | Ga0068855_100040465 | 3300005563 | Bacteria | 5532 |
| 215 | Ga0068855_100041594 | 3300005563 | Bacteria | 5447 |
| 216 | Ga0068855_100061690 | 3300005563 | Bacteria | 4380 |
| 217 | Ga0068855_100084487 | 3300005563 | Bacteria | 3674 |
| 218 | Ga0068855_100159858 | 3300005563 | Bacteria | 2558 |
| 219 | Ga0070664_100000907 | 3300005564 | Bacteria | 23090 |
| 220 | Ga0070664_100001767 | 3300005564 | Bacteria | 17333 |
| 221 | Ga0070664_100003198 | 3300005564 | Bacteria | 13236 |
| 222 | Ga0070664_100016459 | 3300005564 | Bacteria | 6061 |
| 223 | Ga0070664_100056278 | 3300005564 | Bacteria | 3342 |
| 224 | Ga0068857_100000416 | 3300005577 | Bacteria | 30150 |
| 225 | Ga0068857_100002231 | 3300005577 | Bacteria | 15779 |
| 226 | Ga0068857_100003091 | 3300005577 | Bacteria | 13769 |
| 227 | Ga0068857_100008704 | 3300005577 | Bacteria | 8784 |
| 228 | Ga0068857_100019687 | 3300005577 | Bacteria | 5928 |
| 229 | Ga0068857_100035648 | 3300005577 | Bacteria | 4407 |
| 230 | Ga0068857_100135902 | 3300005577 | Bacteria | 2220 |
| 231 | Ga0068854_100001302 | 3300005578 | Bacteria | 15037 |
| 232 | Ga0068854_100003549 | 3300005578 | Bacteria | 9751 |
| 233 | Ga0068854_100007413 | 3300005578 | Bacteria | 7006 |
| 234 | Ga0068854_100014670 | 3300005578 | Bacteria | 5169 |
| 235 | Ga0068854_100023625 | 3300005578 | Bacteria | 4201 |
| 236 | Ga0068854_100024484 | 3300005578 | Bacteria | 4133 |
| 237 | Ga0068854_100065239 | 3300005578 | Bacteria | 2647 |
| 238 | Ga0068856_100003470 | 3300005614 | Bacteria | 15935 |
| 239 | Ga0068856_100003737 | 3300005614 | Bacteria | 15253 |
| 240 | Ga0068856_100007867 | 3300005614 | Bacteria | 10410 |
| 241 | Ga0068856_100008937 | 3300005614 | Bacteria | 9744 |
| 242 | Ga0068856_100021384 | 3300005614 | Bacteria | 6289 |
| 243 | Ga0068856_100049501 | 3300005614 | Bacteria | 4141 |
| 244 | Ga0068852_100001067 | 3300005616 | Bacteria | 18102 |
| 245 | Ga0068852_100001424 | 3300005616 | Bacteria | 16136 |
| 246 | Ga0068852_100001703 | 3300005616 | Bacteria | 14982 |
| 247 | Ga0068852_100001789 | 3300005616 | Bacteria | 14595 |
| 248 | Ga0068852_100006577 | 3300005616 | Bacteria | 8414 |
| 249 | Ga0068852_100009196 | 3300005616 | Bacteria | 7321 |
| 250 | Ga0068852_100023794 | 3300005616 | Bacteria | 4938 |
| 251 | Ga0068852_100030311 | 3300005616 | Bacteria | 4452 |
| 252 | Ga0068852_100033864 | 3300005616 | Bacteria | 4246 |
| 253 | Ga0068852_100052610 | 3300005616 | Bacteria | 3500 |
| 254 | Ga0068852_100081827 | 3300005616 | Bacteria | 2867 |
| 255 | Ga0068859_100000112 | 3300005617 | Bacteria | 77364 |
| 256 | Ga0068859_100004436 | 3300005617 | Bacteria | 14320 |
| 257 | Ga0068859_100006240 | 3300005617 | Bacteria | 12102 |
| 258 | Ga0068859_100096264 | 3300005617 | Bacteria | 3013 |
| 259 | Ga0068864_100004751 | 3300005618 | Bacteria | 11126 |
| 260 | Ga0068864_100005862 | 3300005618 | Bacteria | 10066 |
| 261 | Ga0068864_100012119 | 3300005618 | Bacteria | 7123 |
| 262 | Ga0068864_100171718 | 3300005618 | Bacteria | 1977 |
| 263 | Ga0068866_10009802 | 3300005718 | Bacteria | 4082 |
| 264 | Ga0068861_100002433 | 3300005719 | Bacteria | 12138 |
| 265 | Ga0068861_100003403 | 3300005719 | Bacteria | 10553 |
| 266 | Ga0068861_100003919 | 3300005719 | Bacteria | 9948 |
| 267 | Ga0068861_100023914 | 3300005719 | Bacteria | 4412 |
| 268 | Ga0068861_100055358 | 3300005719 | Bacteria | 3024 |
| 269 | Ga0068861_100078681 | 3300005719 | Bacteria | 2576 |
| 270 | Ga0068861_100091168 | 3300005719 | Bacteria | 2406 |
| 271 | Ga0068851_10005265 | 3300005834 | Bacteria | 5870 |
| 272 | Ga0068851_10005926 | 3300005834 | Bacteria | 5563 |
| 273 | Ga0068851_10007004 | 3300005834 | Bacteria | 5170 |
| 274 | Ga0068851_10007899 | 3300005834 | Bacteria | 4900 |
| 275 | Ga0068851_10013951 | 3300005834 | Bacteria | 3808 |
| 276 | Ga0068851_10015229 | 3300005834 | Bacteria | 3661 |
| 277 | Ga0068851_10030114 | 3300005834 | Bacteria | 2690 |
| 278 | Ga0068870_10000326 | 3300005840 | Bacteria | 17719 |
| 279 | Ga0068870_10025823 | 3300005840 | Bacteria | 2921 |
| 280 | Ga0068870_10026543 | 3300005840 | Bacteria | 2888 |
| 281 | Ga0068863_100016366 | 3300005841 | Bacteria | 7113 |
| 282 | Ga0068863_100019561 | 3300005841 | Bacteria | 6476 |
| 283 | Ga0068863_100080423 | 3300005841 | Bacteria | 3087 |
| 284 | Ga0068863_100181124 | 3300005841 | Bacteria | 2022 |
| 285 | Ga0068858_100006624 | 3300005842 | Bacteria | 11271 |
| 286 | Ga0068858_100010216 | 3300005842 | Bacteria | 8907 |
| 287 | Ga0068858_100042671 | 3300005842 | Bacteria | 4205 |
| 288 | Ga0068858_100043377 | 3300005842 | Bacteria | 4170 |
| 289 | Ga0068860_100000005 | 3300005843 | Bacteria | 472349 |
| 290 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 291 | Ga0068860_100003770 | 3300005843 | Bacteria | 15594 |
| 292 | Ga0068860_100007157 | 3300005843 | Bacteria | 11160 |
| 293 | Ga0068860_100029570 | 3300005843 | Bacteria | 5272 |
| 294 | Ga0068860_100044640 | 3300005843 | Bacteria | 4224 |
| 295 | Ga0068860_100063495 | 3300005843 | Bacteria | 3508 |
| 296 | Ga0068860_100080415 | 3300005843 | Bacteria | 3099 |
| 297 | Ga0068862_100068195 | 3300005844 | Bacteria | 3068 |
| 298 | Ga0068862_100104493 | 3300005844 | Bacteria | 2481 |
| 299 | Ga0068862_100118041 | 3300005844 | Bacteria | 2335 |
| 300 | Ga0081455_10015718 | 3300005937 | Bacteria | 7336 |
| 301 | Ga0081455_10018606 | 3300005937 | Bacteria | 6604 |
| 302 | Ga0081455_10038479 | 3300005937 | Bacteria | 4236 |
| 303 | Ga0081538_10007018 | 3300005981 | Bacteria | 9799 |
| 304 | Ga0081538_10008990 | 3300005981 | Bacteria | 8392 |
| 305 | Ga0081540_1008524 | 3300005983 | Bacteria | 7155 |
| 306 | Ga0081539_10029286 | 3300005985 | Bacteria | 3442 |
| 307 | Ga0070717_10001262 | 3300006028 | Bacteria | 17276 |
| 308 | Ga0070717_10007375 | 3300006028 | Bacteria | 8168 |
| 309 | Ga0070717_10016703 | 3300006028 | Bacteria | 5697 |
| 310 | Ga0070712_100000038 | 3300006175 | Bacteria | 67408 |
| 311 | Ga0070712_100000139 | 3300006175 | Bacteria | 37733 |
| 312 | Ga0070712_100000292 | 3300006175 | Bacteria | 28152 |
| 313 | Ga0075366_10020007 | 3300006195 | Bacteria | 3880 |
| 314 | Ga0097621_100002478 | 3300006237 | Bacteria | 12642 |
| 315 | Ga0097621_100009342 | 3300006237 | Bacteria | 7119 |
| 316 | Ga0097621_100011591 | 3300006237 | Bacteria | 6498 |
| 317 | Ga0097621_100011644 | 3300006237 | Bacteria | 6488 |
| 318 | Ga0097621_100017336 | 3300006237 | Bacteria | 5467 |
| 319 | Ga0097621_100048005 | 3300006237 | Bacteria | 3462 |
| 320 | Ga0097621_100060361 | 3300006237 | Bacteria | 3108 |
| 321 | Ga0097621_100074801 | 3300006237 | Bacteria | 2806 |
| 322 | Ga0075370_10002970 | 3300006353 | Bacteria | 7967 |
| 323 | Ga0068871_100001328 | 3300006358 | Bacteria | 16549 |
| 324 | Ga0068871_100001519 | 3300006358 | Bacteria | 15541 |
| 325 | Ga0068871_100012320 | 3300006358 | Bacteria | 6299 |
| 326 | Ga0075431_100053601 | 3300006847 | Bacteria | 4158 |
| 327 | Ga0075431_100131322 | 3300006847 | Bacteria | 2583 |
| 328 | Ga0075434_100027556 | 3300006871 | Bacteria | 5580 |
| 329 | Ga0075429_100042141 | 3300006880 | Bacteria | 3973 |
| 330 | Ga0075429_100140889 | 3300006880 | Bacteria | 2111 |
| 331 | Ga0068865_100001761 | 3300006881 | Bacteria | 12702 |
| 332 | Ga0068865_100013022 | 3300006881 | Bacteria | 5245 |
| 333 | Ga0068865_100036426 | 3300006881 | Bacteria | 3317 |
| 334 | Ga0075436_100015958 | 3300006914 | Bacteria | 5141 |
| 335 | Ga0075436_100016268 | 3300006914 | Bacteria | 5091 |
| 336 | Ga0097620_100000112 | 3300006931 | Bacteria | 77364 |
| 337 | Ga0097620_100004436 | 3300006931 | Bacteria | 14320 |
| 338 | Ga0097620_100006240 | 3300006931 | Bacteria | 12102 |
| 339 | Ga0097620_100096265 | 3300006931 | Bacteria | 3013 |
| 340 | Ga0079104_1008144 | 3300006946 | Bacteria | 3707 |
| 341 | Ga0079104_1010485 | 3300006946 | Bacteria | 3052 |
| 342 | Ga0075435_100030319 | 3300007076 | Bacteria | 4251 |
| 343 | Ga0075435_100166843 | 3300007076 | Bacteria | 1857 |
| 344 | Ga0099794_10061540 | 3300007265 | Bacteria | 1824 |
| 345 | Ga0105251_10000219 | 3300009011 | Bacteria | 58096 |
| 346 | Ga0105251_10003501 | 3300009011 | Bacteria | 11356 |
| 347 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 348 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 349 | Ga0105240_10000039 | 3300009093 | Bacteria | 270117 |
| 350 | Ga0105240_10000054 | 3300009093 | Bacteria | 225529 |
| 351 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 352 | Ga0105240_10000283 | 3300009093 | Bacteria | 99553 |
| 353 | Ga0105240_10001565 | 3300009093 | Bacteria | 38825 |
| 354 | Ga0105240_10002663 | 3300009093 | Bacteria | 28411 |
| 355 | Ga0105240_10005587 | 3300009093 | Bacteria | 18682 |
| 356 | Ga0105240_10005669 | 3300009093 | Bacteria | 18536 |
| 357 | Ga0105240_10008305 | 3300009093 | Bacteria | 14858 |
| 358 | Ga0105240_10011123 | 3300009093 | Bacteria | 12576 |
| 359 | Ga0105240_10016759 | 3300009093 | Bacteria | 9911 |
| 360 | Ga0105240_10017784 | 3300009093 | Bacteria | 9569 |
| 361 | Ga0105240_10021984 | 3300009093 | Bacteria | 8473 |
| 362 | Ga0105240_10032969 | 3300009093 | Bacteria | 6698 |
| 363 | Ga0105240_10175292 | 3300009093 | Bacteria | 2535 |
| 364 | Ga0111539_10000665 | 3300009094 | Bacteria | 44363 |
| 365 | Ga0111539_10008255 | 3300009094 | Bacteria | 13255 |
| 366 | Ga0111539_10023989 | 3300009094 | Bacteria | 7493 |
| 367 | Ga0111539_10073997 | 3300009094 | Bacteria | 4015 |
| 368 | Ga0111539_10121013 | 3300009094 | Bacteria | 3067 |
| 369 | Ga0105245_10000995 | 3300009098 | Bacteria | 25730 |
| 370 | Ga0105245_10001343 | 3300009098 | Bacteria | 22292 |
| 371 | Ga0105245_10016474 | 3300009098 | Bacteria | 6449 |
| 372 | Ga0114129_10001007 | 3300009147 | Bacteria | 36711 |
| 373 | Ga0114129_10078631 | 3300009147 | Bacteria | 4587 |
| 374 | Ga0105243_10040017 | 3300009148 | Bacteria | 3658 |
| 375 | Ga0105243_10051389 | 3300009148 | Bacteria | 3260 |
| 376 | Ga0105241_10000542 | 3300009174 | Bacteria | 28454 |
| 377 | Ga0105241_10003032 | 3300009174 | Bacteria | 12548 |
| 378 | Ga0105242_10010417 | 3300009176 | Bacteria | 7132 |
| 379 | Ga0105242_10015422 | 3300009176 | Bacteria | 5934 |
| 380 | Ga0105242_10089137 | 3300009176 | Bacteria | 2592 |
| 381 | Ga0105248_10002352 | 3300009177 | Bacteria | 20987 |
| 382 | Ga0105248_10016506 | 3300009177 | Bacteria | 8129 |
| 383 | Ga0105248_10054237 | 3300009177 | Bacteria | 4495 |
| 384 | Ga0105248_10094570 | 3300009177 | Bacteria | 3365 |
| 385 | Ga0105248_10156373 | 3300009177 | Bacteria | 2573 |
| 386 | Ga0105237_10000010 | 3300009545 | Bacteria | 324528 |
| 387 | Ga0105237_10000248 | 3300009545 | Bacteria | 76402 |
| 388 | Ga0105237_10000555 | 3300009545 | Bacteria | 52309 |
| 389 | Ga0105237_10001565 | 3300009545 | Bacteria | 29826 |
| 390 | Ga0105237_10002158 | 3300009545 | Bacteria | 24754 |
| 391 | Ga0105237_10003834 | 3300009545 | Bacteria | 17679 |
| 392 | Ga0105237_10003907 | 3300009545 | Bacteria | 17471 |
| 393 | Ga0105237_10011674 | 3300009545 | Bacteria | 9296 |
| 394 | Ga0105237_10024011 | 3300009545 | Bacteria | 6238 |
| 395 | Ga0105237_10025875 | 3300009545 | Bacteria | 5999 |
| 396 | Ga0105237_10035862 | 3300009545 | Bacteria | 5017 |
| 397 | Ga0105237_10042642 | 3300009545 | Bacteria | 4574 |
| 398 | Ga0105237_10066881 | 3300009545 | Bacteria | 3588 |
| 399 | Ga0105237_10087386 | 3300009545 | Bacteria | 3107 |
| 400 | Ga0105237_10088721 | 3300009545 | Bacteria | 3081 |
| 401 | Ga0105237_10091556 | 3300009545 | Bacteria | 3030 |
| 402 | Ga0105238_10003699 | 3300009551 | Bacteria | 15225 |
| 403 | Ga0105238_10004027 | 3300009551 | Bacteria | 14580 |
| 404 | Ga0105238_10004448 | 3300009551 | Bacteria | 13894 |
| 405 | Ga0105238_10004647 | 3300009551 | Bacteria | 13589 |
| 406 | Ga0105238_10009815 | 3300009551 | Bacteria | 9586 |
| 407 | Ga0105238_10015237 | 3300009551 | Bacteria | 7783 |
| 408 | Ga0105238_10024923 | 3300009551 | Bacteria | 6096 |
| 409 | Ga0105238_10032996 | 3300009551 | Bacteria | 5268 |
| 410 | Ga0105238_10034131 | 3300009551 | Bacteria | 5177 |
| 411 | Ga0105238_10035163 | 3300009551 | Bacteria | 5095 |
| 412 | Ga0105249_10006383 | 3300009553 | Bacteria | 10255 |
| 413 | Ga0105249_10016022 | 3300009553 | Bacteria | 6644 |
| 414 | Ga0105249_10043073 | 3300009553 | Bacteria | 4106 |
| 415 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 416 | Ga0105239_10000970 | 3300010375 | Bacteria | 40255 |
| 417 | Ga0105239_10000996 | 3300010375 | Bacteria | 39663 |
| 418 | Ga0105239_10001560 | 3300010375 | Bacteria | 30320 |
| 419 | Ga0105239_10003467 | 3300010375 | Bacteria | 19300 |
| 420 | Ga0105239_10005119 | 3300010375 | Bacteria | 15475 |
| 421 | Ga0105239_10009015 | 3300010375 | Bacteria | 11293 |
| 422 | Ga0105239_10082394 | 3300010375 | Bacteria | 3542 |
| 423 | Ga0105239_10088886 | 3300010375 | Bacteria | 3406 |
| 424 | Ga0105239_10120461 | 3300010375 | Bacteria | 2914 |
| 425 | Ga0157373_10047748 | 3300013100 | Bacteria | 3053 |
| 426 | Ga0157371_10000601 | 3300013102 | Bacteria | 42868 |
| 427 | Ga0157371_10003863 | 3300013102 | Bacteria | 13369 |
| 428 | Ga0157371_10014715 | 3300013102 | Bacteria | 5888 |
| 429 | Ga0157370_10001897 | 3300013104 | Bacteria | 25729 |
| 430 | Ga0157370_10002430 | 3300013104 | Bacteria | 22453 |
| 431 | Ga0157370_10002944 | 3300013104 | Bacteria | 20270 |
| 432 | Ga0157370_10006375 | 3300013104 | Bacteria | 13020 |
| 433 | Ga0157370_10007304 | 3300013104 | Bacteria | 12057 |
| 434 | Ga0157370_10010515 | 3300013104 | Bacteria | 9745 |
| 435 | Ga0157370_10010755 | 3300013104 | Bacteria | 9623 |
| 436 | Ga0157370_10035604 | 3300013104 | Bacteria | 4836 |
| 437 | Ga0157370_10043870 | 3300013104 | Bacteria | 4301 |
| 438 | Ga0157370_10111260 | 3300013104 | Bacteria | 2560 |
| 439 | Ga0157370_10131639 | 3300013104 | Bacteria | 2333 |
| 440 | Ga0157369_10004260 | 3300013105 | Bacteria | 16922 |
| 441 | Ga0157369_10005126 | 3300013105 | Bacteria | 15340 |
| 442 | Ga0157369_10005519 | 3300013105 | Bacteria | 14689 |
| 443 | Ga0157369_10006060 | 3300013105 | Bacteria | 14033 |
| 444 | Ga0157369_10006355 | 3300013105 | Bacteria | 13713 |
| 445 | Ga0157369_10021623 | 3300013105 | Bacteria | 7194 |
| 446 | Ga0157369_10027624 | 3300013105 | Bacteria | 6287 |
| 447 | Ga0157369_10050582 | 3300013105 | Bacteria | 4500 |
| 448 | Ga0157369_10094622 | 3300013105 | Bacteria | 3189 |
| 449 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 450 | Ga0157374_10000029 | 3300013296 | Bacteria | 211547 |
| 451 | Ga0157374_10000261 | 3300013296 | Bacteria | 48629 |
| 452 | Ga0157374_10000833 | 3300013296 | Bacteria | 27020 |
| 453 | Ga0157378_10000228 | 3300013297 | Bacteria | 54876 |
| 454 | Ga0157378_10000272 | 3300013297 | Bacteria | 50377 |
| 455 | Ga0157378_10003102 | 3300013297 | Bacteria | 14775 |
| 456 | Ga0157378_10003339 | 3300013297 | Bacteria | 14275 |
| 457 | Ga0157378_10018182 | 3300013297 | Bacteria | 6171 |
| 458 | Ga0157378_10070747 | 3300013297 | Bacteria | 3133 |
| 459 | Ga0163162_10001429 | 3300013306 | Bacteria | 22232 |
| 460 | Ga0163162_10002485 | 3300013306 | Bacteria | 17417 |
| 461 | Ga0163162_10003915 | 3300013306 | Bacteria | 14297 |
| 462 | Ga0163162_10004794 | 3300013306 | Bacteria | 13050 |
| 463 | Ga0163162_10005992 | 3300013306 | Bacteria | 11773 |
| 464 | Ga0163162_10032033 | 3300013306 | Bacteria | 5218 |
| 465 | Ga0163162_10060993 | 3300013306 | Bacteria | 3809 |
| 466 | Ga0157372_10001117 | 3300013307 | Bacteria | 29145 |
| 467 | Ga0157372_10001446 | 3300013307 | Bacteria | 25695 |
| 468 | Ga0157372_10003819 | 3300013307 | Bacteria | 16187 |
| 469 | Ga0157372_10004228 | 3300013307 | Bacteria | 15351 |
| 470 | Ga0157372_10004709 | 3300013307 | Bacteria | 14488 |
| 471 | Ga0157372_10007988 | 3300013307 | Bacteria | 11255 |
| 472 | Ga0157372_10010774 | 3300013307 | Bacteria | 9733 |
| 473 | Ga0157372_10018450 | 3300013307 | Bacteria | 7500 |
| 474 | Ga0157372_10034045 | 3300013307 | Bacteria | 5598 |
| 475 | Ga0157372_10067054 | 3300013307 | Bacteria | 4032 |
| 476 | Ga0157372_10086797 | 3300013307 | Bacteria | 3550 |
| 477 | Ga0157372_10185966 | 3300013307 | Bacteria | 2406 |
| 478 | Ga0157375_10002044 | 3300013308 | Bacteria | 17407 |
| 479 | Ga0157375_10005063 | 3300013308 | Bacteria | 11440 |
| 480 | Ga0157375_10006449 | 3300013308 | Bacteria | 10221 |
| 481 | Ga0163163_10007450 | 3300014325 | Bacteria | 9656 |
| 482 | Ga0163163_10124369 | 3300014325 | Bacteria | 2616 |
| 483 | Ga0157380_10001777 | 3300014326 | Bacteria | 14240 |
| 484 | Ga0157380_10009370 | 3300014326 | Bacteria | 7012 |
| 485 | Ga0157380_10011071 | 3300014326 | Bacteria | 6505 |
| 486 | Ga0157380_10011751 | 3300014326 | Bacteria | 6331 |
| 487 | Ga0157380_10062053 | 3300014326 | Bacteria | 2993 |
| 488 | Ga0182008_10006626 | 3300014497 | Bacteria | 6451 |
| 489 | Ga0157377_10009758 | 3300014745 | Bacteria | 4725 |
| 490 | Ga0157379_10010290 | 3300014968 | Bacteria | 8147 |
| 491 | Ga0157379_10099197 | 3300014968 | Bacteria | 2615 |
| 492 | Ga0157376_10000288 | 3300014969 | Bacteria | 34012 |
| 493 | Ga0157376_10000721 | 3300014969 | Bacteria | 21396 |
| 494 | Ga0157376_10023530 | 3300014969 | Bacteria | 4822 |
| 495 | Ga0182007_10003718 | 3300015262 | Bacteria | 7131 |
| 496 | Ga0182005_1000234 | 3300015265 | Bacteria | 35809 |
| 497 | Ga0183363_1071 | 3300015690 | Bacteria | 30324 |
| 498 | Ga0163161_10097246 | 3300017792 | Bacteria | 2187 |
| 499 | Ga0206353_10810131 | 3300020082 | Bacteria | 2535 |
| 500 | Ga0214544_1000110 | 3300021320 | Bacteria | 113143 |
| 501 | Ga0214542_1000032 | 3300021321 | Bacteria | 171690 |
| 502 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 503 | Ga0213872_10031734 | 3300021361 | Bacteria | 2422 |
| 504 | Ga0228711_1000911 | 3300022739 | Bacteria | 40698 |
| 505 | Ga0228710_1001018 | 3300022740 | Bacteria | 40304 |
| 506 | Ga0224572_1000136 | 3300024225 | Bacteria | 6174 |
| 507 | Ga0228598_1003449 | 3300024227 | Bacteria | 3401 |
| 508 | Ga0209435_100027 | 3300025206 | Bacteria | 196217 |
| 509 | Ga0209436_100957 | 3300025208 | Bacteria | 11337 |
| 510 | Ga0209674_100059 | 3300025226 | Bacteria | 282517 |
| 511 | Ga0209674_100790 | 3300025226 | Bacteria | 10649 |
| 512 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 513 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 514 | Ga0209672_102368 | 3300025228 | Bacteria | 4731 |
| 515 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 516 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 517 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 518 | Ga0209437_100064 | 3300025233 | Bacteria | 334360 |
| 519 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 520 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 521 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 522 | Ga0209646_1000086 | 3300025246 | Bacteria | 196217 |
| 523 | Ga0209646_1000091 | 3300025246 | Bacteria | 188727 |
| 524 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 525 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 526 | Ga0209026_1000082 | 3300025250 | Bacteria | 196315 |
| 527 | Ga0209026_1000497 | 3300025250 | Bacteria | 28577 |
| 528 | Ga0209677_101303 | 3300025253 | Bacteria | 11070 |
| 529 | Ga0209677_103674 | 3300025253 | Bacteria | 4821 |
| 530 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 531 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 532 | Ga0209148_1005795 | 3300025254 | Bacteria | 2764 |
| 533 | Ga0209759_1000063 | 3300025256 | Bacteria | 196315 |
| 534 | Ga0209759_1000212 | 3300025256 | Bacteria | 89756 |
| 535 | Ga0209759_1000229 | 3300025256 | Bacteria | 83575 |
| 536 | Ga0209233_1000081 | 3300025261 | Bacteria | 336832 |
| 537 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 538 | Ga0209233_1000228 | 3300025261 | Bacteria | 100100 |
| 539 | Ga0209233_1001833 | 3300025261 | Bacteria | 8155 |
| 540 | Ga0209233_1002148 | 3300025261 | Bacteria | 7412 |
| 541 | Ga0209233_1002543 | 3300025261 | Bacteria | 6655 |
| 542 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 543 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 544 | Ga0209455_1000405 | 3300025272 | Bacteria | 35180 |
| 545 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 546 | Ga0209673_1000018 | 3300025273 | Bacteria | 458281 |
| 547 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 548 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 549 | Ga0209130_1001489 | 3300025284 | Bacteria | 15214 |
| 550 | Ga0209130_1007205 | 3300025284 | Bacteria | 3475 |
| 551 | Ga0209675_1000040 | 3300025291 | Bacteria | 247535 |
| 552 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 553 | Ga0209676_1000093 | 3300025292 | Bacteria | 250231 |
| 554 | Ga0209676_1011256 | 3300025292 | Bacteria | 3627 |
| 555 | Ga0209025_1000092 | 3300025294 | Bacteria | 247020 |
| 556 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 557 | Ga0209025_1000282 | 3300025294 | Bacteria | 115627 |
| 558 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 559 | Ga0209564_1000159 | 3300025295 | Bacteria | 164319 |
| 560 | Ga0209564_1000218 | 3300025295 | Bacteria | 130563 |
| 561 | Ga0209758_1000051 | 3300025297 | Bacteria | 342477 |
| 562 | Ga0209758_1000169 | 3300025297 | Bacteria | 149782 |
| 563 | Ga0209758_1000974 | 3300025297 | Bacteria | 38538 |
| 564 | Ga0209758_1001557 | 3300025297 | Bacteria | 26313 |
| 565 | Ga0209758_1003127 | 3300025297 | Bacteria | 15627 |
| 566 | Ga0209050_1000177 | 3300025298 | Bacteria | 146637 |
| 567 | Ga0209050_1003437 | 3300025298 | Bacteria | 11665 |
| 568 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 569 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 570 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 571 | Ga0207426_1000182 | 3300025302 | Bacteria | 155724 |
| 572 | Ga0207426_1000251 | 3300025302 | Bacteria | 117462 |
| 573 | Ga0209051_1002454 | 3300025303 | Bacteria | 13276 |
| 574 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 575 | Ga0209257_1003777 | 3300025304 | Bacteria | 12500 |
| 576 | Ga0207697_10004556 | 3300025315 | Bacteria | 6600 |
| 577 | Ga0207656_10009682 | 3300025321 | Bacteria | 3582 |
| 578 | Ga0207656_10010296 | 3300025321 | Bacteria | 3499 |
| 579 | Ga0207656_10031110 | 3300025321 | Bacteria | 2209 |
| 580 | Ga0207713_1000393 | 3300025735 | Bacteria | 47322 |
| 581 | Ga0207682_10002884 | 3300025893 | Bacteria | 7588 |
| 582 | Ga0207682_10005238 | 3300025893 | Bacteria | 5303 |
| 583 | Ga0207682_10005627 | 3300025893 | Bacteria | 5095 |
| 584 | Ga0207682_10008737 | 3300025893 | Bacteria | 4007 |
| 585 | Ga0207692_10016492 | 3300025898 | Bacteria | 3274 |
| 586 | Ga0207710_10041730 | 3300025900 | Bacteria | 2035 |
| 587 | Ga0207680_10000035 | 3300025903 | Bacteria | 73889 |
| 588 | Ga0207647_10012031 | 3300025904 | Bacteria | 6039 |
| 589 | Ga0207647_10058204 | 3300025904 | Bacteria | 2367 |
| 590 | Ga0207645_10001460 | 3300025907 | Bacteria | 19330 |
| 591 | Ga0207645_10002051 | 3300025907 | Bacteria | 16146 |
| 592 | Ga0207645_10003092 | 3300025907 | Bacteria | 12763 |
| 593 | Ga0207645_10057360 | 3300025907 | Bacteria | 2486 |
| 594 | Ga0207645_10080504 | 3300025907 | Bacteria | 2088 |
| 595 | Ga0207643_10000186 | 3300025908 | Bacteria | 42591 |
| 596 | Ga0207705_10012043 | 3300025909 | Bacteria | 6249 |
| 597 | Ga0207705_10022270 | 3300025909 | Bacteria | 4519 |
| 598 | Ga0207684_10022962 | 3300025910 | Bacteria | 5328 |
| 599 | Ga0207654_10007114 | 3300025911 | Bacteria | 5636 |
| 600 | Ga0207654_10019867 | 3300025911 | Bacteria | 3553 |
| 601 | Ga0207654_10071771 | 3300025911 | Bacteria | 2059 |
| 602 | Ga0207707_10002439 | 3300025912 | Bacteria | 16735 |
| 603 | Ga0207707_10010871 | 3300025912 | Bacteria | 7912 |
| 604 | Ga0207707_10022710 | 3300025912 | Bacteria | 5486 |
| 605 | Ga0207707_10041539 | 3300025912 | Bacteria | 4016 |
| 606 | Ga0207707_10047537 | 3300025912 | Bacteria | 3737 |
| 607 | Ga0207707_10128331 | 3300025912 | Bacteria | 2217 |
| 608 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 609 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 610 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 611 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 612 | Ga0207695_10000316 | 3300025913 | Bacteria | 116327 |
| 613 | Ga0207695_10000400 | 3300025913 | Bacteria | 97035 |
| 614 | Ga0207695_10000684 | 3300025913 | Bacteria | 66519 |
| 615 | Ga0207695_10001264 | 3300025913 | Bacteria | 43057 |
| 616 | Ga0207695_10002490 | 3300025913 | Bacteria | 27118 |
| 617 | Ga0207695_10005506 | 3300025913 | Bacteria | 16761 |
| 618 | Ga0207695_10006194 | 3300025913 | Bacteria | 15592 |
| 619 | Ga0207695_10064512 | 3300025913 | Bacteria | 3770 |
| 620 | Ga0207695_10092636 | 3300025913 | Bacteria | 3032 |
| 621 | Ga0207695_10104863 | 3300025913 | Bacteria | 2815 |
| 622 | Ga0207695_10160233 | 3300025913 | Bacteria | 2182 |
| 623 | Ga0207671_10000013 | 3300025914 | Bacteria | 478458 |
| 624 | Ga0207671_10000671 | 3300025914 | Bacteria | 44609 |
| 625 | Ga0207671_10001017 | 3300025914 | Bacteria | 34299 |
| 626 | Ga0207671_10001497 | 3300025914 | Bacteria | 26937 |
| 627 | Ga0207671_10003026 | 3300025914 | Bacteria | 17227 |
| 628 | Ga0207671_10004291 | 3300025914 | Bacteria | 13713 |
| 629 | Ga0207671_10010727 | 3300025914 | Bacteria | 7533 |
| 630 | Ga0207671_10012580 | 3300025914 | Bacteria | 6796 |
| 631 | Ga0207671_10021713 | 3300025914 | Bacteria | 4865 |
| 632 | Ga0207671_10025759 | 3300025914 | Bacteria | 4414 |
| 633 | Ga0207671_10058017 | 3300025914 | Bacteria | 2869 |
| 634 | Ga0207671_10062741 | 3300025914 | Bacteria | 2760 |
| 635 | Ga0207671_10066806 | 3300025914 | Bacteria | 2677 |
| 636 | Ga0207671_10136495 | 3300025914 | Bacteria | 1886 |
| 637 | Ga0207693_10000012 | 3300025915 | Bacteria | 154708 |
| 638 | Ga0207693_10000058 | 3300025915 | Bacteria | 94726 |
| 639 | Ga0207693_10001160 | 3300025915 | Bacteria | 23505 |
| 640 | Ga0207693_10002891 | 3300025915 | Bacteria | 14857 |
| 641 | Ga0207663_10000280 | 3300025916 | Bacteria | 22295 |
| 642 | Ga0207663_10003100 | 3300025916 | Bacteria | 8065 |
| 643 | Ga0207663_10005945 | 3300025916 | Bacteria | 6194 |
| 644 | Ga0207663_10013299 | 3300025916 | Bacteria | 4469 |
| 645 | Ga0207660_10014532 | 3300025917 | Bacteria | 5179 |
| 646 | Ga0207660_10074288 | 3300025917 | Bacteria | 2481 |
| 647 | Ga0207662_10034238 | 3300025918 | Bacteria | 2964 |
| 648 | Ga0207662_10050234 | 3300025918 | Bacteria | 2476 |
| 649 | Ga0207657_10001149 | 3300025919 | Bacteria | 28146 |
| 650 | Ga0207657_10001270 | 3300025919 | Bacteria | 26894 |
| 651 | Ga0207657_10003162 | 3300025919 | Bacteria | 17611 |
| 652 | Ga0207657_10016143 | 3300025919 | Bacteria | 7210 |
| 653 | Ga0207657_10017091 | 3300025919 | Bacteria | 6974 |
| 654 | Ga0207657_10019127 | 3300025919 | Bacteria | 6513 |
| 655 | Ga0207657_10034826 | 3300025919 | Bacteria | 4521 |
| 656 | Ga0207649_10017722 | 3300025920 | Bacteria | 4038 |
| 657 | Ga0207649_10024633 | 3300025920 | Bacteria | 3501 |
| 658 | Ga0207652_10005535 | 3300025921 | Bacteria | 10239 |
| 659 | Ga0207652_10011118 | 3300025921 | Bacteria | 7255 |
| 660 | Ga0207652_10027955 | 3300025921 | Bacteria | 4703 |
| 661 | Ga0207681_10000771 | 3300025923 | Bacteria | 21062 |
| 662 | Ga0207681_10038217 | 3300025923 | Bacteria | 3178 |
| 663 | Ga0207694_10002105 | 3300025924 | Bacteria | 16415 |
| 664 | Ga0207694_10002468 | 3300025924 | Bacteria | 15055 |
| 665 | Ga0207694_10002748 | 3300025924 | Bacteria | 14213 |
| 666 | Ga0207694_10005169 | 3300025924 | Bacteria | 10077 |
| 667 | Ga0207694_10015380 | 3300025924 | Bacteria | 5770 |
| 668 | Ga0207694_10021256 | 3300025924 | Bacteria | 4916 |
| 669 | Ga0207694_10048422 | 3300025924 | Bacteria | 3289 |
| 670 | Ga0207694_10150728 | 3300025924 | Bacteria | 1873 |
| 671 | Ga0207650_10000560 | 3300025925 | Bacteria | 30230 |
| 672 | Ga0207650_10002377 | 3300025925 | Bacteria | 13097 |
| 673 | Ga0207650_10011897 | 3300025925 | Bacteria | 5996 |
| 674 | Ga0207650_10025705 | 3300025925 | Bacteria | 4196 |
| 675 | Ga0207650_10026512 | 3300025925 | Bacteria | 4135 |
| 676 | Ga0207659_10000451 | 3300025926 | Bacteria | 24742 |
| 677 | Ga0207659_10006382 | 3300025926 | Bacteria | 7222 |
| 678 | Ga0207659_10019606 | 3300025926 | Bacteria | 4456 |
| 679 | Ga0207659_10033134 | 3300025926 | Bacteria | 3552 |
| 680 | Ga0207659_10069542 | 3300025926 | Bacteria | 2564 |
| 681 | Ga0207659_10091043 | 3300025926 | Bacteria | 2278 |
| 682 | Ga0207687_10001118 | 3300025927 | Bacteria | 18248 |
| 683 | Ga0207687_10006970 | 3300025927 | Bacteria | 7447 |
| 684 | Ga0207687_10013555 | 3300025927 | Bacteria | 5321 |
| 685 | Ga0207687_10030809 | 3300025927 | Bacteria | 3620 |
| 686 | Ga0207700_10003116 | 3300025928 | Bacteria | 9583 |
| 687 | Ga0207700_10067226 | 3300025928 | Bacteria | 2742 |
| 688 | Ga0207664_10000098 | 3300025929 | Bacteria | 80444 |
| 689 | Ga0207664_10003289 | 3300025929 | Bacteria | 10742 |
| 690 | Ga0207644_10011258 | 3300025931 | Bacteria | 5913 |
| 691 | Ga0207644_10016472 | 3300025931 | Bacteria | 4973 |
| 692 | Ga0207644_10019754 | 3300025931 | Bacteria | 4575 |
| 693 | Ga0207644_10021070 | 3300025931 | Bacteria | 4438 |
| 694 | Ga0207644_10037618 | 3300025931 | Bacteria | 3405 |
| 695 | Ga0207644_10051140 | 3300025931 | Bacteria | 2965 |
| 696 | Ga0207706_10000877 | 3300025933 | Bacteria | 30889 |
| 697 | Ga0207706_10048964 | 3300025933 | Bacteria | 3736 |
| 698 | Ga0207706_10146261 | 3300025933 | Bacteria | 2079 |
| 699 | Ga0207686_10001460 | 3300025934 | Bacteria | 13366 |
| 700 | Ga0207686_10030493 | 3300025934 | Bacteria | 3193 |
| 701 | Ga0207709_10013935 | 3300025935 | Bacteria | 4440 |
| 702 | Ga0207709_10042165 | 3300025935 | Bacteria | 2743 |
| 703 | Ga0207670_10005467 | 3300025936 | Bacteria | 6975 |
| 704 | Ga0207670_10009202 | 3300025936 | Bacteria | 5622 |
| 705 | Ga0207670_10079073 | 3300025936 | Bacteria | 2295 |
| 706 | Ga0207669_10008342 | 3300025937 | Bacteria | 4857 |
| 707 | Ga0207669_10036801 | 3300025937 | Bacteria | 2801 |
| 708 | Ga0207704_10038806 | 3300025938 | Bacteria | 2766 |
| 709 | Ga0207691_10001534 | 3300025940 | Bacteria | 22975 |
| 710 | Ga0207691_10004954 | 3300025940 | Bacteria | 12848 |
| 711 | Ga0207691_10005269 | 3300025940 | Bacteria | 12483 |
| 712 | Ga0207691_10007322 | 3300025940 | Bacteria | 10646 |
| 713 | Ga0207691_10010941 | 3300025940 | Bacteria | 8709 |
| 714 | Ga0207691_10013082 | 3300025940 | Bacteria | 7945 |
| 715 | Ga0207691_10014958 | 3300025940 | Bacteria | 7391 |
| 716 | Ga0207691_10015118 | 3300025940 | Bacteria | 7345 |
| 717 | Ga0207691_10015412 | 3300025940 | Bacteria | 7272 |
| 718 | Ga0207691_10030613 | 3300025940 | Bacteria | 5027 |
| 719 | Ga0207691_10039099 | 3300025940 | Bacteria | 4390 |
| 720 | Ga0207691_10136948 | 3300025940 | Bacteria | 2159 |
| 721 | Ga0207711_10000207 | 3300025941 | Bacteria | 62922 |
| 722 | Ga0207711_10003165 | 3300025941 | Bacteria | 14351 |
| 723 | Ga0207711_10012387 | 3300025941 | Bacteria | 7089 |
| 724 | Ga0207711_10017327 | 3300025941 | Bacteria | 5985 |
| 725 | Ga0207689_10000409 | 3300025942 | Bacteria | 40335 |
| 726 | Ga0207689_10000550 | 3300025942 | Bacteria | 35746 |
| 727 | Ga0207689_10000760 | 3300025942 | Bacteria | 30926 |
| 728 | Ga0207689_10005369 | 3300025942 | Bacteria | 11471 |
| 729 | Ga0207689_10015742 | 3300025942 | Bacteria | 6404 |
| 730 | Ga0207689_10016509 | 3300025942 | Bacteria | 6250 |
| 731 | Ga0207689_10058301 | 3300025942 | Bacteria | 3176 |
| 732 | Ga0207689_10065241 | 3300025942 | Unclassified | 2995 |
| 733 | Ga0207661_10000365 | 3300025944 | Bacteria | 29025 |
| 734 | Ga0207661_10002307 | 3300025944 | Bacteria | 13140 |
| 735 | Ga0207661_10011069 | 3300025944 | Bacteria | 6520 |
| 736 | Ga0207661_10014005 | 3300025944 | Bacteria | 5866 |
| 737 | Ga0207661_10060715 | 3300025944 | Bacteria | 3052 |
| 738 | Ga0207661_10101465 | 3300025944 | Bacteria | 2417 |
| 739 | Ga0207679_10001204 | 3300025945 | Bacteria | 16442 |
| 740 | Ga0207679_10002603 | 3300025945 | Bacteria | 11112 |
| 741 | Ga0207667_10000081 | 3300025949 | Bacteria | 162100 |
| 742 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 743 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 744 | Ga0207667_10002602 | 3300025949 | Bacteria | 22393 |
| 745 | Ga0207667_10003158 | 3300025949 | Bacteria | 20383 |
| 746 | Ga0207667_10004524 | 3300025949 | Bacteria | 17034 |
| 747 | Ga0207667_10007079 | 3300025949 | Bacteria | 13547 |
| 748 | Ga0207667_10010462 | 3300025949 | Bacteria | 10842 |
| 749 | Ga0207667_10015326 | 3300025949 | Bacteria | 8715 |
| 750 | Ga0207667_10015806 | 3300025949 | Bacteria | 8553 |
| 751 | Ga0207667_10026254 | 3300025949 | Bacteria | 6365 |
| 752 | Ga0207667_10039797 | 3300025949 | Bacteria | 5006 |
| 753 | Ga0207667_10098895 | 3300025949 | Bacteria | 3010 |
| 754 | Ga0207667_10116840 | 3300025949 | Bacteria | 2749 |
| 755 | Ga0207712_10026330 | 3300025961 | Bacteria | 3872 |
| 756 | Ga0207712_10033856 | 3300025961 | Bacteria | 3457 |
| 757 | Ga0207668_10056683 | 3300025972 | Bacteria | 2730 |
| 758 | Ga0207668_10067709 | 3300025972 | Bacteria | 2536 |
| 759 | Ga0207668_10111988 | 3300025972 | Bacteria | 2049 |
| 760 | Ga0207640_10000223 | 3300025981 | Bacteria | 40042 |
| 761 | Ga0207640_10002318 | 3300025981 | Bacteria | 10227 |
| 762 | Ga0207640_10023258 | 3300025981 | Bacteria | 3722 |
| 763 | Ga0207640_10032095 | 3300025981 | Bacteria | 3254 |
| 764 | Ga0207658_10000030 | 3300025986 | Bacteria | 168693 |
| 765 | Ga0207658_10000818 | 3300025986 | Bacteria | 25979 |
| 766 | Ga0207658_10036460 | 3300025986 | Bacteria | 3526 |
| 767 | Ga0207658_10117742 | 3300025986 | Bacteria | 2112 |
| 768 | Ga0207677_10004108 | 3300026023 | Bacteria | 7787 |
| 769 | Ga0207677_10018320 | 3300026023 | Bacteria | 4199 |
| 770 | Ga0207677_10022413 | 3300026023 | Bacteria | 3881 |
| 771 | Ga0207677_10036833 | 3300026023 | Bacteria | 3192 |
| 772 | Ga0207677_10057314 | 3300026023 | Bacteria | 2674 |
| 773 | Ga0207677_10090940 | 3300026023 | Bacteria | 2219 |
| 774 | Ga0207703_10010303 | 3300026035 | Bacteria | 7321 |
| 775 | Ga0207703_10017240 | 3300026035 | Bacteria | 5637 |
| 776 | Ga0207703_10026368 | 3300026035 | Bacteria | 4573 |
| 777 | Ga0207703_10038038 | 3300026035 | Bacteria | 3837 |
| 778 | Ga0207703_10089463 | 3300026035 | Bacteria | 2586 |
| 779 | Ga0207703_10174297 | 3300026035 | Bacteria | 1894 |
| 780 | Ga0207639_10031212 | 3300026041 | Bacteria | 3914 |
| 781 | Ga0207639_10032444 | 3300026041 | Bacteria | 3845 |
| 782 | Ga0207639_10056919 | 3300026041 | Bacteria | 2999 |
| 783 | Ga0207639_10064622 | 3300026041 | Bacteria | 2837 |
| 784 | Ga0207639_10080984 | 3300026041 | Bacteria | 2570 |
| 785 | Ga0207678_10011277 | 3300026067 | Bacteria | 7846 |
| 786 | Ga0207678_10014250 | 3300026067 | Bacteria | 6989 |
| 787 | Ga0207678_10034046 | 3300026067 | Bacteria | 4437 |
| 788 | Ga0207678_10063094 | 3300026067 | Bacteria | 3184 |
| 789 | Ga0207678_10082198 | 3300026067 | Bacteria | 2756 |
| 790 | Ga0207678_10120869 | 3300026067 | Bacteria | 2235 |
| 791 | Ga0207708_10000774 | 3300026075 | Bacteria | 24066 |
| 792 | Ga0207708_10010414 | 3300026075 | Bacteria | 6903 |
| 793 | Ga0207708_10016060 | 3300026075 | Bacteria | 5623 |
| 794 | Ga0207702_10000654 | 3300026078 | Bacteria | 37703 |
| 795 | Ga0207702_10001923 | 3300026078 | Bacteria | 20310 |
| 796 | Ga0207702_10028235 | 3300026078 | Bacteria | 4662 |
| 797 | Ga0207702_10047907 | 3300026078 | Bacteria | 3603 |
| 798 | Ga0207702_10184247 | 3300026078 | Bacteria | 1925 |
| 799 | Ga0207641_10000013 | 3300026088 | Bacteria | 341378 |
| 800 | Ga0207641_10000089 | 3300026088 | Bacteria | 128603 |
| 801 | Ga0207641_10003358 | 3300026088 | Bacteria | 14226 |
| 802 | Ga0207641_10031952 | 3300026088 | Bacteria | 4368 |
| 803 | Ga0207641_10046760 | 3300026088 | Bacteria | 3649 |
| 804 | Ga0207641_10061416 | 3300026088 | Bacteria | 3205 |
| 805 | Ga0207641_10082299 | 3300026088 | Bacteria | 2796 |
| 806 | Ga0207641_10108350 | 3300026088 | Bacteria | 2458 |
| 807 | Ga0207648_10009106 | 3300026089 | Bacteria | 9542 |
| 808 | Ga0207648_10015625 | 3300026089 | Bacteria | 6975 |
| 809 | Ga0207648_10032020 | 3300026089 | Bacteria | 4646 |
| 810 | Ga0207648_10061960 | 3300026089 | Bacteria | 3261 |
| 811 | Ga0207676_10005841 | 3300026095 | Bacteria | 8697 |
| 812 | Ga0207676_10009328 | 3300026095 | Bacteria | 6983 |
| 813 | Ga0207676_10011036 | 3300026095 | Bacteria | 6446 |
| 814 | Ga0207676_10019779 | 3300026095 | Bacteria | 4917 |
| 815 | Ga0207676_10038263 | 3300026095 | Bacteria | 3659 |
| 816 | Ga0207676_10082977 | 3300026095 | Bacteria | 2609 |
| 817 | Ga0207676_10099321 | 3300026095 | Unclassified | 2409 |
| 818 | Ga0207674_10000042 | 3300026116 | Bacteria | 126790 |
| 819 | Ga0207674_10000159 | 3300026116 | Bacteria | 80339 |
| 820 | Ga0207674_10000357 | 3300026116 | Bacteria | 59170 |
| 821 | Ga0207674_10002307 | 3300026116 | Bacteria | 24170 |
| 822 | Ga0207674_10004196 | 3300026116 | Bacteria | 17388 |
| 823 | Ga0207674_10009845 | 3300026116 | Bacteria | 10882 |
| 824 | Ga0207674_10049085 | 3300026116 | Bacteria | 4318 |
| 825 | Ga0207674_10119515 | 3300026116 | Bacteria | 2604 |
| 826 | Ga0207675_100000576 | 3300026118 | Bacteria | 35873 |
| 827 | Ga0207675_100000872 | 3300026118 | Bacteria | 30060 |
| 828 | Ga0207675_100001526 | 3300026118 | Bacteria | 23217 |
| 829 | Ga0207675_100003993 | 3300026118 | Bacteria | 14308 |
| 830 | Ga0207675_100022740 | 3300026118 | Bacteria | 5834 |
| 831 | Ga0207675_100041926 | 3300026118 | Bacteria | 4274 |
| 832 | Ga0207675_100080135 | 3300026118 | Bacteria | 3061 |
| 833 | Ga0207675_100159215 | 3300026118 | Bacteria | 2153 |
| 834 | Ga0207683_10001016 | 3300026121 | Bacteria | 25569 |
| 835 | Ga0207683_10002413 | 3300026121 | Bacteria | 16319 |
| 836 | Ga0207683_10003038 | 3300026121 | Bacteria | 14665 |
| 837 | Ga0207698_10000144 | 3300026142 | Bacteria | 45298 |
| 838 | Ga0207698_10000786 | 3300026142 | Bacteria | 18484 |
| 839 | Ga0207698_10008141 | 3300026142 | Bacteria | 6608 |
| 840 | Ga0207698_10025890 | 3300026142 | Bacteria | 4142 |
| 841 | Ga0207698_10038399 | 3300026142 | Bacteria | 3538 |
| 842 | Ga0207698_10099257 | 3300026142 | Bacteria | 2408 |
| 843 | Ga0209281_1000314 | 3300027111 | Bacteria | 86424 |
| 844 | Ga0209281_1002256 | 3300027111 | Bacteria | 8166 |
| 845 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 846 | Ga0209371_1000537 | 3300027312 | Bacteria | 35888 |
| 847 | Ga0209371_1006193 | 3300027312 | Bacteria | 4507 |
| 848 | Ga0209282_1000068 | 3300027666 | Bacteria | 85817 |
| 849 | Ga0209971_1001426 | 3300027682 | Bacteria | 5957 |
| 850 | Ga0209974_10003272 | 3300027876 | Bacteria | 5857 |
| 851 | Ga0207428_10059322 | 3300027907 | Bacteria | 3034 |
| 852 | Ga0265356_1000046 | 3300028017 | Bacteria | 20120 |
| 853 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 854 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 855 | Ga0268266_10017537 | 3300028379 | Bacteria | 6108 |
| 856 | Ga0268266_10045180 | 3300028379 | Bacteria | 3768 |
| 857 | Ga0268266_10095979 | 3300028379 | Bacteria | 2604 |
| 858 | Ga0268266_10125486 | 3300028379 | Bacteria | 2290 |
| 859 | Ga0268265_10034418 | 3300028380 | Bacteria | 3692 |
| 860 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 861 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 862 | Ga0268264_10004058 | 3300028381 | Bacteria | 12531 |
| 863 | Ga0268264_10022094 | 3300028381 | Bacteria | 5192 |
| 864 | Ga0268264_10047533 | 3300028381 | Bacteria | 3568 |
| 865 | Ga0268264_10147620 | 3300028381 | Bacteria | 2104 |
| 866 | Ga0265337_1002039 | 3300028556 | Bacteria | 9583 |
| 867 | Ga0265319_1003800 | 3300028563 | Bacteria | 7741 |
| 868 | Ga0265334_10000665 | 3300028573 | Bacteria | 17269 |
| 869 | Ga0265318_10001512 | 3300028577 | Bacteria | 13550 |
| 870 | Ga0265318_10009367 | 3300028577 | Bacteria | 4310 |
| 871 | Ga0265336_10000091 | 3300028666 | Bacteria | 69365 |
| 872 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 873 | Ga0265338_10000094 | 3300028800 | Bacteria | 168366 |
| 874 | Ga0265338_10009598 | 3300028800 | Bacteria | 11502 |
| 875 | Ga0265338_10023109 | 3300028800 | Bacteria | 6403 |
| 876 | Ga0265338_10025148 | 3300028800 | Bacteria | 6055 |
| 877 | Ga0265324_10002737 | 3300029957 | Bacteria | 8761 |
| 878 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 879 | Ga0268256_1001478 | 3300030500 | Bacteria | 13997 |
| 880 | Ga0268256_1003531 | 3300030500 | Bacteria | 7004 |
| 881 | Ga0265762_1000015 | 3300030760 | Bacteria | 19541 |
| 882 | Ga0265762_1000247 | 3300030760 | Bacteria | 8830 |
| 883 | Ga0265762_1004398 | 3300030760 | Bacteria | 2525 |
| 884 | Ga0265330_10002898 | 3300031235 | Bacteria | 9158 |
| 885 | Ga0265325_10035530 | 3300031241 | Bacteria | 2646 |
| 886 | Ga0265340_10000777 | 3300031247 | Bacteria | 18137 |
| 887 | Ga0265331_10003629 | 3300031250 | Bacteria | 9867 |
| 888 | Ga0265331_10011722 | 3300031250 | Bacteria | 4791 |
| 889 | Ga0265327_10000101 | 3300031251 | Bacteria | 188671 |
| 890 | Ga0265316_10026826 | 3300031344 | Bacteria | 4784 |
| 891 | Ga0307513_10006796 | 3300031456 | Bacteria | 14918 |
| 892 | Ga0307513_10016752 | 3300031456 | Bacteria | 8818 |
| 893 | Ga0307513_10025919 | 3300031456 | Bacteria | 6773 |
| 894 | Ga0307513_10031051 | 3300031456 | Bacteria | 6056 |
| 895 | Ga0307513_10086444 | 3300031456 | Bacteria | 3214 |
| 896 | Ga0307509_10023313 | 3300031507 | Bacteria | 6956 |
| 897 | Ga0307509_10036387 | 3300031507 | Bacteria | 5390 |
| 898 | Ga0307408_100000012 | 3300031548 | Bacteria | 408153 |
| 899 | Ga0265313_10003442 | 3300031595 | Bacteria | 12803 |
| 900 | Ga0265313_10004963 | 3300031595 | Bacteria | 9956 |
| 901 | Ga0265313_10005404 | 3300031595 | Bacteria | 9416 |
| 902 | Ga0307508_10091929 | 3300031616 | Bacteria | 2623 |
| 903 | Ga0265314_10000503 | 3300031711 | Bacteria | 50401 |
| 904 | Ga0265314_10001520 | 3300031711 | Bacteria | 25622 |
| 905 | Ga0265314_10052896 | 3300031711 | Bacteria | 2820 |
| 906 | Ga0265342_10021086 | 3300031712 | Bacteria | 4168 |
| 907 | Ga0265342_10028130 | 3300031712 | Bacteria | 3506 |
| 908 | Ga0307516_10001218 | 3300031730 | Bacteria | 35831 |
| 909 | Ga0307516_10001770 | 3300031730 | Bacteria | 29691 |
| 910 | Ga0307516_10019622 | 3300031730 | Bacteria | 6999 |
| 911 | Ga0307405_10005296 | 3300031731 | Bacteria | 6203 |
| 912 | Ga0307405_10072248 | 3300031731 | Bacteria | 2223 |
| 913 | Ga0307413_10036155 | 3300031824 | Bacteria | 2841 |
| 914 | Ga0307410_10004936 | 3300031852 | Bacteria | 6990 |
| 915 | Ga0307410_10019486 | 3300031852 | Bacteria | 4128 |
| 916 | Ga0307410_10051036 | 3300031852 | Bacteria | 2785 |
| 917 | Ga0307406_10022045 | 3300031901 | Bacteria | 3775 |
| 918 | Ga0307406_10036211 | 3300031901 | Bacteria | 3039 |
| 919 | Ga0307407_10010579 | 3300031903 | Bacteria | 4359 |
| 920 | Ga0307407_10011071 | 3300031903 | Bacteria | 4279 |
| 921 | Ga0307407_10037317 | 3300031903 | Bacteria | 2684 |
| 922 | Ga0315914_1000937 | 3300031967 | Bacteria | 41175 |
| 923 | Ga0307409_100001880 | 3300031995 | Bacteria | 10706 |
| 924 | Ga0307409_100002278 | 3300031995 | Bacteria | 9942 |
| 925 | Ga0307409_100004509 | 3300031995 | Bacteria | 7842 |
| 926 | Ga0307409_100009088 | 3300031995 | Bacteria | 6084 |
| 927 | Ga0307416_100030348 | 3300032002 | Bacteria | 4055 |
| 928 | Ga0307416_100031608 | 3300032002 | Bacteria | 3988 |
| 929 | Ga0307416_100050165 | 3300032002 | Bacteria | 3325 |
| 930 | Ga0307416_100050227 | 3300032002 | Bacteria | 3323 |
| 931 | Ga0307411_10003510 | 3300032005 | Bacteria | 7290 |
| 932 | Ga0307411_10014317 | 3300032005 | Bacteria | 4408 |
| 933 | Ga0307411_10024286 | 3300032005 | Bacteria | 3610 |
| 934 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 935 | Ga0307510_10102238 | 3300033180 | Bacteria | 2649 |
| 936 | Ga0315913_1042274 | 3300033430 | Bacteria | 2336 |
| 937 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 938 | Ga0373940_0011049 | 3300035088 | Bacteria | 2137 |
| 939 | Ga0373932_0000899 | 3300035112 | Bacteria | 8694 |
| 940 | Ga0373936_0001015 | 3300035113 | Bacteria | 10035 |
| 941 | Ga0373941_0001232 | 3300035115 | Bacteria | 5370 |
| 942 | Ga0373945_0003061 | 3300035116 | Bacteria | 5258 |
| 943 | Ga0373953_0006044 | 3300035117 | Bacteria | 3967 |
| 944 | Ga0373954_0000003 | 3300035118 | Bacteria | 137757 |
| 945 | Ga0373954_0002478 | 3300035118 | Bacteria | 7748 |
| 946 | Ga0373954_0005203 | 3300035118 | Bacteria | 5621 |
| 947 | Ga0373954_0005212 | 3300035118 | Bacteria | 5617 |
| 948 | Ga0373957_0007832 | 3300035120 | Bacteria | 3433 |
| 949 | Ga0373943_0000669 | 3300035170 | Bacteria | 14898 |
| 950 | Ga0373943_0064677 | 3300035170 | Bacteria | 1837 |
| 951 | Ga0373946_0013112 | 3300035171 | Bacteria | 3110 |
| 952 | Ga0373955_0000118 | 3300035172 | Bacteria | 31719 |
| 953 | Ga0373942_0004480 | 3300035207 | Bacteria | 3239 |
| 954 | Ga0373931_0000240 | 3300035691 | Bacteria | 23366 |
| 955 | Ga0373935_0011104 | 3300035692 | Bacteria | 5408 |
| 956 | Ga0373935_0024658 | 3300035692 | Bacteria | 3704 |
| 957 | Ga0373935_0026953 | 3300035692 | Bacteria | 3552 |
| 958 | Ga0373927_0000282 | 3300035695 | Bacteria | 40021 |
| 959 | Ga0373927_0067639 | 3300035695 | Bacteria | 2312 |
| 960 | Ga0373933_0000658 | 3300035724 | Bacteria | 21439 |
| 961 | Ga0373933_0002250 | 3300035724 | Bacteria | 11004 |
| 962 | Ga0373933_0003016 | 3300035724 | Bacteria | 9394 |
| 963 | Ga0373933_0004189 | 3300035724 | Bacteria | 7948 |
| 964 | Ga0373947_0001632 | 3300035725 | Bacteria | 13760 |
| 965 | Ga0373937_0000440 | 3300036401 | Bacteria | 38396 |
| 966 | Ga0373937_0005019 | 3300036401 | Bacteria | 11262 |
| 967 | Ga0373937_0005357 | 3300036401 | Bacteria | 10972 |
| 968 | Ga0373937_0010310 | 3300036401 | Bacteria | 8156 |
| 969 | Ga0373937_0027922 | 3300036401 | Bacteria | 5105 |
| 970 | Ga0316584_0005493 | 3300036712 | Bacteria | 8513 |
| 971 | Ga0316584_0059153 | 3300036712 | Bacteria | 2870 |
| 972 | Ga0316584_0141540 | 3300036712 | Bacteria | 1793 |
| 973 | Ga0373925_0002387 | 3300037068 | Bacteria | 15061 |
| 974 | Ga0373925_0003223 | 3300037068 | Bacteria | 12747 |
| 975 | Ga0373925_0041873 | 3300037068 | Bacteria | 3397 |
| 976 | Ga0395899_0000226 | 3300037312 | Bacteria | 76657 |
| 977 | Ga0395899_0001647 | 3300037312 | Bacteria | 18642 |
| 978 | Ga0395899_0002404 | 3300037312 | Bacteria | 15206 |
| 979 | Ga0395899_0005993 | 3300037312 | Bacteria | 9443 |
| 980 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 981 | Ga0395900_0037630 | 3300037418 | Bacteria | 4988 |
| 982 | Ga0395898_0000029 | 3300037466 | Bacteria | 370667 |
| 983 | Ga0395901_0104306 | 3300038443 | Bacteria | 2975 |
| 984 | Ga0395901_0111869 | 3300038443 | Bacteria | 2868 |
| 985 | Ga0395901_0150207 | 3300038443 | Bacteria | 2448 |
| 986 | Ga0400483_135128 | 3300039062 | Bacteria | 5440 |
| 987 | Ga0400483_140637 | 3300039062 | Bacteria | 7787 |
| 988 | Ga0400483_161077 | 3300039062 | Bacteria | 2410 |
| 989 | Ga0400483_220317 | 3300039062 | Bacteria | 6723 |
| 990 | Ga0400483_254359 | 3300039062 | Bacteria | 25463 |
| 991 | Ga0436365_0827866 | 3300039437 | Bacteria | 4050 |
| 992 | Ga0436365_1141651 | 3300039437 | Bacteria | 3449 |
| 993 | Ga0436363_1450588 | 3300039450 | Bacteria | 18752 |
| 994 | Ga0439436_0003081 | 3300041404 | Bacteria | 5058 |
| 995 | Ga0439436_0005279 | 3300041404 | Bacteria | 3957 |
| 996 | Ga0439465_0000738 | 3300041413 | Bacteria | 10126 |
| 997 | Ga0451789_0328144 | 3300041443 | Bacteria | 2543 |
| 998 | Ga0451800_0252034 | 3300041459 | Bacteria | 3476 |
| 999 | Ga0451800_0551749 | 3300041459 | Bacteria | 1854 |
| 1000 | Ga0451806_025862 | 3300041462 | Bacteria | 6474 |
| 1001 | Ga0451804_0359998 | 3300041463 | Bacteria | 3440 |
| 1002 | Ga0451804_0727978 | 3300041463 | Bacteria | 2622 |
| 1003 | Ga0451807_1729626 | 3300041486 | Bacteria | 3452 |
| 1004 | Ga0451843_0331670 | 3300041509 | Bacteria | 2547 |
| 1005 | Ga0451853_3542700 | 3300041512 | Bacteria | 5059 |
| 1006 | Ga0439445_0006216 | 3300042004 | Bacteria | 2743 |
| 1007 | Ga0439449_0000136 | 3300042007 | Bacteria | 24746 |
| 1008 | Ga0439449_0019743 | 3300042007 | Bacteria | 2526 |
| 1009 | Ga0439457_004730 | 3300042014 | Bacteria | 3514 |
| 1010 | Ga0450919_001002 | 3300042121 | Bacteria | 3653 |
| 1011 | Ga0451577_0000068 | 3300042876 | Bacteria | 241923 |
| 1012 | Ga0451577_0005641 | 3300042876 | Bacteria | 12717 |
| 1013 | Ga0451577_0020693 | 3300042876 | Bacteria | 6033 |
| 1014 | Ga0466969_0004147 | 3300044656 | Bacteria | 7696 |
| 1015 | Ga0466972_0000051 | 3300044658 | Bacteria | 114011 |
| 1016 | Ga0466972_0000066 | 3300044658 | Bacteria | 103012 |
| 1017 | Ga0466972_0002650 | 3300044658 | Bacteria | 8858 |
| 1018 | Ga0466972_0016077 | 3300044658 | Bacteria | 3741 |
| 1019 | Ga0466972_0058382 | 3300044658 | Bacteria | 1853 |
| 1020 | Ga0453683_0031443 | 3300044673 | Bacteria | 3354 |
| 1021 | Ga0453683_0039345 | 3300044673 | Bacteria | 2972 |
| 1022 | Ga0466966_0010972 | 3300044684 | Bacteria | 6012 |
| 1023 | Ga0466966_0035209 | 3300044684 | Bacteria | 3236 |
| 1024 | Ga0466961_0000057 | 3300044693 | Bacteria | 66922 |
| 1025 | Ga0466961_0000299 | 3300044693 | Bacteria | 32965 |
| 1026 | Ga0466964_0011561 | 3300044706 | Bacteria | 3336 |
| 1027 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 1028 | Ga0453684_0000841 | 3300044712 | Bacteria | 103501 |
| 1029 | Ga0466970_0002111 | 3300044765 | Bacteria | 9599 |
| 1030 | Ga0466970_0009896 | 3300044765 | Bacteria | 4828 |
| 1031 | Ga0466970_0056253 | 3300044765 | Bacteria | 2102 |
| 1032 | Ga0466957_0000150 | 3300044842 | Bacteria | 30176 |
| 1033 | Ga0466957_0016708 | 3300044842 | Bacteria | 4293 |
| 1034 | Ga0466959_0000006 | 3300045049 | Bacteria | 192678 |
| 1035 | Ga0466959_0043416 | 3300045049 | Bacteria | 3314 |
| 1036 | Ga0451576_0000231 | 3300045051 | Bacteria | 136040 |
| 1037 | Ga0451576_0007420 | 3300045051 | Bacteria | 13115 |
| 1038 | Ga0451576_0012737 | 3300045051 | Bacteria | 9442 |
| 1039 | Ga0451576_0229500 | 3300045051 | Bacteria | 1938 |
| 1040 | Ga0466958_0005665 | 3300045836 | Bacteria | 6745 |
| 1041 | Ga0466958_0085200 | 3300045836 | Bacteria | 1949 |
| 1042 | Ga0466967_0000360 | 3300045976 | Bacteria | 21122 |
| 1043 | Ga0495627_007125 | 3300046453 | Bacteria | 4323 |
| 1044 | Ga0495590_0005537 | 3300046457 | Bacteria | 4998 |
| 1045 | Ga0495629_0037018 | 3300046459 | Bacteria | 3440 |
| 1046 | Ga0495629_0163140 | 3300046459 | Bacteria | 1548 |
| 1047 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 1048 | Ga0495638_0002027 | 3300046460 | Bacteria | 17231 |
| 1049 | Ga0495638_0006731 | 3300046460 | Bacteria | 8325 |
| 1050 | Ga0495638_0014676 | 3300046460 | Bacteria | 5285 |
| 1051 | Ga0495638_0058764 | 3300046460 | Bacteria | 2382 |
| 1052 | Ga0495641_0035593 | 3300046461 | Bacteria | 2345 |
| 1053 | Ga0495651_0014430 | 3300046462 | Bacteria | 6107 |
| 1054 | Ga0495651_0015743 | 3300046462 | Bacteria | 5856 |
| 1055 | Ga0495653_0060752 | 3300046463 | Bacteria | 2862 |
| 1056 | Ga0495580_0001774 | 3300046472 | Bacteria | 18967 |
| 1057 | Ga0495580_0004783 | 3300046472 | Bacteria | 11341 |
| 1058 | Ga0495580_0008629 | 3300046472 | Bacteria | 8084 |
| 1059 | Ga0495580_0036679 | 3300046472 | Bacteria | 3519 |
| 1060 | Ga0495580_0069235 | 3300046472 | Bacteria | 2466 |
| 1061 | Ga0495582_0034864 | 3300046473 | Bacteria | 2766 |
| 1062 | Ga0495585_0001026 | 3300046492 | Bacteria | 23232 |
| 1063 | Ga0495585_0011525 | 3300046492 | Bacteria | 5232 |
| 1064 | Ga0495606_0002804 | 3300046507 | Bacteria | 19399 |
| 1065 | Ga0495606_0006725 | 3300046507 | Bacteria | 10527 |
| 1066 | Ga0495608_0000270 | 3300046511 | Bacteria | 37043 |
| 1067 | Ga0495608_0006211 | 3300046511 | Bacteria | 8481 |
| 1068 | Ga0495610_0012871 | 3300046512 | Bacteria | 5003 |
| 1069 | Ga0495616_0001662 | 3300046513 | Bacteria | 15216 |
| 1070 | Ga0495616_0003016 | 3300046513 | Bacteria | 10931 |
| 1071 | Ga0495628_0002765 | 3300046516 | Bacteria | 15713 |
| 1072 | Ga0495628_0041453 | 3300046516 | Bacteria | 3675 |
| 1073 | Ga0495630_0007543 | 3300046517 | Bacteria | 7776 |
| 1074 | Ga0495632_0010918 | 3300046519 | Bacteria | 5334 |
| 1075 | Ga0495632_0032924 | 3300046519 | Bacteria | 2666 |
| 1076 | Ga0495648_0004838 | 3300046524 | Bacteria | 11366 |
| 1077 | Ga0495648_0005660 | 3300046524 | Bacteria | 10338 |
| 1078 | Ga0495652_0002808 | 3300046529 | Bacteria | 17553 |
| 1079 | Ga0495652_0008827 | 3300046529 | Bacteria | 9173 |
| 1080 | Ga0495652_0097198 | 3300046529 | Bacteria | 2396 |
| 1081 | Ga0495665_0013184 | 3300046531 | Bacteria | 4473 |
| 1082 | Ga0495665_0026539 | 3300046531 | Bacteria | 3111 |
| 1083 | Ga0495640_0002870 | 3300046533 | Bacteria | 13875 |
| 1084 | Ga0495586_0000323 | 3300046535 | Bacteria | 30293 |
| 1085 | Ga0495587_0023217 | 3300046536 | Bacteria | 3813 |
| 1086 | Ga0495587_0026329 | 3300046536 | Bacteria | 3548 |
| 1087 | Ga0495645_0005153 | 3300046543 | Bacteria | 8952 |
| 1088 | Ga0495645_0043951 | 3300046543 | Bacteria | 3259 |
| 1089 | Ga0495622_0014803 | 3300046557 | Bacteria | 3625 |
| 1090 | Ga0495667_0000653 | 3300046559 | Bacteria | 22156 |
| 1091 | Ga0495656_0018397 | 3300046615 | Bacteria | 2682 |
| 1092 | Ga0495668_0000179 | 3300046616 | Bacteria | 94559 |
| 1093 | Ga0495668_0005368 | 3300046616 | Bacteria | 8731 |
| 1094 | Ga0495634_0001658 | 3300046642 | Bacteria | 19385 |
| 1095 | Ga0495634_0017168 | 3300046642 | Bacteria | 5169 |
| 1096 | Ga0495634_0019325 | 3300046642 | Bacteria | 4843 |
| 1097 | Ga0495611_0000010 | 3300046648 | Bacteria | 156661 |
| 1098 | Ga0495611_0000844 | 3300046648 | Bacteria | 16812 |
| 1099 | Ga0495625_0001614 | 3300046660 | Bacteria | 26595 |
| 1100 | Ga0495625_0009215 | 3300046660 | Bacteria | 8289 |
| 1101 | Ga0495625_0011056 | 3300046660 | Bacteria | 7398 |
| 1102 | Ga0495625_0034067 | 3300046660 | Bacteria | 3760 |
| 1103 | Ga0495625_0034296 | 3300046660 | Bacteria | 3747 |
| 1104 | Ga0495625_0061513 | 3300046660 | Bacteria | 2657 |
| 1105 | Ga0495635_0000837 | 3300046663 | Bacteria | 20135 |
| 1106 | Ga0495661_0021737 | 3300046665 | Bacteria | 4178 |
| 1107 | Ga0495657_0002784 | 3300046675 | Bacteria | 14541 |
| 1108 | Ga0495599_0001615 | 3300046678 | Bacteria | 12991 |
| 1109 | Ga0495599_0005057 | 3300046678 | Bacteria | 7849 |
| 1110 | Ga0495623_0003238 | 3300046679 | Bacteria | 10759 |
| 1111 | Ga0495623_0007552 | 3300046679 | Bacteria | 7056 |
| 1112 | Ga0495623_0025609 | 3300046679 | Bacteria | 3800 |
| 1113 | Ga0495658_0061016 | 3300046683 | Bacteria | 2164 |
| 1114 | Ga0495658_0087543 | 3300046683 | Bacteria | 1839 |
| 1115 | Ga0495613_0009447 | 3300046689 | Bacteria | 7233 |
| 1116 | Ga0495613_0043426 | 3300046689 | Bacteria | 3326 |
| 1117 | Ga0495624_0009244 | 3300046690 | Bacteria | 6831 |
| 1118 | Ga0495624_0081444 | 3300046690 | Bacteria | 2005 |
| 1119 | Ga0495670_0081391 | 3300046691 | Bacteria | 1650 |
| 1120 | Ga0495649_0001020 | 3300046694 | Bacteria | 21971 |
| 1121 | Ga0495649_0005526 | 3300046694 | Bacteria | 8008 |
| 1122 | Ga0495649_0053860 | 3300046694 | Bacteria | 2177 |
| 1123 | Ga0495600_0005445 | 3300046809 | Bacteria | 7674 |
| 1124 | Ga0495600_0118906 | 3300046809 | Bacteria | 1719 |
| 1125 | Ga0495604_0002515 | 3300047317 | Bacteria | 14637 |
| 1126 | Ga0495604_0003727 | 3300047317 | Bacteria | 12141 |
| 1127 | Ga0495604_0005797 | 3300047317 | Bacteria | 9801 |
| 1128 | Ga0495674_0009625 | 3300047319 | Bacteria | 9181 |
| 1129 | Ga0495674_0012533 | 3300047319 | Bacteria | 7986 |
| 1130 | Ga0495674_0042305 | 3300047319 | Bacteria | 4065 |
| 1131 | Ga0495672_0009330 | 3300047320 | Bacteria | 7122 |
| 1132 | Ga0495676_0052125 | 3300047321 | Bacteria | 3268 |
| 1133 | Ga0495680_0004648 | 3300047322 | Bacteria | 13080 |
| 1134 | Ga0495680_0020835 | 3300047322 | Bacteria | 5503 |
| 1135 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1136 | Ga0495687_000009 | 3300047443 | Bacteria | 419317 |
| 1137 | Ga0495679_036026 | 3300047446 | Bacteria | 1565 |
| 1138 | Ga0495684_0015901 | 3300047471 | Bacteria | 5794 |
| 1139 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1140 | Ga0495686_0023882 | 3300047472 | Bacteria | 4023 |
| 1141 | Ga0495602_0023585 | 3300048088 | Bacteria | 5991 |
| 1142 | Ga0495602_0029691 | 3300048088 | Bacteria | 5198 |
| 1143 | Ga0496100_0017401 | 3300048903 | Bacteria | 4242 |
| 1144 | Ga0496101_0064709 | 3300048904 | Bacteria | 2664 |
| 1145 | Ga0496102_0005187 | 3300048905 | Bacteria | 11063 |
| 1146 | Ga0496102_0012401 | 3300048905 | Bacteria | 7375 |
| 1147 | Ga0496102_0103176 | 3300048905 | Bacteria | 2652 |
| 1148 | Ga0496104_0032002 | 3300048907 | Bacteria | 4895 |
| 1149 | Ga0496104_0079247 | 3300048907 | Bacteria | 3131 |
| 1150 | Ga0496106_0002960 | 3300048909 | Bacteria | 12635 |
| 1151 | Ga0496106_0005704 | 3300048909 | Bacteria | 9209 |
| 1152 | Ga0496106_0011577 | 3300048909 | Bacteria | 6519 |
| 1153 | Ga0496107_0003901 | 3300048910 | Bacteria | 10022 |
| 1154 | Ga0496107_0007566 | 3300048910 | Bacteria | 7494 |
| 1155 | Ga0496107_0060605 | 3300048910 | Bacteria | 2739 |
| 1156 | Ga0496108_0005837 | 3300048911 | Bacteria | 9980 |
| 1157 | Ga0496108_0032985 | 3300048911 | Bacteria | 4302 |
| 1158 | Ga0496108_0043971 | 3300048911 | Bacteria | 3730 |
| 1159 | Ga0496109_0003008 | 3300048912 | Bacteria | 14067 |
| 1160 | Ga0496109_0296872 | 3300048912 | Bacteria | 1523 |
| 1161 | Ga0496110_0005614 | 3300048913 | Bacteria | 9846 |
| 1162 | Ga0496110_0028527 | 3300048913 | Bacteria | 4795 |
| 1163 | Ga0496110_0028692 | 3300048913 | Bacteria | 4782 |
| 1164 | Ga0496111_0002995 | 3300048914 | Bacteria | 10344 |
| 1165 | Ga0496111_0130730 | 3300048914 | Bacteria | 1858 |
| 1166 | Ga0496112_0101172 | 3300048915 | Bacteria | 2852 |
| 1167 | Ga0496113_0038228 | 3300048916 | Bacteria | 3528 |
| 1168 | Ga0496114_0058004 | 3300048917 | Bacteria | 3232 |
| 1169 | Ga0496115_0016796 | 3300048918 | Bacteria | 5579 |
| 1170 | Ga0496115_0041847 | 3300048918 | Bacteria | 3648 |
| 1171 | Ga0496115_0071229 | 3300048918 | Bacteria | 2819 |
| 1172 | Ga0496115_0127876 | 3300048918 | Bacteria | 2093 |
| 1173 | Ga0496117_0001420 | 3300048920 | Bacteria | 34726 |
| 1174 | Ga0496118_0021248 | 3300048921 | Bacteria | 5721 |
| 1175 | Ga0496119_0002453 | 3300048922 | Bacteria | 20369 |
| 1176 | Ga0496120_0002147 | 3300048923 | Bacteria | 21033 |
| 1177 | Ga0496120_0004189 | 3300048923 | Bacteria | 12335 |
| 1178 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 1179 | Ga0496121_0005500 | 3300048924 | Bacteria | 16216 |
| 1180 | Ga0496122_0003345 | 3300048925 | Bacteria | 21155 |
| 1181 | Ga0496122_0045919 | 3300048925 | Bacteria | 3389 |
| 1182 | Ga0496123_0002721 | 3300048926 | Bacteria | 21201 |
| 1183 | Ga0496123_0079477 | 3300048926 | Bacteria | 2004 |
| 1184 | Ga0496124_0001442 | 3300048927 | Bacteria | 35166 |
| 1185 | Ga0496124_0058331 | 3300048927 | Bacteria | 3247 |
| 1186 | Ga0496125_0000044 | 3300048928 | Bacteria | 296762 |
| 1187 | Ga0496126_0090035 | 3300048929 | Bacteria | 2700 |
| 1188 | Ga0501300_001090 | 3300049523 | Bacteria | 4116 |
| 1189 | Ga0501032_0005396 | 3300049569 | Bacteria | 9511 |
| 1190 | Ga0501032_0013929 | 3300049569 | Bacteria | 5705 |
| 1191 | Ga0501032_0031220 | 3300049569 | Bacteria | 3653 |
| 1192 | Ga0501032_0071255 | 3300049569 | Bacteria | 2317 |
| 1193 | Ga0501033_0003857 | 3300049570 | Bacteria | 12187 |
| 1194 | Ga0501033_0040411 | 3300049570 | Bacteria | 3482 |
| 1195 | Ga0501034_0000477 | 3300049571 | Bacteria | 65874 |
| 1196 | Ga0501034_0016290 | 3300049571 | Bacteria | 7631 |
| 1197 | Ga0501034_0022923 | 3300049571 | Bacteria | 6361 |
| 1198 | Ga0501034_0032866 | 3300049571 | Bacteria | 5268 |
| 1199 | Ga0501034_0042626 | 3300049571 | Bacteria | 4594 |
| 1200 | Ga0501034_0102613 | 3300049571 | Bacteria | 2854 |
| 1201 | Ga0501034_0156859 | 3300049571 | Bacteria | 2249 |
| 1202 | Ga0501036_0002308 | 3300049572 | Bacteria | 14905 |
| 1203 | Ga0501036_0012979 | 3300049572 | Bacteria | 6917 |
| 1204 | Ga0501036_0023902 | 3300049572 | Bacteria | 5151 |
| 1205 | Ga0501037_0003677 | 3300049573 | Bacteria | 11133 |
| 1206 | Ga0501038_0000362 | 3300049574 | Bacteria | 39190 |
| 1207 | Ga0501038_0001672 | 3300049574 | Bacteria | 20558 |
| 1208 | Ga0501038_0035578 | 3300049574 | Bacteria | 4371 |
| 1209 | Ga0501038_0039102 | 3300049574 | Bacteria | 4151 |
| 1210 | Ga0501039_0002263 | 3300049575 | Bacteria | 14296 |
| 1211 | Ga0501039_0003220 | 3300049575 | Bacteria | 12205 |
| 1212 | Ga0501039_0005719 | 3300049575 | Bacteria | 9420 |
| 1213 | Ga0501039_0036966 | 3300049575 | Bacteria | 3768 |
| 1214 | Ga0501040_0001734 | 3300049576 | Bacteria | 13998 |
| 1215 | Ga0501041_0000591 | 3300049577 | Bacteria | 18966 |
| 1216 | Ga0501041_0015839 | 3300049577 | Bacteria | 4481 |
| 1217 | Ga0501042_0014377 | 3300049578 | Bacteria | 5402 |
| 1218 | Ga0501042_0151708 | 3300049578 | Bacteria | 1671 |
| 1219 | Ga0501043_0003719 | 3300049579 | Bacteria | 12536 |
| 1220 | Ga0501043_0007335 | 3300049579 | Bacteria | 8753 |
| 1221 | Ga0501043_0039299 | 3300049579 | Bacteria | 3719 |
| 1222 | Ga0501043_0049366 | 3300049579 | Bacteria | 3308 |
| 1223 | Ga0501043_0056907 | 3300049579 | Bacteria | 3071 |
| 1224 | Ga0501046_0000247 | 3300049580 | Bacteria | 55379 |
| 1225 | Ga0501046_0001124 | 3300049580 | Bacteria | 26161 |
| 1226 | Ga0501046_0015436 | 3300049580 | Bacteria | 6416 |
| 1227 | Ga0501047_0007188 | 3300049581 | Bacteria | 10464 |
| 1228 | Ga0501047_0010933 | 3300049581 | Bacteria | 8586 |
| 1229 | Ga0501047_0013273 | 3300049581 | Bacteria | 7804 |
| 1230 | Ga0501047_0059030 | 3300049581 | Bacteria | 3704 |
| 1231 | Ga0501047_0147768 | 3300049581 | Bacteria | 2227 |
| 1232 | Ga0501048_0000787 | 3300049582 | Bacteria | 23234 |
| 1233 | Ga0501048_0080704 | 3300049582 | Bacteria | 2295 |
| 1234 | Ga0501048_0098115 | 3300049582 | Bacteria | 2067 |
| 1235 | Ga0501067_0024303 | 3300049583 | Bacteria | 3361 |
| 1236 | Ga0501068_0002040 | 3300049584 | Bacteria | 10769 |
| 1237 | Ga0501068_0007617 | 3300049584 | Bacteria | 5992 |
| 1238 | Ga0501068_0091481 | 3300049584 | Bacteria | 1877 |
| 1239 | Ga0501069_0002295 | 3300049585 | Bacteria | 9663 |
| 1240 | Ga0501069_0049721 | 3300049585 | Bacteria | 2330 |
| 1241 | Ga0501070_0001510 | 3300049586 | Bacteria | 20741 |
| 1242 | Ga0501070_0004418 | 3300049586 | Bacteria | 12070 |
| 1243 | Ga0501070_0005410 | 3300049586 | Bacteria | 10895 |
| 1244 | Ga0501070_0018072 | 3300049586 | Bacteria | 5916 |
| 1245 | Ga0501070_0046458 | 3300049586 | Bacteria | 3611 |
| 1246 | Ga0501070_0048360 | 3300049586 | Bacteria | 3533 |
| 1247 | Ga0501070_0107492 | 3300049586 | Bacteria | 2306 |
| 1248 | Ga0501071_0000987 | 3300049587 | Bacteria | 15589 |
| 1249 | Ga0501071_0001727 | 3300049587 | Bacteria | 12833 |
| 1250 | Ga0501071_0012879 | 3300049587 | Bacteria | 5689 |
| 1251 | Ga0501071_0012893 | 3300049587 | Bacteria | 5686 |
| 1252 | Ga0501071_0046321 | 3300049587 | Bacteria | 3123 |
| 1253 | Ga0501072_0001146 | 3300049588 | Bacteria | 19686 |
| 1254 | Ga0501072_0001988 | 3300049588 | Bacteria | 15228 |
| 1255 | Ga0501072_0003004 | 3300049588 | Bacteria | 12719 |
| 1256 | Ga0501072_0041045 | 3300049588 | Bacteria | 3634 |
| 1257 | Ga0501073_0000641 | 3300049589 | Bacteria | 24548 |
| 1258 | Ga0501073_0001384 | 3300049589 | Bacteria | 17881 |
| 1259 | Ga0501073_0001548 | 3300049589 | Bacteria | 17041 |
| 1260 | Ga0501073_0001695 | 3300049589 | Bacteria | 16330 |
| 1261 | Ga0501074_0001537 | 3300049590 | Bacteria | 15604 |
| 1262 | Ga0501074_0004126 | 3300049590 | Bacteria | 10371 |
| 1263 | Ga0501074_0019172 | 3300049590 | Bacteria | 4966 |
| 1264 | Ga0501074_0039808 | 3300049590 | Bacteria | 3404 |
| 1265 | Ga0501075_0000564 | 3300049591 | Bacteria | 22512 |
| 1266 | Ga0501075_0002462 | 3300049591 | Bacteria | 12340 |
| 1267 | Ga0501075_0014218 | 3300049591 | Bacteria | 5702 |
| 1268 | Ga0501075_0035690 | 3300049591 | Bacteria | 3709 |
| 1269 | Ga0501076_0000481 | 3300049592 | Bacteria | 25172 |
| 1270 | Ga0501076_0003134 | 3300049592 | Bacteria | 11526 |
| 1271 | Ga0501076_0014132 | 3300049592 | Bacteria | 6004 |
| 1272 | Ga0501077_0001149 | 3300049593 | Bacteria | 15989 |
| 1273 | Ga0501077_0005387 | 3300049593 | Bacteria | 7778 |
| 1274 | Ga0501077_0007486 | 3300049593 | Bacteria | 6738 |
| 1275 | Ga0501198_001072 | 3300049649 | Bacteria | 3493 |
| 1276 | Ga0501201_001338 | 3300049651 | Bacteria | 2314 |
| 1277 | Ga0501235_000298 | 3300049669 | Bacteria | 9349 |
| 1278 | Ga0501257_003399 | 3300049686 | Bacteria | 3413 |
| 1279 | Ga0501225_0002947 | 3300049705 | Bacteria | 5215 |
| 1280 | Ga0501225_0003366 | 3300049705 | Unclassified | 4855 |
| 1281 | Ga0501225_0012951 | 3300049705 | Bacteria | 2338 |
| 1282 | Ga0501079_0000033 | 3300049741 | Bacteria | 59060 |
| 1283 | Ga0501079_0000889 | 3300049741 | Bacteria | 20471 |
| 1284 | Ga0501079_0025822 | 3300049741 | Bacteria | 4505 |
| 1285 | Ga0501080_0000394 | 3300049742 | Bacteria | 33653 |
| 1286 | Ga0501080_0001783 | 3300049742 | Bacteria | 18446 |
| 1287 | Ga0501080_0007140 | 3300049742 | Bacteria | 10079 |
| 1288 | Ga0501080_0007353 | 3300049742 | Bacteria | 9940 |
| 1289 | Ga0501080_0009919 | 3300049742 | Bacteria | 8701 |
| 1290 | Ga0501080_0023189 | 3300049742 | Bacteria | 5755 |
| 1291 | Ga0501080_0024728 | 3300049742 | Bacteria | 5570 |
| 1292 | Ga0501080_0093306 | 3300049742 | Bacteria | 2795 |
| 1293 | Ga0501080_0158592 | 3300049742 | Bacteria | 2090 |
| 1294 | Ga0501081_0000241 | 3300049743 | Bacteria | 27997 |
| 1295 | Ga0501081_0011157 | 3300049743 | Bacteria | 5876 |
| 1296 | Ga0501083_0007984 | 3300049744 | Bacteria | 7495 |
| 1297 | Ga0501083_0010528 | 3300049744 | Bacteria | 6508 |
| 1298 | Ga0501083_0020789 | 3300049744 | Bacteria | 4564 |
| 1299 | Ga0501083_0052137 | 3300049744 | Bacteria | 2749 |
| 1300 | Ga0501264_000010 | 3300049761 | Bacteria | 27684 |
| 1301 | Ga0501035_0010083 | 3300049822 | Bacteria | 8770 |
| 1302 | Ga0501035_0022127 | 3300049822 | Bacteria | 5839 |
| 1303 | Ga0501044_0003662 | 3300049823 | Bacteria | 17288 |
| 1304 | Ga0501044_0006170 | 3300049823 | Bacteria | 13248 |
| 1305 | Ga0501044_0043756 | 3300049823 | Bacteria | 4650 |
| 1306 | Ga0501044_0057472 | 3300049823 | Bacteria | 3992 |
| 1307 | Ga0501044_0125062 | 3300049823 | Bacteria | 2569 |
| 1308 | Ga0501045_0000347 | 3300049824 | Bacteria | 27417 |
| 1309 | Ga0501045_0011373 | 3300049824 | Bacteria | 6249 |
| 1310 | Ga0501045_0019579 | 3300049824 | Bacteria | 4828 |
| 1311 | nmdc:mga0k408_258_c1 | 3300050493 | Bacteria | 28885 |
| 1312 | nmdc:mga05p37_2217_c1 | 3300050507 | Bacteria | 22636 |
| 1313 | nmdc:mga05p37_257531_c1 | 3300050507 | Bacteria | 2090 |
| 1314 | nmdc:mga09592_34056_c1 | 3300050508 | Bacteria | 4257 |
| 1315 | nmdc:mga0qj67_46927_c1 | 3300050509 | Bacteria | 3411 |
| 1316 | nmdc:mga06r32_102693_c1 | 3300050510 | Bacteria | 2807 |
| 1317 | nmdc:mga08y16_54505_c1 | 3300050511 | Bacteria | 4178 |
| 1318 | nmdc:mga08y16_6181_c1 | 3300050511 | Bacteria | 12563 |
| 1319 | nmdc:mga08y16_79473_c1 | 3300050511 | Bacteria | 3418 |
| 1320 | nmdc:mga0n895_10435_c1 | 3300050512 | Bacteria | 8205 |
| 1321 | nmdc:mga0n895_25131_c1 | 3300050512 | Bacteria | 5624 |
| 1322 | nmdc:mga0rr50_11309_c1 | 3300050513 | Bacteria | 5707 |
| 1323 | nmdc:mga08x19_34734_c1 | 3300050514 | Bacteria | 3188 |
| 1324 | nmdc:mga0a205_53348_c1 | 3300050515 | Bacteria | 3902 |
| 1325 | Ga0495601_0009477 | 3300053077 | Bacteria | 5763 |
| 1326 | Ga0500578_0000042 | 3300053086 | Bacteria | 129410 |
| 1327 | Ga0500644_0000080 | 3300053088 | Bacteria | 58728 |
| 1328 | Ga0500583_0000023 | 3300053092 | Bacteria | 123584 |
| 1329 | Ga0500583_0001035 | 3300053092 | Bacteria | 7931 |
| 1330 | Ga0500583_0012576 | 3300053092 | Bacteria | 3235 |
| 1331 | Ga0500641_0000741 | 3300053096 | Bacteria | 11819 |
| 1332 | Ga0500569_000719 | 3300053109 | Bacteria | 5760 |
| 1333 | Ga0500618_000574 | 3300053125 | Bacteria | 22705 |
| 1334 | Ga0500642_0016020 | 3300053130 | Bacteria | 2837 |
| 1335 | Ga0500559_0001354 | 3300053136 | Bacteria | 14070 |
| 1336 | Ga0500568_0000880 | 3300053139 | Bacteria | 21086 |
| 1337 | Ga0500568_0007674 | 3300053139 | Bacteria | 5269 |
| 1338 | Ga0500568_0012030 | 3300053139 | Bacteria | 3989 |
| 1339 | Ga0500568_0020782 | 3300053139 | Bacteria | 2835 |
| 1340 | Ga0500590_035259 | 3300053148 | Bacteria | 2590 |
| 1341 | Ga0500616_0000074 | 3300053153 | Bacteria | 222910 |
| 1342 | Ga0500616_0000091 | 3300053153 | Bacteria | 184945 |
| 1343 | Ga0500616_0000997 | 3300053153 | Bacteria | 30619 |
| 1344 | Ga0500616_0014927 | 3300053153 | Bacteria | 4452 |
| 1345 | Ga0500616_0058341 | 3300053153 | Bacteria | 2008 |
| 1346 | Ga0500622_0005344 | 3300053156 | Bacteria | 7738 |
| 1347 | Ga0500627_0000584 | 3300053158 | Bacteria | 9768 |
| 1348 | Ga0500634_0014029 | 3300053161 | Bacteria | 4219 |
| 1349 | Ga0501084_0002318 | 3300054114 | Bacteria | 15291 |
| 1350 | Ga0501084_0002542 | 3300054114 | Bacteria | 14699 |
| 1351 | Ga0501084_0006383 | 3300054114 | Bacteria | 9688 |
| 1352 | Ga0501084_0020192 | 3300054114 | Bacteria | 5553 |
| 1353 | Ga0501084_0053775 | 3300054114 | Bacteria | 3368 |
| 1354 | Ga0587070_003293 | 3300059491 | Bacteria | 1930 |
| 1355 | Ga0587076_000108 | 3300059645 | Bacteria | 4838 |
| 1356 | Ga0587076_000791 | 3300059645 | Bacteria | 2868 |
| 1357 | Ga0587071_000307 | 3300060344 | Bacteria | 4391 |
| 1358 | Ga0587111_0000129 | 3300060346 | Bacteria | 5229 |
| 1359 | Ga0587111_0001272 | 3300060346 | Bacteria | 2950 |
| 1360 | Ga0501082_0001046 | 3300060353 | Bacteria | 24490 |
| 1361 | Ga0501082_0002017 | 3300060353 | Bacteria | 17846 |
| 1362 | Ga0501082_0027798 | 3300060353 | Bacteria | 4871 |
| 1363 | Ga0501082_0071046 | 3300060353 | Bacteria | 2997 |
| 1364 | Ga0530510_0001017 | 3300061734 | Bacteria | 18586 |
| 1365 | Ga0530510_0001365 | 3300061734 | Bacteria | 16322 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2937868953 | 2937873257 | 452 |
| 2 | 3300050507 | nmdc:mga05p37_257531_c1 | nmdc:mga05p37_257531_c1_635_2080 | 457 |
| 3 | 3300046460 | Ga0495638_0014676 | Ga0495638_0014676_14_1426 | 470 |
| 4 | 3300009545 | Ga0105237_10066881 | Ga0105237_100668811 | 477 |
| 5 | 3300053156 | Ga0500622_0005344 | Ga0500622_0005344_6261_7700 | 477 |
| 6 | 3300049578 | Ga0501042_0151708 | Ga0501042_0151708_218_1657 | 478 |
| 7 | 3300048912 | Ga0496109_0296872 | Ga0496109_0296872_29_1504 | 479 |
| 8 | 3300038443 | Ga0395901_0150207 | Ga0395901_0150207_40_1512 | 490 |
| 9 | 3300046615 | Ga0495656_0018397 | Ga0495656_0018397_1165_2637 | 490 |
| 10 | 3300046642 | Ga0495634_0019325 | Ga0495634_0019325_3149_4795 | 490 |
| 11 | 3300047322 | Ga0495680_0020835 | Ga0495680_0020835_3830_5476 | 490 |
| 12 | 3300046459 | Ga0495629_0163140 | Ga0495629_0163140_19_1533 | 503 |
| 13 | 3300046691 | Ga0495670_0081391 | Ga0495670_0081391_68_1594 | 506 |
| 14 | 3300047321 | Ga0495676_0052125 | Ga0495676_0052125_1687_3213 | 506 |
| 15 | 3300047446 | Ga0495679_036026 | Ga0495679_036026_25_1551 | 506 |
| 16 | 3300035170 | Ga0373943_0064677 | Ga0373943_0064677_264_1796 | 507 |
| 17 | 3300035724 | Ga0373933_0004189 | Ga0373933_0004189_3564_5276 | 512 |
| 18 | 3300046462 | Ga0495651_0015743 | Ga0495651_0015743_3809_5521 | 512 |
| 19 | 3300046511 | Ga0495608_0000270 | Ga0495608_0000270_21807_23519 | 512 |
| 20 | 3300046516 | Ga0495628_0041453 | Ga0495628_0041453_181_1893 | 512 |
| 21 | 3300046529 | Ga0495652_0002808 | Ga0495652_0002808_10830_12542 | 512 |
| 22 | 3300046559 | Ga0495667_0000653 | Ga0495667_0000653_13626_15338 | 512 |
| 23 | 3300046663 | Ga0495635_0000837 | Ga0495635_0000837_14540_16252 | 512 |
| 24 | 3300046675 | Ga0495657_0002784 | Ga0495657_0002784_3400_5112 | 512 |
| 25 | 3300046678 | Ga0495599_0001615 | Ga0495599_0001615_7734_9446 | 512 |
| 26 | 3300046679 | Ga0495623_0025609 | Ga0495623_0025609_103_1815 | 512 |
| 27 | 3300047317 | Ga0495604_0003727 | Ga0495604_0003727_6655_8367 | 512 |
| 28 | 3300047319 | Ga0495674_0012533 | Ga0495674_0012533_2400_4112 | 512 |
| 29 | 3300047471 | Ga0495684_0015901 | Ga0495684_0015901_259_1971 | 512 |
| 30 | 3300048088 | Ga0495602_0023585 | Ga0495602_0023585_462_2174 | 512 |
| 31 | iso_pu_bacteria | 2958144490 | 2958145476 | 512 |
| 32 | 3300053096 | Ga0500641_0000741 | Ga0500641_0000741_3230_4870 | 519 |
| 33 | 3300026067 | Ga0207678_10063094 | Ga0207678_100630942 | 521 |
| 34 | 3300048918 | Ga0496115_0127876 | Ga0496115_0127876_26_1621 | 530 |
| 35 | 3300025927 | Ga0207687_10001118 | Ga0207687_1000111813 | 531 |
| 36 | 3300048914 | Ga0496111_0130730 | Ga0496111_0130730_241_1845 | 531 |
| 37 | 3300049742 | Ga0501080_0158592 | Ga0501080_0158592_473_2077 | 531 |
| 38 | 3300050512 | nmdc:mga0n895_10435_c1 | nmdc:mga0n895_10435_c1_6594_8195 | 531 |
| 39 | 3300002987 | JGI25159J45721_1000251 | JGI25159J45721_10002514 | 532 |
| 40 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001311 | 532 |
| 41 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001450 | 532 |
| 42 | 3300004625 | Ga0055543_1000089 | Ga0055543_100008970 | 532 |
| 43 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008145 | 532 |
| 44 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003464 | 532 |
| 45 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011312 | 532 |
| 46 | 3300005563 | Ga0068855_100061690 | Ga0068855_1000616902 | 534 |
| 47 | 3300006353 | Ga0075370_10002970 | Ga0075370_100029706 | 534 |
| 48 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014228 | 534 |
| 49 | 3300009545 | Ga0105237_10002158 | Ga0105237_1000215820 | 534 |
| 50 | 3300013104 | Ga0157370_10002430 | Ga0157370_100024305 | 534 |
| 51 | 3300015262 | Ga0182007_10003718 | Ga0182007_100037182 | 534 |
| 52 | 3300025253 | Ga0209677_103674 | Ga0209677_1036743 | 534 |
| 53 | 3300025261 | Ga0209233_1000228 | Ga0209233_100022884 | 534 |
| 54 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037229 | 534 |
| 55 | 3300025914 | Ga0207671_10001017 | Ga0207671_100010179 | 534 |
| 56 | 3300025949 | Ga0207667_10098895 | Ga0207667_100988952 | 534 |
| 57 | 3300009093 | Ga0105240_10017784 | Ga0105240_100177846 | 535 |
| 58 | 3300013104 | Ga0157370_10001897 | Ga0157370_1000189710 | 535 |
| 59 | 3300013105 | Ga0157369_10005126 | Ga0157369_100051268 | 535 |
| 60 | 3300013307 | Ga0157372_10001446 | Ga0157372_100014469 | 535 |
| 61 | 3300021321 | Ga0214542_1000032 | Ga0214542_10000322 | 535 |
| 62 | 3300021327 | Ga0214543_1000016 | Ga0214543_1000016276 | 535 |
| 63 | 3300006946 | Ga0079104_1008144 | Ga0079104_10081443 | 536 |
| 64 | 3300006946 | Ga0079104_1010485 | Ga0079104_10104852 | 536 |
| 65 | 3300022739 | Ga0228711_1000911 | Ga0228711_100091139 | 536 |
| 66 | 3300022740 | Ga0228710_1001018 | Ga0228710_100101839 | 536 |
| 67 | 3300027111 | Ga0209281_1000314 | Ga0209281_10003142 | 536 |
| 68 | 3300027111 | Ga0209281_1002256 | Ga0209281_10022562 | 536 |
| 69 | 3300027666 | Ga0209282_1000068 | Ga0209282_10000682 | 536 |
| 70 | 3300031967 | Ga0315914_1000937 | Ga0315914_100093739 | 536 |
| 71 | 3300033430 | Ga0315913_1042274 | Ga0315913_10422742 | 536 |
| 72 | 3300033464 | Ga0315915_1000007 | Ga0315915_1000007243 | 536 |
| 73 | 3300021320 | Ga0214544_1000110 | Ga0214544_100011025 | 538 |
| 74 | 3300046809 | Ga0495600_0118906 | Ga0495600_0118906_41_1666 | 539 |
| 75 | 3300030760 | Ga0265762_1004398 | Ga0265762_10043981 | 541 |
| 76 | 3300049571 | Ga0501034_0016290 | Ga0501034_0016290_1531_3255 | 543 |
| 77 | 3300001979 | JGI24740J21852_10000201 | JGI24740J21852_1000020121 | 544 |
| 78 | 3300002704 | JGI25155J39150_1000014 | JGI25155J39150_1000014160 | 544 |
| 79 | 3300002705 | JGI25156J39149_1000083 | JGI25156J39149_100008330 | 544 |
| 80 | 3300002737 | JGI25162J39368_1000532 | JGI25162J39368_100053227 | 544 |
| 81 | 3300002737 | JGI25162J39368_1002261 | JGI25162J39368_10022612 | 544 |
| 82 | 3300002738 | JGI25154J39366_1000052 | JGI25154J39366_10000526 | 544 |
| 83 | 3300002738 | JGI25154J39366_1000139 | JGI25154J39366_100013913 | 544 |
| 84 | 3300002741 | JGI25157J39369_1000110 | JGI25157J39369_100011049 | 544 |
| 85 | 3300003214 | JGI25165J46597_1000692 | JGI25165J46597_100069225 | 544 |
| 86 | 3300003214 | JGI25165J46597_1001949 | JGI25165J46597_10019497 | 544 |
| 87 | 3300025206 | Ga0209435_100027 | Ga0209435_100027156 | 544 |
| 88 | 3300025233 | Ga0209437_100051 | Ga0209437_1000514 | 544 |
| 89 | 3300025233 | Ga0209437_100060 | Ga0209437_100060226 | 544 |
| 90 | 3300025246 | Ga0209646_1000086 | Ga0209646_1000086156 | 544 |
| 91 | 3300025250 | Ga0209026_1000082 | Ga0209026_1000082156 | 544 |
| 92 | 3300025254 | Ga0209148_1005795 | Ga0209148_10057952 | 544 |
| 93 | 3300025256 | Ga0209759_1000063 | Ga0209759_100006345 | 544 |
| 94 | 3300025261 | Ga0209233_1000160 | Ga0209233_10001604 | 544 |
| 95 | 3300025261 | Ga0209233_1001833 | Ga0209233_10018332 | 544 |
| 96 | 3300046472 | Ga0495580_0036679 | Ga0495580_0036679_217_1860 | 545 |
| 97 | iso_pu_bacteria | 2871481445 | 2871485832 | 545 |
| 98 | 3300005336 | Ga0070680_100011873 | Ga0070680_1000118735 | 546 |
| 99 | 3300005530 | Ga0070679_100001049 | Ga0070679_10000104921 | 546 |
| 100 | 3300005535 | Ga0070684_100002184 | Ga0070684_10000218415 | 546 |
| 101 | 3300005539 | Ga0068853_100042327 | Ga0068853_1000423272 | 546 |
| 102 | 3300005563 | Ga0068855_100006138 | Ga0068855_1000061386 | 546 |
| 103 | 3300005577 | Ga0068857_100002231 | Ga0068857_10000223112 | 546 |
| 104 | 3300005614 | Ga0068856_100007867 | Ga0068856_1000078674 | 546 |
| 105 | 3300005614 | Ga0068856_100008937 | Ga0068856_1000089379 | 546 |
| 106 | 3300005616 | Ga0068852_100030311 | Ga0068852_1000303113 | 546 |
| 107 | 3300005617 | Ga0068859_100004436 | Ga0068859_1000044364 | 546 |
| 108 | 3300006237 | Ga0097621_100017336 | Ga0097621_1000173365 | 546 |
| 109 | 3300006931 | Ga0097620_100004436 | Ga0097620_1000044364 | 546 |
| 110 | 3300009093 | Ga0105240_10005587 | Ga0105240_1000558710 | 546 |
| 111 | 3300009148 | Ga0105243_10051389 | Ga0105243_100513892 | 546 |
| 112 | 3300009545 | Ga0105237_10088721 | Ga0105237_100887212 | 546 |
| 113 | 3300009551 | Ga0105238_10004647 | Ga0105238_1000464713 | 546 |
| 114 | 3300010375 | Ga0105239_10001560 | Ga0105239_100015609 | 546 |
| 115 | 3300010375 | Ga0105239_10005119 | Ga0105239_100051199 | 546 |
| 116 | 3300013104 | Ga0157370_10002944 | Ga0157370_1000294411 | 546 |
| 117 | 3300013105 | Ga0157369_10004260 | Ga0157369_1000426016 | 546 |
| 118 | 3300013105 | Ga0157369_10005519 | Ga0157369_1000551910 | 546 |
| 119 | 3300013307 | Ga0157372_10007988 | Ga0157372_100079889 | 546 |
| 120 | 3300025297 | Ga0209758_1001557 | Ga0209758_10015573 | 546 |
| 121 | 3300025321 | Ga0207656_10031110 | Ga0207656_100311102 | 546 |
| 122 | 3300025911 | Ga0207654_10007114 | Ga0207654_100071145 | 546 |
| 123 | 3300025912 | Ga0207707_10002439 | Ga0207707_1000243916 | 546 |
| 124 | 3300025913 | Ga0207695_10001264 | Ga0207695_1000126427 | 546 |
| 125 | 3300025913 | Ga0207695_10005506 | Ga0207695_1000550610 | 546 |
| 126 | 3300025921 | Ga0207652_10027955 | Ga0207652_100279553 | 546 |
| 127 | 3300025924 | Ga0207694_10002105 | Ga0207694_100021053 | 546 |
| 128 | 3300025927 | Ga0207687_10013555 | Ga0207687_100135554 | 546 |
| 129 | 3300025941 | Ga0207711_10000207 | Ga0207711_1000020715 | 546 |
| 130 | 3300025941 | Ga0207711_10017327 | Ga0207711_100173272 | 546 |
| 131 | 3300025944 | Ga0207661_10000365 | Ga0207661_1000036515 | 546 |
| 132 | 3300025944 | Ga0207661_10060715 | Ga0207661_100607152 | 546 |
| 133 | 3300025949 | Ga0207667_10003158 | Ga0207667_1000315810 | 546 |
| 134 | 3300025949 | Ga0207667_10004524 | Ga0207667_1000452416 | 546 |
| 135 | 3300025949 | Ga0207667_10015806 | Ga0207667_100158064 | 546 |
| 136 | 3300026041 | Ga0207639_10032444 | Ga0207639_100324442 | 546 |
| 137 | 3300026078 | Ga0207702_10028235 | Ga0207702_100282353 | 546 |
| 138 | 3300026078 | Ga0207702_10047907 | Ga0207702_100479072 | 546 |
| 139 | 3300026078 | Ga0207702_10184247 | Ga0207702_101842471 | 546 |
| 140 | 3300026116 | Ga0207674_10000042 | Ga0207674_1000004217 | 546 |
| 141 | 3300026116 | Ga0207674_10004196 | Ga0207674_100041963 | 546 |
| 142 | 3300031595 | Ga0265313_10005404 | Ga0265313_100054042 | 546 |
| 143 | 3300035117 | Ga0373953_0006044 | Ga0373953_0006044_99_1742 | 546 |
| 144 | 3300035118 | Ga0373954_0002478 | Ga0373954_0002478_2202_3845 | 546 |
| 145 | 3300035118 | Ga0373954_0005203 | Ga0373954_0005203_1430_3073 | 546 |
| 146 | 3300035692 | Ga0373935_0026953 | Ga0373935_0026953_13_1656 | 546 |
| 147 | 3300036401 | Ga0373937_0005019 | Ga0373937_0005019_9195_10838 | 546 |
| 148 | 3300036401 | Ga0373937_0027922 | Ga0373937_0027922_961_2604 | 546 |
| 149 | 3300046462 | Ga0495651_0014430 | Ga0495651_0014430_3716_5359 | 546 |
| 150 | 3300046529 | Ga0495652_0008827 | Ga0495652_0008827_1383_3026 | 546 |
| 151 | 3300046529 | Ga0495652_0097198 | Ga0495652_0097198_674_2317 | 546 |
| 152 | 3300046536 | Ga0495587_0026329 | Ga0495587_0026329_333_1976 | 546 |
| 153 | 3300046642 | Ga0495634_0017168 | Ga0495634_0017168_206_1849 | 546 |
| 154 | 3300046678 | Ga0495599_0005057 | Ga0495599_0005057_4814_6457 | 546 |
| 155 | 3300049571 | Ga0501034_0000477 | Ga0501034_0000477_59672_61399 | 546 |
| 156 | 3300049584 | Ga0501068_0091481 | Ga0501068_0091481_86_1735 | 546 |
| 157 | 3300049588 | Ga0501072_0001146 | Ga0501072_0001146_9058_10785 | 546 |
| 158 | 3300048918 | Ga0496115_0041847 | Ga0496115_0041847_1396_3114 | 547 |
| 159 | 3300002987 | JGI25159J45721_1000004 | JGI25159J45721_10000042 | 551 |
| 160 | 3300003354 | JGI25160J50197_1000021 | JGI25160J50197_1000021207 | 551 |
| 161 | 3300003374 | JGI25161J50226_1002682 | JGI25161J50226_10026822 | 551 |
| 162 | 3300003771 | Ga0055526_1019460 | Ga0055526_10194601 | 551 |
| 163 | 3300003775 | Ga0055524_1022102 | Ga0055524_10221022 | 551 |
| 164 | 3300004625 | Ga0055543_1000102 | Ga0055543_10001022 | 551 |
| 165 | 3300005262 | Ga0065165_1000033 | Ga0065165_1000033207 | 551 |
| 166 | 3300006847 | Ga0075431_100131322 | Ga0075431_1001313221 | 551 |
| 167 | 3300009147 | Ga0114129_10078631 | Ga0114129_100786312 | 551 |
| 168 | 3300013249 | Ga0171463_1007 | Ga0171463_1007105 | 551 |
| 169 | 3300015690 | Ga0183363_1071 | Ga0183363_107128 | 551 |
| 170 | 3300025208 | Ga0209436_100957 | Ga0209436_10095710 | 551 |
| 171 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017177 | 551 |
| 172 | 3300025292 | Ga0209676_1011256 | Ga0209676_10112562 | 551 |
| 173 | 3300025294 | Ga0209025_1000161 | Ga0209025_10001612 | 551 |
| 174 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013625 | 551 |
| 175 | 3300025299 | Ga0209256_1000153 | Ga0209256_1000153142 | 551 |
| 176 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006176 | 551 |
| 177 | 3300025304 | Ga0209257_1003777 | Ga0209257_10037774 | 551 |
| 178 | 3300044684 | Ga0466966_0035209 | Ga0466966_0035209_16_1671 | 551 |
| 179 | 3300031730 | Ga0307516_10001218 | Ga0307516_100012186 | 552 |
| 180 | 3300049571 | Ga0501034_0102613 | Ga0501034_0102613_243_1982 | 552 |
| 181 | 3300005335 | Ga0070666_10000052 | Ga0070666_1000005241 | 553 |
| 182 | 3300005367 | Ga0070667_100076809 | Ga0070667_1000768091 | 553 |
| 183 | 3300005617 | Ga0068859_100000112 | Ga0068859_10000011228 | 553 |
| 184 | 3300005618 | Ga0068864_100005862 | Ga0068864_1000058623 | 553 |
| 185 | 3300005834 | Ga0068851_10007004 | Ga0068851_100070042 | 553 |
| 186 | 3300005842 | Ga0068858_100042671 | Ga0068858_1000426713 | 553 |
| 187 | 3300005843 | Ga0068860_100003770 | Ga0068860_1000037704 | 553 |
| 188 | 3300006931 | Ga0097620_100000112 | Ga0097620_10000011221 | 553 |
| 189 | 3300013307 | Ga0157372_10004709 | Ga0157372_100047094 | 553 |
| 190 | 3300025900 | Ga0207710_10041730 | Ga0207710_100417301 | 553 |
| 191 | 3300025903 | Ga0207680_10000035 | Ga0207680_1000003544 | 553 |
| 192 | 3300025931 | Ga0207644_10019754 | Ga0207644_100197543 | 553 |
| 193 | 3300025940 | Ga0207691_10136948 | Ga0207691_101369481 | 553 |
| 194 | 3300025942 | Ga0207689_10000760 | Ga0207689_100007604 | 553 |
| 195 | 3300025972 | Ga0207668_10056683 | Ga0207668_100566832 | 553 |
| 196 | 3300026035 | Ga0207703_10038038 | Ga0207703_100380383 | 553 |
| 197 | 3300026088 | Ga0207641_10000089 | Ga0207641_1000008957 | 553 |
| 198 | 3300026088 | Ga0207641_10108350 | Ga0207641_101083502 | 553 |
| 199 | 3300026095 | Ga0207676_10019779 | Ga0207676_100197793 | 553 |
| 200 | 3300028381 | Ga0268264_10004058 | Ga0268264_100040585 | 553 |
| 201 | 3300036712 | Ga0316584_0141540 | Ga0316584_0141540_100_1767 | 553 |
| 202 | 3300044842 | Ga0466957_0000150 | Ga0466957_0000150_773_2440 | 553 |
| 203 | 3300049705 | Ga0501225_0012951 | Ga0501225_0012951_243_1967 | 553 |
| 204 | 3300005983 | Ga0081540_1008524 | Ga0081540_10085245 | 554 |
| 205 | 3300009551 | Ga0105238_10034131 | Ga0105238_100341313 | 554 |
| 206 | 3300005578 | Ga0068854_100003549 | Ga0068854_1000035492 | 555 |
| 207 | 3300009098 | Ga0105245_10000995 | Ga0105245_100009957 | 555 |
| 208 | 3300013297 | Ga0157378_10003102 | Ga0157378_1000310214 | 555 |
| 209 | 3300026075 | Ga0207708_10000774 | Ga0207708_100007741 | 555 |
| 210 | 3300046616 | Ga0495668_0005368 | Ga0495668_0005368_3073_4749 | 555 |
| 211 | 3300053158 | Ga0500627_0000584 | Ga0500627_0000584_3610_5286 | 555 |
| 212 | 3300026067 | Ga0207678_10082198 | Ga0207678_100821982 | 556 |
| 213 | 3300045976 | Ga0466967_0000360 | Ga0466967_0000360_18286_20001 | 556 |
| 214 | 3300005545 | Ga0070695_100047737 | Ga0070695_1000477372 | 558 |
| 215 | 3300005366 | Ga0070659_100032329 | Ga0070659_1000323291 | 559 |
| 216 | 3300005577 | Ga0068857_100008704 | Ga0068857_1000087042 | 559 |
| 217 | 3300025919 | Ga0207657_10019127 | Ga0207657_100191273 | 559 |
| 218 | 3300025923 | Ga0207681_10038217 | Ga0207681_100382172 | 559 |
| 219 | 3300028380 | Ga0268265_10034418 | Ga0268265_100344182 | 559 |
| 220 | 3300005535 | Ga0070684_100003551 | Ga0070684_1000035518 | 560 |
| 221 | 3300005616 | Ga0068852_100001424 | Ga0068852_1000014246 | 560 |
| 222 | 3300009093 | Ga0105240_10008305 | Ga0105240_100083053 | 560 |
| 223 | 3300009093 | Ga0105240_10011123 | Ga0105240_100111232 | 560 |
| 224 | 3300013105 | Ga0157369_10006355 | Ga0157369_100063558 | 560 |
| 225 | 3300013307 | Ga0157372_10003819 | Ga0157372_100038194 | 560 |
| 226 | 3300025913 | Ga0207695_10000316 | Ga0207695_1000031625 | 560 |
| 227 | 3300025913 | Ga0207695_10092636 | Ga0207695_100926362 | 560 |
| 228 | 3300025913 | Ga0207695_10104863 | Ga0207695_101048632 | 560 |
| 229 | 3300026041 | Ga0207639_10064622 | Ga0207639_100646222 | 560 |
| 230 | 3300026142 | Ga0207698_10000144 | Ga0207698_1000014441 | 560 |
| 231 | 3300027682 | Ga0209971_1001426 | Ga0209971_10014264 | 560 |
| 232 | 3300049579 | Ga0501043_0039299 | Ga0501043_0039299_1082_2821 | 560 |
| 233 | 3300049586 | Ga0501070_0107492 | Ga0501070_0107492_456_2195 | 560 |
| 234 | iso_pu_bacteria | 2906370794 | 2906373899 | 560 |
| 235 | 3300005328 | Ga0070676_10008665 | Ga0070676_100086653 | 561 |
| 236 | 3300005331 | Ga0070670_100002168 | Ga0070670_10000216810 | 561 |
| 237 | 3300005333 | Ga0070677_10006483 | Ga0070677_100064832 | 561 |
| 238 | 3300005334 | Ga0068869_100015842 | Ga0068869_1000158424 | 561 |
| 239 | 3300005343 | Ga0070687_100006553 | Ga0070687_1000065536 | 561 |
| 240 | 3300005347 | Ga0070668_100002293 | Ga0070668_1000022933 | 561 |
| 241 | 3300005356 | Ga0070674_100014891 | Ga0070674_1000148914 | 561 |
| 242 | 3300005434 | Ga0070709_10013525 | Ga0070709_100135253 | 561 |
| 243 | 3300005436 | Ga0070713_100124868 | Ga0070713_1001248681 | 561 |
| 244 | 3300005441 | Ga0070700_100016261 | Ga0070700_1000162614 | 561 |
| 245 | 3300005456 | Ga0070678_100010861 | Ga0070678_1000108614 | 561 |
| 246 | 3300005457 | Ga0070662_100010906 | Ga0070662_1000109063 | 561 |
| 247 | 3300005459 | Ga0068867_100015107 | Ga0068867_1000151073 | 561 |
| 248 | 3300005459 | Ga0068867_100048551 | Ga0068867_1000485512 | 561 |
| 249 | 3300005543 | Ga0070672_100001412 | Ga0070672_10000141210 | 561 |
| 250 | 3300005718 | Ga0068866_10009802 | Ga0068866_100098022 | 561 |
| 251 | 3300005719 | Ga0068861_100003403 | Ga0068861_1000034039 | 561 |
| 252 | 3300005842 | Ga0068858_100006624 | Ga0068858_1000066245 | 561 |
| 253 | 3300005843 | Ga0068860_100007157 | Ga0068860_1000071572 | 561 |
| 254 | 3300005843 | Ga0068860_100044640 | Ga0068860_1000446403 | 561 |
| 255 | 3300006881 | Ga0068865_100001761 | Ga0068865_10000176111 | 561 |
| 256 | 3300009177 | Ga0105248_10094570 | Ga0105248_100945702 | 561 |
| 257 | 3300009553 | Ga0105249_10006383 | Ga0105249_100063839 | 561 |
| 258 | 3300013297 | Ga0157378_10000272 | Ga0157378_1000027225 | 561 |
| 259 | 3300013306 | Ga0163162_10003915 | Ga0163162_100039155 | 561 |
| 260 | 3300014326 | Ga0157380_10011751 | Ga0157380_100117514 | 561 |
| 261 | 3300014968 | Ga0157379_10010290 | Ga0157379_100102908 | 561 |
| 262 | 3300025893 | Ga0207682_10005627 | Ga0207682_100056272 | 561 |
| 263 | 3300025923 | Ga0207681_10000771 | Ga0207681_1000077114 | 561 |
| 264 | 3300025925 | Ga0207650_10000560 | Ga0207650_1000056018 | 561 |
| 265 | 3300025926 | Ga0207659_10006382 | Ga0207659_100063825 | 561 |
| 266 | 3300025927 | Ga0207687_10030809 | Ga0207687_100308091 | 561 |
| 267 | 3300025928 | Ga0207700_10067226 | Ga0207700_100672262 | 561 |
| 268 | 3300025933 | Ga0207706_10048964 | Ga0207706_100489643 | 561 |
| 269 | 3300025935 | Ga0207709_10013935 | Ga0207709_100139354 | 561 |
| 270 | 3300025937 | Ga0207669_10008342 | Ga0207669_100083423 | 561 |
| 271 | 3300025940 | Ga0207691_10005269 | Ga0207691_1000526910 | 561 |
| 272 | 3300025941 | Ga0207711_10012387 | Ga0207711_100123875 | 561 |
| 273 | 3300025942 | Ga0207689_10015742 | Ga0207689_100157424 | 561 |
| 274 | 3300025961 | Ga0207712_10033856 | Ga0207712_100338563 | 561 |
| 275 | 3300025986 | Ga0207658_10000818 | Ga0207658_1000081814 | 561 |
| 276 | 3300026023 | Ga0207677_10057314 | Ga0207677_100573142 | 561 |
| 277 | 3300026035 | Ga0207703_10026368 | Ga0207703_100263683 | 561 |
| 278 | 3300026075 | Ga0207708_10016060 | Ga0207708_100160604 | 561 |
| 279 | 3300026088 | Ga0207641_10003358 | Ga0207641_1000335810 | 561 |
| 280 | 3300026089 | Ga0207648_10009106 | Ga0207648_100091069 | 561 |
| 281 | 3300028381 | Ga0268264_10047533 | Ga0268264_100475332 | 561 |
| 282 | 3300048905 | Ga0496102_0005187 | Ga0496102_0005187_5979_7694 | 561 |
| 283 | 3300005328 | Ga0070676_10016033 | Ga0070676_100160334 | 562 |
| 284 | 3300005459 | Ga0068867_100013463 | Ga0068867_1000134632 | 562 |
| 285 | 3300005539 | Ga0068853_100034021 | Ga0068853_1000340214 | 562 |
| 286 | 3300009176 | Ga0105242_10089137 | Ga0105242_100891372 | 562 |
| 287 | 3300026035 | Ga0207703_10017240 | Ga0207703_100172405 | 562 |
| 288 | 3300045051 | Ga0451576_0000231 | Ga0451576_0000231_133173_134912 | 562 |
| 289 | 3300049572 | Ga0501036_0012979 | Ga0501036_0012979_3163_4896 | 562 |
| 290 | 3300049575 | Ga0501039_0002263 | Ga0501039_0002263_1346_3079 | 562 |
| 291 | 3300049578 | Ga0501042_0014377 | Ga0501042_0014377_1867_3600 | 562 |
| 292 | 3300049587 | Ga0501071_0000987 | Ga0501071_0000987_3197_4930 | 562 |
| 293 | 3300049588 | Ga0501072_0001988 | Ga0501072_0001988_8214_9947 | 562 |
| 294 | 3300049590 | Ga0501074_0039808 | Ga0501074_0039808_18_1751 | 562 |
| 295 | 3300049591 | Ga0501075_0002462 | Ga0501075_0002462_7190_8923 | 562 |
| 296 | 3300049592 | Ga0501076_0000481 | Ga0501076_0000481_632_2365 | 562 |
| 297 | 3300049741 | Ga0501079_0025822 | Ga0501079_0025822_1068_2801 | 562 |
| 298 | 3300049742 | Ga0501080_0023189 | Ga0501080_0023189_696_2429 | 562 |
| 299 | 3300049743 | Ga0501081_0011157 | Ga0501081_0011157_4011_5744 | 562 |
| 300 | 3300054114 | Ga0501084_0020192 | Ga0501084_0020192_1434_3167 | 562 |
| 301 | 3300060353 | Ga0501082_0001046 | Ga0501082_0001046_22491_24224 | 562 |
| 302 | 3300061734 | Ga0530510_0001365 | Ga0530510_0001365_1577_3310 | 562 |
| 303 | 3300005334 | Ga0068869_100001825 | Ga0068869_1000018253 | 563 |
| 304 | 3300005338 | Ga0068868_100008536 | Ga0068868_1000085364 | 563 |
| 305 | 3300005354 | Ga0070675_100010314 | Ga0070675_1000103144 | 563 |
| 306 | 3300005455 | Ga0070663_100049380 | Ga0070663_1000493802 | 563 |
| 307 | 3300005457 | Ga0070662_100030839 | Ga0070662_1000308392 | 563 |
| 308 | 3300005458 | Ga0070681_10054169 | Ga0070681_100541692 | 563 |
| 309 | 3300005530 | Ga0070679_100002199 | Ga0070679_1000021997 | 563 |
| 310 | 3300005563 | Ga0068855_100033174 | Ga0068855_1000331743 | 563 |
| 311 | 3300005614 | Ga0068856_100049501 | Ga0068856_1000495012 | 563 |
| 312 | 3300005616 | Ga0068852_100023794 | Ga0068852_1000237942 | 563 |
| 313 | 3300005719 | Ga0068861_100002433 | Ga0068861_10000243310 | 563 |
| 314 | 3300006358 | Ga0068871_100012320 | Ga0068871_1000123203 | 563 |
| 315 | 3300006847 | Ga0075431_100053601 | Ga0075431_1000536012 | 563 |
| 316 | 3300006880 | Ga0075429_100042141 | Ga0075429_1000421412 | 563 |
| 317 | 3300013306 | Ga0163162_10032033 | Ga0163162_100320336 | 563 |
| 318 | 3300013307 | Ga0157372_10018450 | Ga0157372_100184502 | 563 |
| 319 | 3300014745 | Ga0157377_10009758 | Ga0157377_100097586 | 563 |
| 320 | 3300014969 | Ga0157376_10023530 | Ga0157376_100235304 | 563 |
| 321 | 3300017792 | Ga0163161_10097246 | Ga0163161_100972461 | 563 |
| 322 | 3300025297 | Ga0209758_1000051 | Ga0209758_1000051197 | 563 |
| 323 | 3300025912 | Ga0207707_10047537 | Ga0207707_100475372 | 563 |
| 324 | 3300025919 | Ga0207657_10016143 | Ga0207657_100161432 | 563 |
| 325 | 3300025921 | Ga0207652_10005535 | Ga0207652_100055355 | 563 |
| 326 | 3300025926 | Ga0207659_10033134 | Ga0207659_100331342 | 563 |
| 327 | 3300025941 | Ga0207711_10003165 | Ga0207711_1000316512 | 563 |
| 328 | 3300025942 | Ga0207689_10000550 | Ga0207689_1000055013 | 563 |
| 329 | 3300026023 | Ga0207677_10004108 | Ga0207677_100041085 | 563 |
| 330 | 3300026041 | Ga0207639_10080984 | Ga0207639_100809842 | 563 |
| 331 | 3300026067 | Ga0207678_10014250 | Ga0207678_100142505 | 563 |
| 332 | 3300026095 | Ga0207676_10038263 | Ga0207676_100382634 | 563 |
| 333 | 3300026118 | Ga0207675_100000576 | Ga0207675_10000057613 | 563 |
| 334 | 3300031731 | Ga0307405_10072248 | Ga0307405_100722482 | 563 |
| 335 | 3300031995 | Ga0307409_100002278 | Ga0307409_1000022787 | 563 |
| 336 | 3300035088 | Ga0373940_0011049 | Ga0373940_0011049_348_2087 | 563 |
| 337 | 3300048904 | Ga0496101_0064709 | Ga0496101_0064709_76_1815 | 563 |
| 338 | 3300048909 | Ga0496106_0002960 | Ga0496106_0002960_9916_11655 | 563 |
| 339 | 3300048911 | Ga0496108_0043971 | Ga0496108_0043971_1583_3325 | 563 |
| 340 | 3300048913 | Ga0496110_0028527 | Ga0496110_0028527_505_2247 | 563 |
| 341 | 3300048916 | Ga0496113_0038228 | Ga0496113_0038228_1252_2991 | 563 |
| 342 | 3300048918 | Ga0496115_0071229 | Ga0496115_0071229_135_1874 | 563 |
| 343 | 3300050510 | nmdc:mga06r32_102693_c1 | nmdc:mga06r32_102693_c1_430_2124 | 563 |
| 344 | iso_pu_bacteria | 2503198000 | 2503198281 | 563 |
| 345 | iso_pu_bacteria | 2509276018 | 2509368353 | 563 |
| 346 | iso_pu_bacteria | 2510065059 | 2510314635 | 563 |
| 347 | iso_pu_bacteria | 2512875024 | 2512962550 | 563 |
| 348 | iso_pu_bacteria | 2513237164 | 2514038619 | 563 |
| 349 | iso_pu_bacteria | 2687453392 | 2688595607 | 563 |
| 350 | iso_pu_bacteria | 2756170246 | 2756674310 | 563 |
| 351 | iso_pu_bacteria | 2818991442 | 2819577402 | 563 |
| 352 | iso_pu_bacteria | 2844002411 | 2844003867 | 563 |
| 353 | iso_pu_bacteria | 2844009547 | 2844010406 | 563 |
| 354 | iso_pu_bacteria | 2856320880 | 2856321918 | 563 |
| 355 | iso_pu_bacteria | 2856328259 | 2856331790 | 563 |
| 356 | iso_pu_bacteria | 2856334872 | 2856340809 | 563 |
| 357 | iso_pu_bacteria | 2857367948 | 2857373608 | 563 |
| 358 | iso_pu_bacteria | 2869169390 | 2869170784 | 563 |
| 359 | iso_pu_bacteria | 2869234852 | 2869236926 | 563 |
| 360 | iso_pu_bacteria | 2869242130 | 2869243357 | 563 |
| 361 | iso_pu_bacteria | 2869249662 | 2869251912 | 563 |
| 362 | iso_pu_bacteria | 2869256925 | 2869261811 | 563 |
| 363 | iso_pu_bacteria | 2869264136 | 2869264864 | 563 |
| 364 | iso_pu_bacteria | 2869271264 | 2869278136 | 563 |
| 365 | iso_pu_bacteria | 2869278585 | 2869280096 | 563 |
| 366 | iso_pu_bacteria | 2871435913 | 2871437151 | 563 |
| 367 | iso_pu_bacteria | 2871451962 | 2871458850 | 563 |
| 368 | iso_pu_bacteria | 2871459585 | 2871459644 | 563 |
| 369 | iso_pu_bacteria | 2871466892 | 2871468257 | 563 |
| 370 | iso_pu_bacteria | 2874109183 | 2874109948 | 563 |
| 371 | iso_pu_bacteria | 2874131515 | 2874132125 | 563 |
| 372 | iso_pu_bacteria | 2874139085 | 2874143352 | 563 |
| 373 | iso_pu_bacteria | 2874162495 | 2874162925 | 563 |
| 374 | iso_pu_bacteria | 2874168670 | 2874171996 | 563 |
| 375 | iso_pu_bacteria | 2876386047 | 2876391393 | 563 |
| 376 | iso_pu_bacteria | 2876399893 | 2876404220 | 563 |
| 377 | iso_pu_bacteria | 2876406927 | 2876410048 | 563 |
| 378 | iso_pu_bacteria | 2876420981 | 2876423796 | 563 |
| 379 | iso_pu_bacteria | 2878730984 | 2878736391 | 563 |
| 380 | iso_pu_bacteria | 2878738818 | 2878740579 | 563 |
| 381 | iso_pu_bacteria | 2878774303 | 2878780848 | 563 |
| 382 | iso_pu_bacteria | 2878781027 | 2878786965 | 563 |
| 383 | iso_pu_bacteria | 2888337043 | 2888342949 | 563 |
| 384 | iso_pu_bacteria | 2906363423 | 2906370376 | 563 |
| 385 | iso_pu_bacteria | 2906378014 | 2906382631 | 563 |
| 386 | iso_pu_bacteria | 2906393657 | 2906394360 | 563 |
| 387 | iso_pu_bacteria | 2906401398 | 2906402781 | 563 |
| 388 | iso_pu_bacteria | 2906408224 | 2906413360 | 563 |
| 389 | iso_pu_bacteria | 2906427513 | 2906435410 | 563 |
| 390 | iso_pu_bacteria | 2922151315 | 2922158354 | 563 |
| 391 | iso_pu_bacteria | 2922172374 | 2922177233 | 563 |
| 392 | iso_pu_bacteria | 2922178524 | 2922178800 | 563 |
| 393 | iso_pu_bacteria | 2924718760 | 2924723145 | 563 |
| 394 | iso_pu_bacteria | 2924733363 | 2924736709 | 563 |
| 395 | iso_pu_bacteria | 2924741084 | 2924743939 | 563 |
| 396 | iso_pu_bacteria | 2924748358 | 2924753892 | 563 |
| 397 | iso_pu_bacteria | 2924776078 | 2924778180 | 563 |
| 398 | iso_pu_bacteria | 2929212328 | 2929214027 | 563 |
| 399 | iso_pu_bacteria | 2937822353 | 2937824315 | 563 |
| 400 | iso_pu_bacteria | 2937861824 | 2937868891 | 563 |
| 401 | iso_pu_bacteria | 2937877337 | 2937877978 | 563 |
| 402 | iso_pu_bacteria | 2937972304 | 2937973965 | 563 |
| 403 | iso_pu_bacteria | 2937980651 | 2937986213 | 563 |
| 404 | iso_pu_bacteria | 2958034702 | 2958035962 | 563 |
| 405 | iso_pu_bacteria | 2958041894 | 2958045268 | 563 |
| 406 | iso_pu_bacteria | 2958084443 | 2958085089 | 563 |
| 407 | iso_pu_bacteria | 2958108152 | 2958114691 | 563 |
| 408 | iso_pu_bacteria | 2958122699 | 2958129380 | 563 |
| 409 | iso_pu_bacteria | 2958158011 | 2958158145 | 563 |
| 410 | iso_pu_bacteria | 2961183825 | 2961184123 | 563 |
| 411 | iso_pu_bacteria | 2965025482 | 2965028598 | 563 |
| 412 | iso_pu_bacteria | 2965032056 | 2965038511 | 563 |
| 413 | iso_pu_bacteria | 2965040258 | 2965041195 | 563 |
| 414 | iso_pu_bacteria | 2965089291 | 2965096496 | 563 |
| 415 | iso_pu_bacteria | 2968016561 | 2968017049 | 563 |
| 416 | iso_pu_bacteria | 2968138860 | 2968146095 | 563 |
| 417 | iso_pu_bacteria | 2970469710 | 2970470206 | 563 |
| 418 | iso_pu_bacteria | 2970489779 | 2970493902 | 563 |
| 419 | iso_pu_bacteria | 2970510686 | 2970510797 | 563 |
| 420 | iso_pu_bacteria | 2970532167 | 2970533105 | 563 |
| 421 | iso_pu_bacteria | 2970547951 | 2970548456 | 563 |
| 422 | iso_pu_bacteria | 2970593180 | 2970594693 | 563 |
| 423 | iso_pu_bacteria | 2970619444 | 2970621067 | 563 |
| 424 | iso_pu_bacteria | 2970627176 | 2970631009 | 563 |
| 425 | iso_pu_bacteria | 2977851361 | 2977856420 | 563 |
| 426 | iso_pu_bacteria | 2977872689 | 2977875355 | 563 |
| 427 | iso_pu_bacteria | 2977907340 | 2977913167 | 563 |
| 428 | iso_pu_bacteria | 2977915119 | 2977919771 | 563 |
| 429 | iso_pu_bacteria | 2977935797 | 2977938531 | 563 |
| 430 | iso_pu_bacteria | 2977950692 | 2977955050 | 563 |
| 431 | iso_pu_bacteria | 2977957713 | 2977959632 | 563 |
| 432 | iso_pu_bacteria | 2979764755 | 2979765492 | 563 |
| 433 | iso_pu_bacteria | 2979772303 | 2979773488 | 563 |
| 434 | iso_pu_bacteria | 2987645492 | 2987646667 | 563 |
| 435 | iso_pu_bacteria | 2996348954 | 2996349007 | 563 |
| 436 | iso_pu_bacteria | 2996386984 | 2996388040 | 563 |
| 437 | iso_pu_bacteria | 3004167301 | 3004172812 | 563 |
| 438 | iso_pu_bacteria | 3004195979 | 3004203186 | 563 |
| 439 | iso_pu_bacteria | 3004239961 | 3004245572 | 563 |
| 440 | iso_pu_bacteria | 3004268573 | 3004272597 | 563 |
| 441 | iso_pu_bacteria | 3004275668 | 3004275719 | 563 |
| 442 | iso_pu_bacteria | 3004289098 | 3004292016 | 563 |
| 443 | iso_pu_bacteria | 649633066 | 649870174 | 563 |
| 444 | iso_pu_bacteria | 8004312739 | 8004313857 | 563 |
| 445 | iso_pu_bacteria | 8004361976 | 8004364258 | 563 |
| 446 | iso_pu_bacteria | 2643221550 | 2643772709 | 564 |
| 447 | iso_pu_bacteria | 2643221618 | 2644106842 | 564 |
| 448 | iso_pu_bacteria | 2643221623 | 2644132970 | 564 |
| 449 | iso_pu_bacteria | 2643221626 | 2644149352 | 564 |
| 450 | iso_pu_bacteria | 2643221655 | 2644309914 | 564 |
| 451 | iso_pu_bacteria | 2643221659 | 2644337196 | 564 |
| 452 | iso_pu_bacteria | 2643221698 | 2644540491 | 564 |
| 453 | iso_pu_bacteria | 2643221712 | 2644616365 | 564 |
| 454 | iso_pu_bacteria | 2738543024 | 2739305556 | 564 |
| 455 | iso_pu_bacteria | 2844163670 | 2844170988 | 564 |
| 456 | iso_pu_bacteria | 2910245624 | 2910248857 | 564 |
| 457 | iso_pu_bacteria | 2941499720 | 2941503271 | 564 |
| 458 | iso_pu_bacteria | 2989349275 | 2989353544 | 564 |
| 459 | iso_pu_bacteria | 8002285264 | 8002289613 | 564 |
| 460 | 3300005844 | Ga0068862_100104493 | Ga0068862_1001044932 | 565 |
| 461 | 3300025938 | Ga0207704_10038806 | Ga0207704_100388062 | 565 |
| 462 | 3300025942 | Ga0207689_10058301 | Ga0207689_100583012 | 565 |
| 463 | 3300025972 | Ga0207668_10067709 | Ga0207668_100677092 | 565 |
| 464 | 3300027312 | Ga0209371_1000537 | Ga0209371_10005373 | 565 |
| 465 | 3300030500 | Ga0268256_1003531 | Ga0268256_10035313 | 565 |
| 466 | 3300039437 | Ga0436365_0827866 | Ga0436365_0827866_1760_3505 | 565 |
| 467 | 3300048925 | Ga0496122_0045919 | Ga0496122_0045919_537_2282 | 565 |
| 468 | 3300048926 | Ga0496123_0079477 | Ga0496123_0079477_131_1876 | 565 |
| 469 | iso_pu_bacteria | 2857349434 | 2857353972 | 565 |
| 470 | iso_pu_bacteria | 2929921140 | 2929926122 | 565 |
| 471 | iso_pu_bacteria | 2987636660 | 2987642616 | 565 |
| 472 | iso_pu_bacteria | 8003151029 | 8003151861 | 565 |
| 473 | 3300005438 | Ga0070701_10027034 | Ga0070701_100270342 | 566 |
| 474 | 3300006881 | Ga0068865_100036426 | Ga0068865_1000364262 | 566 |
| 475 | 3300014968 | Ga0157379_10099197 | Ga0157379_100991972 | 566 |
| 476 | iso_pu_bacteria | 2615840698 | 2616552906 | 566 |
| 477 | iso_pu_bacteria | 8005682033 | 8005683669 | 566 |
| 478 | 3300002705 | JGI25156J39149_1003633 | JGI25156J39149_10036334 | 567 |
| 479 | 3300002741 | JGI25157J39369_1001300 | JGI25157J39369_10013007 | 567 |
| 480 | 3300005439 | Ga0070711_100010683 | Ga0070711_1000106832 | 567 |
| 481 | 3300005467 | Ga0070706_100017407 | Ga0070706_1000174073 | 567 |
| 482 | 3300005471 | Ga0070698_100016910 | Ga0070698_1000169103 | 567 |
| 483 | 3300006175 | Ga0070712_100000139 | Ga0070712_10000013921 | 567 |
| 484 | 3300009147 | Ga0114129_10001007 | Ga0114129_1000100729 | 567 |
| 485 | 3300010375 | Ga0105239_10120461 | Ga0105239_101204612 | 567 |
| 486 | 3300015265 | Ga0182005_1000234 | Ga0182005_100023430 | 567 |
| 487 | 3300024225 | Ga0224572_1000136 | Ga0224572_10001362 | 567 |
| 488 | 3300025250 | Ga0209026_1000050 | Ga0209026_100005047 | 567 |
| 489 | 3300025256 | Ga0209759_1000229 | Ga0209759_100022960 | 567 |
| 490 | 3300025261 | Ga0209233_1002543 | Ga0209233_10025435 | 567 |
| 491 | 3300025284 | Ga0209130_1007205 | Ga0209130_10072052 | 567 |
| 492 | 3300025910 | Ga0207684_10022962 | Ga0207684_100229623 | 567 |
| 493 | 3300025915 | Ga0207693_10002891 | Ga0207693_100028918 | 567 |
| 494 | 3300025916 | Ga0207663_10005945 | Ga0207663_100059454 | 567 |
| 495 | 3300028017 | Ga0265356_1000046 | Ga0265356_100004617 | 567 |
| 496 | 3300030760 | Ga0265762_1000247 | Ga0265762_10002472 | 567 |
| 497 | 3300031251 | Ga0265327_10000101 | Ga0265327_1000010142 | 567 |
| 498 | 3300044673 | Ga0453683_0039345 | Ga0453683_0039345_208_1914 | 567 |
| 499 | 3300046660 | Ga0495625_0009215 | Ga0495625_0009215_3600_5312 | 567 |
| 500 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_158997_160706 | 567 |
| 501 | 3300048927 | Ga0496124_0001442 | Ga0496124_0001442_12286_14001 | 567 |
| 502 | 3300049569 | Ga0501032_0031220 | Ga0501032_0031220_885_2597 | 567 |
| 503 | 3300049570 | Ga0501033_0040411 | Ga0501033_0040411_1266_2978 | 567 |
| 504 | 3300049571 | Ga0501034_0042626 | Ga0501034_0042626_2649_4361 | 567 |
| 505 | 3300049571 | Ga0501034_0156859 | Ga0501034_0156859_437_2149 | 567 |
| 506 | 3300049581 | Ga0501047_0013273 | Ga0501047_0013273_2475_4187 | 567 |
| 507 | 3300049586 | Ga0501070_0048360 | Ga0501070_0048360_292_2004 | 567 |
| 508 | 3300049742 | Ga0501080_0093306 | Ga0501080_0093306_890_2602 | 567 |
| 509 | 3300049823 | Ga0501044_0043756 | Ga0501044_0043756_2500_4212 | 567 |
| 510 | 3300050507 | nmdc:mga05p37_2217_c1 | nmdc:mga05p37_2217_c1_12945_14654 | 567 |
| 511 | 3300053088 | Ga0500644_0000080 | Ga0500644_0000080_54714_56423 | 567 |
| 512 | 3300053109 | Ga0500569_000719 | Ga0500569_000719_732_2441 | 567 |
| 513 | 3300053148 | Ga0500590_035259 | Ga0500590_035259_156_1865 | 567 |
| 514 | iso_pu_bacteria | 2510065057 | 2510302697 | 567 |
| 515 | iso_pu_bacteria | 2511231052 | 2511497748 | 567 |
| 516 | iso_pu_bacteria | 2513237086 | 2513584593 | 567 |
| 517 | iso_pu_bacteria | 2513237091 | 2513616393 | 567 |
| 518 | iso_pu_bacteria | 2513237140 | 2513883860 | 567 |
| 519 | iso_pu_bacteria | 2513237143 | 2513902036 | 567 |
| 520 | iso_pu_bacteria | 2515154107 | 2515612017 | 567 |
| 521 | iso_pu_bacteria | 2516653046 | 2516896601 | 567 |
| 522 | iso_pu_bacteria | 2524023207 | 2524452096 | 567 |
| 523 | iso_pu_bacteria | 2551306084 | 2551681459 | 567 |
| 524 | iso_pu_bacteria | 2551306085 | 2551684694 | 567 |
| 525 | iso_pu_bacteria | 2551306086 | 2551695025 | 567 |
| 526 | iso_pu_bacteria | 2551306087 | 2551700294 | 567 |
| 527 | iso_pu_bacteria | 2551306089 | 2551713051 | 567 |
| 528 | iso_pu_bacteria | 2551306090 | 2551718171 | 567 |
| 529 | iso_pu_bacteria | 2551306090 | 2551722872 | 567 |
| 530 | iso_pu_bacteria | 2551306091 | 2551724555 | 567 |
| 531 | iso_pu_bacteria | 2551306092 | 2551733544 | 567 |
| 532 | iso_pu_bacteria | 2551306093 | 2551744390 | 567 |
| 533 | iso_pu_bacteria | 2738541278 | 2738728148 | 567 |
| 534 | iso_pu_bacteria | 2751185821 | 2753462407 | 567 |
| 535 | iso_pu_bacteria | 2844163670 | 2844163952 | 567 |
| 536 | iso_pu_bacteria | 2855825444 | 2855828567 | 567 |
| 537 | iso_pu_bacteria | 2855839649 | 2855843692 | 567 |
| 538 | iso_pu_bacteria | 2858800743 | 2858807063 | 567 |
| 539 | iso_pu_bacteria | 2913295892 | 2913296173 | 567 |
| 540 | iso_pu_bacteria | 2915986958 | 2915988619 | 567 |
| 541 | iso_pu_bacteria | 2915993759 | 2915998160 | 567 |
| 542 | iso_pu_bacteria | 2916000859 | 2916007327 | 567 |
| 543 | iso_pu_bacteria | 2916007675 | 2916011277 | 567 |
| 544 | iso_pu_bacteria | 2916014648 | 2916020565 | 567 |
| 545 | iso_pu_bacteria | 2916021584 | 2916028097 | 567 |
| 546 | iso_pu_bacteria | 2916028427 | 2916032819 | 567 |
| 547 | iso_pu_bacteria | 2916035215 | 2916038205 | 567 |
| 548 | iso_pu_bacteria | 2916041962 | 2916045025 | 567 |
| 549 | iso_pu_bacteria | 2916048683 | 2916051962 | 567 |
| 550 | iso_pu_bacteria | 2916055098 | 2916059471 | 567 |
| 551 | iso_pu_bacteria | 2916068649 | 2916073299 | 567 |
| 552 | iso_pu_bacteria | 2916076590 | 2916082549 | 567 |
| 553 | iso_pu_bacteria | 2921201388 | 2921203440 | 567 |
| 554 | iso_pu_bacteria | 2921208531 | 2921213261 | 567 |
| 555 | iso_pu_bacteria | 2921237296 | 2921240528 | 567 |
| 556 | iso_pu_bacteria | 2921244191 | 2921245732 | 567 |
| 557 | iso_pu_bacteria | 2921257292 | 2921260043 | 567 |
| 558 | iso_pu_bacteria | 2921263974 | 2921268444 | 567 |
| 559 | iso_pu_bacteria | 2921282425 | 2921284667 | 567 |
| 560 | iso_pu_bacteria | 2921289301 | 2921290729 | 567 |
| 561 | iso_pu_bacteria | 2921296804 | 2921297005 | 567 |
| 562 | iso_pu_bacteria | 2924144063 | 2924148117 | 567 |
| 563 | iso_pu_bacteria | 2924150972 | 2924154766 | 567 |
| 564 | iso_pu_bacteria | 2924158325 | 2924163923 | 567 |
| 565 | iso_pu_bacteria | 2924165586 | 2924168441 | 567 |
| 566 | iso_pu_bacteria | 2924172951 | 2924177182 | 567 |
| 567 | iso_pu_bacteria | 2924179722 | 2924182034 | 567 |
| 568 | iso_pu_bacteria | 2924186466 | 2924188910 | 567 |
| 569 | iso_pu_bacteria | 2924193448 | 2924195760 | 567 |
| 570 | iso_pu_bacteria | 2924200457 | 2924202970 | 567 |
| 571 | iso_pu_bacteria | 2924207177 | 2924210004 | 567 |
| 572 | iso_pu_bacteria | 2924214083 | 2924215609 | 567 |
| 573 | iso_pu_bacteria | 2924221636 | 2924228387 | 567 |
| 574 | iso_pu_bacteria | 2924228884 | 2924233759 | 567 |
| 575 | iso_pu_bacteria | 2929921140 | 2929924068 | 567 |
| 576 | iso_pu_bacteria | 2936996657 | 2937001550 | 567 |
| 577 | iso_pu_bacteria | 2937002841 | 2937005885 | 567 |
| 578 | iso_pu_bacteria | 2937009748 | 2937014280 | 567 |
| 579 | iso_pu_bacteria | 2937016420 | 2937021581 | 567 |
| 580 | iso_pu_bacteria | 2937023124 | 2937023940 | 567 |
| 581 | iso_pu_bacteria | 2937042894 | 2937043375 | 567 |
| 582 | iso_pu_bacteria | 2937049772 | 2937054063 | 567 |
| 583 | iso_pu_bacteria | 2937056579 | 2937056837 | 567 |
| 584 | iso_pu_bacteria | 2937063883 | 2937066102 | 567 |
| 585 | iso_pu_bacteria | 2937071275 | 2937075418 | 567 |
| 586 | iso_pu_bacteria | 2937091812 | 2937096104 | 567 |
| 587 | iso_pu_bacteria | 2937098957 | 2937105180 | 567 |
| 588 | iso_pu_bacteria | 2937106411 | 2937108065 | 567 |
| 589 | iso_pu_bacteria | 2937113482 | 2937118857 | 567 |
| 590 | iso_pu_bacteria | 2937119839 | 2937125800 | 567 |
| 591 | iso_pu_bacteria | 2937126314 | 2937131072 | 567 |
| 592 | iso_pu_bacteria | 2941499720 | 2941504668 | 567 |
| 593 | iso_pu_bacteria | 2957382221 | 2957382985 | 567 |
| 594 | iso_pu_bacteria | 2957388812 | 2957391943 | 567 |
| 595 | iso_pu_bacteria | 2957395598 | 2957396281 | 567 |
| 596 | iso_pu_bacteria | 2957402308 | 2957402963 | 567 |
| 597 | iso_pu_bacteria | 2957408893 | 2957410734 | 567 |
| 598 | iso_pu_bacteria | 2957415311 | 2957416718 | 567 |
| 599 | iso_pu_bacteria | 2957422303 | 2957422831 | 567 |
| 600 | iso_pu_bacteria | 2957430029 | 2957435258 | 567 |
| 601 | iso_pu_bacteria | 2957443900 | 2957445213 | 567 |
| 602 | iso_pu_bacteria | 2957450854 | 2957454880 | 567 |
| 603 | iso_pu_bacteria | 2957457609 | 2957458984 | 567 |
| 604 | iso_pu_bacteria | 2957464669 | 2957464855 | 567 |
| 605 | iso_pu_bacteria | 2957471148 | 2957476860 | 567 |
| 606 | iso_pu_bacteria | 2957478035 | 2957482411 | 567 |
| 607 | iso_pu_bacteria | 2957484790 | 2957490039 | 567 |
| 608 | iso_pu_bacteria | 2957491536 | 2957491720 | 567 |
| 609 | iso_pu_bacteria | 2957498199 | 2957501615 | 567 |
| 610 | iso_pu_bacteria | 2957505466 | 2957510123 | 567 |
| 611 | iso_pu_bacteria | 2958137437 | 2958142626 | 567 |
| 612 | iso_pu_bacteria | 2960584000 | 2960584997 | 567 |
| 613 | iso_pu_bacteria | 2960597568 | 2960598437 | 567 |
| 614 | iso_pu_bacteria | 2960603979 | 2960609507 | 567 |
| 615 | iso_pu_bacteria | 2960610863 | 2960614221 | 567 |
| 616 | iso_pu_bacteria | 2960617483 | 2960621894 | 567 |
| 617 | iso_pu_bacteria | 2960624210 | 2960629140 | 567 |
| 618 | iso_pu_bacteria | 2960637947 | 2960640709 | 567 |
| 619 | iso_pu_bacteria | 2960645483 | 2960645671 | 567 |
| 620 | iso_pu_bacteria | 2960652885 | 2960658129 | 567 |
| 621 | iso_pu_bacteria | 2960660292 | 2960661996 | 567 |
| 622 | iso_pu_bacteria | 2960667422 | 2960669744 | 567 |
| 623 | iso_pu_bacteria | 2960674078 | 2960680350 | 567 |
| 624 | iso_pu_bacteria | 2960687367 | 2960690855 | 567 |
| 625 | iso_pu_bacteria | 2964607997 | 2964610792 | 567 |
| 626 | iso_pu_bacteria | 2964615318 | 2964619313 | 567 |
| 627 | iso_pu_bacteria | 2964621998 | 2964624178 | 567 |
| 628 | iso_pu_bacteria | 2964628898 | 2964632537 | 567 |
| 629 | iso_pu_bacteria | 2964636051 | 2964640645 | 567 |
| 630 | iso_pu_bacteria | 2964643177 | 2964644575 | 567 |
| 631 | iso_pu_bacteria | 2964649959 | 2964655046 | 567 |
| 632 | iso_pu_bacteria | 2964656573 | 2964661686 | 567 |
| 633 | iso_pu_bacteria | 2964663802 | 2964666794 | 567 |
| 634 | iso_pu_bacteria | 2964670856 | 2964677169 | 567 |
| 635 | iso_pu_bacteria | 2964678106 | 2964679749 | 567 |
| 636 | iso_pu_bacteria | 2964685014 | 2964686934 | 567 |
| 637 | iso_pu_bacteria | 2964691889 | 2964692561 | 567 |
| 638 | iso_pu_bacteria | 2964698721 | 2964703249 | 567 |
| 639 | iso_pu_bacteria | 2964705432 | 2964709563 | 567 |
| 640 | iso_pu_bacteria | 2964712639 | 2964714027 | 567 |
| 641 | iso_pu_bacteria | 2964719344 | 2964722533 | 567 |
| 642 | iso_pu_bacteria | 2967664464 | 2967668563 | 567 |
| 643 | iso_pu_bacteria | 2967671571 | 2967677056 | 567 |
| 644 | iso_pu_bacteria | 2967678726 | 2967684728 | 567 |
| 645 | iso_pu_bacteria | 2967693043 | 2967697801 | 567 |
| 646 | iso_pu_bacteria | 2967699805 | 2967700296 | 567 |
| 647 | iso_pu_bacteria | 2967706974 | 2967708692 | 567 |
| 648 | iso_pu_bacteria | 2967714385 | 2967721273 | 567 |
| 649 | iso_pu_bacteria | 2967721400 | 2967725205 | 567 |
| 650 | iso_pu_bacteria | 2967735183 | 2967740681 | 567 |
| 651 | iso_pu_bacteria | 2967742019 | 2967745400 | 567 |
| 652 | iso_pu_bacteria | 2967748971 | 2967750830 | 567 |
| 653 | iso_pu_bacteria | 2967755722 | 2967761659 | 567 |
| 654 | iso_pu_bacteria | 2967762386 | 2967766038 | 567 |
| 655 | iso_pu_bacteria | 2967769361 | 2967772306 | 567 |
| 656 | iso_pu_bacteria | 2967775926 | 2967777748 | 567 |
| 657 | iso_pu_bacteria | 2970019648 | 2970023529 | 567 |
| 658 | iso_pu_bacteria | 2970033650 | 2970039040 | 567 |
| 659 | iso_pu_bacteria | 2970040964 | 2970046523 | 567 |
| 660 | iso_pu_bacteria | 2970047711 | 2970053737 | 567 |
| 661 | iso_pu_bacteria | 2970054988 | 2970058642 | 567 |
| 662 | iso_pu_bacteria | 2970061556 | 2970063581 | 567 |
| 663 | iso_pu_bacteria | 2970068827 | 2970071279 | 567 |
| 664 | iso_pu_bacteria | 2970076120 | 2970078405 | 567 |
| 665 | iso_pu_bacteria | 2970082768 | 2970083962 | 567 |
| 666 | iso_pu_bacteria | 2970088815 | 2970094770 | 567 |
| 667 | iso_pu_bacteria | 2970095765 | 2970097371 | 567 |
| 668 | iso_pu_bacteria | 2970102677 | 2970105818 | 567 |
| 669 | iso_pu_bacteria | 2970109326 | 2970114790 | 567 |
| 670 | iso_pu_bacteria | 2970116247 | 2970119592 | 567 |
| 671 | iso_pu_bacteria | 2970129317 | 2970134954 | 567 |
| 672 | iso_pu_bacteria | 2970136068 | 2970136867 | 567 |
| 673 | iso_pu_bacteria | 2970149975 | 2970154132 | 567 |
| 674 | iso_pu_bacteria | 2970156795 | 2970162930 | 567 |
| 675 | iso_pu_bacteria | 2970164137 | 2970164625 | 567 |
| 676 | iso_pu_bacteria | 2970170962 | 2970174291 | 567 |
| 677 | iso_pu_bacteria | 2970177841 | 2970178774 | 567 |
| 678 | iso_pu_bacteria | 2970184632 | 2970189406 | 567 |
| 679 | iso_pu_bacteria | 2970191845 | 2970194656 | 567 |
| 680 | iso_pu_bacteria | 2977516862 | 2977518818 | 567 |
| 681 | iso_pu_bacteria | 2977523885 | 2977526605 | 567 |
| 682 | iso_pu_bacteria | 2977537788 | 2977541340 | 567 |
| 683 | iso_pu_bacteria | 2977551784 | 2977557698 | 567 |
| 684 | iso_pu_bacteria | 2977558990 | 2977559591 | 567 |
| 685 | iso_pu_bacteria | 2977565890 | 2977569235 | 567 |
| 686 | iso_pu_bacteria | 2977572785 | 2977578778 | 567 |
| 687 | iso_pu_bacteria | 2977579622 | 2977584720 | 567 |
| 688 | iso_pu_bacteria | 648276728 | 648739893 | 567 |
| 689 | iso_pu_bacteria | 8003992118 | 8003996252 | 567 |
| 690 | iso_pu_bacteria | 8024486573 | 8024488337 | 567 |
| 691 | 3300005327 | Ga0070658_10034021 | Ga0070658_100340213 | 568 |
| 692 | 3300005327 | Ga0070658_10096835 | Ga0070658_100968351 | 568 |
| 693 | 3300005329 | Ga0070683_100011555 | Ga0070683_1000115554 | 568 |
| 694 | 3300005336 | Ga0070680_100027164 | Ga0070680_1000271643 | 568 |
| 695 | 3300005338 | Ga0068868_100003695 | Ga0068868_1000036952 | 568 |
| 696 | 3300005434 | Ga0070709_10029392 | Ga0070709_100293922 | 568 |
| 697 | 3300005435 | Ga0070714_100000027 | Ga0070714_10000002711 | 568 |
| 698 | 3300005435 | Ga0070714_100100823 | Ga0070714_1001008231 | 568 |
| 699 | 3300005436 | Ga0070713_100000070 | Ga0070713_10000007035 | 568 |
| 700 | 3300005436 | Ga0070713_100025593 | Ga0070713_1000255932 | 568 |
| 701 | 3300005436 | Ga0070713_100092697 | Ga0070713_1000926972 | 568 |
| 702 | 3300005437 | Ga0070710_10023423 | Ga0070710_100234232 | 568 |
| 703 | 3300005439 | Ga0070711_100000078 | Ga0070711_10000007827 | 568 |
| 704 | 3300005439 | Ga0070711_100001722 | Ga0070711_1000017224 | 568 |
| 705 | 3300005439 | Ga0070711_100008573 | Ga0070711_1000085734 | 568 |
| 706 | 3300005578 | Ga0068854_100065239 | Ga0068854_1000652392 | 568 |
| 707 | 3300005842 | Ga0068858_100010216 | Ga0068858_1000102164 | 568 |
| 708 | 3300006028 | Ga0070717_10001262 | Ga0070717_100012626 | 568 |
| 709 | 3300006028 | Ga0070717_10007375 | Ga0070717_100073755 | 568 |
| 710 | 3300006028 | Ga0070717_10016703 | Ga0070717_100167031 | 568 |
| 711 | 3300006175 | Ga0070712_100000038 | Ga0070712_10000003810 | 568 |
| 712 | 3300006175 | Ga0070712_100000292 | Ga0070712_1000002927 | 568 |
| 713 | 3300006237 | Ga0097621_100009342 | Ga0097621_1000093424 | 568 |
| 714 | 3300006237 | Ga0097621_100011644 | Ga0097621_1000116441 | 568 |
| 715 | 3300006358 | Ga0068871_100001519 | Ga0068871_1000015197 | 568 |
| 716 | 3300006871 | Ga0075434_100027556 | Ga0075434_1000275564 | 568 |
| 717 | 3300007076 | Ga0075435_100030319 | Ga0075435_1000303193 | 568 |
| 718 | 3300007076 | Ga0075435_100166843 | Ga0075435_1001668431 | 568 |
| 719 | 3300009093 | Ga0105240_10016759 | Ga0105240_100167593 | 568 |
| 720 | 3300009098 | Ga0105245_10001343 | Ga0105245_100013433 | 568 |
| 721 | 3300009098 | Ga0105245_10016474 | Ga0105245_100164742 | 568 |
| 722 | 3300009177 | Ga0105248_10002352 | Ga0105248_1000235210 | 568 |
| 723 | 3300009177 | Ga0105248_10016506 | Ga0105248_100165065 | 568 |
| 724 | 3300009177 | Ga0105248_10054237 | Ga0105248_100542373 | 568 |
| 725 | 3300009545 | Ga0105237_10003834 | Ga0105237_1000383414 | 568 |
| 726 | 3300009545 | Ga0105237_10042642 | Ga0105237_100426422 | 568 |
| 727 | 3300009545 | Ga0105237_10087386 | Ga0105237_100873862 | 568 |
| 728 | 3300009551 | Ga0105238_10035163 | Ga0105238_100351633 | 568 |
| 729 | 3300009553 | Ga0105249_10043073 | Ga0105249_100430732 | 568 |
| 730 | 3300010375 | Ga0105239_10003467 | Ga0105239_1000346714 | 568 |
| 731 | 3300010375 | Ga0105239_10082394 | Ga0105239_100823942 | 568 |
| 732 | 3300010375 | Ga0105239_10088886 | Ga0105239_100888862 | 568 |
| 733 | 3300013100 | Ga0157373_10047748 | Ga0157373_100477482 | 568 |
| 734 | 3300013105 | Ga0157369_10021623 | Ga0157369_100216233 | 568 |
| 735 | 3300013105 | Ga0157369_10027624 | Ga0157369_100276246 | 568 |
| 736 | 3300013297 | Ga0157378_10000228 | Ga0157378_100002288 | 568 |
| 737 | 3300013297 | Ga0157378_10070747 | Ga0157378_100707472 | 568 |
| 738 | 3300013307 | Ga0157372_10010774 | Ga0157372_100107742 | 568 |
| 739 | 3300014497 | Ga0182008_10006626 | Ga0182008_100066262 | 568 |
| 740 | 3300024227 | Ga0228598_1003449 | Ga0228598_10034491 | 568 |
| 741 | 3300025284 | Ga0209130_1001489 | Ga0209130_100148914 | 568 |
| 742 | 3300025302 | Ga0207426_1000182 | Ga0207426_100018243 | 568 |
| 743 | 3300025898 | Ga0207692_10016492 | Ga0207692_100164921 | 568 |
| 744 | 3300025909 | Ga0207705_10022270 | Ga0207705_100222703 | 568 |
| 745 | 3300025914 | Ga0207671_10004291 | Ga0207671_100042916 | 568 |
| 746 | 3300025915 | Ga0207693_10000012 | Ga0207693_1000001271 | 568 |
| 747 | 3300025915 | Ga0207693_10000058 | Ga0207693_1000005841 | 568 |
| 748 | 3300025915 | Ga0207693_10001160 | Ga0207693_100011608 | 568 |
| 749 | 3300025916 | Ga0207663_10000280 | Ga0207663_100002808 | 568 |
| 750 | 3300025916 | Ga0207663_10003100 | Ga0207663_100031004 | 568 |
| 751 | 3300025916 | Ga0207663_10013299 | Ga0207663_100132992 | 568 |
| 752 | 3300025919 | Ga0207657_10003162 | Ga0207657_100031625 | 568 |
| 753 | 3300025924 | Ga0207694_10005169 | Ga0207694_100051694 | 568 |
| 754 | 3300025927 | Ga0207687_10006970 | Ga0207687_100069704 | 568 |
| 755 | 3300025928 | Ga0207700_10003116 | Ga0207700_100031166 | 568 |
| 756 | 3300025929 | Ga0207664_10000098 | Ga0207664_1000009843 | 568 |
| 757 | 3300025961 | Ga0207712_10026330 | Ga0207712_100263302 | 568 |
| 758 | 3300026023 | Ga0207677_10018320 | Ga0207677_100183202 | 568 |
| 759 | 3300026023 | Ga0207677_10090940 | Ga0207677_100909401 | 568 |
| 760 | 3300026035 | Ga0207703_10010303 | Ga0207703_100103034 | 568 |
| 761 | 3300026078 | Ga0207702_10001923 | Ga0207702_100019239 | 568 |
| 762 | 3300028786 | Ga0307517_10002048 | Ga0307517_1000204815 | 568 |
| 763 | 3300028800 | Ga0265338_10009598 | Ga0265338_100095983 | 568 |
| 764 | 3300028800 | Ga0265338_10023109 | Ga0265338_100231093 | 568 |
| 765 | 3300028800 | Ga0265338_10025148 | Ga0265338_100251485 | 568 |
| 766 | 3300031241 | Ga0265325_10035530 | Ga0265325_100355302 | 568 |
| 767 | 3300031711 | Ga0265314_10000503 | Ga0265314_1000050310 | 568 |
| 768 | 3300031712 | Ga0265342_10028130 | Ga0265342_100281302 | 568 |
| 769 | 3300031730 | Ga0307516_10001770 | Ga0307516_1000177028 | 568 |
| 770 | 3300035113 | Ga0373936_0001015 | Ga0373936_0001015_2542_4257 | 568 |
| 771 | 3300035116 | Ga0373945_0003061 | Ga0373945_0003061_3056_4771 | 568 |
| 772 | 3300035118 | Ga0373954_0005212 | Ga0373954_0005212_3851_5569 | 568 |
| 773 | 3300035120 | Ga0373957_0007832 | Ga0373957_0007832_77_1792 | 568 |
| 774 | 3300035170 | Ga0373943_0000669 | Ga0373943_0000669_7362_9077 | 568 |
| 775 | 3300035171 | Ga0373946_0013112 | Ga0373946_0013112_955_2670 | 568 |
| 776 | 3300035172 | Ga0373955_0000118 | Ga0373955_0000118_17786_19504 | 568 |
| 777 | 3300035692 | Ga0373935_0011104 | Ga0373935_0011104_82_1797 | 568 |
| 778 | 3300035692 | Ga0373935_0024658 | Ga0373935_0024658_1928_3643 | 568 |
| 779 | 3300035724 | Ga0373933_0000658 | Ga0373933_0000658_817_2535 | 568 |
| 780 | 3300035724 | Ga0373933_0003016 | Ga0373933_0003016_6262_7977 | 568 |
| 781 | 3300035725 | Ga0373947_0001632 | Ga0373947_0001632_8592_10307 | 568 |
| 782 | 3300036401 | Ga0373937_0000440 | Ga0373937_0000440_3497_5215 | 568 |
| 783 | 3300036401 | Ga0373937_0005357 | Ga0373937_0005357_1183_2898 | 568 |
| 784 | 3300036401 | Ga0373937_0010310 | Ga0373937_0010310_217_1926 | 568 |
| 785 | 3300037068 | Ga0373925_0002387 | Ga0373925_0002387_7237_8952 | 568 |
| 786 | 3300037068 | Ga0373925_0041873 | Ga0373925_0041873_606_2321 | 568 |
| 787 | 3300044658 | Ga0466972_0000051 | Ga0466972_0000051_25714_27423 | 568 |
| 788 | 3300044658 | Ga0466972_0016077 | Ga0466972_0016077_461_2176 | 568 |
| 789 | 3300044765 | Ga0466970_0056253 | Ga0466970_0056253_149_1858 | 568 |
| 790 | 3300046459 | Ga0495629_0037018 | Ga0495629_0037018_641_2356 | 568 |
| 791 | 3300046472 | Ga0495580_0001774 | Ga0495580_0001774_2673_4388 | 568 |
| 792 | 3300046472 | Ga0495580_0004783 | Ga0495580_0004783_1340_3055 | 568 |
| 793 | 3300046472 | Ga0495580_0008629 | Ga0495580_0008629_4339_6054 | 568 |
| 794 | 3300046472 | Ga0495580_0069235 | Ga0495580_0069235_447_2162 | 568 |
| 795 | 3300046473 | Ga0495582_0034864 | Ga0495582_0034864_551_2266 | 568 |
| 796 | 3300046531 | Ga0495665_0026539 | Ga0495665_0026539_466_2181 | 568 |
| 797 | 3300046543 | Ga0495645_0043951 | Ga0495645_0043951_154_1869 | 568 |
| 798 | 3300046679 | Ga0495623_0003238 | Ga0495623_0003238_3136_4854 | 568 |
| 799 | 3300046683 | Ga0495658_0087543 | Ga0495658_0087543_60_1775 | 568 |
| 800 | 3300046689 | Ga0495613_0043426 | Ga0495613_0043426_1114_2829 | 568 |
| 801 | 3300046690 | Ga0495624_0081444 | Ga0495624_0081444_142_1857 | 568 |
| 802 | 3300047317 | Ga0495604_0002515 | Ga0495604_0002515_2831_4549 | 568 |
| 803 | 3300047319 | Ga0495674_0042305 | Ga0495674_0042305_507_2222 | 568 |
| 804 | 3300048088 | Ga0495602_0029691 | Ga0495602_0029691_3373_5091 | 568 |
| 805 | 3300048905 | Ga0496102_0103176 | Ga0496102_0103176_139_1854 | 568 |
| 806 | 3300048907 | Ga0496104_0079247 | Ga0496104_0079247_681_2396 | 568 |
| 807 | 3300048910 | Ga0496107_0060605 | Ga0496107_0060605_245_1960 | 568 |
| 808 | 3300048911 | Ga0496108_0032985 | Ga0496108_0032985_2552_4267 | 568 |
| 809 | 3300048915 | Ga0496112_0101172 | Ga0496112_0101172_444_2159 | 568 |
| 810 | 3300048918 | Ga0496115_0016796 | Ga0496115_0016796_3625_5340 | 568 |
| 811 | 3300049588 | Ga0501072_0041045 | Ga0501072_0041045_1221_2936 | 568 |
| 812 | 3300049744 | Ga0501083_0020789 | Ga0501083_0020789_547_2262 | 568 |
| 813 | 3300050512 | nmdc:mga0n895_25131_c1 | nmdc:mga0n895_25131_c1_3088_4803 | 568 |
| 814 | 3300050513 | nmdc:mga0rr50_11309_c1 | nmdc:mga0rr50_11309_c1_609_2324 | 568 |
| 815 | iso_pu_bacteria | 2510917022 | 2511131859 | 568 |
| 816 | iso_pu_bacteria | 2512047086 | 2512528781 | 568 |
| 817 | iso_pu_bacteria | 2512875026 | 2512969590 | 568 |
| 818 | iso_pu_bacteria | 2513237089 | 2513606186 | 568 |
| 819 | iso_pu_bacteria | 2513237146 | 2513928180 | 568 |
| 820 | iso_pu_bacteria | 2513237156 | 2513985105 | 568 |
| 821 | iso_pu_bacteria | 2513237160 | 2514007901 | 568 |
| 822 | iso_pu_bacteria | 2517487022 | 2517565532 | 568 |
| 823 | iso_pu_bacteria | 2524023209 | 2524458929 | 568 |
| 824 | iso_pu_bacteria | 2582581299 | 2585228598 | 568 |
| 825 | iso_pu_bacteria | 2582581307 | 2585271420 | 568 |
| 826 | iso_pu_bacteria | 2582581308 | 2585279357 | 568 |
| 827 | iso_pu_bacteria | 2582581315 | 2585323037 | 568 |
| 828 | iso_pu_bacteria | 2582581316 | 2585331151 | 568 |
| 829 | iso_pu_bacteria | 2585427527 | 2585531158 | 568 |
| 830 | iso_pu_bacteria | 2585427530 | 2585552918 | 568 |
| 831 | iso_pu_bacteria | 2585427531 | 2585559163 | 568 |
| 832 | iso_pu_bacteria | 2585427608 | 2585898545 | 568 |
| 833 | iso_pu_bacteria | 2585427609 | 2585903891 | 568 |
| 834 | iso_pu_bacteria | 2585428125 | 2587980991 | 568 |
| 835 | iso_pu_bacteria | 2599185170 | 2599416930 | 568 |
| 836 | iso_pu_bacteria | 2599185352 | 2600194907 | 568 |
| 837 | iso_pu_bacteria | 2615840626 | 2616311100 | 568 |
| 838 | iso_pu_bacteria | 2615840698 | 2616554539 | 568 |
| 839 | iso_pu_bacteria | 2617270742 | 2617385399 | 568 |
| 840 | iso_pu_bacteria | 2643221557 | 2643804134 | 568 |
| 841 | iso_pu_bacteria | 2643221610 | 2644065089 | 568 |
| 842 | iso_pu_bacteria | 2643221634 | 2644191743 | 568 |
| 843 | iso_pu_bacteria | 2643221634 | 2644196301 | 568 |
| 844 | iso_pu_bacteria | 2643221668 | 2644376499 | 568 |
| 845 | iso_pu_bacteria | 2643221675 | 2644416762 | 568 |
| 846 | iso_pu_bacteria | 2643221680 | 2644449802 | 568 |
| 847 | iso_pu_bacteria | 2643221688 | 2644494254 | 568 |
| 848 | iso_pu_bacteria | 2643221723 | 2644675762 | 568 |
| 849 | iso_pu_bacteria | 2643221726 | 2644689934 | 568 |
| 850 | iso_pu_bacteria | 2667528174 | 2671111144 | 568 |
| 851 | iso_pu_bacteria | 2693429784 | 2694639704 | 568 |
| 852 | iso_pu_bacteria | 2775507266 | 2778175716 | 568 |
| 853 | iso_pu_bacteria | 2791355091 | 2792620534 | 568 |
| 854 | iso_pu_bacteria | 2791355092 | 2792625892 | 568 |
| 855 | iso_pu_bacteria | 2791355253 | 2793280054 | 568 |
| 856 | iso_pu_bacteria | 2802428858 | 2802716020 | 568 |
| 857 | iso_pu_bacteria | 2802428859 | 2802722956 | 568 |
| 858 | iso_pu_bacteria | 2802428860 | 2802728913 | 568 |
| 859 | iso_pu_bacteria | 2802428861 | 2802735278 | 568 |
| 860 | iso_pu_bacteria | 2802428862 | 2802742118 | 568 |
| 861 | iso_pu_bacteria | 2802428863 | 2802748565 | 568 |
| 862 | iso_pu_bacteria | 2818991448 | 2819609426 | 568 |
| 863 | iso_pu_bacteria | 2818991453 | 2819641263 | 568 |
| 864 | iso_pu_bacteria | 2838029111 | 2838033309 | 568 |
| 865 | iso_pu_bacteria | 2838035591 | 2838041741 | 568 |
| 866 | iso_pu_bacteria | 2838661181 | 2838661285 | 568 |
| 867 | iso_pu_bacteria | 2842298080 | 2842298281 | 568 |
| 868 | iso_pu_bacteria | 2842357229 | 2842360119 | 568 |
| 869 | iso_pu_bacteria | 2842475841 | 2842480026 | 568 |
| 870 | iso_pu_bacteria | 2842482326 | 2842483784 | 568 |
| 871 | iso_pu_bacteria | 2842502639 | 2842505189 | 568 |
| 872 | iso_pu_bacteria | 2842509118 | 2842514201 | 568 |
| 873 | iso_pu_bacteria | 2852387548 | 2852390565 | 568 |
| 874 | iso_pu_bacteria | 2888350351 | 2888351003 | 568 |
| 875 | iso_pu_bacteria | 2889010040 | 2889013389 | 568 |
| 876 | iso_pu_bacteria | 2889016732 | 2889021892 | 568 |
| 877 | iso_pu_bacteria | 2915980308 | 2915983685 | 568 |
| 878 | iso_pu_bacteria | 2916061851 | 2916068322 | 568 |
| 879 | iso_pu_bacteria | 2917554339 | 2917558062 | 568 |
| 880 | iso_pu_bacteria | 2919408235 | 2919410290 | 568 |
| 881 | iso_pu_bacteria | 2920822456 | 2920825546 | 568 |
| 882 | iso_pu_bacteria | 2921250672 | 2921256924 | 568 |
| 883 | iso_pu_bacteria | 2937029754 | 2937035037 | 568 |
| 884 | iso_pu_bacteria | 2937036028 | 2937039269 | 568 |
| 885 | iso_pu_bacteria | 2937078374 | 2937084319 | 568 |
| 886 | iso_pu_bacteria | 2937084907 | 2937090721 | 568 |
| 887 | iso_pu_bacteria | 2938014810 | 2938018202 | 568 |
| 888 | iso_pu_bacteria | 2939669807 | 2939673027 | 568 |
| 889 | iso_pu_bacteria | 2957375807 | 2957381013 | 568 |
| 890 | iso_pu_bacteria | 2957437181 | 2957441145 | 568 |
| 891 | iso_pu_bacteria | 2958100919 | 2958101111 | 568 |
| 892 | iso_pu_bacteria | 2958172287 | 2958173178 | 568 |
| 893 | iso_pu_bacteria | 2960591022 | 2960596739 | 568 |
| 894 | iso_pu_bacteria | 2960631154 | 2960634405 | 568 |
| 895 | iso_pu_bacteria | 2960680706 | 2960683367 | 568 |
| 896 | iso_pu_bacteria | 2960693952 | 2960695218 | 568 |
| 897 | iso_pu_bacteria | 2967686174 | 2967687940 | 568 |
| 898 | iso_pu_bacteria | 2967728569 | 2967732716 | 568 |
| 899 | iso_pu_bacteria | 2970026789 | 2970028861 | 568 |
| 900 | iso_pu_bacteria | 2970122695 | 2970126642 | 568 |
| 901 | iso_pu_bacteria | 2970143518 | 2970148398 | 568 |
| 902 | iso_pu_bacteria | 2977530762 | 2977532679 | 568 |
| 903 | iso_pu_bacteria | 2977544691 | 2977547953 | 568 |
| 904 | iso_pu_bacteria | 2977971508 | 2977975222 | 568 |
| 905 | iso_pu_bacteria | 2987652177 | 2987652542 | 568 |
| 906 | iso_pu_bacteria | 3005416602 | 3005418889 | 568 |
| 907 | iso_pu_bacteria | 8003999396 | 8004004009 | 568 |
| 908 | iso_pu_bacteria | 8005314921 | 8005318219 | 568 |
| 909 | iso_pu_bacteria | 8005484373 | 8005488903 | 568 |
| 910 | iso_pu_bacteria | 8005645114 | 8005645987 | 568 |
| 911 | iso_pu_bacteria | 8005682033 | 8005682594 | 568 |
| 912 | iso_pu_bacteria | 8046767195 | 8046770536 | 568 |
| 913 | iso_pu_bacteria | 8057575449 | 8057576664 | 568 |
| 914 | 3300002737 | JGI25162J39368_1003823 | JGI25162J39368_10038233 | 569 |
| 915 | 3300002738 | JGI25154J39366_1000080 | JGI25154J39366_100008027 | 569 |
| 916 | 3300003215 | JGI25153J46596_10002621 | JGI25153J46596_100026216 | 569 |
| 917 | 3300003323 | rootH1_10001237 | rootH1_100012376 | 569 |
| 918 | 3300003354 | JGI25160J50197_1002128 | JGI25160J50197_10021285 | 569 |
| 919 | 3300003354 | JGI25160J50197_1005585 | JGI25160J50197_10055854 | 569 |
| 920 | 3300003790 | Ga0055528_1000246 | Ga0055528_100024614 | 569 |
| 921 | 3300003791 | Ga0055530_10003361 | Ga0055530_100033612 | 569 |
| 922 | 3300003791 | Ga0055530_10013503 | Ga0055530_100135033 | 569 |
| 923 | 3300003794 | Ga0055531_10000048 | Ga0055531_1000004899 | 569 |
| 924 | 3300004625 | Ga0055543_1009724 | Ga0055543_10097241 | 569 |
| 925 | 3300005262 | Ga0065165_1000124 | Ga0065165_100012463 | 569 |
| 926 | 3300005327 | Ga0070658_10000053 | Ga0070658_10000053106 | 569 |
| 927 | 3300005328 | Ga0070676_10000108 | Ga0070676_1000010820 | 569 |
| 928 | 3300005334 | Ga0068869_100090464 | Ga0068869_1000904641 | 569 |
| 929 | 3300005356 | Ga0070674_100003032 | Ga0070674_1000030322 | 569 |
| 930 | 3300005456 | Ga0070678_100064235 | Ga0070678_1000642352 | 569 |
| 931 | 3300005535 | Ga0070684_100000495 | Ga0070684_10000049515 | 569 |
| 932 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001693 | 569 |
| 933 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008911 | 569 |
| 934 | 3300005577 | Ga0068857_100000416 | Ga0068857_1000004166 | 569 |
| 935 | 3300005578 | Ga0068854_100023625 | Ga0068854_1000236252 | 569 |
| 936 | 3300005616 | Ga0068852_100052610 | Ga0068852_1000526102 | 569 |
| 937 | 3300005618 | Ga0068864_100171718 | Ga0068864_1001717181 | 569 |
| 938 | 3300005843 | Ga0068860_100000046 | Ga0068860_1000000468 | 569 |
| 939 | 3300005843 | Ga0068860_100029570 | Ga0068860_1000295705 | 569 |
| 940 | 3300005843 | Ga0068860_100080415 | Ga0068860_1000804152 | 569 |
| 941 | 3300006195 | Ga0075366_10020007 | Ga0075366_100200073 | 569 |
| 942 | 3300006237 | Ga0097621_100060361 | Ga0097621_1000603612 | 569 |
| 943 | 3300006881 | Ga0068865_100013022 | Ga0068865_1000130222 | 569 |
| 944 | 3300009093 | Ga0105240_10000039 | Ga0105240_1000003959 | 569 |
| 945 | 3300009093 | Ga0105240_10000074 | Ga0105240_10000074113 | 569 |
| 946 | 3300009093 | Ga0105240_10002663 | Ga0105240_1000266318 | 569 |
| 947 | 3300009093 | Ga0105240_10032969 | Ga0105240_100329694 | 569 |
| 948 | 3300009093 | Ga0105240_10175292 | Ga0105240_101752922 | 569 |
| 949 | 3300009094 | Ga0111539_10073997 | Ga0111539_100739973 | 569 |
| 950 | 3300009174 | Ga0105241_10003032 | Ga0105241_100030327 | 569 |
| 951 | 3300009545 | Ga0105237_10001565 | Ga0105237_1000156517 | 569 |
| 952 | 3300009545 | Ga0105237_10003907 | Ga0105237_100039071 | 569 |
| 953 | 3300009545 | Ga0105237_10011674 | Ga0105237_100116743 | 569 |
| 954 | 3300009545 | Ga0105237_10035862 | Ga0105237_100358622 | 569 |
| 955 | 3300009545 | Ga0105237_10091556 | Ga0105237_100915563 | 569 |
| 956 | 3300009551 | Ga0105238_10004027 | Ga0105238_100040272 | 569 |
| 957 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004870 | 569 |
| 958 | 3300013102 | Ga0157371_10014715 | Ga0157371_100147152 | 569 |
| 959 | 3300013104 | Ga0157370_10006375 | Ga0157370_1000637512 | 569 |
| 960 | 3300013306 | Ga0163162_10005992 | Ga0163162_100059929 | 569 |
| 961 | 3300013307 | Ga0157372_10004228 | Ga0157372_100042289 | 569 |
| 962 | 3300013307 | Ga0157372_10067054 | Ga0157372_100670542 | 569 |
| 963 | 3300013307 | Ga0157372_10086797 | Ga0157372_100867972 | 569 |
| 964 | 3300014969 | Ga0157376_10000721 | Ga0157376_1000072115 | 569 |
| 965 | 3300025246 | Ga0209646_1000091 | Ga0209646_100009140 | 569 |
| 966 | 3300025250 | Ga0209026_1000497 | Ga0209026_10004973 | 569 |
| 967 | 3300025273 | Ga0209673_1000014 | Ga0209673_1000014144 | 569 |
| 968 | 3300025273 | Ga0209673_1000018 | Ga0209673_100001892 | 569 |
| 969 | 3300025297 | Ga0209758_1003127 | Ga0209758_10031275 | 569 |
| 970 | 3300025298 | Ga0209050_1000177 | Ga0209050_100017770 | 569 |
| 971 | 3300025298 | Ga0209050_1003437 | Ga0209050_10034376 | 569 |
| 972 | 3300025302 | Ga0207426_1000251 | Ga0207426_100025115 | 569 |
| 973 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071402 | 569 |
| 974 | 3300025907 | Ga0207645_10002051 | Ga0207645_100020517 | 569 |
| 975 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071227 | 569 |
| 976 | 3300025913 | Ga0207695_10002490 | Ga0207695_1000249013 | 569 |
| 977 | 3300025913 | Ga0207695_10160233 | Ga0207695_101602331 | 569 |
| 978 | 3300025914 | Ga0207671_10001497 | Ga0207671_1000149712 | 569 |
| 979 | 3300025914 | Ga0207671_10003026 | Ga0207671_1000302612 | 569 |
| 980 | 3300025914 | Ga0207671_10025759 | Ga0207671_100257592 | 569 |
| 981 | 3300025914 | Ga0207671_10058017 | Ga0207671_100580172 | 569 |
| 982 | 3300025914 | Ga0207671_10062741 | Ga0207671_100627412 | 569 |
| 983 | 3300025919 | Ga0207657_10034826 | Ga0207657_100348263 | 569 |
| 984 | 3300025924 | Ga0207694_10002468 | Ga0207694_100024687 | 569 |
| 985 | 3300025924 | Ga0207694_10048422 | Ga0207694_100484223 | 569 |
| 986 | 3300025926 | Ga0207659_10069542 | Ga0207659_100695422 | 569 |
| 987 | 3300025937 | Ga0207669_10036801 | Ga0207669_100368012 | 569 |
| 988 | 3300025940 | Ga0207691_10010941 | Ga0207691_100109413 | 569 |
| 989 | 3300025940 | Ga0207691_10030613 | Ga0207691_100306132 | 569 |
| 990 | 3300025942 | Ga0207689_10005369 | Ga0207689_100053698 | 569 |
| 991 | 3300025942 | Ga0207689_10065241 | Ga0207689_100652412 | 569 |
| 992 | 3300025949 | Ga0207667_10000135 | Ga0207667_1000013514 | 569 |
| 993 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017726 | 569 |
| 994 | 3300025949 | Ga0207667_10015326 | Ga0207667_100153263 | 569 |
| 995 | 3300026089 | Ga0207648_10015625 | Ga0207648_100156255 | 569 |
| 996 | 3300026089 | Ga0207648_10032020 | Ga0207648_100320202 | 569 |
| 997 | 3300026118 | Ga0207675_100001526 | Ga0207675_10000152612 | 569 |
| 998 | 3300026118 | Ga0207675_100159215 | Ga0207675_1001592152 | 569 |
| 999 | 3300026121 | Ga0207683_10002413 | Ga0207683_100024138 | 569 |
| 1000 | 3300026142 | Ga0207698_10025890 | Ga0207698_100258901 | 569 |
| 1001 | 3300026142 | Ga0207698_10038399 | Ga0207698_100383992 | 569 |
| 1002 | 3300028379 | Ga0268266_10000049 | Ga0268266_1000004954 | 569 |
| 1003 | 3300028379 | Ga0268266_10045180 | Ga0268266_100451802 | 569 |
| 1004 | 3300028381 | Ga0268264_10000041 | Ga0268264_10000041319 | 569 |
| 1005 | 3300028381 | Ga0268264_10022094 | Ga0268264_100220942 | 569 |
| 1006 | 3300031730 | Ga0307516_10019622 | Ga0307516_100196223 | 569 |
| 1007 | 3300033180 | Ga0307510_10000091 | Ga0307510_1000009138 | 569 |
| 1008 | 3300042876 | Ga0451577_0005641 | Ga0451577_0005641_7625_9337 | 569 |
| 1009 | 3300044658 | Ga0466972_0002650 | Ga0466972_0002650_1723_3441 | 569 |
| 1010 | 3300044712 | Ga0453684_0000841 | Ga0453684_0000841_49309_51021 | 569 |
| 1011 | 3300045049 | Ga0466959_0043416 | Ga0466959_0043416_407_2122 | 569 |
| 1012 | 3300045051 | Ga0451576_0007420 | Ga0451576_0007420_1935_3647 | 569 |
| 1013 | 3300046460 | Ga0495638_0000004 | Ga0495638_0000004_18851_20563 | 569 |
| 1014 | 3300046492 | Ga0495585_0001026 | Ga0495585_0001026_3724_5439 | 569 |
| 1015 | 3300046507 | Ga0495606_0002804 | Ga0495606_0002804_5081_6799 | 569 |
| 1016 | 3300046524 | Ga0495648_0004838 | Ga0495648_0004838_5422_7140 | 569 |
| 1017 | 3300046557 | Ga0495622_0014803 | Ga0495622_0014803_190_1905 | 569 |
| 1018 | 3300046616 | Ga0495668_0000179 | Ga0495668_0000179_45260_46975 | 569 |
| 1019 | 3300046648 | Ga0495611_0000844 | Ga0495611_0000844_2099_3817 | 569 |
| 1020 | 3300046660 | Ga0495625_0001614 | Ga0495625_0001614_14514_16229 | 569 |
| 1021 | 3300046660 | Ga0495625_0061513 | Ga0495625_0061513_13_1728 | 569 |
| 1022 | 3300046683 | Ga0495658_0061016 | Ga0495658_0061016_99_1814 | 569 |
| 1023 | 3300046694 | Ga0495649_0053860 | Ga0495649_0053860_72_1790 | 569 |
| 1024 | 3300047320 | Ga0495672_0009330 | Ga0495672_0009330_1001_2716 | 569 |
| 1025 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_369216_370934 | 569 |
| 1026 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_403816_405534 | 569 |
| 1027 | 3300047472 | Ga0495686_0023882 | Ga0495686_0023882_395_2110 | 569 |
| 1028 | 3300049523 | Ga0501300_001090 | Ga0501300_001090_1462_3249 | 569 |
| 1029 | 3300049570 | Ga0501033_0003857 | Ga0501033_0003857_7291_9009 | 569 |
| 1030 | 3300049572 | Ga0501036_0002308 | Ga0501036_0002308_5870_7588 | 569 |
| 1031 | 3300049573 | Ga0501037_0003677 | Ga0501037_0003677_2875_4593 | 569 |
| 1032 | 3300049574 | Ga0501038_0001672 | Ga0501038_0001672_18479_20197 | 569 |
| 1033 | 3300049575 | Ga0501039_0003220 | Ga0501039_0003220_3054_4772 | 569 |
| 1034 | 3300049576 | Ga0501040_0001734 | Ga0501040_0001734_7417_9135 | 569 |
| 1035 | 3300049577 | Ga0501041_0000591 | Ga0501041_0000591_7311_9029 | 569 |
| 1036 | 3300049579 | Ga0501043_0003719 | Ga0501043_0003719_5041_6759 | 569 |
| 1037 | 3300049580 | Ga0501046_0000247 | Ga0501046_0000247_42322_44040 | 569 |
| 1038 | 3300049582 | Ga0501048_0000787 | Ga0501048_0000787_7278_8996 | 569 |
| 1039 | 3300049584 | Ga0501068_0007617 | Ga0501068_0007617_3927_5645 | 569 |
| 1040 | 3300049586 | Ga0501070_0004418 | Ga0501070_0004418_3289_5007 | 569 |
| 1041 | 3300049587 | Ga0501071_0012893 | Ga0501071_0012893_1061_2779 | 569 |
| 1042 | 3300049588 | Ga0501072_0003004 | Ga0501072_0003004_3616_5334 | 569 |
| 1043 | 3300049591 | Ga0501075_0000564 | Ga0501075_0000564_7384_9102 | 569 |
| 1044 | 3300049592 | Ga0501076_0003134 | Ga0501076_0003134_1611_3329 | 569 |
| 1045 | 3300049593 | Ga0501077_0001149 | Ga0501077_0001149_1670_3388 | 569 |
| 1046 | 3300049686 | Ga0501257_003399 | Ga0501257_003399_1525_3237 | 569 |
| 1047 | 3300049741 | Ga0501079_0000889 | Ga0501079_0000889_11396_13114 | 569 |
| 1048 | 3300049742 | Ga0501080_0009919 | Ga0501080_0009919_58_1776 | 569 |
| 1049 | 3300049743 | Ga0501081_0000241 | Ga0501081_0000241_13657_15375 | 569 |
| 1050 | 3300049761 | Ga0501264_000010 | Ga0501264_000010_10022_11734 | 569 |
| 1051 | 3300049822 | Ga0501035_0022127 | Ga0501035_0022127_2907_4625 | 569 |
| 1052 | 3300049823 | Ga0501044_0057472 | Ga0501044_0057472_1130_2845 | 569 |
| 1053 | 3300049823 | Ga0501044_0125062 | Ga0501044_0125062_185_1903 | 569 |
| 1054 | 3300049824 | Ga0501045_0000347 | Ga0501045_0000347_7203_8921 | 569 |
| 1055 | 3300049824 | Ga0501045_0019579 | Ga0501045_0019579_675_2408 | 569 |
| 1056 | 3300053130 | Ga0500642_0016020 | Ga0500642_0016020_935_2653 | 569 |
| 1057 | 3300053139 | Ga0500568_0000880 | Ga0500568_0000880_3434_5149 | 569 |
| 1058 | 3300053139 | Ga0500568_0007674 | Ga0500568_0007674_2674_4392 | 569 |
| 1059 | 3300053153 | Ga0500616_0000091 | Ga0500616_0000091_19089_20801 | 569 |
| 1060 | 3300054114 | Ga0501084_0002318 | Ga0501084_0002318_9089_10807 | 569 |
| 1061 | 3300060353 | Ga0501082_0002017 | Ga0501082_0002017_7819_9537 | 569 |
| 1062 | 3300061734 | Ga0530510_0001017 | Ga0530510_0001017_10704_12422 | 569 |
| 1063 | iso_pu_bacteria | 2509276022 | 2509398256 | 569 |
| 1064 | iso_pu_bacteria | 2643221595 | 2643986310 | 569 |
| 1065 | iso_pu_bacteria | 2643221603 | 2644027219 | 569 |
| 1066 | iso_pu_bacteria | 2643221627 | 2644152542 | 569 |
| 1067 | iso_pu_bacteria | 2643221634 | 2644191977 | 569 |
| 1068 | iso_pu_bacteria | 2842775625 | 2842778572 | 569 |
| 1069 | iso_pu_bacteria | 2856320880 | 2856326357 | 569 |
| 1070 | iso_pu_bacteria | 2869278585 | 2869284019 | 569 |
| 1071 | iso_pu_bacteria | 2874139085 | 2874144638 | 569 |
| 1072 | iso_pu_bacteria | 2878738818 | 2878743987 | 569 |
| 1073 | iso_pu_bacteria | 2888337043 | 2888342072 | 569 |
| 1074 | iso_pu_bacteria | 2924718760 | 2924722172 | 569 |
| 1075 | iso_pu_bacteria | 2924776078 | 2924781904 | 569 |
| 1076 | iso_pu_bacteria | 2937877337 | 2937884767 | 569 |
| 1077 | iso_pu_bacteria | 2937972304 | 2937978040 | 569 |
| 1078 | iso_pu_bacteria | 2958034702 | 2958040408 | 569 |
| 1079 | iso_pu_bacteria | 2958041894 | 2958055256 | 569 |
| 1080 | iso_pu_bacteria | 2958064165 | 2958068253 | 569 |
| 1081 | iso_pu_bacteria | 2958084443 | 2958092076 | 569 |
| 1082 | iso_pu_bacteria | 2958092219 | 2958094368 | 569 |
| 1083 | iso_pu_bacteria | 2968016561 | 2968021966 | 569 |
| 1084 | iso_pu_bacteria | 2970469710 | 2970474556 | 569 |
| 1085 | iso_pu_bacteria | 2970593180 | 2970598631 | 569 |
| 1086 | iso_pu_bacteria | 2996348954 | 2996353965 | 569 |
| 1087 | iso_pu_bacteria | 3004275668 | 3004280633 | 569 |
| 1088 | 3300001989 | JGI24739J22299_10001200 | JGI24739J22299_100012005 | 570 |
| 1089 | 3300003316 | rootH1_10027701 | rootH1_100277011 | 570 |
| 1090 | 3300003316 | rootH1_10078771 | rootH1_100787712 | 570 |
| 1091 | 3300003323 | rootH1_10000759 | rootH1_1000075922 | 570 |
| 1092 | 3300003323 | rootH1_10019846 | rootH1_100198469 | 570 |
| 1093 | 3300003323 | rootH1_10091236 | rootH1_100912364 | 570 |
| 1094 | 3300005335 | Ga0070666_10013814 | Ga0070666_100138143 | 570 |
| 1095 | 3300005354 | Ga0070675_100010177 | Ga0070675_1000101773 | 570 |
| 1096 | 3300005354 | Ga0070675_100061126 | Ga0070675_1000611262 | 570 |
| 1097 | 3300005364 | Ga0070673_100003789 | Ga0070673_1000037897 | 570 |
| 1098 | 3300005535 | Ga0070684_100052722 | Ga0070684_1000527223 | 570 |
| 1099 | 3300005543 | Ga0070672_100001253 | Ga0070672_10000125312 | 570 |
| 1100 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006406 | 570 |
| 1101 | 3300005563 | Ga0068855_100021735 | Ga0068855_1000217354 | 570 |
| 1102 | 3300005563 | Ga0068855_100041594 | Ga0068855_1000415943 | 570 |
| 1103 | 3300005577 | Ga0068857_100035648 | Ga0068857_1000356482 | 570 |
| 1104 | 3300005578 | Ga0068854_100014670 | Ga0068854_1000146703 | 570 |
| 1105 | 3300005616 | Ga0068852_100001067 | Ga0068852_10000106714 | 570 |
| 1106 | 3300005840 | Ga0068870_10025823 | Ga0068870_100258233 | 570 |
| 1107 | 3300005843 | Ga0068860_100000005 | Ga0068860_100000005325 | 570 |
| 1108 | 3300005844 | Ga0068862_100068195 | Ga0068862_1000681953 | 570 |
| 1109 | 3300005937 | Ga0081455_10018606 | Ga0081455_100186062 | 570 |
| 1110 | 3300009093 | Ga0105240_10005669 | Ga0105240_100056698 | 570 |
| 1111 | 3300009093 | Ga0105240_10021984 | Ga0105240_100219845 | 570 |
| 1112 | 3300009545 | Ga0105237_10000555 | Ga0105237_1000055523 | 570 |
| 1113 | 3300009545 | Ga0105237_10025875 | Ga0105237_100258753 | 570 |
| 1114 | 3300009551 | Ga0105238_10009815 | Ga0105238_100098151 | 570 |
| 1115 | 3300010375 | Ga0105239_10000970 | Ga0105239_1000097028 | 570 |
| 1116 | 3300013104 | Ga0157370_10111260 | Ga0157370_101112601 | 570 |
| 1117 | 3300013105 | Ga0157369_10006060 | Ga0157369_100060606 | 570 |
| 1118 | 3300013296 | Ga0157374_10000029 | Ga0157374_10000029105 | 570 |
| 1119 | 3300013306 | Ga0163162_10002485 | Ga0163162_100024859 | 570 |
| 1120 | 3300013306 | Ga0163162_10060993 | Ga0163162_100609933 | 570 |
| 1121 | 3300013307 | Ga0157372_10001117 | Ga0157372_100011172 | 570 |
| 1122 | 3300013308 | Ga0157375_10006449 | Ga0157375_100064494 | 570 |
| 1123 | 3300014326 | Ga0157380_10001777 | Ga0157380_100017778 | 570 |
| 1124 | 3300014969 | Ga0157376_10000288 | Ga0157376_1000028817 | 570 |
| 1125 | 3300025893 | Ga0207682_10005238 | Ga0207682_100052383 | 570 |
| 1126 | 3300025907 | Ga0207645_10080504 | Ga0207645_100805042 | 570 |
| 1127 | 3300025912 | Ga0207707_10128331 | Ga0207707_101283312 | 570 |
| 1128 | 3300025913 | Ga0207695_10064512 | Ga0207695_100645122 | 570 |
| 1129 | 3300025914 | Ga0207671_10012580 | Ga0207671_100125803 | 570 |
| 1130 | 3300025914 | Ga0207671_10021713 | Ga0207671_100217132 | 570 |
| 1131 | 3300025914 | Ga0207671_10136495 | Ga0207671_101364951 | 570 |
| 1132 | 3300025924 | Ga0207694_10150728 | Ga0207694_101507281 | 570 |
| 1133 | 3300025940 | Ga0207691_10001534 | Ga0207691_1000153419 | 570 |
| 1134 | 3300025940 | Ga0207691_10007322 | Ga0207691_100073223 | 570 |
| 1135 | 3300025949 | Ga0207667_10002602 | Ga0207667_100026027 | 570 |
| 1136 | 3300025949 | Ga0207667_10010462 | Ga0207667_100104623 | 570 |
| 1137 | 3300026088 | Ga0207641_10061416 | Ga0207641_100614163 | 570 |
| 1138 | 3300026088 | Ga0207641_10082299 | Ga0207641_100822992 | 570 |
| 1139 | 3300026089 | Ga0207648_10061960 | Ga0207648_100619603 | 570 |
| 1140 | 3300026095 | Ga0207676_10082977 | Ga0207676_100829772 | 570 |
| 1141 | 3300026116 | Ga0207674_10049085 | Ga0207674_100490853 | 570 |
| 1142 | 3300027312 | Ga0209371_1006193 | Ga0209371_10061934 | 570 |
| 1143 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010486 | 570 |
| 1144 | 3300028381 | Ga0268264_10000012 | Ga0268264_10000012306 | 570 |
| 1145 | 3300030500 | Ga0268256_1001478 | Ga0268256_10014783 | 570 |
| 1146 | 3300031456 | Ga0307513_10006796 | Ga0307513_1000679612 | 570 |
| 1147 | 3300031616 | Ga0307508_10091929 | Ga0307508_100919292 | 570 |
| 1148 | 3300035695 | Ga0373927_0067639 | Ga0373927_0067639_426_2147 | 570 |
| 1149 | 3300041404 | Ga0439436_0003081 | Ga0439436_0003081_1363_3084 | 570 |
| 1150 | 3300041512 | Ga0451853_3542700 | Ga0451853_3542700_1961_3682 | 570 |
| 1151 | 3300042007 | Ga0439449_0019743 | Ga0439449_0019743_171_1892 | 570 |
| 1152 | 3300042014 | Ga0439457_004730 | Ga0439457_004730_1523_3244 | 570 |
| 1153 | 3300044658 | Ga0466972_0000066 | Ga0466972_0000066_46674_48392 | 570 |
| 1154 | 3300044842 | Ga0466957_0016708 | Ga0466957_0016708_588_2309 | 570 |
| 1155 | 3300046460 | Ga0495638_0002027 | Ga0495638_0002027_8789_10501 | 570 |
| 1156 | 3300046461 | Ga0495641_0035593 | Ga0495641_0035593_265_1998 | 570 |
| 1157 | 3300046524 | Ga0495648_0005660 | Ga0495648_0005660_5831_7552 | 570 |
| 1158 | 3300047443 | Ga0495687_000009 | Ga0495687_000009_292425_294146 | 570 |
| 1159 | 3300049581 | Ga0501047_0010933 | Ga0501047_0010933_2758_4479 | 570 |
| 1160 | 3300049649 | Ga0501198_001072 | Ga0501198_001072_1452_3170 | 570 |
| 1161 | 3300049651 | Ga0501201_001338 | Ga0501201_001338_162_1880 | 570 |
| 1162 | 3300049669 | Ga0501235_000298 | Ga0501235_000298_6865_8583 | 570 |
| 1163 | 3300049705 | Ga0501225_0002947 | Ga0501225_0002947_2851_4572 | 570 |
| 1164 | 3300049705 | Ga0501225_0003366 | Ga0501225_0003366_243_1961 | 570 |
| 1165 | 3300050493 | nmdc:mga0k408_258_c1 | nmdc:mga0k408_258_c1_8833_10611 | 570 |
| 1166 | 3300053086 | Ga0500578_0000042 | Ga0500578_0000042_55507_57228 | 570 |
| 1167 | 3300053092 | Ga0500583_0000023 | Ga0500583_0000023_66827_68548 | 570 |
| 1168 | 3300053125 | Ga0500618_000574 | Ga0500618_000574_10513_12234 | 570 |
| 1169 | 3300053153 | Ga0500616_0058341 | Ga0500616_0058341_111_1832 | 570 |
| 1170 | iso_pu_bacteria | 2508501050 | 2508727222 | 570 |
| 1171 | iso_pu_bacteria | 2508501114 | 2509077679 | 570 |
| 1172 | iso_pu_bacteria | 2643221577 | 2643896475 | 570 |
| 1173 | iso_pu_bacteria | 2643221685 | 2644478769 | 570 |
| 1174 | iso_pu_bacteria | 2773857925 | 2774871397 | 570 |
| 1175 | iso_pu_bacteria | 2818991457 | 2819660314 | 570 |
| 1176 | iso_pu_bacteria | 2835312727 | 2835313881 | 570 |
| 1177 | iso_pu_bacteria | 2852684882 | 2852689150 | 570 |
| 1178 | iso_pu_bacteria | 2882456835 | 2882460201 | 570 |
| 1179 | iso_pu_bacteria | 2894232714 | 2894233984 | 570 |
| 1180 | iso_pu_bacteria | 2895498888 | 2895499276 | 570 |
| 1181 | iso_pu_bacteria | 2895511927 | 2895512297 | 570 |
| 1182 | iso_pu_bacteria | 2895522137 | 2895522307 | 570 |
| 1183 | iso_pu_bacteria | 2895525241 | 2895527249 | 570 |
| 1184 | iso_pu_bacteria | 2919130084 | 2919130409 | 570 |
| 1185 | iso_pu_bacteria | 2929195423 | 2929198583 | 570 |
| 1186 | iso_pu_bacteria | 2937610967 | 2937613536 | 570 |
| 1187 | iso_pu_bacteria | 3007315729 | 3007318425 | 570 |
| 1188 | iso_pu_bacteria | 8002745576 | 8002747549 | 570 |
| 1189 | iso_pu_bacteria | 8002869464 | 8002870137 | 570 |
| 1190 | iso_pu_bacteria | 8021622325 | 8021624874 | 570 |
| 1191 | iso_pu_bacteria | 8021626552 | 8021627855 | 570 |
| 1192 | iso_pu_bacteria | 8021648035 | 8021651912 | 570 |
| 1193 | 3300005327 | Ga0070658_10025804 | Ga0070658_100258042 | 571 |
| 1194 | 3300005329 | Ga0070683_100038807 | Ga0070683_1000388072 | 571 |
| 1195 | 3300005329 | Ga0070683_100119600 | Ga0070683_1001196002 | 571 |
| 1196 | 3300005331 | Ga0070670_100044896 | Ga0070670_1000448963 | 571 |
| 1197 | 3300005334 | Ga0068869_100030435 | Ga0068869_1000304351 | 571 |
| 1198 | 3300005338 | Ga0068868_100083497 | Ga0068868_1000834972 | 571 |
| 1199 | 3300005339 | Ga0070660_100046674 | Ga0070660_1000466742 | 571 |
| 1200 | 3300005340 | Ga0070689_100127268 | Ga0070689_1001272682 | 571 |
| 1201 | 3300005343 | Ga0070687_100059207 | Ga0070687_1000592071 | 571 |
| 1202 | 3300005355 | Ga0070671_100002043 | Ga0070671_1000020436 | 571 |
| 1203 | 3300005365 | Ga0070688_100046559 | Ga0070688_1000465592 | 571 |
| 1204 | 3300005366 | Ga0070659_100012803 | Ga0070659_1000128032 | 571 |
| 1205 | 3300005367 | Ga0070667_100000008 | Ga0070667_100000008144 | 571 |
| 1206 | 3300005435 | Ga0070714_100107899 | Ga0070714_1001078992 | 571 |
| 1207 | 3300005458 | Ga0070681_10002731 | Ga0070681_1000273112 | 571 |
| 1208 | 3300005458 | Ga0070681_10009647 | Ga0070681_100096477 | 571 |
| 1209 | 3300005458 | Ga0070681_10016790 | Ga0070681_100167902 | 571 |
| 1210 | 3300005530 | Ga0070679_100003313 | Ga0070679_10000331311 | 571 |
| 1211 | 3300005539 | Ga0068853_100002085 | Ga0068853_1000020857 | 571 |
| 1212 | 3300005539 | Ga0068853_100153353 | Ga0068853_1001533532 | 571 |
| 1213 | 3300005543 | Ga0070672_100007962 | Ga0070672_1000079624 | 571 |
| 1214 | 3300005563 | Ga0068855_100013875 | Ga0068855_1000138758 | 571 |
| 1215 | 3300005563 | Ga0068855_100040465 | Ga0068855_1000404652 | 571 |
| 1216 | 3300005563 | Ga0068855_100084487 | Ga0068855_1000844872 | 571 |
| 1217 | 3300005564 | Ga0070664_100016459 | Ga0070664_1000164594 | 571 |
| 1218 | 3300005564 | Ga0070664_100056278 | Ga0070664_1000562782 | 571 |
| 1219 | 3300005577 | Ga0068857_100135902 | Ga0068857_1001359022 | 571 |
| 1220 | 3300005578 | Ga0068854_100024484 | Ga0068854_1000244842 | 571 |
| 1221 | 3300005614 | Ga0068856_100021384 | Ga0068856_1000213845 | 571 |
| 1222 | 3300005616 | Ga0068852_100006577 | Ga0068852_1000065777 | 571 |
| 1223 | 3300005616 | Ga0068852_100033864 | Ga0068852_1000338643 | 571 |
| 1224 | 3300005616 | Ga0068852_100081827 | Ga0068852_1000818272 | 571 |
| 1225 | 3300005719 | Ga0068861_100023914 | Ga0068861_1000239144 | 571 |
| 1226 | 3300005719 | Ga0068861_100091168 | Ga0068861_1000911682 | 571 |
| 1227 | 3300005834 | Ga0068851_10005265 | Ga0068851_100052655 | 571 |
| 1228 | 3300005834 | Ga0068851_10007899 | Ga0068851_100078995 | 571 |
| 1229 | 3300005834 | Ga0068851_10015229 | Ga0068851_100152292 | 571 |
| 1230 | 3300005834 | Ga0068851_10030114 | Ga0068851_100301141 | 571 |
| 1231 | 3300005840 | Ga0068870_10000326 | Ga0068870_1000032613 | 571 |
| 1232 | 3300005841 | Ga0068863_100016366 | Ga0068863_1000163663 | 571 |
| 1233 | 3300005841 | Ga0068863_100181124 | Ga0068863_1001811241 | 571 |
| 1234 | 3300005842 | Ga0068858_100043377 | Ga0068858_1000433775 | 571 |
| 1235 | 3300005843 | Ga0068860_100063495 | Ga0068860_1000634953 | 571 |
| 1236 | 3300005844 | Ga0068862_100118041 | Ga0068862_1001180412 | 571 |
| 1237 | 3300005981 | Ga0081538_10008990 | Ga0081538_100089908 | 571 |
| 1238 | 3300006237 | Ga0097621_100048005 | Ga0097621_1000480052 | 571 |
| 1239 | 3300006237 | Ga0097621_100074801 | Ga0097621_1000748013 | 571 |
| 1240 | 3300007265 | Ga0099794_10061540 | Ga0099794_100615401 | 571 |
| 1241 | 3300009093 | Ga0105240_10000008 | Ga0105240_10000008107 | 571 |
| 1242 | 3300009093 | Ga0105240_10000054 | Ga0105240_1000005433 | 571 |
| 1243 | 3300009545 | Ga0105237_10000248 | Ga0105237_1000024826 | 571 |
| 1244 | 3300009545 | Ga0105237_10024011 | Ga0105237_100240113 | 571 |
| 1245 | 3300009551 | Ga0105238_10024923 | Ga0105238_100249232 | 571 |
| 1246 | 3300009553 | Ga0105249_10016022 | Ga0105249_100160223 | 571 |
| 1247 | 3300010375 | Ga0105239_10000996 | Ga0105239_1000099612 | 571 |
| 1248 | 3300013104 | Ga0157370_10010515 | Ga0157370_100105153 | 571 |
| 1249 | 3300013104 | Ga0157370_10010755 | Ga0157370_100107552 | 571 |
| 1250 | 3300013104 | Ga0157370_10043870 | Ga0157370_100438703 | 571 |
| 1251 | 3300013104 | Ga0157370_10131639 | Ga0157370_101316391 | 571 |
| 1252 | 3300013105 | Ga0157369_10094622 | Ga0157369_100946222 | 571 |
| 1253 | 3300013297 | Ga0157378_10018182 | Ga0157378_100181824 | 571 |
| 1254 | 3300013306 | Ga0163162_10001429 | Ga0163162_100014298 | 571 |
| 1255 | 3300013307 | Ga0157372_10034045 | Ga0157372_100340453 | 571 |
| 1256 | 3300013307 | Ga0157372_10185966 | Ga0157372_101859662 | 571 |
| 1257 | 3300014326 | Ga0157380_10009370 | Ga0157380_100093704 | 571 |
| 1258 | 3300020082 | Ga0206353_10810131 | Ga0206353_108101312 | 571 |
| 1259 | 3300025228 | Ga0209672_102368 | Ga0209672_1023681 | 571 |
| 1260 | 3300025261 | Ga0209233_1002148 | Ga0209233_10021485 | 571 |
| 1261 | 3300025315 | Ga0207697_10004556 | Ga0207697_100045565 | 571 |
| 1262 | 3300025893 | Ga0207682_10002884 | Ga0207682_100028845 | 571 |
| 1263 | 3300025907 | Ga0207645_10001460 | Ga0207645_100014605 | 571 |
| 1264 | 3300025908 | Ga0207643_10000186 | Ga0207643_1000018620 | 571 |
| 1265 | 3300025911 | Ga0207654_10071771 | Ga0207654_100717712 | 571 |
| 1266 | 3300025912 | Ga0207707_10010871 | Ga0207707_100108717 | 571 |
| 1267 | 3300025912 | Ga0207707_10022710 | Ga0207707_100227105 | 571 |
| 1268 | 3300025912 | Ga0207707_10041539 | Ga0207707_100415392 | 571 |
| 1269 | 3300025913 | Ga0207695_10000021 | Ga0207695_10000021295 | 571 |
| 1270 | 3300025913 | Ga0207695_10000043 | Ga0207695_10000043267 | 571 |
| 1271 | 3300025913 | Ga0207695_10006194 | Ga0207695_100061944 | 571 |
| 1272 | 3300025914 | Ga0207671_10000671 | Ga0207671_1000067131 | 571 |
| 1273 | 3300025914 | Ga0207671_10066806 | Ga0207671_100668062 | 571 |
| 1274 | 3300025917 | Ga0207660_10014532 | Ga0207660_100145324 | 571 |
| 1275 | 3300025917 | Ga0207660_10074288 | Ga0207660_100742882 | 571 |
| 1276 | 3300025918 | Ga0207662_10034238 | Ga0207662_100342381 | 571 |
| 1277 | 3300025919 | Ga0207657_10001149 | Ga0207657_1000114921 | 571 |
| 1278 | 3300025921 | Ga0207652_10011118 | Ga0207652_100111186 | 571 |
| 1279 | 3300025925 | Ga0207650_10025705 | Ga0207650_100257053 | 571 |
| 1280 | 3300025926 | Ga0207659_10019606 | Ga0207659_100196063 | 571 |
| 1281 | 3300025931 | Ga0207644_10011258 | Ga0207644_100112585 | 571 |
| 1282 | 3300025931 | Ga0207644_10021070 | Ga0207644_100210703 | 571 |
| 1283 | 3300025936 | Ga0207670_10079073 | Ga0207670_100790731 | 571 |
| 1284 | 3300025940 | Ga0207691_10004954 | Ga0207691_100049547 | 571 |
| 1285 | 3300025942 | Ga0207689_10000409 | Ga0207689_1000040935 | 571 |
| 1286 | 3300025944 | Ga0207661_10101465 | Ga0207661_101014652 | 571 |
| 1287 | 3300025949 | Ga0207667_10026254 | Ga0207667_100262542 | 571 |
| 1288 | 3300025949 | Ga0207667_10039797 | Ga0207667_100397972 | 571 |
| 1289 | 3300025949 | Ga0207667_10116840 | Ga0207667_101168402 | 571 |
| 1290 | 3300025972 | Ga0207668_10111988 | Ga0207668_101119882 | 571 |
| 1291 | 3300025981 | Ga0207640_10023258 | Ga0207640_100232584 | 571 |
| 1292 | 3300025986 | Ga0207658_10000030 | Ga0207658_1000003024 | 571 |
| 1293 | 3300026035 | Ga0207703_10174297 | Ga0207703_101742971 | 571 |
| 1294 | 3300026041 | Ga0207639_10056919 | Ga0207639_100569192 | 571 |
| 1295 | 3300026067 | Ga0207678_10011277 | Ga0207678_100112772 | 571 |
| 1296 | 3300026095 | Ga0207676_10005841 | Ga0207676_100058414 | 571 |
| 1297 | 3300026116 | Ga0207674_10000357 | Ga0207674_1000035757 | 571 |
| 1298 | 3300026118 | Ga0207675_100000872 | Ga0207675_10000087224 | 571 |
| 1299 | 3300026118 | Ga0207675_100080135 | Ga0207675_1000801352 | 571 |
| 1300 | 3300026121 | Ga0207683_10003038 | Ga0207683_1000303810 | 571 |
| 1301 | 3300027876 | Ga0209974_10003272 | Ga0209974_100032721 | 571 |
| 1302 | 3300028379 | Ga0268266_10095979 | Ga0268266_100959792 | 571 |
| 1303 | 3300028556 | Ga0265337_1002039 | Ga0265337_10020394 | 571 |
| 1304 | 3300028563 | Ga0265319_1003800 | Ga0265319_10038002 | 571 |
| 1305 | 3300028573 | Ga0265334_10000665 | Ga0265334_100006656 | 571 |
| 1306 | 3300028577 | Ga0265318_10001512 | Ga0265318_1000151213 | 571 |
| 1307 | 3300028666 | Ga0265336_10000091 | Ga0265336_1000009144 | 571 |
| 1308 | 3300028800 | Ga0265338_10000094 | Ga0265338_1000009449 | 571 |
| 1309 | 3300029957 | Ga0265324_10002737 | Ga0265324_100027376 | 571 |
| 1310 | 3300030760 | Ga0265762_1000015 | Ga0265762_100001511 | 571 |
| 1311 | 3300031235 | Ga0265330_10002898 | Ga0265330_100028987 | 571 |
| 1312 | 3300031247 | Ga0265340_10000777 | Ga0265340_100007779 | 571 |
| 1313 | 3300031344 | Ga0265316_10026826 | Ga0265316_100268262 | 571 |
| 1314 | 3300031731 | Ga0307405_10005296 | Ga0307405_100052965 | 571 |
| 1315 | 3300031852 | Ga0307410_10019486 | Ga0307410_100194863 | 571 |
| 1316 | 3300031852 | Ga0307410_10051036 | Ga0307410_100510362 | 571 |
| 1317 | 3300031901 | Ga0307406_10022045 | Ga0307406_100220454 | 571 |
| 1318 | 3300031995 | Ga0307409_100001880 | Ga0307409_1000018807 | 571 |
| 1319 | 3300032002 | Ga0307416_100050227 | Ga0307416_1000502272 | 571 |
| 1320 | 3300032005 | Ga0307411_10014317 | Ga0307411_100143176 | 571 |
| 1321 | 3300032005 | Ga0307411_10024286 | Ga0307411_100242863 | 571 |
| 1322 | 3300044706 | Ga0466964_0011561 | Ga0466964_0011561_372_2096 | 571 |
| 1323 | 3300046507 | Ga0495606_0006725 | Ga0495606_0006725_3525_5249 | 571 |
| 1324 | 3300046519 | Ga0495632_0010918 | Ga0495632_0010918_2611_4326 | 571 |
| 1325 | 3300046648 | Ga0495611_0000010 | Ga0495611_0000010_31406_33130 | 571 |
| 1326 | 3300046660 | Ga0495625_0034296 | Ga0495625_0034296_661_2376 | 571 |
| 1327 | 3300048903 | Ga0496100_0017401 | Ga0496100_0017401_1700_3424 | 571 |
| 1328 | 3300048905 | Ga0496102_0012401 | Ga0496102_0012401_5538_7262 | 571 |
| 1329 | 3300048909 | Ga0496106_0005704 | Ga0496106_0005704_3944_5668 | 571 |
| 1330 | 3300048910 | Ga0496107_0007566 | Ga0496107_0007566_1191_2915 | 571 |
| 1331 | 3300048911 | Ga0496108_0005837 | Ga0496108_0005837_6498_8222 | 571 |
| 1332 | 3300048912 | Ga0496109_0003008 | Ga0496109_0003008_9184_10908 | 571 |
| 1333 | 3300048913 | Ga0496110_0028692 | Ga0496110_0028692_2714_4438 | 571 |
| 1334 | 3300048917 | Ga0496114_0058004 | Ga0496114_0058004_351_2075 | 571 |
| 1335 | 3300049583 | Ga0501067_0024303 | Ga0501067_0024303_1255_2970 | 571 |
| 1336 | 3300049584 | Ga0501068_0002040 | Ga0501068_0002040_5664_7379 | 571 |
| 1337 | 3300049586 | Ga0501070_0005410 | Ga0501070_0005410_7624_9348 | 571 |
| 1338 | 3300049586 | Ga0501070_0046458 | Ga0501070_0046458_1102_2817 | 571 |
| 1339 | 3300049587 | Ga0501071_0001727 | Ga0501071_0001727_4041_5756 | 571 |
| 1340 | 3300049589 | Ga0501073_0001384 | Ga0501073_0001384_2437_4152 | 571 |
| 1341 | 3300049589 | Ga0501073_0001548 | Ga0501073_0001548_7218_8942 | 571 |
| 1342 | 3300049590 | Ga0501074_0001537 | Ga0501074_0001537_5560_7284 | 571 |
| 1343 | 3300049590 | Ga0501074_0019172 | Ga0501074_0019172_2345_4060 | 571 |
| 1344 | 3300049591 | Ga0501075_0035690 | Ga0501075_0035690_1252_2967 | 571 |
| 1345 | 3300049593 | Ga0501077_0005387 | Ga0501077_0005387_3304_5019 | 571 |
| 1346 | 3300049741 | Ga0501079_0000033 | Ga0501079_0000033_36375_38090 | 571 |
| 1347 | 3300049742 | Ga0501080_0001783 | Ga0501080_0001783_15392_17107 | 571 |
| 1348 | 3300049742 | Ga0501080_0007140 | Ga0501080_0007140_3166_4890 | 571 |
| 1349 | 3300049742 | Ga0501080_0024728 | Ga0501080_0024728_3077_4801 | 571 |
| 1350 | 3300049744 | Ga0501083_0010528 | Ga0501083_0010528_2078_3802 | 571 |
| 1351 | 3300050511 | nmdc:mga08y16_54505_c1 | nmdc:mga08y16_54505_c1_2124_3848 | 571 |
| 1352 | 3300054114 | Ga0501084_0006383 | Ga0501084_0006383_5799_7514 | 571 |
| 1353 | 3300054114 | Ga0501084_0053775 | Ga0501084_0053775_1624_3348 | 571 |
| 1354 | 3300003187 | JGI25151J46595_10001193 | JGI25151J46595_1000119311 | 572 |
| 1355 | 3300003771 | Ga0055526_1000723 | Ga0055526_100072319 | 572 |
| 1356 | 3300003771 | Ga0055526_1010357 | Ga0055526_10103573 | 572 |
| 1357 | 3300003781 | Ga0055536_1000219 | Ga0055536_10002195 | 572 |
| 1358 | 3300003781 | Ga0055536_1003998 | Ga0055536_10039984 | 572 |
| 1359 | 3300003784 | Ga0055534_1001363 | Ga0055534_10013633 | 572 |
| 1360 | 3300005327 | Ga0070658_10021249 | Ga0070658_100212492 | 572 |
| 1361 | 3300005340 | Ga0070689_100068108 | Ga0070689_1000681082 | 572 |
| 1362 | 3300005355 | Ga0070671_100002005 | Ga0070671_10000200510 | 572 |
| 1363 | 3300005366 | Ga0070659_100004754 | Ga0070659_1000047544 | 572 |
| 1364 | 3300005457 | Ga0070662_100002343 | Ga0070662_1000023432 | 572 |
| 1365 | 3300005466 | Ga0070685_10058711 | Ga0070685_100587112 | 572 |
| 1366 | 3300005530 | Ga0070679_100128575 | Ga0070679_1001285752 | 572 |
| 1367 | 3300005543 | Ga0070672_100110485 | Ga0070672_1001104852 | 572 |
| 1368 | 3300005563 | Ga0068855_100159858 | Ga0068855_1001598582 | 572 |
| 1369 | 3300005564 | Ga0070664_100003198 | Ga0070664_1000031983 | 572 |
| 1370 | 3300005577 | Ga0068857_100019687 | Ga0068857_1000196874 | 572 |
| 1371 | 3300005614 | Ga0068856_100003737 | Ga0068856_1000037378 | 572 |
| 1372 | 3300005616 | Ga0068852_100009196 | Ga0068852_1000091964 | 572 |
| 1373 | 3300006880 | Ga0075429_100140889 | Ga0075429_1001408892 | 572 |
| 1374 | 3300006914 | Ga0075436_100016268 | Ga0075436_1000162681 | 572 |
| 1375 | 3300009094 | Ga0111539_10000665 | Ga0111539_1000066515 | 572 |
| 1376 | 3300009094 | Ga0111539_10008255 | Ga0111539_1000825510 | 572 |
| 1377 | 3300009094 | Ga0111539_10023989 | Ga0111539_100239895 | 572 |
| 1378 | 3300009177 | Ga0105248_10156373 | Ga0105248_101563732 | 572 |
| 1379 | 3300013102 | Ga0157371_10000601 | Ga0157371_100006018 | 572 |
| 1380 | 3300013104 | Ga0157370_10007304 | Ga0157370_100073047 | 572 |
| 1381 | 3300014326 | Ga0157380_10011071 | Ga0157380_100110713 | 572 |
| 1382 | 3300025291 | Ga0209675_1000040 | Ga0209675_100004091 | 572 |
| 1383 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014563 | 572 |
| 1384 | 3300025292 | Ga0209676_1000093 | Ga0209676_1000093136 | 572 |
| 1385 | 3300025294 | Ga0209025_1000092 | Ga0209025_100009291 | 572 |
| 1386 | 3300025295 | Ga0209564_1000159 | Ga0209564_100015955 | 572 |
| 1387 | 3300025295 | Ga0209564_1000218 | Ga0209564_10002189 | 572 |
| 1388 | 3300025303 | Ga0209051_1002454 | Ga0209051_10024547 | 572 |
| 1389 | 3300025909 | Ga0207705_10012043 | Ga0207705_100120432 | 572 |
| 1390 | 3300025919 | Ga0207657_10001270 | Ga0207657_1000127018 | 572 |
| 1391 | 3300025919 | Ga0207657_10017091 | Ga0207657_100170916 | 572 |
| 1392 | 3300025926 | Ga0207659_10091043 | Ga0207659_100910432 | 572 |
| 1393 | 3300025931 | Ga0207644_10016472 | Ga0207644_100164722 | 572 |
| 1394 | 3300025931 | Ga0207644_10051140 | Ga0207644_100511402 | 572 |
| 1395 | 3300025933 | Ga0207706_10000877 | Ga0207706_1000087722 | 572 |
| 1396 | 3300025935 | Ga0207709_10042165 | Ga0207709_100421652 | 572 |
| 1397 | 3300025936 | Ga0207670_10005467 | Ga0207670_100054676 | 572 |
| 1398 | 3300025940 | Ga0207691_10015412 | Ga0207691_100154122 | 572 |
| 1399 | 3300025949 | Ga0207667_10007079 | Ga0207667_100070798 | 572 |
| 1400 | 3300025986 | Ga0207658_10117742 | Ga0207658_101177421 | 572 |
| 1401 | 3300026067 | Ga0207678_10120869 | Ga0207678_101208692 | 572 |
| 1402 | 3300026116 | Ga0207674_10009845 | Ga0207674_100098458 | 572 |
| 1403 | 3300026142 | Ga0207698_10008141 | Ga0207698_100081413 | 572 |
| 1404 | 3300027907 | Ga0207428_10059322 | Ga0207428_100593222 | 572 |
| 1405 | 3300031548 | Ga0307408_100000012 | Ga0307408_100000012159 | 572 |
| 1406 | 3300031595 | Ga0265313_10004963 | Ga0265313_100049632 | 572 |
| 1407 | 3300031901 | Ga0307406_10036211 | Ga0307406_100362112 | 572 |
| 1408 | 3300031903 | Ga0307407_10011071 | Ga0307407_100110712 | 572 |
| 1409 | 3300032002 | Ga0307416_100031608 | Ga0307416_1000316084 | 572 |
| 1410 | 3300032002 | Ga0307416_100050165 | Ga0307416_1000501651 | 572 |
| 1411 | 3300035112 | Ga0373932_0000899 | Ga0373932_0000899_4419_6146 | 572 |
| 1412 | 3300035115 | Ga0373941_0001232 | Ga0373941_0001232_2219_3946 | 572 |
| 1413 | 3300035207 | Ga0373942_0004480 | Ga0373942_0004480_379_2106 | 572 |
| 1414 | 3300035691 | Ga0373931_0000240 | Ga0373931_0000240_16858_18585 | 572 |
| 1415 | 3300036712 | Ga0316584_0059153 | Ga0316584_0059153_116_1891 | 572 |
| 1416 | 3300037068 | Ga0373925_0003223 | Ga0373925_0003223_1412_3157 | 572 |
| 1417 | 3300037418 | Ga0395900_0037630 | Ga0395900_0037630_1554_3281 | 572 |
| 1418 | 3300038443 | Ga0395901_0111869 | Ga0395901_0111869_714_2441 | 572 |
| 1419 | 3300039437 | Ga0436365_1141651 | Ga0436365_1141651_519_2246 | 572 |
| 1420 | 3300039450 | Ga0436363_1450588 | Ga0436363_1450588_2948_4675 | 572 |
| 1421 | 3300044658 | Ga0466972_0058382 | Ga0466972_0058382_31_1764 | 572 |
| 1422 | 3300046492 | Ga0495585_0011525 | Ga0495585_0011525_216_1943 | 572 |
| 1423 | 3300046513 | Ga0495616_0003016 | Ga0495616_0003016_625_2343 | 572 |
| 1424 | 3300046543 | Ga0495645_0005153 | Ga0495645_0005153_4433_6160 | 572 |
| 1425 | 3300046679 | Ga0495623_0007552 | Ga0495623_0007552_1580_3307 | 572 |
| 1426 | 3300048909 | Ga0496106_0011577 | Ga0496106_0011577_148_1875 | 572 |
| 1427 | 3300048910 | Ga0496107_0003901 | Ga0496107_0003901_5062_6789 | 572 |
| 1428 | 3300049569 | Ga0501032_0071255 | Ga0501032_0071255_531_2258 | 572 |
| 1429 | 3300049572 | Ga0501036_0023902 | Ga0501036_0023902_2339_4066 | 572 |
| 1430 | 3300049574 | Ga0501038_0000362 | Ga0501038_0000362_18126_19853 | 572 |
| 1431 | 3300049575 | Ga0501039_0005719 | Ga0501039_0005719_3212_4939 | 572 |
| 1432 | 3300049579 | Ga0501043_0007335 | Ga0501043_0007335_3814_5541 | 572 |
| 1433 | 3300049580 | Ga0501046_0001124 | Ga0501046_0001124_8018_9745 | 572 |
| 1434 | 3300049581 | Ga0501047_0059030 | Ga0501047_0059030_657_2384 | 572 |
| 1435 | 3300049581 | Ga0501047_0147768 | Ga0501047_0147768_119_1846 | 572 |
| 1436 | 3300049582 | Ga0501048_0098115 | Ga0501048_0098115_94_1821 | 572 |
| 1437 | 3300049585 | Ga0501069_0002295 | Ga0501069_0002295_5558_7285 | 572 |
| 1438 | 3300049586 | Ga0501070_0001510 | Ga0501070_0001510_5689_7416 | 572 |
| 1439 | 3300049589 | Ga0501073_0001695 | Ga0501073_0001695_10611_12338 | 572 |
| 1440 | 3300049590 | Ga0501074_0004126 | Ga0501074_0004126_3076_4803 | 572 |
| 1441 | 3300049742 | Ga0501080_0000394 | Ga0501080_0000394_15479_17206 | 572 |
| 1442 | 3300049744 | Ga0501083_0052137 | Ga0501083_0052137_657_2384 | 572 |
| 1443 | 3300049823 | Ga0501044_0003662 | Ga0501044_0003662_6896_8623 | 572 |
| 1444 | 3300050508 | nmdc:mga09592_34056_c1 | nmdc:mga09592_34056_c1_1077_2804 | 572 |
| 1445 | 3300050511 | nmdc:mga08y16_6181_c1 | nmdc:mga08y16_6181_c1_864_2591 | 572 |
| 1446 | 3300053077 | Ga0495601_0009477 | Ga0495601_0009477_1647_3374 | 572 |
| 1447 | iso_pu_bacteria | 2939669807 | 2939673028 | 572 |
| 1448 | 3300001990 | JGI24737J22298_10001648 | JGI24737J22298_100016483 | 573 |
| 1449 | 3300003214 | JGI25165J46597_1000641 | JGI25165J46597_100064117 | 573 |
| 1450 | 3300005329 | Ga0070683_100007379 | Ga0070683_10000737913 | 573 |
| 1451 | 3300005331 | Ga0070670_100001436 | Ga0070670_10000143622 | 573 |
| 1452 | 3300005335 | Ga0070666_10031350 | Ga0070666_100313505 | 573 |
| 1453 | 3300005338 | Ga0068868_100000489 | Ga0068868_10000048923 | 573 |
| 1454 | 3300005339 | Ga0070660_100009031 | Ga0070660_1000090312 | 573 |
| 1455 | 3300005343 | Ga0070687_100072953 | Ga0070687_1000729531 | 573 |
| 1456 | 3300005353 | Ga0070669_100019673 | Ga0070669_1000196733 | 573 |
| 1457 | 3300005354 | Ga0070675_100000808 | Ga0070675_10000080816 | 573 |
| 1458 | 3300005355 | Ga0070671_100000766 | Ga0070671_10000076614 | 573 |
| 1459 | 3300005364 | Ga0070673_100000760 | Ga0070673_1000007607 | 573 |
| 1460 | 3300005456 | Ga0070678_100150125 | Ga0070678_1001501251 | 573 |
| 1461 | 3300005539 | Ga0068853_100078638 | Ga0068853_1000786382 | 573 |
| 1462 | 3300005546 | Ga0070696_100004763 | Ga0070696_1000047638 | 573 |
| 1463 | 3300005564 | Ga0070664_100000907 | Ga0070664_10000090718 | 573 |
| 1464 | 3300005578 | Ga0068854_100007413 | Ga0068854_1000074132 | 573 |
| 1465 | 3300005616 | Ga0068852_100001703 | Ga0068852_10000170313 | 573 |
| 1466 | 3300005618 | Ga0068864_100004751 | Ga0068864_10000475111 | 573 |
| 1467 | 3300005719 | Ga0068861_100055358 | Ga0068861_1000553583 | 573 |
| 1468 | 3300005834 | Ga0068851_10005926 | Ga0068851_100059263 | 573 |
| 1469 | 3300005981 | Ga0081538_10007018 | Ga0081538_100070185 | 573 |
| 1470 | 3300006237 | Ga0097621_100002478 | Ga0097621_1000024781 | 573 |
| 1471 | 3300006358 | Ga0068871_100001328 | Ga0068871_10000132814 | 573 |
| 1472 | 3300009551 | Ga0105238_10004448 | Ga0105238_100044485 | 573 |
| 1473 | 3300009551 | Ga0105238_10015237 | Ga0105238_100152375 | 573 |
| 1474 | 3300010375 | Ga0105239_10009015 | Ga0105239_100090155 | 573 |
| 1475 | 3300013296 | Ga0157374_10000833 | Ga0157374_1000083317 | 573 |
| 1476 | 3300013297 | Ga0157378_10003339 | Ga0157378_1000333911 | 573 |
| 1477 | 3300013308 | Ga0157375_10002044 | Ga0157375_100020442 | 573 |
| 1478 | 3300025233 | Ga0209437_100064 | Ga0209437_10006456 | 573 |
| 1479 | 3300025261 | Ga0209233_1000081 | Ga0209233_1000081246 | 573 |
| 1480 | 3300025297 | Ga0209758_1000169 | Ga0209758_100016947 | 573 |
| 1481 | 3300025321 | Ga0207656_10009682 | Ga0207656_100096823 | 573 |
| 1482 | 3300025907 | Ga0207645_10003092 | Ga0207645_100030923 | 573 |
| 1483 | 3300025914 | Ga0207671_10010727 | Ga0207671_100107275 | 573 |
| 1484 | 3300025924 | Ga0207694_10002748 | Ga0207694_100027485 | 573 |
| 1485 | 3300025925 | Ga0207650_10002377 | Ga0207650_1000237713 | 573 |
| 1486 | 3300025926 | Ga0207659_10000451 | Ga0207659_1000045115 | 573 |
| 1487 | 3300025931 | Ga0207644_10037618 | Ga0207644_100376182 | 573 |
| 1488 | 3300025933 | Ga0207706_10146261 | Ga0207706_101462612 | 573 |
| 1489 | 3300025944 | Ga0207661_10011069 | Ga0207661_100110692 | 573 |
| 1490 | 3300025945 | Ga0207679_10001204 | Ga0207679_1000120411 | 573 |
| 1491 | 3300025981 | Ga0207640_10002318 | Ga0207640_1000231813 | 573 |
| 1492 | 3300025986 | Ga0207658_10036460 | Ga0207658_100364602 | 573 |
| 1493 | 3300026023 | Ga0207677_10022413 | Ga0207677_100224132 | 573 |
| 1494 | 3300026095 | Ga0207676_10009328 | Ga0207676_100093283 | 573 |
| 1495 | 3300026118 | Ga0207675_100003993 | Ga0207675_1000039936 | 573 |
| 1496 | 3300026121 | Ga0207683_10001016 | Ga0207683_1000101610 | 573 |
| 1497 | 3300026142 | Ga0207698_10000786 | Ga0207698_1000078610 | 573 |
| 1498 | 3300028577 | Ga0265318_10009367 | Ga0265318_100093673 | 573 |
| 1499 | 3300031250 | Ga0265331_10003629 | Ga0265331_100036294 | 573 |
| 1500 | 3300031250 | Ga0265331_10011722 | Ga0265331_100117225 | 573 |
| 1501 | 3300031456 | Ga0307513_10086444 | Ga0307513_100864443 | 573 |
| 1502 | 3300031507 | Ga0307509_10036387 | Ga0307509_100363873 | 573 |
| 1503 | 3300031595 | Ga0265313_10003442 | Ga0265313_100034428 | 573 |
| 1504 | 3300031711 | Ga0265314_10001520 | Ga0265314_1000152012 | 573 |
| 1505 | 3300031711 | Ga0265314_10052896 | Ga0265314_100528962 | 573 |
| 1506 | 3300031712 | Ga0265342_10021086 | Ga0265342_100210861 | 573 |
| 1507 | 3300036712 | Ga0316584_0005493 | Ga0316584_0005493_4586_6316 | 573 |
| 1508 | 3300037312 | Ga0395899_0001647 | Ga0395899_0001647_6888_8609 | 573 |
| 1509 | 3300037312 | Ga0395899_0005993 | Ga0395899_0005993_7610_9331 | 573 |
| 1510 | 3300039062 | Ga0400483_135128 | Ga0400483_135128_1862_3595 | 573 |
| 1511 | 3300039062 | Ga0400483_140637 | Ga0400483_140637_181_1914 | 573 |
| 1512 | 3300039062 | Ga0400483_161077 | Ga0400483_161077_666_2399 | 573 |
| 1513 | 3300039062 | Ga0400483_254359 | Ga0400483_254359_22784_24517 | 573 |
| 1514 | 3300044765 | Ga0466970_0009896 | Ga0466970_0009896_659_2380 | 573 |
| 1515 | 3300045836 | Ga0466958_0005665 | Ga0466958_0005665_1840_3567 | 573 |
| 1516 | 3300048907 | Ga0496104_0032002 | Ga0496104_0032002_35_1765 | 573 |
| 1517 | 3300048913 | Ga0496110_0005614 | Ga0496110_0005614_1203_2933 | 573 |
| 1518 | 3300048914 | Ga0496111_0002995 | Ga0496111_0002995_6682_8412 | 573 |
| 1519 | 3300048923 | Ga0496120_0004189 | Ga0496120_0004189_9776_11503 | 573 |
| 1520 | 3300048929 | Ga0496126_0090035 | Ga0496126_0090035_428_2155 | 573 |
| 1521 | 3300049569 | Ga0501032_0005396 | Ga0501032_0005396_6594_8327 | 573 |
| 1522 | 3300049571 | Ga0501034_0022923 | Ga0501034_0022923_3994_5727 | 573 |
| 1523 | 3300049574 | Ga0501038_0035578 | Ga0501038_0035578_1456_3189 | 573 |
| 1524 | 3300049574 | Ga0501038_0039102 | Ga0501038_0039102_2041_3771 | 573 |
| 1525 | 3300049575 | Ga0501039_0036966 | Ga0501039_0036966_1929_3659 | 573 |
| 1526 | 3300049577 | Ga0501041_0015839 | Ga0501041_0015839_876_2606 | 573 |
| 1527 | 3300049579 | Ga0501043_0056907 | Ga0501043_0056907_427_2160 | 573 |
| 1528 | 3300049581 | Ga0501047_0007188 | Ga0501047_0007188_7005_8738 | 573 |
| 1529 | 3300049582 | Ga0501048_0080704 | Ga0501048_0080704_460_2187 | 573 |
| 1530 | 3300049585 | Ga0501069_0049721 | Ga0501069_0049721_336_2069 | 573 |
| 1531 | 3300049586 | Ga0501070_0018072 | Ga0501070_0018072_3993_5726 | 573 |
| 1532 | 3300049587 | Ga0501071_0046321 | Ga0501071_0046321_661_2391 | 573 |
| 1533 | 3300049591 | Ga0501075_0014218 | Ga0501075_0014218_292_2022 | 573 |
| 1534 | 3300049592 | Ga0501076_0014132 | Ga0501076_0014132_2538_4268 | 573 |
| 1535 | 3300049744 | Ga0501083_0007984 | Ga0501083_0007984_240_1973 | 573 |
| 1536 | 3300049822 | Ga0501035_0010083 | Ga0501035_0010083_5178_6926 | 573 |
| 1537 | 3300049823 | Ga0501044_0006170 | Ga0501044_0006170_9657_11390 | 573 |
| 1538 | 3300049824 | Ga0501045_0011373 | Ga0501045_0011373_3155_4882 | 573 |
| 1539 | 3300050509 | nmdc:mga0qj67_46927_c1 | nmdc:mga0qj67_46927_c1_769_2499 | 573 |
| 1540 | 3300050515 | nmdc:mga0a205_53348_c1 | nmdc:mga0a205_53348_c1_1152_2885 | 573 |
| 1541 | 3300053092 | Ga0500583_0001035 | Ga0500583_0001035_1683_3413 | 573 |
| 1542 | 3300053092 | Ga0500583_0012576 | Ga0500583_0012576_201_1925 | 573 |
| 1543 | 3300053139 | Ga0500568_0012030 | Ga0500568_0012030_1933_3663 | 573 |
| 1544 | 3300053139 | Ga0500568_0020782 | Ga0500568_0020782_951_2675 | 573 |
| 1545 | 3300053153 | Ga0500616_0000074 | Ga0500616_0000074_86861_88585 | 573 |
| 1546 | 3300053153 | Ga0500616_0000997 | Ga0500616_0000997_19954_21684 | 573 |
| 1547 | 3300059491 | Ga0587070_003293 | Ga0587070_003293_164_1885 | 573 |
| 1548 | 3300059645 | Ga0587076_000108 | Ga0587076_000108_1102_2823 | 573 |
| 1549 | 3300059645 | Ga0587076_000791 | Ga0587076_000791_567_2288 | 573 |
| 1550 | 3300060344 | Ga0587071_000307 | Ga0587071_000307_1484_3205 | 573 |
| 1551 | 3300060346 | Ga0587111_0000129 | Ga0587111_0000129_2926_4647 | 573 |
| 1552 | 3300060346 | Ga0587111_0001272 | Ga0587111_0001272_607_2328 | 573 |
| 1553 | 3300060353 | Ga0501082_0071046 | Ga0501082_0071046_433_2166 | 573 |
| 1554 | iso_pu_bacteria | 2751185897 | 2753763005 | 573 |
| 1555 | 3300001989 | JGI24739J22299_10005441 | JGI24739J22299_100054414 | 574 |
| 1556 | 3300002741 | JGI25157J39369_1000256 | JGI25157J39369_10002569 | 574 |
| 1557 | 3300003187 | JGI25151J46595_10000586 | JGI25151J46595_1000058610 | 574 |
| 1558 | 3300003752 | Ga0055539_1001711 | Ga0055539_10017112 | 574 |
| 1559 | 3300003756 | Ga0055533_1002287 | Ga0055533_10022872 | 574 |
| 1560 | 3300003759 | Ga0055525_1000043 | Ga0055525_100004361 | 574 |
| 1561 | 3300003760 | Ga0055527_1000305 | Ga0055527_100030515 | 574 |
| 1562 | 3300003760 | Ga0055527_1000393 | Ga0055527_100039316 | 574 |
| 1563 | 3300003761 | Ga0055535_1000652 | Ga0055535_100065215 | 574 |
| 1564 | 3300003761 | Ga0055535_1000974 | Ga0055535_10009743 | 574 |
| 1565 | 3300003762 | Ga0055542_1000672 | Ga0055542_100067215 | 574 |
| 1566 | 3300003762 | Ga0055542_1000970 | Ga0055542_10009703 | 574 |
| 1567 | 3300003763 | Ga0055529_1000620 | Ga0055529_100062014 | 574 |
| 1568 | 3300003763 | Ga0055529_1000818 | Ga0055529_10008183 | 574 |
| 1569 | 3300003856 | Ga0058692_1000017 | Ga0058692_1000017185 | 574 |
| 1570 | 3300005262 | Ga0065165_1004243 | Ga0065165_10042433 | 574 |
| 1571 | 3300005289 | Ga0065704_10103010 | Ga0065704_101030102 | 574 |
| 1572 | 3300005330 | Ga0070690_100048350 | Ga0070690_1000483501 | 574 |
| 1573 | 3300005331 | Ga0070670_100097870 | Ga0070670_1000978701 | 574 |
| 1574 | 3300005337 | Ga0070682_100012555 | Ga0070682_1000125554 | 574 |
| 1575 | 3300005434 | Ga0070709_10008330 | Ga0070709_100083306 | 574 |
| 1576 | 3300005435 | Ga0070714_100009506 | Ga0070714_1000095066 | 574 |
| 1577 | 3300005436 | Ga0070713_100010524 | Ga0070713_1000105247 | 574 |
| 1578 | 3300005440 | Ga0070705_100002145 | Ga0070705_1000021457 | 574 |
| 1579 | 3300005455 | Ga0070663_100020181 | Ga0070663_1000201811 | 574 |
| 1580 | 3300005543 | Ga0070672_100001924 | Ga0070672_1000019246 | 574 |
| 1581 | 3300005543 | Ga0070672_100086476 | Ga0070672_1000864762 | 574 |
| 1582 | 3300005547 | Ga0070693_100033350 | Ga0070693_1000333501 | 574 |
| 1583 | 3300005548 | Ga0070665_100002302 | Ga0070665_1000023022 | 574 |
| 1584 | 3300005548 | Ga0070665_100004515 | Ga0070665_1000045155 | 574 |
| 1585 | 3300005549 | Ga0070704_100037227 | Ga0070704_1000372272 | 574 |
| 1586 | 3300005578 | Ga0068854_100001302 | Ga0068854_1000013026 | 574 |
| 1587 | 3300005614 | Ga0068856_100003470 | Ga0068856_1000034702 | 574 |
| 1588 | 3300005617 | Ga0068859_100096264 | Ga0068859_1000962642 | 574 |
| 1589 | 3300005719 | Ga0068861_100003919 | Ga0068861_1000039198 | 574 |
| 1590 | 3300005719 | Ga0068861_100078681 | Ga0068861_1000786812 | 574 |
| 1591 | 3300005834 | Ga0068851_10013951 | Ga0068851_100139511 | 574 |
| 1592 | 3300005840 | Ga0068870_10026543 | Ga0068870_100265432 | 574 |
| 1593 | 3300005841 | Ga0068863_100019561 | Ga0068863_1000195615 | 574 |
| 1594 | 3300005937 | Ga0081455_10015718 | Ga0081455_100157182 | 574 |
| 1595 | 3300005937 | Ga0081455_10038479 | Ga0081455_100384792 | 574 |
| 1596 | 3300006237 | Ga0097621_100011591 | Ga0097621_1000115915 | 574 |
| 1597 | 3300006914 | Ga0075436_100015958 | Ga0075436_1000159583 | 574 |
| 1598 | 3300006931 | Ga0097620_100096265 | Ga0097620_1000962652 | 574 |
| 1599 | 3300009093 | Ga0105240_10001565 | Ga0105240_1000156519 | 574 |
| 1600 | 3300009148 | Ga0105243_10040017 | Ga0105243_100400172 | 574 |
| 1601 | 3300009176 | Ga0105242_10015422 | Ga0105242_100154222 | 574 |
| 1602 | 3300009545 | Ga0105237_10000010 | Ga0105237_10000010161 | 574 |
| 1603 | 3300009551 | Ga0105238_10032996 | Ga0105238_100329965 | 574 |
| 1604 | 3300013105 | Ga0157369_10050582 | Ga0157369_100505824 | 574 |
| 1605 | 3300014326 | Ga0157380_10062053 | Ga0157380_100620532 | 574 |
| 1606 | 3300021361 | Ga0213872_10031734 | Ga0213872_100317341 | 574 |
| 1607 | 3300025226 | Ga0209674_100059 | Ga0209674_100059168 | 574 |
| 1608 | 3300025226 | Ga0209674_100790 | Ga0209674_1007906 | 574 |
| 1609 | 3300025228 | Ga0209672_100004 | Ga0209672_100004706 | 574 |
| 1610 | 3300025228 | Ga0209672_100008 | Ga0209672_100008610 | 574 |
| 1611 | 3300025230 | Ga0209563_100036 | Ga0209563_100036189 | 574 |
| 1612 | 3300025242 | Ga0209258_100003 | Ga0209258_100003706 | 574 |
| 1613 | 3300025242 | Ga0209258_100004 | Ga0209258_100004580 | 574 |
| 1614 | 3300025242 | Ga0209258_100008 | Ga0209258_100008205 | 574 |
| 1615 | 3300025250 | Ga0209026_1000045 | Ga0209026_1000045202 | 574 |
| 1616 | 3300025253 | Ga0209677_101303 | Ga0209677_1013032 | 574 |
| 1617 | 3300025254 | Ga0209148_1000025 | Ga0209148_100002510 | 574 |
| 1618 | 3300025254 | Ga0209148_1000053 | Ga0209148_1000053325 | 574 |
| 1619 | 3300025256 | Ga0209759_1000212 | Ga0209759_100021271 | 574 |
| 1620 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004706 | 574 |
| 1621 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007325 | 574 |
| 1622 | 3300025272 | Ga0209455_1000405 | Ga0209455_10004059 | 574 |
| 1623 | 3300025294 | Ga0209025_1000282 | Ga0209025_100028289 | 574 |
| 1624 | 3300025297 | Ga0209758_1000974 | Ga0209758_100097421 | 574 |
| 1625 | 3300025735 | Ga0207713_1000393 | Ga0207713_100039315 | 574 |
| 1626 | 3300025893 | Ga0207682_10008737 | Ga0207682_100087372 | 574 |
| 1627 | 3300025904 | Ga0207647_10012031 | Ga0207647_100120316 | 574 |
| 1628 | 3300025907 | Ga0207645_10057360 | Ga0207645_100573602 | 574 |
| 1629 | 3300025913 | Ga0207695_10000400 | Ga0207695_1000040049 | 574 |
| 1630 | 3300025914 | Ga0207671_10000013 | Ga0207671_10000013232 | 574 |
| 1631 | 3300025918 | Ga0207662_10050234 | Ga0207662_100502341 | 574 |
| 1632 | 3300025924 | Ga0207694_10015380 | Ga0207694_100153805 | 574 |
| 1633 | 3300025925 | Ga0207650_10011897 | Ga0207650_100118974 | 574 |
| 1634 | 3300025925 | Ga0207650_10026512 | Ga0207650_100265121 | 574 |
| 1635 | 3300025929 | Ga0207664_10003289 | Ga0207664_100032895 | 574 |
| 1636 | 3300025934 | Ga0207686_10030493 | Ga0207686_100304932 | 574 |
| 1637 | 3300025940 | Ga0207691_10013082 | Ga0207691_100130828 | 574 |
| 1638 | 3300025940 | Ga0207691_10015118 | Ga0207691_100151182 | 574 |
| 1639 | 3300025940 | Ga0207691_10039099 | Ga0207691_100390994 | 574 |
| 1640 | 3300025949 | Ga0207667_10000081 | Ga0207667_1000008175 | 574 |
| 1641 | 3300025981 | Ga0207640_10000223 | Ga0207640_1000022328 | 574 |
| 1642 | 3300026035 | Ga0207703_10089463 | Ga0207703_100894633 | 574 |
| 1643 | 3300026067 | Ga0207678_10034046 | Ga0207678_100340462 | 574 |
| 1644 | 3300026075 | Ga0207708_10010414 | Ga0207708_100104142 | 574 |
| 1645 | 3300026078 | Ga0207702_10000654 | Ga0207702_1000065410 | 574 |
| 1646 | 3300026088 | Ga0207641_10046760 | Ga0207641_100467602 | 574 |
| 1647 | 3300026116 | Ga0207674_10000159 | Ga0207674_1000015919 | 574 |
| 1648 | 3300026116 | Ga0207674_10119515 | Ga0207674_101195152 | 574 |
| 1649 | 3300026118 | Ga0207675_100022740 | Ga0207675_1000227405 | 574 |
| 1650 | 3300026118 | Ga0207675_100041926 | Ga0207675_1000419261 | 574 |
| 1651 | 3300027312 | Ga0209371_1000044 | Ga0209371_1000044240 | 574 |
| 1652 | 3300028379 | Ga0268266_10017537 | Ga0268266_100175374 | 574 |
| 1653 | 3300030500 | Ga0268256_1000046 | Ga0268256_1000046240 | 574 |
| 1654 | 3300031456 | Ga0307513_10016752 | Ga0307513_100167525 | 574 |
| 1655 | 3300031456 | Ga0307513_10025919 | Ga0307513_100259191 | 574 |
| 1656 | 3300031456 | Ga0307513_10031051 | Ga0307513_100310512 | 574 |
| 1657 | 3300031507 | Ga0307509_10023313 | Ga0307509_100233132 | 574 |
| 1658 | 3300031824 | Ga0307413_10036155 | Ga0307413_100361552 | 574 |
| 1659 | 3300031852 | Ga0307410_10004936 | Ga0307410_100049362 | 574 |
| 1660 | 3300031903 | Ga0307407_10010579 | Ga0307407_100105793 | 574 |
| 1661 | 3300031903 | Ga0307407_10037317 | Ga0307407_100373172 | 574 |
| 1662 | 3300031995 | Ga0307409_100004509 | Ga0307409_1000045092 | 574 |
| 1663 | 3300031995 | Ga0307409_100009088 | Ga0307409_1000090882 | 574 |
| 1664 | 3300032002 | Ga0307416_100030348 | Ga0307416_1000303484 | 574 |
| 1665 | 3300032005 | Ga0307411_10003510 | Ga0307411_100035104 | 574 |
| 1666 | 3300033180 | Ga0307510_10102238 | Ga0307510_101022382 | 574 |
| 1667 | 3300035118 | Ga0373954_0000003 | Ga0373954_0000003_62460_64193 | 574 |
| 1668 | 3300035724 | Ga0373933_0002250 | Ga0373933_0002250_3027_4760 | 574 |
| 1669 | 3300037312 | Ga0395899_0000226 | Ga0395899_0000226_28521_30245 | 574 |
| 1670 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_373126_374850 | 574 |
| 1671 | 3300037466 | Ga0395898_0000029 | Ga0395898_0000029_130171_131895 | 574 |
| 1672 | 3300038443 | Ga0395901_0104306 | Ga0395901_0104306_941_2665 | 574 |
| 1673 | 3300041404 | Ga0439436_0005279 | Ga0439436_0005279_1581_3305 | 574 |
| 1674 | 3300041413 | Ga0439465_0000738 | Ga0439465_0000738_1132_2856 | 574 |
| 1675 | 3300041443 | Ga0451789_0328144 | Ga0451789_0328144_71_1795 | 574 |
| 1676 | 3300041459 | Ga0451800_0252034 | Ga0451800_0252034_1391_3115 | 574 |
| 1677 | 3300041459 | Ga0451800_0551749 | Ga0451800_0551749_56_1780 | 574 |
| 1678 | 3300041462 | Ga0451806_025862 | Ga0451806_025862_2967_4691 | 574 |
| 1679 | 3300041463 | Ga0451804_0359998 | Ga0451804_0359998_326_2050 | 574 |
| 1680 | 3300041463 | Ga0451804_0727978 | Ga0451804_0727978_84_1808 | 574 |
| 1681 | 3300041486 | Ga0451807_1729626 | Ga0451807_1729626_1391_3115 | 574 |
| 1682 | 3300041509 | Ga0451843_0331670 | Ga0451843_0331670_275_1999 | 574 |
| 1683 | 3300042004 | Ga0439445_0006216 | Ga0439445_0006216_651_2375 | 574 |
| 1684 | 3300042007 | Ga0439449_0000136 | Ga0439449_0000136_17959_19683 | 574 |
| 1685 | 3300042121 | Ga0450919_001002 | Ga0450919_001002_1370_3106 | 574 |
| 1686 | 3300042876 | Ga0451577_0000068 | Ga0451577_0000068_123650_125374 | 574 |
| 1687 | 3300042876 | Ga0451577_0020693 | Ga0451577_0020693_616_2340 | 574 |
| 1688 | 3300044656 | Ga0466969_0004147 | Ga0466969_0004147_108_1832 | 574 |
| 1689 | 3300044673 | Ga0453683_0031443 | Ga0453683_0031443_383_2107 | 574 |
| 1690 | 3300044684 | Ga0466966_0010972 | Ga0466966_0010972_1538_3262 | 574 |
| 1691 | 3300044693 | Ga0466961_0000057 | Ga0466961_0000057_37154_38920 | 574 |
| 1692 | 3300044693 | Ga0466961_0000299 | Ga0466961_0000299_9162_10886 | 574 |
| 1693 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_33601_35325 | 574 |
| 1694 | 3300044765 | Ga0466970_0002111 | Ga0466970_0002111_3307_5031 | 574 |
| 1695 | 3300045049 | Ga0466959_0000006 | Ga0466959_0000006_106090_107814 | 574 |
| 1696 | 3300045051 | Ga0451576_0012737 | Ga0451576_0012737_2286_4010 | 574 |
| 1697 | 3300045836 | Ga0466958_0085200 | Ga0466958_0085200_207_1931 | 574 |
| 1698 | 3300046453 | Ga0495627_007125 | Ga0495627_007125_276_2006 | 574 |
| 1699 | 3300046457 | Ga0495590_0005537 | Ga0495590_0005537_505_2229 | 574 |
| 1700 | 3300046460 | Ga0495638_0006731 | Ga0495638_0006731_1325_3049 | 574 |
| 1701 | 3300046460 | Ga0495638_0058764 | Ga0495638_0058764_436_2160 | 574 |
| 1702 | 3300046512 | Ga0495610_0012871 | Ga0495610_0012871_2248_3996 | 574 |
| 1703 | 3300046513 | Ga0495616_0001662 | Ga0495616_0001662_6631_8355 | 574 |
| 1704 | 3300046519 | Ga0495632_0032924 | Ga0495632_0032924_743_2467 | 574 |
| 1705 | 3300046660 | Ga0495625_0011056 | Ga0495625_0011056_2715_4439 | 574 |
| 1706 | 3300046660 | Ga0495625_0034067 | Ga0495625_0034067_138_1862 | 574 |
| 1707 | 3300046665 | Ga0495661_0021737 | Ga0495661_0021737_1240_3060 | 574 |
| 1708 | 3300046694 | Ga0495649_0001020 | Ga0495649_0001020_18351_20168 | 574 |
| 1709 | 3300046694 | Ga0495649_0005526 | Ga0495649_0005526_2400_4124 | 574 |
| 1710 | 3300048924 | Ga0496121_0005500 | Ga0496121_0005500_11751_13475 | 574 |
| 1711 | 3300048928 | Ga0496125_0000044 | Ga0496125_0000044_262021_263745 | 574 |
| 1712 | 3300049569 | Ga0501032_0013929 | Ga0501032_0013929_2192_3919 | 574 |
| 1713 | 3300049571 | Ga0501034_0032866 | Ga0501034_0032866_3158_4885 | 574 |
| 1714 | 3300049579 | Ga0501043_0049366 | Ga0501043_0049366_1470_3197 | 574 |
| 1715 | 3300049580 | Ga0501046_0015436 | Ga0501046_0015436_1991_3718 | 574 |
| 1716 | 3300049587 | Ga0501071_0012879 | Ga0501071_0012879_2231_3955 | 574 |
| 1717 | 3300049589 | Ga0501073_0000641 | Ga0501073_0000641_15452_17176 | 574 |
| 1718 | 3300049593 | Ga0501077_0007486 | Ga0501077_0007486_2569_4293 | 574 |
| 1719 | 3300049742 | Ga0501080_0007353 | Ga0501080_0007353_3929_5653 | 574 |
| 1720 | 3300050514 | nmdc:mga08x19_34734_c1 | nmdc:mga08x19_34734_c1_1136_2869 | 574 |
| 1721 | 3300053136 | Ga0500559_0001354 | Ga0500559_0001354_8060_9811 | 574 |
| 1722 | 3300053161 | Ga0500634_0014029 | Ga0500634_0014029_1174_2904 | 574 |
| 1723 | 3300054114 | Ga0501084_0002542 | Ga0501084_0002542_7417_9141 | 574 |
| 1724 | 3300060353 | Ga0501082_0027798 | Ga0501082_0027798_264_1988 | 574 |
| 1725 | 3300013104 | Ga0157370_10035604 | Ga0157370_100356043 | 575 |
| 1726 | 3300047319 | Ga0495674_0009625 | Ga0495674_0009625_328_2076 | 575 |
| 1727 | 3300005337 | Ga0070682_100006411 | Ga0070682_1000064113 | 576 |
| 1728 | 3300005466 | Ga0070685_10019728 | Ga0070685_100197282 | 576 |
| 1729 | 3300009094 | Ga0111539_10121013 | Ga0111539_101210132 | 576 |
| 1730 | 3300009176 | Ga0105242_10010417 | Ga0105242_100104174 | 576 |
| 1731 | 3300014325 | Ga0163163_10124369 | Ga0163163_101243692 | 576 |
| 1732 | 3300025934 | Ga0207686_10001460 | Ga0207686_100014603 | 576 |
| 1733 | 3300026088 | Ga0207641_10031952 | Ga0207641_100319523 | 576 |
| 1734 | 3300026095 | Ga0207676_10099321 | Ga0207676_100993212 | 576 |
| 1735 | 3300045051 | Ga0451576_0229500 | Ga0451576_0229500_57_1796 | 576 |
| 1736 | 3300046463 | Ga0495653_0060752 | Ga0495653_0060752_840_2579 | 576 |
| 1737 | 3300046511 | Ga0495608_0006211 | Ga0495608_0006211_2543_4282 | 576 |
| 1738 | 3300046516 | Ga0495628_0002765 | Ga0495628_0002765_12408_14147 | 576 |
| 1739 | 3300046517 | Ga0495630_0007543 | Ga0495630_0007543_4736_6475 | 576 |
| 1740 | 3300046533 | Ga0495640_0002870 | Ga0495640_0002870_8472_10211 | 576 |
| 1741 | 3300046535 | Ga0495586_0000323 | Ga0495586_0000323_13720_15459 | 576 |
| 1742 | 3300046536 | Ga0495587_0023217 | Ga0495587_0023217_1345_3084 | 576 |
| 1743 | 3300046642 | Ga0495634_0001658 | Ga0495634_0001658_13085_14824 | 576 |
| 1744 | 3300046689 | Ga0495613_0009447 | Ga0495613_0009447_4049_5788 | 576 |
| 1745 | 3300046690 | Ga0495624_0009244 | Ga0495624_0009244_1095_2834 | 576 |
| 1746 | 3300046809 | Ga0495600_0005445 | Ga0495600_0005445_1852_3591 | 576 |
| 1747 | 3300047317 | Ga0495604_0005797 | Ga0495604_0005797_3636_5375 | 576 |
| 1748 | 3300047322 | Ga0495680_0004648 | Ga0495680_0004648_1305_3044 | 576 |
| 1749 | 3300050511 | nmdc:mga08y16_79473_c1 | nmdc:mga08y16_79473_c1_751_2490 | 576 |
| 1750 | 3300005329 | Ga0070683_100001109 | Ga0070683_10000110910 | 577 |
| 1751 | 3300005338 | Ga0068868_100041896 | Ga0068868_1000418962 | 577 |
| 1752 | 3300005340 | Ga0070689_100016986 | Ga0070689_1000169862 | 577 |
| 1753 | 3300005344 | Ga0070661_100013472 | Ga0070661_1000134722 | 577 |
| 1754 | 3300005344 | Ga0070661_100019540 | Ga0070661_1000195401 | 577 |
| 1755 | 3300005457 | Ga0070662_100010712 | Ga0070662_1000107123 | 577 |
| 1756 | 3300005535 | Ga0070684_100002631 | Ga0070684_1000026313 | 577 |
| 1757 | 3300005535 | Ga0070684_100004494 | Ga0070684_1000044943 | 577 |
| 1758 | 3300005539 | Ga0068853_100002841 | Ga0068853_1000028414 | 577 |
| 1759 | 3300005543 | Ga0070672_100012236 | Ga0070672_1000122362 | 577 |
| 1760 | 3300005548 | Ga0070665_100131384 | Ga0070665_1001313842 | 577 |
| 1761 | 3300005564 | Ga0070664_100001767 | Ga0070664_1000017679 | 577 |
| 1762 | 3300005577 | Ga0068857_100003091 | Ga0068857_1000030914 | 577 |
| 1763 | 3300005617 | Ga0068859_100006240 | Ga0068859_1000062405 | 577 |
| 1764 | 3300005618 | Ga0068864_100012119 | Ga0068864_1000121191 | 577 |
| 1765 | 3300006931 | Ga0097620_100006240 | Ga0097620_1000062404 | 577 |
| 1766 | 3300009011 | Ga0105251_10003501 | Ga0105251_100035017 | 577 |
| 1767 | 3300013102 | Ga0157371_10003863 | Ga0157371_100038636 | 577 |
| 1768 | 3300013296 | Ga0157374_10000261 | Ga0157374_1000026128 | 577 |
| 1769 | 3300013306 | Ga0163162_10004794 | Ga0163162_100047949 | 577 |
| 1770 | 3300013308 | Ga0157375_10005063 | Ga0157375_100050635 | 577 |
| 1771 | 3300014325 | Ga0163163_10007450 | Ga0163163_100074503 | 577 |
| 1772 | 3300025904 | Ga0207647_10058204 | Ga0207647_100582042 | 577 |
| 1773 | 3300025920 | Ga0207649_10017722 | Ga0207649_100177222 | 577 |
| 1774 | 3300025920 | Ga0207649_10024633 | Ga0207649_100246332 | 577 |
| 1775 | 3300025936 | Ga0207670_10009202 | Ga0207670_100092023 | 577 |
| 1776 | 3300025940 | Ga0207691_10014958 | Ga0207691_100149584 | 577 |
| 1777 | 3300025942 | Ga0207689_10016509 | Ga0207689_100165093 | 577 |
| 1778 | 3300025944 | Ga0207661_10002307 | Ga0207661_100023075 | 577 |
| 1779 | 3300025944 | Ga0207661_10014005 | Ga0207661_100140052 | 577 |
| 1780 | 3300025945 | Ga0207679_10002603 | Ga0207679_100026035 | 577 |
| 1781 | 3300026023 | Ga0207677_10036833 | Ga0207677_100368332 | 577 |
| 1782 | 3300026041 | Ga0207639_10031212 | Ga0207639_100312122 | 577 |
| 1783 | 3300026095 | Ga0207676_10011036 | Ga0207676_100110363 | 577 |
| 1784 | 3300026116 | Ga0207674_10002307 | Ga0207674_100023075 | 577 |
| 1785 | 3300028379 | Ga0268266_10125486 | Ga0268266_101254862 | 577 |
| 1786 | 3300028381 | Ga0268264_10147620 | Ga0268264_101476202 | 577 |
| 1787 | 3300005985 | Ga0081539_10029286 | Ga0081539_100292862 | 578 |
| 1788 | 3300009093 | Ga0105240_10000283 | Ga0105240_1000028349 | 578 |
| 1789 | 3300009174 | Ga0105241_10000542 | Ga0105241_100005428 | 578 |
| 1790 | 3300009551 | Ga0105238_10003699 | Ga0105238_100036994 | 578 |
| 1791 | 3300025911 | Ga0207654_10019867 | Ga0207654_100198673 | 578 |
| 1792 | 3300025913 | Ga0207695_10000684 | Ga0207695_1000068426 | 578 |
| 1793 | 3300025924 | Ga0207694_10021256 | Ga0207694_100212562 | 578 |
| 1794 | iso_pu_bacteria | 2738543024 | 2739306725 | 578 |
| 1795 | 3300005290 | Ga0065712_10015539 | Ga0065712_100155392 | 580 |
| 1796 | 3300005329 | Ga0070683_100043783 | Ga0070683_1000437832 | 580 |
| 1797 | 3300005337 | Ga0070682_100049077 | Ga0070682_1000490772 | 580 |
| 1798 | 3300005339 | Ga0070660_100009871 | Ga0070660_1000098715 | 580 |
| 1799 | 3300026088 | Ga0207641_10000013 | Ga0207641_10000013189 | 580 |
| 1800 | 3300046531 | Ga0495665_0013184 | Ga0495665_0013184_373_2151 | 584 |
| 1801 | 3300005841 | Ga0068863_100080423 | Ga0068863_1000804232 | 585 |
| 1802 | 3300025321 | Ga0207656_10010296 | Ga0207656_100102962 | 585 |
| 1803 | 3300026142 | Ga0207698_10099257 | Ga0207698_100992572 | 585 |
| 1804 | iso_pu_bacteria | 2643221618 | 2644105197 | 585 |
| 1805 | iso_pu_bacteria | 2643221626 | 2644145727 | 585 |
| 1806 | iso_pu_bacteria | 2643221655 | 2644309610 | 585 |
| 1807 | iso_pu_bacteria | 2643221698 | 2644543339 | 585 |
| 1808 | iso_pu_bacteria | 2643221712 | 2644616134 | 585 |
| 1809 | 3300005616 | Ga0068852_100001789 | Ga0068852_10000178910 | 587 |
| 1810 | 3300025981 | Ga0207640_10032095 | Ga0207640_100320952 | 587 |
| 1811 | 3300053153 | Ga0500616_0014927 | Ga0500616_0014927_1354_3129 | 590 |
| 1812 | 3300035695 | Ga0373927_0000282 | Ga0373927_0000282_2201_4090 | 599 |
| 1813 | 3300009011 | Ga0105251_10000219 | Ga0105251_1000021910 | 604 |
| 1814 | 3300048920 | Ga0496117_0001420 | Ga0496117_0001420_14745_16559 | 604 |
| 1815 | 3300048921 | Ga0496118_0021248 | Ga0496118_0021248_1210_3024 | 604 |
| 1816 | 3300048922 | Ga0496119_0002453 | Ga0496119_0002453_1215_3029 | 604 |
| 1817 | 3300048923 | Ga0496120_0002147 | Ga0496120_0002147_18003_19817 | 604 |
| 1818 | 3300048925 | Ga0496122_0003345 | Ga0496122_0003345_1262_3076 | 604 |
| 1819 | 3300048926 | Ga0496123_0002721 | Ga0496123_0002721_1220_3034 | 604 |
| 1820 | 3300048927 | Ga0496124_0058331 | Ga0496124_0058331_145_1959 | 604 |
| 1821 | 3300037312 | Ga0395899_0002404 | Ga0395899_0002404_6077_7897 | 606 |
| 1822 | 3300039062 | Ga0400483_220317 | Ga0400483_220317_2977_4863 | 611 |
| 1823 | 2162886007 | SwRhRL2b_contig_295801 | SwRhRL2b_0163.00000470 | 623 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8epz-assembly1.cif.gz_B | crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn | 0.9935 | 58 | 623 |
| 5j83-assembly1.cif.gz_A | crystal structure of l-arabinonate dehydratase in apo-form | 0.9891 | 56 | 623 |
| 8epz-assembly1.cif.gz_B | crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn | 0.9883 | 58 | 623 |
| 5j83-assembly1.cif.gz_A | crystal structure of l-arabinonate dehydratase in apo-form | 0.9755 | 56 | 623 |
| 5oyn-assembly1.cif.gz_D | crystal structure of d-xylonate dehydratase in holo-form | 0.9744 | 53 | 611 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWK7_1_375_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9497 | 59 | 422 | 3.40.50.360 |
| af_Q2FWK7_1_375_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9202 | 59 | 422 | 3.40.50.360 |
| af_I1M137_1_420_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8483 | 13 | 422 | 3.40.50.1820 |
| af_I1M137_1_420_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8268 | 13 | 422 | 3.40.50.1820 |
| af_Q58672_371_522_3.50.30.80 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like | 0.818 | 426 | 580 | 3.50.30.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N7K134-F1-model_v4 | Dihydroxy-acid dehydratase (EC 4.2.1.9) | 0.9986 | 155 | 334 |
GO:0004160
GO:0019752 GO:0046872 GO:0051536 |
| AF-H1S8E2-F1-model_v4 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | 0.9973 | 58 | 434 |
GO:0016836
GO:0019752 GO:0046872 GO:0051536 |
| AF-A0A3B8LDC1-F1-model_v4 | Dihydroxy-acid dehydratase (EC 4.2.1.9) | 0.9968 | 55 | 292 |
GO:0004160
GO:0019752 GO:0046872 GO:0051536 |
| AF-A0A2V9VQF8-F1-model_v4 | Dihydroxy-acid dehydratase (EC 4.2.1.9) | 0.9964 | 59 | 198 |
GO:0004160
GO:0046872 GO:0051536 |
| AF-A0A365VRI8-F1-model_v4 | deleted | 0.9964 | 121 | 301 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar