F495805

General Info

Members Datasets Scaffolds Average Seq Length
1823 921 1365 570

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0000282|Ga0373927_0000282_2201_4090
Length 629
Sequence MNYKGHVPCSVVFVGDPGDHQACASFRQAILRLRLPISFTVSSERFAGIRRTIERRVPMKKLRSQEWFGRQDKMGFLYRSWMQNQGRPHDLFEGRPVIGICNTWSELTPCNGHFRELADFVKRGVWEAGGFPLEFPVMSLGETLLRPTAMLFRNLASMDVEESIRGNPLDGVVLLMGCDKTTPSLLMGAASCDLPTIGLSGGPMLSGKFHGHDLGSGTGVWQMCERVSSGEMKLAEFFEAESCMHRSKGHCMTMGTASTMASMVEALGISLPGNAAIPAVDARRNVLAQMTGRRIVQMVQEDLRMSSILTRTAFENAIRANAAIGGSTNAVIHLIAIAGRIGVPLALDDFDRLGSALPCLVDLQPSGQYLMEDFFYAGGLPAVLRELAEAGVLDRDALTVNGKTIGENIADAPCWNRSVIHTFSDPFKPRAGITVLRGNLAPNGAVIKLSAASPHLLQHRGRAVVFDSIEDFHSRINDEALDIDESCVMVLKNCGPRGYPGMAEVGNMPLPPKLLRKGVTDMVRISDARMSGTAYGTVVLHISPEAAAGGPLALVQSGDMVALDVAQRVIRLDVDDATLAARRSKWTSPSLPARGWERLYVEHVQQAHLGADLDFLVGHSGARVARDSH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
18 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
23 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
27 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
33 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
34 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
35 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
36 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
37 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
38 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
43 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
44 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
45 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
46 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
47 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
48 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
49 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
50 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
51 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
52 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
53 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
54 2643221557 Ensifer sp. Root558 Isolate Unclassified
55 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
56 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
57 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
58 2643221610 Ensifer sp. Root74 Isolate Unclassified
59 2643221618 Ensifer sp. Root231 Isolate Unclassified
60 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
61 2643221626 Ensifer sp. Root31 Isolate Unclassified
62 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
63 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
64 2643221655 Ensifer sp. Root1252 Isolate Unclassified
65 2643221659 Ensifer sp. Root127 Isolate Unclassified
66 2643221668 Ensifer sp. Root423 Isolate Unclassified
67 2643221675 Ensifer sp. Root1298 Isolate Unclassified
68 2643221680 Ensifer sp. Root1312 Isolate Unclassified
69 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
70 2643221688 Rhizobium sp. Root482 Isolate Unclassified
71 2643221698 Ensifer sp. Root142 Isolate Unclassified
72 2643221712 Ensifer sp. Root258 Isolate Unclassified
73 2643221723 Ensifer sp. Root278 Isolate Unclassified
74 2643221726 Ensifer sp. Root954 Isolate Unclassified
75 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
76 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
77 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
78 2738541278 Niastella sp. CF465 Isolate Unclassified
79 2738543024 Aminobacter sp. AP02 Isolate Unclassified
80 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
81 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
82 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
83 2773857925 Microvirga vignae BR3299 Isolate Unclassified
84 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
85 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
86 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
87 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
88 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
89 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
90 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
91 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
92 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
93 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
94 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
95 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
96 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
97 2818991457 Xanthomonas translucens 569 Isolate Unclassified
98 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
99 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
100 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
101 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
102 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
103 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
104 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
105 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
106 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
107 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
108 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
109 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
110 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
111 2844163670 Ensifer sp. 1H6 Isolate Unclassified
112 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
113 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
114 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
115 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
116 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
117 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
118 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
119 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
120 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
121 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
122 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
123 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
124 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
125 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
126 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
127 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
128 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
129 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
130 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
131 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
132 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
133 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
134 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
135 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
136 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
137 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
138 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
139 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
140 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
141 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
142 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
143 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
144 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
145 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
146 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
147 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
148 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
149 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
150 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
151 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
152 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
153 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
154 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
155 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
156 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
157 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
158 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
159 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
160 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
161 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
162 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
163 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
164 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
165 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
166 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
167 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
168 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
169 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
170 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
171 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
172 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
173 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
174 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
175 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
176 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
177 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
178 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
179 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
180 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
181 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
182 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
183 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
184 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
185 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
186 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
187 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
188 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
189 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
190 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
191 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
192 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
193 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
194 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
195 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
196 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
197 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
198 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
199 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
200 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
201 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
202 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
203 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
204 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
205 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
206 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
207 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
208 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
209 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
210 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
211 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
212 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
213 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
214 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
215 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
216 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
217 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
218 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
219 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
220 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
221 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
222 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
223 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
224 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
225 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
226 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
227 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
228 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
229 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
230 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
231 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
232 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
233 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
234 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
235 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
236 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
237 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
238 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
239 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
240 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
241 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
242 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
243 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
244 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
245 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
246 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
247 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
248 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
249 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
250 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
251 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
252 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
253 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
254 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
255 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
256 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
257 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
258 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
259 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
260 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
261 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
262 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
263 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
264 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
265 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
266 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
267 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
268 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
269 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
270 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
271 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
272 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
273 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
274 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
275 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
276 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
277 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
278 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
279 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
280 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
281 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
282 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
283 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
284 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
285 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
286 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
287 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
288 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
289 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
290 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
291 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
292 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
293 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
294 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
295 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
296 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
297 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
298 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
299 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
300 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
301 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
302 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
303 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
304 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
305 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
306 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
307 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
308 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
309 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
310 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
311 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
312 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
313 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
314 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
315 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
316 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
317 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
318 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
319 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
320 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
321 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
322 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
323 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
324 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
325 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
326 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
327 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
328 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
329 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
330 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
331 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
332 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
333 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
334 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
335 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
336 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
337 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
338 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
339 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
340 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
341 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
342 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
343 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
344 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
345 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
346 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
347 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
348 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
349 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
350 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
351 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
352 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
353 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
354 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
355 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
356 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
357 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
358 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
359 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
360 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
361 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
362 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
363 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
364 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
365 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
366 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
367 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
368 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
369 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
370 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
371 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
372 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
373 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
374 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
375 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
376 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
377 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
378 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
379 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
380 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
381 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
382 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
383 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
384 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
385 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
386 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
387 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
388 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
389 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
390 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
391 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
392 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
393 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
394 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
395 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
396 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
397 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
398 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
399 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
400 3004167301 Mesorhizobium loti 582 Isolate Unclassified
401 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
402 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
403 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
404 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
405 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
406 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
407 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
408 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
409 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
410 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
411 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
412 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
413 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
414 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
415 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
416 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
417 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
418 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
419 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
420 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
421 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
422 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
423 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
424 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
425 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
426 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
427 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
428 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
429 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
430 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
431 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
432 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
433 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
434 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
435 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
436 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
437 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
438 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
439 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
440 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
441 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
442 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
443 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
444 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
445 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
446 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
447 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
448 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
449 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
450 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
451 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
452 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
453 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
454 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
455 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
456 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
457 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
458 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
459 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
460 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
461 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
462 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
463 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
464 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
465 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
466 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
467 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
468 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
469 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
470 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
471 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
472 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
473 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
474 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
475 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
476 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
477 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
478 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
479 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
480 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
481 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
482 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
483 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
484 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
485 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
486 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
487 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
488 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
489 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
490 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
491 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
492 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
493 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
494 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
495 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
496 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
497 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
498 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
499 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
500 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
501 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
502 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
503 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
504 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
505 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
506 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
507 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
508 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
509 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
510 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
511 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
512 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
513 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
514 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
515 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
516 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
517 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
518 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
519 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
520 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
521 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
522 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
523 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
524 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
525 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
526 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
527 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
528 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
529 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
530 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
531 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
532 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
533 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
534 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
535 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
536 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
537 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
538 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
539 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
540 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
541 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
542 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
543 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
544 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
545 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
546 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
547 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
548 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
549 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
550 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
551 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
552 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
553 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
554 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
555 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
556 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
557 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
558 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
559 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
560 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
561 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
562 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
563 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
564 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
565 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
566 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
567 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
568 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
569 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
570 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
571 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
575 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
577 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
578 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
579 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
581 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
582 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
583 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
584 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
585 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
586 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
587 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
588 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
589 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
590 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
591 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
592 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
593 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
594 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
643 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
644 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
645 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
647 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
648 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
650 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
651 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
652 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
654 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
656 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
657 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
658 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
659 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
660 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
661 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
662 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
663 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
665 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
666 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
667 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
668 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
669 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
670 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
671 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
672 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
673 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
674 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
675 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
676 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
677 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
678 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
679 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
680 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
681 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
682 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
683 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
684 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
685 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
686 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
687 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
688 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
689 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
690 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
691 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
692 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
693 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
694 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
695 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
696 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
697 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
698 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
699 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
700 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
701 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
702 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
703 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
704 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
705 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
706 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
707 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
708 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
709 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
710 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
711 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
712 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
713 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
714 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
715 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
716 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
717 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
718 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
719 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
720 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
721 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
722 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
723 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
724 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
725 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
726 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
727 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
728 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
729 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
730 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
731 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
732 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
733 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
734 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
735 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
736 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
737 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
738 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
739 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
740 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
741 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
742 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
743 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
744 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
745 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
746 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
747 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
748 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
749 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
750 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
751 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
752 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
753 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
754 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
755 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
756 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
757 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
758 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
759 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
760 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
761 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
762 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
763 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
764 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
765 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
766 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
767 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
768 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
769 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
770 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
771 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
772 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
773 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
774 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
775 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
776 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
777 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
778 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
779 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
780 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
781 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
782 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
783 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
784 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
785 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
786 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
787 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
788 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
789 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
790 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
791 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
792 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
793 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
794 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
795 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
796 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
797 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
798 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
799 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
800 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
801 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
802 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
803 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
804 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
805 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
806 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
807 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
808 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
809 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
810 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
811 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
812 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
813 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
814 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
815 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
816 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
817 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
818 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
819 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
820 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
821 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
822 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
823 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
824 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
825 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
826 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
827 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
828 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
829 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
830 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
831 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
832 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
833 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
834 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
835 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
836 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
837 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
838 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
839 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
840 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
841 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
842 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
843 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
844 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
845 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
846 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
847 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
848 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
849 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
850 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
851 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
852 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
853 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
854 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
855 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
856 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
857 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
858 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
859 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
860 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
861 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
862 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
863 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
864 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
865 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
866 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
867 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
868 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
869 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
870 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
871 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
872 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
873 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
874 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
875 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
876 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
877 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
878 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
879 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
880 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
881 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
882 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
883 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
884 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
885 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
886 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
887 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
888 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
889 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
890 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
891 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
892 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
893 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
894 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
895 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
896 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
897 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
898 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
899 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
900 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
901 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
902 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
903 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
904 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
905 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
906 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
907 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
908 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
909 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
910 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
911 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
912 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
913 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
914 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
915 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
916 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
917 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
918 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
919 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
920 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
921 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.33
Metatranscriptomes 0.55
Isolates 25.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 20.46
Rhizoplane 2.14
Rhizosphere 63.3
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_295801 2162886007 Bacteria 2176
2 JGI24740J21852_10000201 3300001979 Bacteria 24790
3 JGI24739J22299_10001200 3300001989 Bacteria 9693
4 JGI24739J22299_10005441 3300001989 Bacteria 4838
5 JGI24737J22298_10001648 3300001990 Bacteria 7969
6 JGI25155J39150_1000014 3300002704 Bacteria 196159
7 JGI25156J39149_1000083 3300002705 Bacteria 70138
8 JGI25156J39149_1003633 3300002705 Bacteria 4970
9 JGI25162J39368_1000532 3300002737 Bacteria 28366
10 JGI25162J39368_1002261 3300002737 Bacteria 7807
11 JGI25162J39368_1003823 3300002737 Bacteria 3967
12 JGI25154J39366_1000052 3300002738 Bacteria 120209
13 JGI25154J39366_1000080 3300002738 Bacteria 89374
14 JGI25154J39366_1000139 3300002738 Bacteria 56829
15 JGI25157J39369_1000110 3300002741 Bacteria 69643
16 JGI25157J39369_1000256 3300002741 Bacteria 39240
17 JGI25157J39369_1001300 3300002741 Bacteria 10003
18 JGI25159J45721_1000004 3300002987 Bacteria 215789
19 JGI25159J45721_1000251 3300002987 Bacteria 25319
20 JGI25151J46595_10000586 3300003187 Bacteria 32351
21 JGI25151J46595_10001193 3300003187 Bacteria 18647
22 JGI25165J46597_1000641 3300003214 Bacteria 28973
23 JGI25165J46597_1000692 3300003214 Bacteria 26996
24 JGI25165J46597_1001949 3300003214 Bacteria 8120
25 JGI25153J46596_10002621 3300003215 Bacteria 10289
26 rootH1_10027701 3300003316 Bacteria 3466
27 rootH1_10078771 3300003316 Bacteria 2953
28 rootH1_10000759 3300003323 Bacteria 51501
29 rootH1_10001237 3300003323 Bacteria 16036
30 rootH1_10019846 3300003323 Bacteria 13232
31 rootH1_10091236 3300003323 Bacteria 6919
32 JGI25160J50197_1000001 3300003354 Bacteria 782301
33 JGI25160J50197_1000021 3300003354 Bacteria 215789
34 JGI25160J50197_1002128 3300003354 Bacteria 9395
35 JGI25160J50197_1005585 3300003354 Bacteria 5208
36 JGI25161J50226_1000001 3300003374 Bacteria 655036
37 JGI25161J50226_1002682 3300003374 Bacteria 4421
38 Ga0055539_1001711 3300003752 Bacteria 3868
39 Ga0055533_1002287 3300003756 Bacteria 4447
40 Ga0055525_1000043 3300003759 Bacteria 268656
41 Ga0055527_1000305 3300003760 Bacteria 27630
42 Ga0055527_1000393 3300003760 Bacteria 18682
43 Ga0055535_1000652 3300003761 Bacteria 27630
44 Ga0055535_1000974 3300003761 Bacteria 18682
45 Ga0055542_1000672 3300003762 Bacteria 27630
46 Ga0055542_1000970 3300003762 Bacteria 18685
47 Ga0055529_1000620 3300003763 Bacteria 26580
48 Ga0055529_1000818 3300003763 Bacteria 18682
49 Ga0055526_1000723 3300003771 Bacteria 24955
50 Ga0055526_1010357 3300003771 Bacteria 4351
51 Ga0055526_1019460 3300003771 Bacteria 2473
52 Ga0055524_1022102 3300003775 Bacteria 2088
53 Ga0055536_1000219 3300003781 Bacteria 46718
54 Ga0055536_1003998 3300003781 Bacteria 7700
55 Ga0055534_1001363 3300003784 Bacteria 9779
56 Ga0055528_1000246 3300003790 Bacteria 45702
57 Ga0055530_10003361 3300003791 Bacteria 9163
58 Ga0055530_10013503 3300003791 Bacteria 2783
59 Ga0055531_10000048 3300003794 Bacteria 131142
60 Ga0058692_1000017 3300003856 Bacteria 274459
61 Ga0055543_1000089 3300004625 Bacteria 79924
62 Ga0055543_1000102 3300004625 Bacteria 73861
63 Ga0055543_1009724 3300004625 Bacteria 2049
64 Ga0065165_1000008 3300005262 Bacteria 334429
65 Ga0065165_1000033 3300005262 Bacteria 215827
66 Ga0065165_1000124 3300005262 Bacteria 130515
67 Ga0065165_1004243 3300005262 Bacteria 9096
68 Ga0065704_10103010 3300005289 Bacteria 2186
69 Ga0065712_10015539 3300005290 Bacteria 2213
70 Ga0070658_10000053 3300005327 Bacteria 116207
71 Ga0070658_10021249 3300005327 Bacteria 5201
72 Ga0070658_10025804 3300005327 Bacteria 4711
73 Ga0070658_10034021 3300005327 Bacteria 4101
74 Ga0070658_10096835 3300005327 Bacteria 2436
75 Ga0070676_10000108 3300005328 Bacteria 30064
76 Ga0070676_10008665 3300005328 Bacteria 5487
77 Ga0070676_10016033 3300005328 Bacteria 4138
78 Ga0070683_100001109 3300005329 Bacteria 20315
79 Ga0070683_100007379 3300005329 Bacteria 9289
80 Ga0070683_100011555 3300005329 Bacteria 7641
81 Ga0070683_100038807 3300005329 Bacteria 4367
82 Ga0070683_100043783 3300005329 Bacteria 4125
83 Ga0070683_100119600 3300005329 Bacteria 2488
84 Ga0070690_100048350 3300005330 Bacteria 2708
85 Ga0070670_100001436 3300005331 Bacteria 19172
86 Ga0070670_100002168 3300005331 Bacteria 16128
87 Ga0070670_100044896 3300005331 Bacteria 3798
88 Ga0070670_100097870 3300005331 Bacteria 2524
89 Ga0070677_10006483 3300005333 Bacteria 3889
90 Ga0068869_100001825 3300005334 Bacteria 12787
91 Ga0068869_100015842 3300005334 Bacteria 5070
92 Ga0068869_100030435 3300005334 Bacteria 3789
93 Ga0068869_100090464 3300005334 Bacteria 2300
94 Ga0070666_10000052 3300005335 Bacteria 99095
95 Ga0070666_10013814 3300005335 Bacteria 5131
96 Ga0070666_10031350 3300005335 Bacteria 3509
97 Ga0070680_100011873 3300005336 Bacteria 6757
98 Ga0070680_100027164 3300005336 Bacteria 4584
99 Ga0070682_100006411 3300005337 Bacteria 6610
100 Ga0070682_100012555 3300005337 Bacteria 4858
101 Ga0070682_100049077 3300005337 Bacteria 2631
102 Ga0068868_100000489 3300005338 Bacteria 26346
103 Ga0068868_100003695 3300005338 Bacteria 10685
104 Ga0068868_100008536 3300005338 Bacteria 7336
105 Ga0068868_100041896 3300005338 Bacteria 3570
106 Ga0068868_100083497 3300005338 Bacteria 2564
107 Ga0070660_100009031 3300005339 Bacteria 6994
108 Ga0070660_100009871 3300005339 Bacteria 6732
109 Ga0070660_100046674 3300005339 Bacteria 3321
110 Ga0070689_100016986 3300005340 Bacteria 5338
111 Ga0070689_100068108 3300005340 Bacteria 2776
112 Ga0070689_100127268 3300005340 Bacteria 2039
113 Ga0070687_100006553 3300005343 Bacteria 4779
114 Ga0070687_100059207 3300005343 Bacteria 2016
115 Ga0070687_100072953 3300005343 Bacteria 1848
116 Ga0070661_100013472 3300005344 Bacteria 5740
117 Ga0070661_100019540 3300005344 Bacteria 4829
118 Ga0070668_100002293 3300005347 Bacteria 14111
119 Ga0070669_100019673 3300005353 Bacteria 4823
120 Ga0070675_100000808 3300005354 Bacteria 22032
121 Ga0070675_100010177 3300005354 Bacteria 7336
122 Ga0070675_100010314 3300005354 Bacteria 7293
123 Ga0070675_100061126 3300005354 Bacteria 3110
124 Ga0070671_100000766 3300005355 Bacteria 23072
125 Ga0070671_100002005 3300005355 Bacteria 15645
126 Ga0070671_100002043 3300005355 Bacteria 15557
127 Ga0070674_100003032 3300005356 Bacteria 9343
128 Ga0070674_100014891 3300005356 Bacteria 4842
129 Ga0070673_100000760 3300005364 Bacteria 17933
130 Ga0070673_100003789 3300005364 Bacteria 9488
131 Ga0070688_100046559 3300005365 Bacteria 2686
132 Ga0070659_100004754 3300005366 Bacteria 9704
133 Ga0070659_100012803 3300005366 Bacteria 6228
134 Ga0070659_100032329 3300005366 Bacteria 4057
135 Ga0070667_100000008 3300005367 Bacteria 285591
136 Ga0070667_100076809 3300005367 Bacteria 2851
137 Ga0070709_10008330 3300005434 Bacteria 5692
138 Ga0070709_10013525 3300005434 Bacteria 4591
139 Ga0070709_10029392 3300005434 Bacteria 3287
140 Ga0070714_100000027 3300005435 Bacteria 141750
141 Ga0070714_100009506 3300005435 Bacteria 7647
142 Ga0070714_100100823 3300005435 Bacteria 2543
143 Ga0070714_100107899 3300005435 Bacteria 2461
144 Ga0070713_100000070 3300005436 Bacteria 64658
145 Ga0070713_100010524 3300005436 Bacteria 6686
146 Ga0070713_100025593 3300005436 Bacteria 4617
147 Ga0070713_100092697 3300005436 Bacteria 2601
148 Ga0070713_100124868 3300005436 Bacteria 2262
149 Ga0070710_10023423 3300005437 Bacteria 3246
150 Ga0070701_10027034 3300005438 Bacteria 2806
151 Ga0070711_100000078 3300005439 Bacteria 54188
152 Ga0070711_100001722 3300005439 Bacteria 12135
153 Ga0070711_100008573 3300005439 Bacteria 6269
154 Ga0070711_100010683 3300005439 Bacteria 5689
155 Ga0070705_100002145 3300005440 Bacteria 10031
156 Ga0070700_100016261 3300005441 Bacteria 4236
157 Ga0070663_100020181 3300005455 Bacteria 4408
158 Ga0070663_100049380 3300005455 Bacteria 2987
159 Ga0070678_100010861 3300005456 Bacteria 5585
160 Ga0070678_100064235 3300005456 Bacteria 2719
161 Ga0070678_100150125 3300005456 Bacteria 1876
162 Ga0070662_100002343 3300005457 Bacteria 11649
163 Ga0070662_100010712 3300005457 Bacteria 6036
164 Ga0070662_100010906 3300005457 Bacteria 5987
165 Ga0070662_100030839 3300005457 Bacteria 3756
166 Ga0070681_10002731 3300005458 Bacteria 16262
167 Ga0070681_10009647 3300005458 Bacteria 9496
168 Ga0070681_10016790 3300005458 Bacteria 7309
169 Ga0070681_10054169 3300005458 Bacteria 3997
170 Ga0068867_100013463 3300005459 Bacteria 5794
171 Ga0068867_100015107 3300005459 Bacteria 5474
172 Ga0068867_100048551 3300005459 Bacteria 3123
173 Ga0070685_10019728 3300005466 Bacteria 3642
174 Ga0070685_10058711 3300005466 Bacteria 2244
175 Ga0070706_100017407 3300005467 Bacteria 6632
176 Ga0070698_100016910 3300005471 Bacteria 7691
177 Ga0070679_100001049 3300005530 Bacteria 24084
178 Ga0070679_100002199 3300005530 Bacteria 17619
179 Ga0070679_100003313 3300005530 Bacteria 14753
180 Ga0070679_100128575 3300005530 Bacteria 2515
181 Ga0070684_100000495 3300005535 Bacteria 27122
182 Ga0070684_100002184 3300005535 Bacteria 14445
183 Ga0070684_100002631 3300005535 Bacteria 13264
184 Ga0070684_100003551 3300005535 Bacteria 11721
185 Ga0070684_100004494 3300005535 Bacteria 10615
186 Ga0070684_100052722 3300005535 Bacteria 3538
187 Ga0068853_100002085 3300005539 Bacteria 14821
188 Ga0068853_100002841 3300005539 Bacteria 13127
189 Ga0068853_100034021 3300005539 Bacteria 4324
190 Ga0068853_100042327 3300005539 Bacteria 3894
191 Ga0068853_100078638 3300005539 Bacteria 2883
192 Ga0068853_100153353 3300005539 Bacteria 2075
193 Ga0070672_100001253 3300005543 Bacteria 15629
194 Ga0070672_100001412 3300005543 Bacteria 14833
195 Ga0070672_100001924 3300005543 Bacteria 13036
196 Ga0070672_100007962 3300005543 Bacteria 7239
197 Ga0070672_100012236 3300005543 Bacteria 6014
198 Ga0070672_100086476 3300005543 Bacteria 2521
199 Ga0070672_100110485 3300005543 Bacteria 2240
200 Ga0070695_100047737 3300005545 Bacteria 2736
201 Ga0070696_100004763 3300005546 Bacteria 9063
202 Ga0070693_100033350 3300005547 Bacteria 2841
203 Ga0070665_100000001 3300005548 Bacteria 1083363
204 Ga0070665_100000006 3300005548 Bacteria 718034
205 Ga0070665_100002302 3300005548 Bacteria 21191
206 Ga0070665_100004515 3300005548 Bacteria 14591
207 Ga0070665_100131384 3300005548 Bacteria 2506
208 Ga0070704_100037227 3300005549 Bacteria 3322
209 Ga0068855_100000089 3300005563 Bacteria 110845
210 Ga0068855_100006138 3300005563 Bacteria 14646
211 Ga0068855_100013875 3300005563 Bacteria 9717
212 Ga0068855_100021735 3300005563 Bacteria 7695
213 Ga0068855_100033174 3300005563 Bacteria 6164
214 Ga0068855_100040465 3300005563 Bacteria 5532
215 Ga0068855_100041594 3300005563 Bacteria 5447
216 Ga0068855_100061690 3300005563 Bacteria 4380
217 Ga0068855_100084487 3300005563 Bacteria 3674
218 Ga0068855_100159858 3300005563 Bacteria 2558
219 Ga0070664_100000907 3300005564 Bacteria 23090
220 Ga0070664_100001767 3300005564 Bacteria 17333
221 Ga0070664_100003198 3300005564 Bacteria 13236
222 Ga0070664_100016459 3300005564 Bacteria 6061
223 Ga0070664_100056278 3300005564 Bacteria 3342
224 Ga0068857_100000416 3300005577 Bacteria 30150
225 Ga0068857_100002231 3300005577 Bacteria 15779
226 Ga0068857_100003091 3300005577 Bacteria 13769
227 Ga0068857_100008704 3300005577 Bacteria 8784
228 Ga0068857_100019687 3300005577 Bacteria 5928
229 Ga0068857_100035648 3300005577 Bacteria 4407
230 Ga0068857_100135902 3300005577 Bacteria 2220
231 Ga0068854_100001302 3300005578 Bacteria 15037
232 Ga0068854_100003549 3300005578 Bacteria 9751
233 Ga0068854_100007413 3300005578 Bacteria 7006
234 Ga0068854_100014670 3300005578 Bacteria 5169
235 Ga0068854_100023625 3300005578 Bacteria 4201
236 Ga0068854_100024484 3300005578 Bacteria 4133
237 Ga0068854_100065239 3300005578 Bacteria 2647
238 Ga0068856_100003470 3300005614 Bacteria 15935
239 Ga0068856_100003737 3300005614 Bacteria 15253
240 Ga0068856_100007867 3300005614 Bacteria 10410
241 Ga0068856_100008937 3300005614 Bacteria 9744
242 Ga0068856_100021384 3300005614 Bacteria 6289
243 Ga0068856_100049501 3300005614 Bacteria 4141
244 Ga0068852_100001067 3300005616 Bacteria 18102
245 Ga0068852_100001424 3300005616 Bacteria 16136
246 Ga0068852_100001703 3300005616 Bacteria 14982
247 Ga0068852_100001789 3300005616 Bacteria 14595
248 Ga0068852_100006577 3300005616 Bacteria 8414
249 Ga0068852_100009196 3300005616 Bacteria 7321
250 Ga0068852_100023794 3300005616 Bacteria 4938
251 Ga0068852_100030311 3300005616 Bacteria 4452
252 Ga0068852_100033864 3300005616 Bacteria 4246
253 Ga0068852_100052610 3300005616 Bacteria 3500
254 Ga0068852_100081827 3300005616 Bacteria 2867
255 Ga0068859_100000112 3300005617 Bacteria 77364
256 Ga0068859_100004436 3300005617 Bacteria 14320
257 Ga0068859_100006240 3300005617 Bacteria 12102
258 Ga0068859_100096264 3300005617 Bacteria 3013
259 Ga0068864_100004751 3300005618 Bacteria 11126
260 Ga0068864_100005862 3300005618 Bacteria 10066
261 Ga0068864_100012119 3300005618 Bacteria 7123
262 Ga0068864_100171718 3300005618 Bacteria 1977
263 Ga0068866_10009802 3300005718 Bacteria 4082
264 Ga0068861_100002433 3300005719 Bacteria 12138
265 Ga0068861_100003403 3300005719 Bacteria 10553
266 Ga0068861_100003919 3300005719 Bacteria 9948
267 Ga0068861_100023914 3300005719 Bacteria 4412
268 Ga0068861_100055358 3300005719 Bacteria 3024
269 Ga0068861_100078681 3300005719 Bacteria 2576
270 Ga0068861_100091168 3300005719 Bacteria 2406
271 Ga0068851_10005265 3300005834 Bacteria 5870
272 Ga0068851_10005926 3300005834 Bacteria 5563
273 Ga0068851_10007004 3300005834 Bacteria 5170
274 Ga0068851_10007899 3300005834 Bacteria 4900
275 Ga0068851_10013951 3300005834 Bacteria 3808
276 Ga0068851_10015229 3300005834 Bacteria 3661
277 Ga0068851_10030114 3300005834 Bacteria 2690
278 Ga0068870_10000326 3300005840 Bacteria 17719
279 Ga0068870_10025823 3300005840 Bacteria 2921
280 Ga0068870_10026543 3300005840 Bacteria 2888
281 Ga0068863_100016366 3300005841 Bacteria 7113
282 Ga0068863_100019561 3300005841 Bacteria 6476
283 Ga0068863_100080423 3300005841 Bacteria 3087
284 Ga0068863_100181124 3300005841 Bacteria 2022
285 Ga0068858_100006624 3300005842 Bacteria 11271
286 Ga0068858_100010216 3300005842 Bacteria 8907
287 Ga0068858_100042671 3300005842 Bacteria 4205
288 Ga0068858_100043377 3300005842 Bacteria 4170
289 Ga0068860_100000005 3300005843 Bacteria 472349
290 Ga0068860_100000046 3300005843 Bacteria 214800
291 Ga0068860_100003770 3300005843 Bacteria 15594
292 Ga0068860_100007157 3300005843 Bacteria 11160
293 Ga0068860_100029570 3300005843 Bacteria 5272
294 Ga0068860_100044640 3300005843 Bacteria 4224
295 Ga0068860_100063495 3300005843 Bacteria 3508
296 Ga0068860_100080415 3300005843 Bacteria 3099
297 Ga0068862_100068195 3300005844 Bacteria 3068
298 Ga0068862_100104493 3300005844 Bacteria 2481
299 Ga0068862_100118041 3300005844 Bacteria 2335
300 Ga0081455_10015718 3300005937 Bacteria 7336
301 Ga0081455_10018606 3300005937 Bacteria 6604
302 Ga0081455_10038479 3300005937 Bacteria 4236
303 Ga0081538_10007018 3300005981 Bacteria 9799
304 Ga0081538_10008990 3300005981 Bacteria 8392
305 Ga0081540_1008524 3300005983 Bacteria 7155
306 Ga0081539_10029286 3300005985 Bacteria 3442
307 Ga0070717_10001262 3300006028 Bacteria 17276
308 Ga0070717_10007375 3300006028 Bacteria 8168
309 Ga0070717_10016703 3300006028 Bacteria 5697
310 Ga0070712_100000038 3300006175 Bacteria 67408
311 Ga0070712_100000139 3300006175 Bacteria 37733
312 Ga0070712_100000292 3300006175 Bacteria 28152
313 Ga0075366_10020007 3300006195 Bacteria 3880
314 Ga0097621_100002478 3300006237 Bacteria 12642
315 Ga0097621_100009342 3300006237 Bacteria 7119
316 Ga0097621_100011591 3300006237 Bacteria 6498
317 Ga0097621_100011644 3300006237 Bacteria 6488
318 Ga0097621_100017336 3300006237 Bacteria 5467
319 Ga0097621_100048005 3300006237 Bacteria 3462
320 Ga0097621_100060361 3300006237 Bacteria 3108
321 Ga0097621_100074801 3300006237 Bacteria 2806
322 Ga0075370_10002970 3300006353 Bacteria 7967
323 Ga0068871_100001328 3300006358 Bacteria 16549
324 Ga0068871_100001519 3300006358 Bacteria 15541
325 Ga0068871_100012320 3300006358 Bacteria 6299
326 Ga0075431_100053601 3300006847 Bacteria 4158
327 Ga0075431_100131322 3300006847 Bacteria 2583
328 Ga0075434_100027556 3300006871 Bacteria 5580
329 Ga0075429_100042141 3300006880 Bacteria 3973
330 Ga0075429_100140889 3300006880 Bacteria 2111
331 Ga0068865_100001761 3300006881 Bacteria 12702
332 Ga0068865_100013022 3300006881 Bacteria 5245
333 Ga0068865_100036426 3300006881 Bacteria 3317
334 Ga0075436_100015958 3300006914 Bacteria 5141
335 Ga0075436_100016268 3300006914 Bacteria 5091
336 Ga0097620_100000112 3300006931 Bacteria 77364
337 Ga0097620_100004436 3300006931 Bacteria 14320
338 Ga0097620_100006240 3300006931 Bacteria 12102
339 Ga0097620_100096265 3300006931 Bacteria 3013
340 Ga0079104_1008144 3300006946 Bacteria 3707
341 Ga0079104_1010485 3300006946 Bacteria 3052
342 Ga0075435_100030319 3300007076 Bacteria 4251
343 Ga0075435_100166843 3300007076 Bacteria 1857
344 Ga0099794_10061540 3300007265 Bacteria 1824
345 Ga0105251_10000219 3300009011 Bacteria 58096
346 Ga0105251_10003501 3300009011 Bacteria 11356
347 Ga0105240_10000008 3300009093 Bacteria 618862
348 Ga0105240_10000014 3300009093 Bacteria 482033
349 Ga0105240_10000039 3300009093 Bacteria 270117
350 Ga0105240_10000054 3300009093 Bacteria 225529
351 Ga0105240_10000074 3300009093 Bacteria 199611
352 Ga0105240_10000283 3300009093 Bacteria 99553
353 Ga0105240_10001565 3300009093 Bacteria 38825
354 Ga0105240_10002663 3300009093 Bacteria 28411
355 Ga0105240_10005587 3300009093 Bacteria 18682
356 Ga0105240_10005669 3300009093 Bacteria 18536
357 Ga0105240_10008305 3300009093 Bacteria 14858
358 Ga0105240_10011123 3300009093 Bacteria 12576
359 Ga0105240_10016759 3300009093 Bacteria 9911
360 Ga0105240_10017784 3300009093 Bacteria 9569
361 Ga0105240_10021984 3300009093 Bacteria 8473
362 Ga0105240_10032969 3300009093 Bacteria 6698
363 Ga0105240_10175292 3300009093 Bacteria 2535
364 Ga0111539_10000665 3300009094 Bacteria 44363
365 Ga0111539_10008255 3300009094 Bacteria 13255
366 Ga0111539_10023989 3300009094 Bacteria 7493
367 Ga0111539_10073997 3300009094 Bacteria 4015
368 Ga0111539_10121013 3300009094 Bacteria 3067
369 Ga0105245_10000995 3300009098 Bacteria 25730
370 Ga0105245_10001343 3300009098 Bacteria 22292
371 Ga0105245_10016474 3300009098 Bacteria 6449
372 Ga0114129_10001007 3300009147 Bacteria 36711
373 Ga0114129_10078631 3300009147 Bacteria 4587
374 Ga0105243_10040017 3300009148 Bacteria 3658
375 Ga0105243_10051389 3300009148 Bacteria 3260
376 Ga0105241_10000542 3300009174 Bacteria 28454
377 Ga0105241_10003032 3300009174 Bacteria 12548
378 Ga0105242_10010417 3300009176 Bacteria 7132
379 Ga0105242_10015422 3300009176 Bacteria 5934
380 Ga0105242_10089137 3300009176 Bacteria 2592
381 Ga0105248_10002352 3300009177 Bacteria 20987
382 Ga0105248_10016506 3300009177 Bacteria 8129
383 Ga0105248_10054237 3300009177 Bacteria 4495
384 Ga0105248_10094570 3300009177 Bacteria 3365
385 Ga0105248_10156373 3300009177 Bacteria 2573
386 Ga0105237_10000010 3300009545 Bacteria 324528
387 Ga0105237_10000248 3300009545 Bacteria 76402
388 Ga0105237_10000555 3300009545 Bacteria 52309
389 Ga0105237_10001565 3300009545 Bacteria 29826
390 Ga0105237_10002158 3300009545 Bacteria 24754
391 Ga0105237_10003834 3300009545 Bacteria 17679
392 Ga0105237_10003907 3300009545 Bacteria 17471
393 Ga0105237_10011674 3300009545 Bacteria 9296
394 Ga0105237_10024011 3300009545 Bacteria 6238
395 Ga0105237_10025875 3300009545 Bacteria 5999
396 Ga0105237_10035862 3300009545 Bacteria 5017
397 Ga0105237_10042642 3300009545 Bacteria 4574
398 Ga0105237_10066881 3300009545 Bacteria 3588
399 Ga0105237_10087386 3300009545 Bacteria 3107
400 Ga0105237_10088721 3300009545 Bacteria 3081
401 Ga0105237_10091556 3300009545 Bacteria 3030
402 Ga0105238_10003699 3300009551 Bacteria 15225
403 Ga0105238_10004027 3300009551 Bacteria 14580
404 Ga0105238_10004448 3300009551 Bacteria 13894
405 Ga0105238_10004647 3300009551 Bacteria 13589
406 Ga0105238_10009815 3300009551 Bacteria 9586
407 Ga0105238_10015237 3300009551 Bacteria 7783
408 Ga0105238_10024923 3300009551 Bacteria 6096
409 Ga0105238_10032996 3300009551 Bacteria 5268
410 Ga0105238_10034131 3300009551 Bacteria 5177
411 Ga0105238_10035163 3300009551 Bacteria 5095
412 Ga0105249_10006383 3300009553 Bacteria 10255
413 Ga0105249_10016022 3300009553 Bacteria 6644
414 Ga0105249_10043073 3300009553 Bacteria 4106
415 Ga0105239_10000048 3300010375 Bacteria 177855
416 Ga0105239_10000970 3300010375 Bacteria 40255
417 Ga0105239_10000996 3300010375 Bacteria 39663
418 Ga0105239_10001560 3300010375 Bacteria 30320
419 Ga0105239_10003467 3300010375 Bacteria 19300
420 Ga0105239_10005119 3300010375 Bacteria 15475
421 Ga0105239_10009015 3300010375 Bacteria 11293
422 Ga0105239_10082394 3300010375 Bacteria 3542
423 Ga0105239_10088886 3300010375 Bacteria 3406
424 Ga0105239_10120461 3300010375 Bacteria 2914
425 Ga0157373_10047748 3300013100 Bacteria 3053
426 Ga0157371_10000601 3300013102 Bacteria 42868
427 Ga0157371_10003863 3300013102 Bacteria 13369
428 Ga0157371_10014715 3300013102 Bacteria 5888
429 Ga0157370_10001897 3300013104 Bacteria 25729
430 Ga0157370_10002430 3300013104 Bacteria 22453
431 Ga0157370_10002944 3300013104 Bacteria 20270
432 Ga0157370_10006375 3300013104 Bacteria 13020
433 Ga0157370_10007304 3300013104 Bacteria 12057
434 Ga0157370_10010515 3300013104 Bacteria 9745
435 Ga0157370_10010755 3300013104 Bacteria 9623
436 Ga0157370_10035604 3300013104 Bacteria 4836
437 Ga0157370_10043870 3300013104 Bacteria 4301
438 Ga0157370_10111260 3300013104 Bacteria 2560
439 Ga0157370_10131639 3300013104 Bacteria 2333
440 Ga0157369_10004260 3300013105 Bacteria 16922
441 Ga0157369_10005126 3300013105 Bacteria 15340
442 Ga0157369_10005519 3300013105 Bacteria 14689
443 Ga0157369_10006060 3300013105 Bacteria 14033
444 Ga0157369_10006355 3300013105 Bacteria 13713
445 Ga0157369_10021623 3300013105 Bacteria 7194
446 Ga0157369_10027624 3300013105 Bacteria 6287
447 Ga0157369_10050582 3300013105 Bacteria 4500
448 Ga0157369_10094622 3300013105 Bacteria 3189
449 Ga0171463_1007 3300013249 Bacteria 301198
450 Ga0157374_10000029 3300013296 Bacteria 211547
451 Ga0157374_10000261 3300013296 Bacteria 48629
452 Ga0157374_10000833 3300013296 Bacteria 27020
453 Ga0157378_10000228 3300013297 Bacteria 54876
454 Ga0157378_10000272 3300013297 Bacteria 50377
455 Ga0157378_10003102 3300013297 Bacteria 14775
456 Ga0157378_10003339 3300013297 Bacteria 14275
457 Ga0157378_10018182 3300013297 Bacteria 6171
458 Ga0157378_10070747 3300013297 Bacteria 3133
459 Ga0163162_10001429 3300013306 Bacteria 22232
460 Ga0163162_10002485 3300013306 Bacteria 17417
461 Ga0163162_10003915 3300013306 Bacteria 14297
462 Ga0163162_10004794 3300013306 Bacteria 13050
463 Ga0163162_10005992 3300013306 Bacteria 11773
464 Ga0163162_10032033 3300013306 Bacteria 5218
465 Ga0163162_10060993 3300013306 Bacteria 3809
466 Ga0157372_10001117 3300013307 Bacteria 29145
467 Ga0157372_10001446 3300013307 Bacteria 25695
468 Ga0157372_10003819 3300013307 Bacteria 16187
469 Ga0157372_10004228 3300013307 Bacteria 15351
470 Ga0157372_10004709 3300013307 Bacteria 14488
471 Ga0157372_10007988 3300013307 Bacteria 11255
472 Ga0157372_10010774 3300013307 Bacteria 9733
473 Ga0157372_10018450 3300013307 Bacteria 7500
474 Ga0157372_10034045 3300013307 Bacteria 5598
475 Ga0157372_10067054 3300013307 Bacteria 4032
476 Ga0157372_10086797 3300013307 Bacteria 3550
477 Ga0157372_10185966 3300013307 Bacteria 2406
478 Ga0157375_10002044 3300013308 Bacteria 17407
479 Ga0157375_10005063 3300013308 Bacteria 11440
480 Ga0157375_10006449 3300013308 Bacteria 10221
481 Ga0163163_10007450 3300014325 Bacteria 9656
482 Ga0163163_10124369 3300014325 Bacteria 2616
483 Ga0157380_10001777 3300014326 Bacteria 14240
484 Ga0157380_10009370 3300014326 Bacteria 7012
485 Ga0157380_10011071 3300014326 Bacteria 6505
486 Ga0157380_10011751 3300014326 Bacteria 6331
487 Ga0157380_10062053 3300014326 Bacteria 2993
488 Ga0182008_10006626 3300014497 Bacteria 6451
489 Ga0157377_10009758 3300014745 Bacteria 4725
490 Ga0157379_10010290 3300014968 Bacteria 8147
491 Ga0157379_10099197 3300014968 Bacteria 2615
492 Ga0157376_10000288 3300014969 Bacteria 34012
493 Ga0157376_10000721 3300014969 Bacteria 21396
494 Ga0157376_10023530 3300014969 Bacteria 4822
495 Ga0182007_10003718 3300015262 Bacteria 7131
496 Ga0182005_1000234 3300015265 Bacteria 35809
497 Ga0183363_1071 3300015690 Bacteria 30324
498 Ga0163161_10097246 3300017792 Bacteria 2187
499 Ga0206353_10810131 3300020082 Bacteria 2535
500 Ga0214544_1000110 3300021320 Bacteria 113143
501 Ga0214542_1000032 3300021321 Bacteria 171690
502 Ga0214543_1000016 3300021327 Bacteria 295257
503 Ga0213872_10031734 3300021361 Bacteria 2422
504 Ga0228711_1000911 3300022739 Bacteria 40698
505 Ga0228710_1001018 3300022740 Bacteria 40304
506 Ga0224572_1000136 3300024225 Bacteria 6174
507 Ga0228598_1003449 3300024227 Bacteria 3401
508 Ga0209435_100027 3300025206 Bacteria 196217
509 Ga0209436_100957 3300025208 Bacteria 11337
510 Ga0209674_100059 3300025226 Bacteria 282517
511 Ga0209674_100790 3300025226 Bacteria 10649
512 Ga0209672_100004 3300025228 Bacteria 1467504
513 Ga0209672_100008 3300025228 Bacteria 946876
514 Ga0209672_102368 3300025228 Bacteria 4731
515 Ga0209563_100036 3300025230 Bacteria 448275
516 Ga0209437_100051 3300025233 Bacteria 392523
517 Ga0209437_100060 3300025233 Bacteria 355034
518 Ga0209437_100064 3300025233 Bacteria 334360
519 Ga0209258_100003 3300025242 Bacteria 1467504
520 Ga0209258_100004 3300025242 Bacteria 1376422
521 Ga0209258_100008 3300025242 Bacteria 1009355
522 Ga0209646_1000086 3300025246 Bacteria 196217
523 Ga0209646_1000091 3300025246 Bacteria 188727
524 Ga0209026_1000045 3300025250 Bacteria 263431
525 Ga0209026_1000050 3300025250 Bacteria 254994
526 Ga0209026_1000082 3300025250 Bacteria 196315
527 Ga0209026_1000497 3300025250 Bacteria 28577
528 Ga0209677_101303 3300025253 Bacteria 11070
529 Ga0209677_103674 3300025253 Bacteria 4821
530 Ga0209148_1000025 3300025254 Bacteria 663262
531 Ga0209148_1000053 3300025254 Bacteria 373506
532 Ga0209148_1005795 3300025254 Bacteria 2764
533 Ga0209759_1000063 3300025256 Bacteria 196315
534 Ga0209759_1000212 3300025256 Bacteria 89756
535 Ga0209759_1000229 3300025256 Bacteria 83575
536 Ga0209233_1000081 3300025261 Bacteria 336832
537 Ga0209233_1000160 3300025261 Bacteria 159035
538 Ga0209233_1000228 3300025261 Bacteria 100100
539 Ga0209233_1001833 3300025261 Bacteria 8155
540 Ga0209233_1002148 3300025261 Bacteria 7412
541 Ga0209233_1002543 3300025261 Bacteria 6655
542 Ga0209455_1000004 3300025272 Bacteria 1467504
543 Ga0209455_1000007 3300025272 Bacteria 1157983
544 Ga0209455_1000405 3300025272 Bacteria 35180
545 Ga0209673_1000014 3300025273 Bacteria 537082
546 Ga0209673_1000018 3300025273 Bacteria 458281
547 Ga0209130_1000003 3300025284 Bacteria 677988
548 Ga0209130_1000017 3300025284 Bacteria 388431
549 Ga0209130_1001489 3300025284 Bacteria 15214
550 Ga0209130_1007205 3300025284 Bacteria 3475
551 Ga0209675_1000040 3300025291 Bacteria 247535
552 Ga0209676_1000014 3300025292 Bacteria 793514
553 Ga0209676_1000093 3300025292 Bacteria 250231
554 Ga0209676_1011256 3300025292 Bacteria 3627
555 Ga0209025_1000092 3300025294 Bacteria 247020
556 Ga0209025_1000161 3300025294 Bacteria 166506
557 Ga0209025_1000282 3300025294 Bacteria 115627
558 Ga0209564_1000013 3300025295 Bacteria 775755
559 Ga0209564_1000159 3300025295 Bacteria 164319
560 Ga0209564_1000218 3300025295 Bacteria 130563
561 Ga0209758_1000051 3300025297 Bacteria 342477
562 Ga0209758_1000169 3300025297 Bacteria 149782
563 Ga0209758_1000974 3300025297 Bacteria 38538
564 Ga0209758_1001557 3300025297 Bacteria 26313
565 Ga0209758_1003127 3300025297 Bacteria 15627
566 Ga0209050_1000177 3300025298 Bacteria 146637
567 Ga0209050_1003437 3300025298 Bacteria 11665
568 Ga0209256_1000153 3300025299 Bacteria 144736
569 Ga0207426_1000006 3300025302 Bacteria 1025969
570 Ga0207426_1000011 3300025302 Bacteria 791203
571 Ga0207426_1000182 3300025302 Bacteria 155724
572 Ga0207426_1000251 3300025302 Bacteria 117462
573 Ga0209051_1002454 3300025303 Bacteria 13276
574 Ga0209257_1000007 3300025304 Bacteria 1564415
575 Ga0209257_1003777 3300025304 Bacteria 12500
576 Ga0207697_10004556 3300025315 Bacteria 6600
577 Ga0207656_10009682 3300025321 Bacteria 3582
578 Ga0207656_10010296 3300025321 Bacteria 3499
579 Ga0207656_10031110 3300025321 Bacteria 2209
580 Ga0207713_1000393 3300025735 Bacteria 47322
581 Ga0207682_10002884 3300025893 Bacteria 7588
582 Ga0207682_10005238 3300025893 Bacteria 5303
583 Ga0207682_10005627 3300025893 Bacteria 5095
584 Ga0207682_10008737 3300025893 Bacteria 4007
585 Ga0207692_10016492 3300025898 Bacteria 3274
586 Ga0207710_10041730 3300025900 Bacteria 2035
587 Ga0207680_10000035 3300025903 Bacteria 73889
588 Ga0207647_10012031 3300025904 Bacteria 6039
589 Ga0207647_10058204 3300025904 Bacteria 2367
590 Ga0207645_10001460 3300025907 Bacteria 19330
591 Ga0207645_10002051 3300025907 Bacteria 16146
592 Ga0207645_10003092 3300025907 Bacteria 12763
593 Ga0207645_10057360 3300025907 Bacteria 2486
594 Ga0207645_10080504 3300025907 Bacteria 2088
595 Ga0207643_10000186 3300025908 Bacteria 42591
596 Ga0207705_10012043 3300025909 Bacteria 6249
597 Ga0207705_10022270 3300025909 Bacteria 4519
598 Ga0207684_10022962 3300025910 Bacteria 5328
599 Ga0207654_10007114 3300025911 Bacteria 5636
600 Ga0207654_10019867 3300025911 Bacteria 3553
601 Ga0207654_10071771 3300025911 Bacteria 2059
602 Ga0207707_10002439 3300025912 Bacteria 16735
603 Ga0207707_10010871 3300025912 Bacteria 7912
604 Ga0207707_10022710 3300025912 Bacteria 5486
605 Ga0207707_10041539 3300025912 Bacteria 4016
606 Ga0207707_10047537 3300025912 Bacteria 3737
607 Ga0207707_10128331 3300025912 Bacteria 2217
608 Ga0207695_10000021 3300025913 Bacteria 679399
609 Ga0207695_10000037 3300025913 Bacteria 476303
610 Ga0207695_10000043 3300025913 Bacteria 444585
611 Ga0207695_10000071 3300025913 Bacteria 315568
612 Ga0207695_10000316 3300025913 Bacteria 116327
613 Ga0207695_10000400 3300025913 Bacteria 97035
614 Ga0207695_10000684 3300025913 Bacteria 66519
615 Ga0207695_10001264 3300025913 Bacteria 43057
616 Ga0207695_10002490 3300025913 Bacteria 27118
617 Ga0207695_10005506 3300025913 Bacteria 16761
618 Ga0207695_10006194 3300025913 Bacteria 15592
619 Ga0207695_10064512 3300025913 Bacteria 3770
620 Ga0207695_10092636 3300025913 Bacteria 3032
621 Ga0207695_10104863 3300025913 Bacteria 2815
622 Ga0207695_10160233 3300025913 Bacteria 2182
623 Ga0207671_10000013 3300025914 Bacteria 478458
624 Ga0207671_10000671 3300025914 Bacteria 44609
625 Ga0207671_10001017 3300025914 Bacteria 34299
626 Ga0207671_10001497 3300025914 Bacteria 26937
627 Ga0207671_10003026 3300025914 Bacteria 17227
628 Ga0207671_10004291 3300025914 Bacteria 13713
629 Ga0207671_10010727 3300025914 Bacteria 7533
630 Ga0207671_10012580 3300025914 Bacteria 6796
631 Ga0207671_10021713 3300025914 Bacteria 4865
632 Ga0207671_10025759 3300025914 Bacteria 4414
633 Ga0207671_10058017 3300025914 Bacteria 2869
634 Ga0207671_10062741 3300025914 Bacteria 2760
635 Ga0207671_10066806 3300025914 Bacteria 2677
636 Ga0207671_10136495 3300025914 Bacteria 1886
637 Ga0207693_10000012 3300025915 Bacteria 154708
638 Ga0207693_10000058 3300025915 Bacteria 94726
639 Ga0207693_10001160 3300025915 Bacteria 23505
640 Ga0207693_10002891 3300025915 Bacteria 14857
641 Ga0207663_10000280 3300025916 Bacteria 22295
642 Ga0207663_10003100 3300025916 Bacteria 8065
643 Ga0207663_10005945 3300025916 Bacteria 6194
644 Ga0207663_10013299 3300025916 Bacteria 4469
645 Ga0207660_10014532 3300025917 Bacteria 5179
646 Ga0207660_10074288 3300025917 Bacteria 2481
647 Ga0207662_10034238 3300025918 Bacteria 2964
648 Ga0207662_10050234 3300025918 Bacteria 2476
649 Ga0207657_10001149 3300025919 Bacteria 28146
650 Ga0207657_10001270 3300025919 Bacteria 26894
651 Ga0207657_10003162 3300025919 Bacteria 17611
652 Ga0207657_10016143 3300025919 Bacteria 7210
653 Ga0207657_10017091 3300025919 Bacteria 6974
654 Ga0207657_10019127 3300025919 Bacteria 6513
655 Ga0207657_10034826 3300025919 Bacteria 4521
656 Ga0207649_10017722 3300025920 Bacteria 4038
657 Ga0207649_10024633 3300025920 Bacteria 3501
658 Ga0207652_10005535 3300025921 Bacteria 10239
659 Ga0207652_10011118 3300025921 Bacteria 7255
660 Ga0207652_10027955 3300025921 Bacteria 4703
661 Ga0207681_10000771 3300025923 Bacteria 21062
662 Ga0207681_10038217 3300025923 Bacteria 3178
663 Ga0207694_10002105 3300025924 Bacteria 16415
664 Ga0207694_10002468 3300025924 Bacteria 15055
665 Ga0207694_10002748 3300025924 Bacteria 14213
666 Ga0207694_10005169 3300025924 Bacteria 10077
667 Ga0207694_10015380 3300025924 Bacteria 5770
668 Ga0207694_10021256 3300025924 Bacteria 4916
669 Ga0207694_10048422 3300025924 Bacteria 3289
670 Ga0207694_10150728 3300025924 Bacteria 1873
671 Ga0207650_10000560 3300025925 Bacteria 30230
672 Ga0207650_10002377 3300025925 Bacteria 13097
673 Ga0207650_10011897 3300025925 Bacteria 5996
674 Ga0207650_10025705 3300025925 Bacteria 4196
675 Ga0207650_10026512 3300025925 Bacteria 4135
676 Ga0207659_10000451 3300025926 Bacteria 24742
677 Ga0207659_10006382 3300025926 Bacteria 7222
678 Ga0207659_10019606 3300025926 Bacteria 4456
679 Ga0207659_10033134 3300025926 Bacteria 3552
680 Ga0207659_10069542 3300025926 Bacteria 2564
681 Ga0207659_10091043 3300025926 Bacteria 2278
682 Ga0207687_10001118 3300025927 Bacteria 18248
683 Ga0207687_10006970 3300025927 Bacteria 7447
684 Ga0207687_10013555 3300025927 Bacteria 5321
685 Ga0207687_10030809 3300025927 Bacteria 3620
686 Ga0207700_10003116 3300025928 Bacteria 9583
687 Ga0207700_10067226 3300025928 Bacteria 2742
688 Ga0207664_10000098 3300025929 Bacteria 80444
689 Ga0207664_10003289 3300025929 Bacteria 10742
690 Ga0207644_10011258 3300025931 Bacteria 5913
691 Ga0207644_10016472 3300025931 Bacteria 4973
692 Ga0207644_10019754 3300025931 Bacteria 4575
693 Ga0207644_10021070 3300025931 Bacteria 4438
694 Ga0207644_10037618 3300025931 Bacteria 3405
695 Ga0207644_10051140 3300025931 Bacteria 2965
696 Ga0207706_10000877 3300025933 Bacteria 30889
697 Ga0207706_10048964 3300025933 Bacteria 3736
698 Ga0207706_10146261 3300025933 Bacteria 2079
699 Ga0207686_10001460 3300025934 Bacteria 13366
700 Ga0207686_10030493 3300025934 Bacteria 3193
701 Ga0207709_10013935 3300025935 Bacteria 4440
702 Ga0207709_10042165 3300025935 Bacteria 2743
703 Ga0207670_10005467 3300025936 Bacteria 6975
704 Ga0207670_10009202 3300025936 Bacteria 5622
705 Ga0207670_10079073 3300025936 Bacteria 2295
706 Ga0207669_10008342 3300025937 Bacteria 4857
707 Ga0207669_10036801 3300025937 Bacteria 2801
708 Ga0207704_10038806 3300025938 Bacteria 2766
709 Ga0207691_10001534 3300025940 Bacteria 22975
710 Ga0207691_10004954 3300025940 Bacteria 12848
711 Ga0207691_10005269 3300025940 Bacteria 12483
712 Ga0207691_10007322 3300025940 Bacteria 10646
713 Ga0207691_10010941 3300025940 Bacteria 8709
714 Ga0207691_10013082 3300025940 Bacteria 7945
715 Ga0207691_10014958 3300025940 Bacteria 7391
716 Ga0207691_10015118 3300025940 Bacteria 7345
717 Ga0207691_10015412 3300025940 Bacteria 7272
718 Ga0207691_10030613 3300025940 Bacteria 5027
719 Ga0207691_10039099 3300025940 Bacteria 4390
720 Ga0207691_10136948 3300025940 Bacteria 2159
721 Ga0207711_10000207 3300025941 Bacteria 62922
722 Ga0207711_10003165 3300025941 Bacteria 14351
723 Ga0207711_10012387 3300025941 Bacteria 7089
724 Ga0207711_10017327 3300025941 Bacteria 5985
725 Ga0207689_10000409 3300025942 Bacteria 40335
726 Ga0207689_10000550 3300025942 Bacteria 35746
727 Ga0207689_10000760 3300025942 Bacteria 30926
728 Ga0207689_10005369 3300025942 Bacteria 11471
729 Ga0207689_10015742 3300025942 Bacteria 6404
730 Ga0207689_10016509 3300025942 Bacteria 6250
731 Ga0207689_10058301 3300025942 Bacteria 3176
732 Ga0207689_10065241 3300025942 Unclassified 2995
733 Ga0207661_10000365 3300025944 Bacteria 29025
734 Ga0207661_10002307 3300025944 Bacteria 13140
735 Ga0207661_10011069 3300025944 Bacteria 6520
736 Ga0207661_10014005 3300025944 Bacteria 5866
737 Ga0207661_10060715 3300025944 Bacteria 3052
738 Ga0207661_10101465 3300025944 Bacteria 2417
739 Ga0207679_10001204 3300025945 Bacteria 16442
740 Ga0207679_10002603 3300025945 Bacteria 11112
741 Ga0207667_10000081 3300025949 Bacteria 162100
742 Ga0207667_10000135 3300025949 Bacteria 111565
743 Ga0207667_10000177 3300025949 Bacteria 92852
744 Ga0207667_10002602 3300025949 Bacteria 22393
745 Ga0207667_10003158 3300025949 Bacteria 20383
746 Ga0207667_10004524 3300025949 Bacteria 17034
747 Ga0207667_10007079 3300025949 Bacteria 13547
748 Ga0207667_10010462 3300025949 Bacteria 10842
749 Ga0207667_10015326 3300025949 Bacteria 8715
750 Ga0207667_10015806 3300025949 Bacteria 8553
751 Ga0207667_10026254 3300025949 Bacteria 6365
752 Ga0207667_10039797 3300025949 Bacteria 5006
753 Ga0207667_10098895 3300025949 Bacteria 3010
754 Ga0207667_10116840 3300025949 Bacteria 2749
755 Ga0207712_10026330 3300025961 Bacteria 3872
756 Ga0207712_10033856 3300025961 Bacteria 3457
757 Ga0207668_10056683 3300025972 Bacteria 2730
758 Ga0207668_10067709 3300025972 Bacteria 2536
759 Ga0207668_10111988 3300025972 Bacteria 2049
760 Ga0207640_10000223 3300025981 Bacteria 40042
761 Ga0207640_10002318 3300025981 Bacteria 10227
762 Ga0207640_10023258 3300025981 Bacteria 3722
763 Ga0207640_10032095 3300025981 Bacteria 3254
764 Ga0207658_10000030 3300025986 Bacteria 168693
765 Ga0207658_10000818 3300025986 Bacteria 25979
766 Ga0207658_10036460 3300025986 Bacteria 3526
767 Ga0207658_10117742 3300025986 Bacteria 2112
768 Ga0207677_10004108 3300026023 Bacteria 7787
769 Ga0207677_10018320 3300026023 Bacteria 4199
770 Ga0207677_10022413 3300026023 Bacteria 3881
771 Ga0207677_10036833 3300026023 Bacteria 3192
772 Ga0207677_10057314 3300026023 Bacteria 2674
773 Ga0207677_10090940 3300026023 Bacteria 2219
774 Ga0207703_10010303 3300026035 Bacteria 7321
775 Ga0207703_10017240 3300026035 Bacteria 5637
776 Ga0207703_10026368 3300026035 Bacteria 4573
777 Ga0207703_10038038 3300026035 Bacteria 3837
778 Ga0207703_10089463 3300026035 Bacteria 2586
779 Ga0207703_10174297 3300026035 Bacteria 1894
780 Ga0207639_10031212 3300026041 Bacteria 3914
781 Ga0207639_10032444 3300026041 Bacteria 3845
782 Ga0207639_10056919 3300026041 Bacteria 2999
783 Ga0207639_10064622 3300026041 Bacteria 2837
784 Ga0207639_10080984 3300026041 Bacteria 2570
785 Ga0207678_10011277 3300026067 Bacteria 7846
786 Ga0207678_10014250 3300026067 Bacteria 6989
787 Ga0207678_10034046 3300026067 Bacteria 4437
788 Ga0207678_10063094 3300026067 Bacteria 3184
789 Ga0207678_10082198 3300026067 Bacteria 2756
790 Ga0207678_10120869 3300026067 Bacteria 2235
791 Ga0207708_10000774 3300026075 Bacteria 24066
792 Ga0207708_10010414 3300026075 Bacteria 6903
793 Ga0207708_10016060 3300026075 Bacteria 5623
794 Ga0207702_10000654 3300026078 Bacteria 37703
795 Ga0207702_10001923 3300026078 Bacteria 20310
796 Ga0207702_10028235 3300026078 Bacteria 4662
797 Ga0207702_10047907 3300026078 Bacteria 3603
798 Ga0207702_10184247 3300026078 Bacteria 1925
799 Ga0207641_10000013 3300026088 Bacteria 341378
800 Ga0207641_10000089 3300026088 Bacteria 128603
801 Ga0207641_10003358 3300026088 Bacteria 14226
802 Ga0207641_10031952 3300026088 Bacteria 4368
803 Ga0207641_10046760 3300026088 Bacteria 3649
804 Ga0207641_10061416 3300026088 Bacteria 3205
805 Ga0207641_10082299 3300026088 Bacteria 2796
806 Ga0207641_10108350 3300026088 Bacteria 2458
807 Ga0207648_10009106 3300026089 Bacteria 9542
808 Ga0207648_10015625 3300026089 Bacteria 6975
809 Ga0207648_10032020 3300026089 Bacteria 4646
810 Ga0207648_10061960 3300026089 Bacteria 3261
811 Ga0207676_10005841 3300026095 Bacteria 8697
812 Ga0207676_10009328 3300026095 Bacteria 6983
813 Ga0207676_10011036 3300026095 Bacteria 6446
814 Ga0207676_10019779 3300026095 Bacteria 4917
815 Ga0207676_10038263 3300026095 Bacteria 3659
816 Ga0207676_10082977 3300026095 Bacteria 2609
817 Ga0207676_10099321 3300026095 Unclassified 2409
818 Ga0207674_10000042 3300026116 Bacteria 126790
819 Ga0207674_10000159 3300026116 Bacteria 80339
820 Ga0207674_10000357 3300026116 Bacteria 59170
821 Ga0207674_10002307 3300026116 Bacteria 24170
822 Ga0207674_10004196 3300026116 Bacteria 17388
823 Ga0207674_10009845 3300026116 Bacteria 10882
824 Ga0207674_10049085 3300026116 Bacteria 4318
825 Ga0207674_10119515 3300026116 Bacteria 2604
826 Ga0207675_100000576 3300026118 Bacteria 35873
827 Ga0207675_100000872 3300026118 Bacteria 30060
828 Ga0207675_100001526 3300026118 Bacteria 23217
829 Ga0207675_100003993 3300026118 Bacteria 14308
830 Ga0207675_100022740 3300026118 Bacteria 5834
831 Ga0207675_100041926 3300026118 Bacteria 4274
832 Ga0207675_100080135 3300026118 Bacteria 3061
833 Ga0207675_100159215 3300026118 Bacteria 2153
834 Ga0207683_10001016 3300026121 Bacteria 25569
835 Ga0207683_10002413 3300026121 Bacteria 16319
836 Ga0207683_10003038 3300026121 Bacteria 14665
837 Ga0207698_10000144 3300026142 Bacteria 45298
838 Ga0207698_10000786 3300026142 Bacteria 18484
839 Ga0207698_10008141 3300026142 Bacteria 6608
840 Ga0207698_10025890 3300026142 Bacteria 4142
841 Ga0207698_10038399 3300026142 Bacteria 3538
842 Ga0207698_10099257 3300026142 Bacteria 2408
843 Ga0209281_1000314 3300027111 Bacteria 86424
844 Ga0209281_1002256 3300027111 Bacteria 8166
845 Ga0209371_1000044 3300027312 Bacteria 327086
846 Ga0209371_1000537 3300027312 Bacteria 35888
847 Ga0209371_1006193 3300027312 Bacteria 4507
848 Ga0209282_1000068 3300027666 Bacteria 85817
849 Ga0209971_1001426 3300027682 Bacteria 5957
850 Ga0209974_10003272 3300027876 Bacteria 5857
851 Ga0207428_10059322 3300027907 Bacteria 3034
852 Ga0265356_1000046 3300028017 Bacteria 20120
853 Ga0268266_10000010 3300028379 Bacteria 1030233
854 Ga0268266_10000049 3300028379 Bacteria 307763
855 Ga0268266_10017537 3300028379 Bacteria 6108
856 Ga0268266_10045180 3300028379 Bacteria 3768
857 Ga0268266_10095979 3300028379 Bacteria 2604
858 Ga0268266_10125486 3300028379 Bacteria 2290
859 Ga0268265_10034418 3300028380 Bacteria 3692
860 Ga0268264_10000012 3300028381 Bacteria 521740
861 Ga0268264_10000041 3300028381 Bacteria 372501
862 Ga0268264_10004058 3300028381 Bacteria 12531
863 Ga0268264_10022094 3300028381 Bacteria 5192
864 Ga0268264_10047533 3300028381 Bacteria 3568
865 Ga0268264_10147620 3300028381 Bacteria 2104
866 Ga0265337_1002039 3300028556 Bacteria 9583
867 Ga0265319_1003800 3300028563 Bacteria 7741
868 Ga0265334_10000665 3300028573 Bacteria 17269
869 Ga0265318_10001512 3300028577 Bacteria 13550
870 Ga0265318_10009367 3300028577 Bacteria 4310
871 Ga0265336_10000091 3300028666 Bacteria 69365
872 Ga0307517_10002048 3300028786 Bacteria 32795
873 Ga0265338_10000094 3300028800 Bacteria 168366
874 Ga0265338_10009598 3300028800 Bacteria 11502
875 Ga0265338_10023109 3300028800 Bacteria 6403
876 Ga0265338_10025148 3300028800 Bacteria 6055
877 Ga0265324_10002737 3300029957 Bacteria 8761
878 Ga0268256_1000046 3300030500 Bacteria 327003
879 Ga0268256_1001478 3300030500 Bacteria 13997
880 Ga0268256_1003531 3300030500 Bacteria 7004
881 Ga0265762_1000015 3300030760 Bacteria 19541
882 Ga0265762_1000247 3300030760 Bacteria 8830
883 Ga0265762_1004398 3300030760 Bacteria 2525
884 Ga0265330_10002898 3300031235 Bacteria 9158
885 Ga0265325_10035530 3300031241 Bacteria 2646
886 Ga0265340_10000777 3300031247 Bacteria 18137
887 Ga0265331_10003629 3300031250 Bacteria 9867
888 Ga0265331_10011722 3300031250 Bacteria 4791
889 Ga0265327_10000101 3300031251 Bacteria 188671
890 Ga0265316_10026826 3300031344 Bacteria 4784
891 Ga0307513_10006796 3300031456 Bacteria 14918
892 Ga0307513_10016752 3300031456 Bacteria 8818
893 Ga0307513_10025919 3300031456 Bacteria 6773
894 Ga0307513_10031051 3300031456 Bacteria 6056
895 Ga0307513_10086444 3300031456 Bacteria 3214
896 Ga0307509_10023313 3300031507 Bacteria 6956
897 Ga0307509_10036387 3300031507 Bacteria 5390
898 Ga0307408_100000012 3300031548 Bacteria 408153
899 Ga0265313_10003442 3300031595 Bacteria 12803
900 Ga0265313_10004963 3300031595 Bacteria 9956
901 Ga0265313_10005404 3300031595 Bacteria 9416
902 Ga0307508_10091929 3300031616 Bacteria 2623
903 Ga0265314_10000503 3300031711 Bacteria 50401
904 Ga0265314_10001520 3300031711 Bacteria 25622
905 Ga0265314_10052896 3300031711 Bacteria 2820
906 Ga0265342_10021086 3300031712 Bacteria 4168
907 Ga0265342_10028130 3300031712 Bacteria 3506
908 Ga0307516_10001218 3300031730 Bacteria 35831
909 Ga0307516_10001770 3300031730 Bacteria 29691
910 Ga0307516_10019622 3300031730 Bacteria 6999
911 Ga0307405_10005296 3300031731 Bacteria 6203
912 Ga0307405_10072248 3300031731 Bacteria 2223
913 Ga0307413_10036155 3300031824 Bacteria 2841
914 Ga0307410_10004936 3300031852 Bacteria 6990
915 Ga0307410_10019486 3300031852 Bacteria 4128
916 Ga0307410_10051036 3300031852 Bacteria 2785
917 Ga0307406_10022045 3300031901 Bacteria 3775
918 Ga0307406_10036211 3300031901 Bacteria 3039
919 Ga0307407_10010579 3300031903 Bacteria 4359
920 Ga0307407_10011071 3300031903 Bacteria 4279
921 Ga0307407_10037317 3300031903 Bacteria 2684
922 Ga0315914_1000937 3300031967 Bacteria 41175
923 Ga0307409_100001880 3300031995 Bacteria 10706
924 Ga0307409_100002278 3300031995 Bacteria 9942
925 Ga0307409_100004509 3300031995 Bacteria 7842
926 Ga0307409_100009088 3300031995 Bacteria 6084
927 Ga0307416_100030348 3300032002 Bacteria 4055
928 Ga0307416_100031608 3300032002 Bacteria 3988
929 Ga0307416_100050165 3300032002 Bacteria 3325
930 Ga0307416_100050227 3300032002 Bacteria 3323
931 Ga0307411_10003510 3300032005 Bacteria 7290
932 Ga0307411_10014317 3300032005 Bacteria 4408
933 Ga0307411_10024286 3300032005 Bacteria 3610
934 Ga0307510_10000091 3300033180 Bacteria 68694
935 Ga0307510_10102238 3300033180 Bacteria 2649
936 Ga0315913_1042274 3300033430 Bacteria 2336
937 Ga0315915_1000007 3300033464 Bacteria 319225
938 Ga0373940_0011049 3300035088 Bacteria 2137
939 Ga0373932_0000899 3300035112 Bacteria 8694
940 Ga0373936_0001015 3300035113 Bacteria 10035
941 Ga0373941_0001232 3300035115 Bacteria 5370
942 Ga0373945_0003061 3300035116 Bacteria 5258
943 Ga0373953_0006044 3300035117 Bacteria 3967
944 Ga0373954_0000003 3300035118 Bacteria 137757
945 Ga0373954_0002478 3300035118 Bacteria 7748
946 Ga0373954_0005203 3300035118 Bacteria 5621
947 Ga0373954_0005212 3300035118 Bacteria 5617
948 Ga0373957_0007832 3300035120 Bacteria 3433
949 Ga0373943_0000669 3300035170 Bacteria 14898
950 Ga0373943_0064677 3300035170 Bacteria 1837
951 Ga0373946_0013112 3300035171 Bacteria 3110
952 Ga0373955_0000118 3300035172 Bacteria 31719
953 Ga0373942_0004480 3300035207 Bacteria 3239
954 Ga0373931_0000240 3300035691 Bacteria 23366
955 Ga0373935_0011104 3300035692 Bacteria 5408
956 Ga0373935_0024658 3300035692 Bacteria 3704
957 Ga0373935_0026953 3300035692 Bacteria 3552
958 Ga0373927_0000282 3300035695 Bacteria 40021
959 Ga0373927_0067639 3300035695 Bacteria 2312
960 Ga0373933_0000658 3300035724 Bacteria 21439
961 Ga0373933_0002250 3300035724 Bacteria 11004
962 Ga0373933_0003016 3300035724 Bacteria 9394
963 Ga0373933_0004189 3300035724 Bacteria 7948
964 Ga0373947_0001632 3300035725 Bacteria 13760
965 Ga0373937_0000440 3300036401 Bacteria 38396
966 Ga0373937_0005019 3300036401 Bacteria 11262
967 Ga0373937_0005357 3300036401 Bacteria 10972
968 Ga0373937_0010310 3300036401 Bacteria 8156
969 Ga0373937_0027922 3300036401 Bacteria 5105
970 Ga0316584_0005493 3300036712 Bacteria 8513
971 Ga0316584_0059153 3300036712 Bacteria 2870
972 Ga0316584_0141540 3300036712 Bacteria 1793
973 Ga0373925_0002387 3300037068 Bacteria 15061
974 Ga0373925_0003223 3300037068 Bacteria 12747
975 Ga0373925_0041873 3300037068 Bacteria 3397
976 Ga0395899_0000226 3300037312 Bacteria 76657
977 Ga0395899_0001647 3300037312 Bacteria 18642
978 Ga0395899_0002404 3300037312 Bacteria 15206
979 Ga0395899_0005993 3300037312 Bacteria 9443
980 Ga0395900_0000011 3300037418 Bacteria 421926
981 Ga0395900_0037630 3300037418 Bacteria 4988
982 Ga0395898_0000029 3300037466 Bacteria 370667
983 Ga0395901_0104306 3300038443 Bacteria 2975
984 Ga0395901_0111869 3300038443 Bacteria 2868
985 Ga0395901_0150207 3300038443 Bacteria 2448
986 Ga0400483_135128 3300039062 Bacteria 5440
987 Ga0400483_140637 3300039062 Bacteria 7787
988 Ga0400483_161077 3300039062 Bacteria 2410
989 Ga0400483_220317 3300039062 Bacteria 6723
990 Ga0400483_254359 3300039062 Bacteria 25463
991 Ga0436365_0827866 3300039437 Bacteria 4050
992 Ga0436365_1141651 3300039437 Bacteria 3449
993 Ga0436363_1450588 3300039450 Bacteria 18752
994 Ga0439436_0003081 3300041404 Bacteria 5058
995 Ga0439436_0005279 3300041404 Bacteria 3957
996 Ga0439465_0000738 3300041413 Bacteria 10126
997 Ga0451789_0328144 3300041443 Bacteria 2543
998 Ga0451800_0252034 3300041459 Bacteria 3476
999 Ga0451800_0551749 3300041459 Bacteria 1854
1000 Ga0451806_025862 3300041462 Bacteria 6474
1001 Ga0451804_0359998 3300041463 Bacteria 3440
1002 Ga0451804_0727978 3300041463 Bacteria 2622
1003 Ga0451807_1729626 3300041486 Bacteria 3452
1004 Ga0451843_0331670 3300041509 Bacteria 2547
1005 Ga0451853_3542700 3300041512 Bacteria 5059
1006 Ga0439445_0006216 3300042004 Bacteria 2743
1007 Ga0439449_0000136 3300042007 Bacteria 24746
1008 Ga0439449_0019743 3300042007 Bacteria 2526
1009 Ga0439457_004730 3300042014 Bacteria 3514
1010 Ga0450919_001002 3300042121 Bacteria 3653
1011 Ga0451577_0000068 3300042876 Bacteria 241923
1012 Ga0451577_0005641 3300042876 Bacteria 12717
1013 Ga0451577_0020693 3300042876 Bacteria 6033
1014 Ga0466969_0004147 3300044656 Bacteria 7696
1015 Ga0466972_0000051 3300044658 Bacteria 114011
1016 Ga0466972_0000066 3300044658 Bacteria 103012
1017 Ga0466972_0002650 3300044658 Bacteria 8858
1018 Ga0466972_0016077 3300044658 Bacteria 3741
1019 Ga0466972_0058382 3300044658 Bacteria 1853
1020 Ga0453683_0031443 3300044673 Bacteria 3354
1021 Ga0453683_0039345 3300044673 Bacteria 2972
1022 Ga0466966_0010972 3300044684 Bacteria 6012
1023 Ga0466966_0035209 3300044684 Bacteria 3236
1024 Ga0466961_0000057 3300044693 Bacteria 66922
1025 Ga0466961_0000299 3300044693 Bacteria 32965
1026 Ga0466964_0011561 3300044706 Bacteria 3336
1027 Ga0453684_0000126 3300044712 Bacteria 336395
1028 Ga0453684_0000841 3300044712 Bacteria 103501
1029 Ga0466970_0002111 3300044765 Bacteria 9599
1030 Ga0466970_0009896 3300044765 Bacteria 4828
1031 Ga0466970_0056253 3300044765 Bacteria 2102
1032 Ga0466957_0000150 3300044842 Bacteria 30176
1033 Ga0466957_0016708 3300044842 Bacteria 4293
1034 Ga0466959_0000006 3300045049 Bacteria 192678
1035 Ga0466959_0043416 3300045049 Bacteria 3314
1036 Ga0451576_0000231 3300045051 Bacteria 136040
1037 Ga0451576_0007420 3300045051 Bacteria 13115
1038 Ga0451576_0012737 3300045051 Bacteria 9442
1039 Ga0451576_0229500 3300045051 Bacteria 1938
1040 Ga0466958_0005665 3300045836 Bacteria 6745
1041 Ga0466958_0085200 3300045836 Bacteria 1949
1042 Ga0466967_0000360 3300045976 Bacteria 21122
1043 Ga0495627_007125 3300046453 Bacteria 4323
1044 Ga0495590_0005537 3300046457 Bacteria 4998
1045 Ga0495629_0037018 3300046459 Bacteria 3440
1046 Ga0495629_0163140 3300046459 Bacteria 1548
1047 Ga0495638_0000004 3300046460 Bacteria 700795
1048 Ga0495638_0002027 3300046460 Bacteria 17231
1049 Ga0495638_0006731 3300046460 Bacteria 8325
1050 Ga0495638_0014676 3300046460 Bacteria 5285
1051 Ga0495638_0058764 3300046460 Bacteria 2382
1052 Ga0495641_0035593 3300046461 Bacteria 2345
1053 Ga0495651_0014430 3300046462 Bacteria 6107
1054 Ga0495651_0015743 3300046462 Bacteria 5856
1055 Ga0495653_0060752 3300046463 Bacteria 2862
1056 Ga0495580_0001774 3300046472 Bacteria 18967
1057 Ga0495580_0004783 3300046472 Bacteria 11341
1058 Ga0495580_0008629 3300046472 Bacteria 8084
1059 Ga0495580_0036679 3300046472 Bacteria 3519
1060 Ga0495580_0069235 3300046472 Bacteria 2466
1061 Ga0495582_0034864 3300046473 Bacteria 2766
1062 Ga0495585_0001026 3300046492 Bacteria 23232
1063 Ga0495585_0011525 3300046492 Bacteria 5232
1064 Ga0495606_0002804 3300046507 Bacteria 19399
1065 Ga0495606_0006725 3300046507 Bacteria 10527
1066 Ga0495608_0000270 3300046511 Bacteria 37043
1067 Ga0495608_0006211 3300046511 Bacteria 8481
1068 Ga0495610_0012871 3300046512 Bacteria 5003
1069 Ga0495616_0001662 3300046513 Bacteria 15216
1070 Ga0495616_0003016 3300046513 Bacteria 10931
1071 Ga0495628_0002765 3300046516 Bacteria 15713
1072 Ga0495628_0041453 3300046516 Bacteria 3675
1073 Ga0495630_0007543 3300046517 Bacteria 7776
1074 Ga0495632_0010918 3300046519 Bacteria 5334
1075 Ga0495632_0032924 3300046519 Bacteria 2666
1076 Ga0495648_0004838 3300046524 Bacteria 11366
1077 Ga0495648_0005660 3300046524 Bacteria 10338
1078 Ga0495652_0002808 3300046529 Bacteria 17553
1079 Ga0495652_0008827 3300046529 Bacteria 9173
1080 Ga0495652_0097198 3300046529 Bacteria 2396
1081 Ga0495665_0013184 3300046531 Bacteria 4473
1082 Ga0495665_0026539 3300046531 Bacteria 3111
1083 Ga0495640_0002870 3300046533 Bacteria 13875
1084 Ga0495586_0000323 3300046535 Bacteria 30293
1085 Ga0495587_0023217 3300046536 Bacteria 3813
1086 Ga0495587_0026329 3300046536 Bacteria 3548
1087 Ga0495645_0005153 3300046543 Bacteria 8952
1088 Ga0495645_0043951 3300046543 Bacteria 3259
1089 Ga0495622_0014803 3300046557 Bacteria 3625
1090 Ga0495667_0000653 3300046559 Bacteria 22156
1091 Ga0495656_0018397 3300046615 Bacteria 2682
1092 Ga0495668_0000179 3300046616 Bacteria 94559
1093 Ga0495668_0005368 3300046616 Bacteria 8731
1094 Ga0495634_0001658 3300046642 Bacteria 19385
1095 Ga0495634_0017168 3300046642 Bacteria 5169
1096 Ga0495634_0019325 3300046642 Bacteria 4843
1097 Ga0495611_0000010 3300046648 Bacteria 156661
1098 Ga0495611_0000844 3300046648 Bacteria 16812
1099 Ga0495625_0001614 3300046660 Bacteria 26595
1100 Ga0495625_0009215 3300046660 Bacteria 8289
1101 Ga0495625_0011056 3300046660 Bacteria 7398
1102 Ga0495625_0034067 3300046660 Bacteria 3760
1103 Ga0495625_0034296 3300046660 Bacteria 3747
1104 Ga0495625_0061513 3300046660 Bacteria 2657
1105 Ga0495635_0000837 3300046663 Bacteria 20135
1106 Ga0495661_0021737 3300046665 Bacteria 4178
1107 Ga0495657_0002784 3300046675 Bacteria 14541
1108 Ga0495599_0001615 3300046678 Bacteria 12991
1109 Ga0495599_0005057 3300046678 Bacteria 7849
1110 Ga0495623_0003238 3300046679 Bacteria 10759
1111 Ga0495623_0007552 3300046679 Bacteria 7056
1112 Ga0495623_0025609 3300046679 Bacteria 3800
1113 Ga0495658_0061016 3300046683 Bacteria 2164
1114 Ga0495658_0087543 3300046683 Bacteria 1839
1115 Ga0495613_0009447 3300046689 Bacteria 7233
1116 Ga0495613_0043426 3300046689 Bacteria 3326
1117 Ga0495624_0009244 3300046690 Bacteria 6831
1118 Ga0495624_0081444 3300046690 Bacteria 2005
1119 Ga0495670_0081391 3300046691 Bacteria 1650
1120 Ga0495649_0001020 3300046694 Bacteria 21971
1121 Ga0495649_0005526 3300046694 Bacteria 8008
1122 Ga0495649_0053860 3300046694 Bacteria 2177
1123 Ga0495600_0005445 3300046809 Bacteria 7674
1124 Ga0495600_0118906 3300046809 Bacteria 1719
1125 Ga0495604_0002515 3300047317 Bacteria 14637
1126 Ga0495604_0003727 3300047317 Bacteria 12141
1127 Ga0495604_0005797 3300047317 Bacteria 9801
1128 Ga0495674_0009625 3300047319 Bacteria 9181
1129 Ga0495674_0012533 3300047319 Bacteria 7986
1130 Ga0495674_0042305 3300047319 Bacteria 4065
1131 Ga0495672_0009330 3300047320 Bacteria 7122
1132 Ga0495676_0052125 3300047321 Bacteria 3268
1133 Ga0495680_0004648 3300047322 Bacteria 13080
1134 Ga0495680_0020835 3300047322 Bacteria 5503
1135 Ga0495687_000001 3300047443 Bacteria 1215582
1136 Ga0495687_000009 3300047443 Bacteria 419317
1137 Ga0495679_036026 3300047446 Bacteria 1565
1138 Ga0495684_0015901 3300047471 Bacteria 5794
1139 Ga0495686_0000004 3300047472 Bacteria 869019
1140 Ga0495686_0023882 3300047472 Bacteria 4023
1141 Ga0495602_0023585 3300048088 Bacteria 5991
1142 Ga0495602_0029691 3300048088 Bacteria 5198
1143 Ga0496100_0017401 3300048903 Bacteria 4242
1144 Ga0496101_0064709 3300048904 Bacteria 2664
1145 Ga0496102_0005187 3300048905 Bacteria 11063
1146 Ga0496102_0012401 3300048905 Bacteria 7375
1147 Ga0496102_0103176 3300048905 Bacteria 2652
1148 Ga0496104_0032002 3300048907 Bacteria 4895
1149 Ga0496104_0079247 3300048907 Bacteria 3131
1150 Ga0496106_0002960 3300048909 Bacteria 12635
1151 Ga0496106_0005704 3300048909 Bacteria 9209
1152 Ga0496106_0011577 3300048909 Bacteria 6519
1153 Ga0496107_0003901 3300048910 Bacteria 10022
1154 Ga0496107_0007566 3300048910 Bacteria 7494
1155 Ga0496107_0060605 3300048910 Bacteria 2739
1156 Ga0496108_0005837 3300048911 Bacteria 9980
1157 Ga0496108_0032985 3300048911 Bacteria 4302
1158 Ga0496108_0043971 3300048911 Bacteria 3730
1159 Ga0496109_0003008 3300048912 Bacteria 14067
1160 Ga0496109_0296872 3300048912 Bacteria 1523
1161 Ga0496110_0005614 3300048913 Bacteria 9846
1162 Ga0496110_0028527 3300048913 Bacteria 4795
1163 Ga0496110_0028692 3300048913 Bacteria 4782
1164 Ga0496111_0002995 3300048914 Bacteria 10344
1165 Ga0496111_0130730 3300048914 Bacteria 1858
1166 Ga0496112_0101172 3300048915 Bacteria 2852
1167 Ga0496113_0038228 3300048916 Bacteria 3528
1168 Ga0496114_0058004 3300048917 Bacteria 3232
1169 Ga0496115_0016796 3300048918 Bacteria 5579
1170 Ga0496115_0041847 3300048918 Bacteria 3648
1171 Ga0496115_0071229 3300048918 Bacteria 2819
1172 Ga0496115_0127876 3300048918 Bacteria 2093
1173 Ga0496117_0001420 3300048920 Bacteria 34726
1174 Ga0496118_0021248 3300048921 Bacteria 5721
1175 Ga0496119_0002453 3300048922 Bacteria 20369
1176 Ga0496120_0002147 3300048923 Bacteria 21033
1177 Ga0496120_0004189 3300048923 Bacteria 12335
1178 Ga0496121_0000007 3300048924 Bacteria 942516
1179 Ga0496121_0005500 3300048924 Bacteria 16216
1180 Ga0496122_0003345 3300048925 Bacteria 21155
1181 Ga0496122_0045919 3300048925 Bacteria 3389
1182 Ga0496123_0002721 3300048926 Bacteria 21201
1183 Ga0496123_0079477 3300048926 Bacteria 2004
1184 Ga0496124_0001442 3300048927 Bacteria 35166
1185 Ga0496124_0058331 3300048927 Bacteria 3247
1186 Ga0496125_0000044 3300048928 Bacteria 296762
1187 Ga0496126_0090035 3300048929 Bacteria 2700
1188 Ga0501300_001090 3300049523 Bacteria 4116
1189 Ga0501032_0005396 3300049569 Bacteria 9511
1190 Ga0501032_0013929 3300049569 Bacteria 5705
1191 Ga0501032_0031220 3300049569 Bacteria 3653
1192 Ga0501032_0071255 3300049569 Bacteria 2317
1193 Ga0501033_0003857 3300049570 Bacteria 12187
1194 Ga0501033_0040411 3300049570 Bacteria 3482
1195 Ga0501034_0000477 3300049571 Bacteria 65874
1196 Ga0501034_0016290 3300049571 Bacteria 7631
1197 Ga0501034_0022923 3300049571 Bacteria 6361
1198 Ga0501034_0032866 3300049571 Bacteria 5268
1199 Ga0501034_0042626 3300049571 Bacteria 4594
1200 Ga0501034_0102613 3300049571 Bacteria 2854
1201 Ga0501034_0156859 3300049571 Bacteria 2249
1202 Ga0501036_0002308 3300049572 Bacteria 14905
1203 Ga0501036_0012979 3300049572 Bacteria 6917
1204 Ga0501036_0023902 3300049572 Bacteria 5151
1205 Ga0501037_0003677 3300049573 Bacteria 11133
1206 Ga0501038_0000362 3300049574 Bacteria 39190
1207 Ga0501038_0001672 3300049574 Bacteria 20558
1208 Ga0501038_0035578 3300049574 Bacteria 4371
1209 Ga0501038_0039102 3300049574 Bacteria 4151
1210 Ga0501039_0002263 3300049575 Bacteria 14296
1211 Ga0501039_0003220 3300049575 Bacteria 12205
1212 Ga0501039_0005719 3300049575 Bacteria 9420
1213 Ga0501039_0036966 3300049575 Bacteria 3768
1214 Ga0501040_0001734 3300049576 Bacteria 13998
1215 Ga0501041_0000591 3300049577 Bacteria 18966
1216 Ga0501041_0015839 3300049577 Bacteria 4481
1217 Ga0501042_0014377 3300049578 Bacteria 5402
1218 Ga0501042_0151708 3300049578 Bacteria 1671
1219 Ga0501043_0003719 3300049579 Bacteria 12536
1220 Ga0501043_0007335 3300049579 Bacteria 8753
1221 Ga0501043_0039299 3300049579 Bacteria 3719
1222 Ga0501043_0049366 3300049579 Bacteria 3308
1223 Ga0501043_0056907 3300049579 Bacteria 3071
1224 Ga0501046_0000247 3300049580 Bacteria 55379
1225 Ga0501046_0001124 3300049580 Bacteria 26161
1226 Ga0501046_0015436 3300049580 Bacteria 6416
1227 Ga0501047_0007188 3300049581 Bacteria 10464
1228 Ga0501047_0010933 3300049581 Bacteria 8586
1229 Ga0501047_0013273 3300049581 Bacteria 7804
1230 Ga0501047_0059030 3300049581 Bacteria 3704
1231 Ga0501047_0147768 3300049581 Bacteria 2227
1232 Ga0501048_0000787 3300049582 Bacteria 23234
1233 Ga0501048_0080704 3300049582 Bacteria 2295
1234 Ga0501048_0098115 3300049582 Bacteria 2067
1235 Ga0501067_0024303 3300049583 Bacteria 3361
1236 Ga0501068_0002040 3300049584 Bacteria 10769
1237 Ga0501068_0007617 3300049584 Bacteria 5992
1238 Ga0501068_0091481 3300049584 Bacteria 1877
1239 Ga0501069_0002295 3300049585 Bacteria 9663
1240 Ga0501069_0049721 3300049585 Bacteria 2330
1241 Ga0501070_0001510 3300049586 Bacteria 20741
1242 Ga0501070_0004418 3300049586 Bacteria 12070
1243 Ga0501070_0005410 3300049586 Bacteria 10895
1244 Ga0501070_0018072 3300049586 Bacteria 5916
1245 Ga0501070_0046458 3300049586 Bacteria 3611
1246 Ga0501070_0048360 3300049586 Bacteria 3533
1247 Ga0501070_0107492 3300049586 Bacteria 2306
1248 Ga0501071_0000987 3300049587 Bacteria 15589
1249 Ga0501071_0001727 3300049587 Bacteria 12833
1250 Ga0501071_0012879 3300049587 Bacteria 5689
1251 Ga0501071_0012893 3300049587 Bacteria 5686
1252 Ga0501071_0046321 3300049587 Bacteria 3123
1253 Ga0501072_0001146 3300049588 Bacteria 19686
1254 Ga0501072_0001988 3300049588 Bacteria 15228
1255 Ga0501072_0003004 3300049588 Bacteria 12719
1256 Ga0501072_0041045 3300049588 Bacteria 3634
1257 Ga0501073_0000641 3300049589 Bacteria 24548
1258 Ga0501073_0001384 3300049589 Bacteria 17881
1259 Ga0501073_0001548 3300049589 Bacteria 17041
1260 Ga0501073_0001695 3300049589 Bacteria 16330
1261 Ga0501074_0001537 3300049590 Bacteria 15604
1262 Ga0501074_0004126 3300049590 Bacteria 10371
1263 Ga0501074_0019172 3300049590 Bacteria 4966
1264 Ga0501074_0039808 3300049590 Bacteria 3404
1265 Ga0501075_0000564 3300049591 Bacteria 22512
1266 Ga0501075_0002462 3300049591 Bacteria 12340
1267 Ga0501075_0014218 3300049591 Bacteria 5702
1268 Ga0501075_0035690 3300049591 Bacteria 3709
1269 Ga0501076_0000481 3300049592 Bacteria 25172
1270 Ga0501076_0003134 3300049592 Bacteria 11526
1271 Ga0501076_0014132 3300049592 Bacteria 6004
1272 Ga0501077_0001149 3300049593 Bacteria 15989
1273 Ga0501077_0005387 3300049593 Bacteria 7778
1274 Ga0501077_0007486 3300049593 Bacteria 6738
1275 Ga0501198_001072 3300049649 Bacteria 3493
1276 Ga0501201_001338 3300049651 Bacteria 2314
1277 Ga0501235_000298 3300049669 Bacteria 9349
1278 Ga0501257_003399 3300049686 Bacteria 3413
1279 Ga0501225_0002947 3300049705 Bacteria 5215
1280 Ga0501225_0003366 3300049705 Unclassified 4855
1281 Ga0501225_0012951 3300049705 Bacteria 2338
1282 Ga0501079_0000033 3300049741 Bacteria 59060
1283 Ga0501079_0000889 3300049741 Bacteria 20471
1284 Ga0501079_0025822 3300049741 Bacteria 4505
1285 Ga0501080_0000394 3300049742 Bacteria 33653
1286 Ga0501080_0001783 3300049742 Bacteria 18446
1287 Ga0501080_0007140 3300049742 Bacteria 10079
1288 Ga0501080_0007353 3300049742 Bacteria 9940
1289 Ga0501080_0009919 3300049742 Bacteria 8701
1290 Ga0501080_0023189 3300049742 Bacteria 5755
1291 Ga0501080_0024728 3300049742 Bacteria 5570
1292 Ga0501080_0093306 3300049742 Bacteria 2795
1293 Ga0501080_0158592 3300049742 Bacteria 2090
1294 Ga0501081_0000241 3300049743 Bacteria 27997
1295 Ga0501081_0011157 3300049743 Bacteria 5876
1296 Ga0501083_0007984 3300049744 Bacteria 7495
1297 Ga0501083_0010528 3300049744 Bacteria 6508
1298 Ga0501083_0020789 3300049744 Bacteria 4564
1299 Ga0501083_0052137 3300049744 Bacteria 2749
1300 Ga0501264_000010 3300049761 Bacteria 27684
1301 Ga0501035_0010083 3300049822 Bacteria 8770
1302 Ga0501035_0022127 3300049822 Bacteria 5839
1303 Ga0501044_0003662 3300049823 Bacteria 17288
1304 Ga0501044_0006170 3300049823 Bacteria 13248
1305 Ga0501044_0043756 3300049823 Bacteria 4650
1306 Ga0501044_0057472 3300049823 Bacteria 3992
1307 Ga0501044_0125062 3300049823 Bacteria 2569
1308 Ga0501045_0000347 3300049824 Bacteria 27417
1309 Ga0501045_0011373 3300049824 Bacteria 6249
1310 Ga0501045_0019579 3300049824 Bacteria 4828
1311 nmdc:mga0k408_258_c1 3300050493 Bacteria 28885
1312 nmdc:mga05p37_2217_c1 3300050507 Bacteria 22636
1313 nmdc:mga05p37_257531_c1 3300050507 Bacteria 2090
1314 nmdc:mga09592_34056_c1 3300050508 Bacteria 4257
1315 nmdc:mga0qj67_46927_c1 3300050509 Bacteria 3411
1316 nmdc:mga06r32_102693_c1 3300050510 Bacteria 2807
1317 nmdc:mga08y16_54505_c1 3300050511 Bacteria 4178
1318 nmdc:mga08y16_6181_c1 3300050511 Bacteria 12563
1319 nmdc:mga08y16_79473_c1 3300050511 Bacteria 3418
1320 nmdc:mga0n895_10435_c1 3300050512 Bacteria 8205
1321 nmdc:mga0n895_25131_c1 3300050512 Bacteria 5624
1322 nmdc:mga0rr50_11309_c1 3300050513 Bacteria 5707
1323 nmdc:mga08x19_34734_c1 3300050514 Bacteria 3188
1324 nmdc:mga0a205_53348_c1 3300050515 Bacteria 3902
1325 Ga0495601_0009477 3300053077 Bacteria 5763
1326 Ga0500578_0000042 3300053086 Bacteria 129410
1327 Ga0500644_0000080 3300053088 Bacteria 58728
1328 Ga0500583_0000023 3300053092 Bacteria 123584
1329 Ga0500583_0001035 3300053092 Bacteria 7931
1330 Ga0500583_0012576 3300053092 Bacteria 3235
1331 Ga0500641_0000741 3300053096 Bacteria 11819
1332 Ga0500569_000719 3300053109 Bacteria 5760
1333 Ga0500618_000574 3300053125 Bacteria 22705
1334 Ga0500642_0016020 3300053130 Bacteria 2837
1335 Ga0500559_0001354 3300053136 Bacteria 14070
1336 Ga0500568_0000880 3300053139 Bacteria 21086
1337 Ga0500568_0007674 3300053139 Bacteria 5269
1338 Ga0500568_0012030 3300053139 Bacteria 3989
1339 Ga0500568_0020782 3300053139 Bacteria 2835
1340 Ga0500590_035259 3300053148 Bacteria 2590
1341 Ga0500616_0000074 3300053153 Bacteria 222910
1342 Ga0500616_0000091 3300053153 Bacteria 184945
1343 Ga0500616_0000997 3300053153 Bacteria 30619
1344 Ga0500616_0014927 3300053153 Bacteria 4452
1345 Ga0500616_0058341 3300053153 Bacteria 2008
1346 Ga0500622_0005344 3300053156 Bacteria 7738
1347 Ga0500627_0000584 3300053158 Bacteria 9768
1348 Ga0500634_0014029 3300053161 Bacteria 4219
1349 Ga0501084_0002318 3300054114 Bacteria 15291
1350 Ga0501084_0002542 3300054114 Bacteria 14699
1351 Ga0501084_0006383 3300054114 Bacteria 9688
1352 Ga0501084_0020192 3300054114 Bacteria 5553
1353 Ga0501084_0053775 3300054114 Bacteria 3368
1354 Ga0587070_003293 3300059491 Bacteria 1930
1355 Ga0587076_000108 3300059645 Bacteria 4838
1356 Ga0587076_000791 3300059645 Bacteria 2868
1357 Ga0587071_000307 3300060344 Bacteria 4391
1358 Ga0587111_0000129 3300060346 Bacteria 5229
1359 Ga0587111_0001272 3300060346 Bacteria 2950
1360 Ga0501082_0001046 3300060353 Bacteria 24490
1361 Ga0501082_0002017 3300060353 Bacteria 17846
1362 Ga0501082_0027798 3300060353 Bacteria 4871
1363 Ga0501082_0071046 3300060353 Bacteria 2997
1364 Ga0530510_0001017 3300061734 Bacteria 18586
1365 Ga0530510_0001365 3300061734 Bacteria 16322

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2937868953 2937873257 452
2 3300050507 nmdc:mga05p37_257531_c1 nmdc:mga05p37_257531_c1_635_2080 457
3 3300046460 Ga0495638_0014676 Ga0495638_0014676_14_1426 470
4 3300009545 Ga0105237_10066881 Ga0105237_100668811 477
5 3300053156 Ga0500622_0005344 Ga0500622_0005344_6261_7700 477
6 3300049578 Ga0501042_0151708 Ga0501042_0151708_218_1657 478
7 3300048912 Ga0496109_0296872 Ga0496109_0296872_29_1504 479
8 3300038443 Ga0395901_0150207 Ga0395901_0150207_40_1512 490
9 3300046615 Ga0495656_0018397 Ga0495656_0018397_1165_2637 490
10 3300046642 Ga0495634_0019325 Ga0495634_0019325_3149_4795 490
11 3300047322 Ga0495680_0020835 Ga0495680_0020835_3830_5476 490
12 3300046459 Ga0495629_0163140 Ga0495629_0163140_19_1533 503
13 3300046691 Ga0495670_0081391 Ga0495670_0081391_68_1594 506
14 3300047321 Ga0495676_0052125 Ga0495676_0052125_1687_3213 506
15 3300047446 Ga0495679_036026 Ga0495679_036026_25_1551 506
16 3300035170 Ga0373943_0064677 Ga0373943_0064677_264_1796 507
17 3300035724 Ga0373933_0004189 Ga0373933_0004189_3564_5276 512
18 3300046462 Ga0495651_0015743 Ga0495651_0015743_3809_5521 512
19 3300046511 Ga0495608_0000270 Ga0495608_0000270_21807_23519 512
20 3300046516 Ga0495628_0041453 Ga0495628_0041453_181_1893 512
21 3300046529 Ga0495652_0002808 Ga0495652_0002808_10830_12542 512
22 3300046559 Ga0495667_0000653 Ga0495667_0000653_13626_15338 512
23 3300046663 Ga0495635_0000837 Ga0495635_0000837_14540_16252 512
24 3300046675 Ga0495657_0002784 Ga0495657_0002784_3400_5112 512
25 3300046678 Ga0495599_0001615 Ga0495599_0001615_7734_9446 512
26 3300046679 Ga0495623_0025609 Ga0495623_0025609_103_1815 512
27 3300047317 Ga0495604_0003727 Ga0495604_0003727_6655_8367 512
28 3300047319 Ga0495674_0012533 Ga0495674_0012533_2400_4112 512
29 3300047471 Ga0495684_0015901 Ga0495684_0015901_259_1971 512
30 3300048088 Ga0495602_0023585 Ga0495602_0023585_462_2174 512
31 iso_pu_bacteria 2958144490 2958145476 512
32 3300053096 Ga0500641_0000741 Ga0500641_0000741_3230_4870 519
33 3300026067 Ga0207678_10063094 Ga0207678_100630942 521
34 3300048918 Ga0496115_0127876 Ga0496115_0127876_26_1621 530
35 3300025927 Ga0207687_10001118 Ga0207687_1000111813 531
36 3300048914 Ga0496111_0130730 Ga0496111_0130730_241_1845 531
37 3300049742 Ga0501080_0158592 Ga0501080_0158592_473_2077 531
38 3300050512 nmdc:mga0n895_10435_c1 nmdc:mga0n895_10435_c1_6594_8195 531
39 3300002987 JGI25159J45721_1000251 JGI25159J45721_10002514 532
40 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001311 532
41 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001450 532
42 3300004625 Ga0055543_1000089 Ga0055543_100008970 532
43 3300005262 Ga0065165_1000008 Ga0065165_1000008145 532
44 3300025284 Ga0209130_1000003 Ga0209130_1000003464 532
45 3300025302 Ga0207426_1000011 Ga0207426_1000011312 532
46 3300005563 Ga0068855_100061690 Ga0068855_1000616902 534
47 3300006353 Ga0075370_10002970 Ga0075370_100029706 534
48 3300009093 Ga0105240_10000014 Ga0105240_10000014228 534
49 3300009545 Ga0105237_10002158 Ga0105237_1000215820 534
50 3300013104 Ga0157370_10002430 Ga0157370_100024305 534
51 3300015262 Ga0182007_10003718 Ga0182007_100037182 534
52 3300025253 Ga0209677_103674 Ga0209677_1036743 534
53 3300025261 Ga0209233_1000228 Ga0209233_100022884 534
54 3300025913 Ga0207695_10000037 Ga0207695_10000037229 534
55 3300025914 Ga0207671_10001017 Ga0207671_100010179 534
56 3300025949 Ga0207667_10098895 Ga0207667_100988952 534
57 3300009093 Ga0105240_10017784 Ga0105240_100177846 535
58 3300013104 Ga0157370_10001897 Ga0157370_1000189710 535
59 3300013105 Ga0157369_10005126 Ga0157369_100051268 535
60 3300013307 Ga0157372_10001446 Ga0157372_100014469 535
61 3300021321 Ga0214542_1000032 Ga0214542_10000322 535
62 3300021327 Ga0214543_1000016 Ga0214543_1000016276 535
63 3300006946 Ga0079104_1008144 Ga0079104_10081443 536
64 3300006946 Ga0079104_1010485 Ga0079104_10104852 536
65 3300022739 Ga0228711_1000911 Ga0228711_100091139 536
66 3300022740 Ga0228710_1001018 Ga0228710_100101839 536
67 3300027111 Ga0209281_1000314 Ga0209281_10003142 536
68 3300027111 Ga0209281_1002256 Ga0209281_10022562 536
69 3300027666 Ga0209282_1000068 Ga0209282_10000682 536
70 3300031967 Ga0315914_1000937 Ga0315914_100093739 536
71 3300033430 Ga0315913_1042274 Ga0315913_10422742 536
72 3300033464 Ga0315915_1000007 Ga0315915_1000007243 536
73 3300021320 Ga0214544_1000110 Ga0214544_100011025 538
74 3300046809 Ga0495600_0118906 Ga0495600_0118906_41_1666 539
75 3300030760 Ga0265762_1004398 Ga0265762_10043981 541
76 3300049571 Ga0501034_0016290 Ga0501034_0016290_1531_3255 543
77 3300001979 JGI24740J21852_10000201 JGI24740J21852_1000020121 544
78 3300002704 JGI25155J39150_1000014 JGI25155J39150_1000014160 544
79 3300002705 JGI25156J39149_1000083 JGI25156J39149_100008330 544
80 3300002737 JGI25162J39368_1000532 JGI25162J39368_100053227 544
81 3300002737 JGI25162J39368_1002261 JGI25162J39368_10022612 544
82 3300002738 JGI25154J39366_1000052 JGI25154J39366_10000526 544
83 3300002738 JGI25154J39366_1000139 JGI25154J39366_100013913 544
84 3300002741 JGI25157J39369_1000110 JGI25157J39369_100011049 544
85 3300003214 JGI25165J46597_1000692 JGI25165J46597_100069225 544
86 3300003214 JGI25165J46597_1001949 JGI25165J46597_10019497 544
87 3300025206 Ga0209435_100027 Ga0209435_100027156 544
88 3300025233 Ga0209437_100051 Ga0209437_1000514 544
89 3300025233 Ga0209437_100060 Ga0209437_100060226 544
90 3300025246 Ga0209646_1000086 Ga0209646_1000086156 544
91 3300025250 Ga0209026_1000082 Ga0209026_1000082156 544
92 3300025254 Ga0209148_1005795 Ga0209148_10057952 544
93 3300025256 Ga0209759_1000063 Ga0209759_100006345 544
94 3300025261 Ga0209233_1000160 Ga0209233_10001604 544
95 3300025261 Ga0209233_1001833 Ga0209233_10018332 544
96 3300046472 Ga0495580_0036679 Ga0495580_0036679_217_1860 545
97 iso_pu_bacteria 2871481445 2871485832 545
98 3300005336 Ga0070680_100011873 Ga0070680_1000118735 546
99 3300005530 Ga0070679_100001049 Ga0070679_10000104921 546
100 3300005535 Ga0070684_100002184 Ga0070684_10000218415 546
101 3300005539 Ga0068853_100042327 Ga0068853_1000423272 546
102 3300005563 Ga0068855_100006138 Ga0068855_1000061386 546
103 3300005577 Ga0068857_100002231 Ga0068857_10000223112 546
104 3300005614 Ga0068856_100007867 Ga0068856_1000078674 546
105 3300005614 Ga0068856_100008937 Ga0068856_1000089379 546
106 3300005616 Ga0068852_100030311 Ga0068852_1000303113 546
107 3300005617 Ga0068859_100004436 Ga0068859_1000044364 546
108 3300006237 Ga0097621_100017336 Ga0097621_1000173365 546
109 3300006931 Ga0097620_100004436 Ga0097620_1000044364 546
110 3300009093 Ga0105240_10005587 Ga0105240_1000558710 546
111 3300009148 Ga0105243_10051389 Ga0105243_100513892 546
112 3300009545 Ga0105237_10088721 Ga0105237_100887212 546
113 3300009551 Ga0105238_10004647 Ga0105238_1000464713 546
114 3300010375 Ga0105239_10001560 Ga0105239_100015609 546
115 3300010375 Ga0105239_10005119 Ga0105239_100051199 546
116 3300013104 Ga0157370_10002944 Ga0157370_1000294411 546
117 3300013105 Ga0157369_10004260 Ga0157369_1000426016 546
118 3300013105 Ga0157369_10005519 Ga0157369_1000551910 546
119 3300013307 Ga0157372_10007988 Ga0157372_100079889 546
120 3300025297 Ga0209758_1001557 Ga0209758_10015573 546
121 3300025321 Ga0207656_10031110 Ga0207656_100311102 546
122 3300025911 Ga0207654_10007114 Ga0207654_100071145 546
123 3300025912 Ga0207707_10002439 Ga0207707_1000243916 546
124 3300025913 Ga0207695_10001264 Ga0207695_1000126427 546
125 3300025913 Ga0207695_10005506 Ga0207695_1000550610 546
126 3300025921 Ga0207652_10027955 Ga0207652_100279553 546
127 3300025924 Ga0207694_10002105 Ga0207694_100021053 546
128 3300025927 Ga0207687_10013555 Ga0207687_100135554 546
129 3300025941 Ga0207711_10000207 Ga0207711_1000020715 546
130 3300025941 Ga0207711_10017327 Ga0207711_100173272 546
131 3300025944 Ga0207661_10000365 Ga0207661_1000036515 546
132 3300025944 Ga0207661_10060715 Ga0207661_100607152 546
133 3300025949 Ga0207667_10003158 Ga0207667_1000315810 546
134 3300025949 Ga0207667_10004524 Ga0207667_1000452416 546
135 3300025949 Ga0207667_10015806 Ga0207667_100158064 546
136 3300026041 Ga0207639_10032444 Ga0207639_100324442 546
137 3300026078 Ga0207702_10028235 Ga0207702_100282353 546
138 3300026078 Ga0207702_10047907 Ga0207702_100479072 546
139 3300026078 Ga0207702_10184247 Ga0207702_101842471 546
140 3300026116 Ga0207674_10000042 Ga0207674_1000004217 546
141 3300026116 Ga0207674_10004196 Ga0207674_100041963 546
142 3300031595 Ga0265313_10005404 Ga0265313_100054042 546
143 3300035117 Ga0373953_0006044 Ga0373953_0006044_99_1742 546
144 3300035118 Ga0373954_0002478 Ga0373954_0002478_2202_3845 546
145 3300035118 Ga0373954_0005203 Ga0373954_0005203_1430_3073 546
146 3300035692 Ga0373935_0026953 Ga0373935_0026953_13_1656 546
147 3300036401 Ga0373937_0005019 Ga0373937_0005019_9195_10838 546
148 3300036401 Ga0373937_0027922 Ga0373937_0027922_961_2604 546
149 3300046462 Ga0495651_0014430 Ga0495651_0014430_3716_5359 546
150 3300046529 Ga0495652_0008827 Ga0495652_0008827_1383_3026 546
151 3300046529 Ga0495652_0097198 Ga0495652_0097198_674_2317 546
152 3300046536 Ga0495587_0026329 Ga0495587_0026329_333_1976 546
153 3300046642 Ga0495634_0017168 Ga0495634_0017168_206_1849 546
154 3300046678 Ga0495599_0005057 Ga0495599_0005057_4814_6457 546
155 3300049571 Ga0501034_0000477 Ga0501034_0000477_59672_61399 546
156 3300049584 Ga0501068_0091481 Ga0501068_0091481_86_1735 546
157 3300049588 Ga0501072_0001146 Ga0501072_0001146_9058_10785 546
158 3300048918 Ga0496115_0041847 Ga0496115_0041847_1396_3114 547
159 3300002987 JGI25159J45721_1000004 JGI25159J45721_10000042 551
160 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021207 551
161 3300003374 JGI25161J50226_1002682 JGI25161J50226_10026822 551
162 3300003771 Ga0055526_1019460 Ga0055526_10194601 551
163 3300003775 Ga0055524_1022102 Ga0055524_10221022 551
164 3300004625 Ga0055543_1000102 Ga0055543_10001022 551
165 3300005262 Ga0065165_1000033 Ga0065165_1000033207 551
166 3300006847 Ga0075431_100131322 Ga0075431_1001313221 551
167 3300009147 Ga0114129_10078631 Ga0114129_100786312 551
168 3300013249 Ga0171463_1007 Ga0171463_1007105 551
169 3300015690 Ga0183363_1071 Ga0183363_107128 551
170 3300025208 Ga0209436_100957 Ga0209436_10095710 551
171 3300025284 Ga0209130_1000017 Ga0209130_1000017177 551
172 3300025292 Ga0209676_1011256 Ga0209676_10112562 551
173 3300025294 Ga0209025_1000161 Ga0209025_10001612 551
174 3300025295 Ga0209564_1000013 Ga0209564_1000013625 551
175 3300025299 Ga0209256_1000153 Ga0209256_1000153142 551
176 3300025302 Ga0207426_1000006 Ga0207426_1000006176 551
177 3300025304 Ga0209257_1003777 Ga0209257_10037774 551
178 3300044684 Ga0466966_0035209 Ga0466966_0035209_16_1671 551
179 3300031730 Ga0307516_10001218 Ga0307516_100012186 552
180 3300049571 Ga0501034_0102613 Ga0501034_0102613_243_1982 552
181 3300005335 Ga0070666_10000052 Ga0070666_1000005241 553
182 3300005367 Ga0070667_100076809 Ga0070667_1000768091 553
183 3300005617 Ga0068859_100000112 Ga0068859_10000011228 553
184 3300005618 Ga0068864_100005862 Ga0068864_1000058623 553
185 3300005834 Ga0068851_10007004 Ga0068851_100070042 553
186 3300005842 Ga0068858_100042671 Ga0068858_1000426713 553
187 3300005843 Ga0068860_100003770 Ga0068860_1000037704 553
188 3300006931 Ga0097620_100000112 Ga0097620_10000011221 553
189 3300013307 Ga0157372_10004709 Ga0157372_100047094 553
190 3300025900 Ga0207710_10041730 Ga0207710_100417301 553
191 3300025903 Ga0207680_10000035 Ga0207680_1000003544 553
192 3300025931 Ga0207644_10019754 Ga0207644_100197543 553
193 3300025940 Ga0207691_10136948 Ga0207691_101369481 553
194 3300025942 Ga0207689_10000760 Ga0207689_100007604 553
195 3300025972 Ga0207668_10056683 Ga0207668_100566832 553
196 3300026035 Ga0207703_10038038 Ga0207703_100380383 553
197 3300026088 Ga0207641_10000089 Ga0207641_1000008957 553
198 3300026088 Ga0207641_10108350 Ga0207641_101083502 553
199 3300026095 Ga0207676_10019779 Ga0207676_100197793 553
200 3300028381 Ga0268264_10004058 Ga0268264_100040585 553
201 3300036712 Ga0316584_0141540 Ga0316584_0141540_100_1767 553
202 3300044842 Ga0466957_0000150 Ga0466957_0000150_773_2440 553
203 3300049705 Ga0501225_0012951 Ga0501225_0012951_243_1967 553
204 3300005983 Ga0081540_1008524 Ga0081540_10085245 554
205 3300009551 Ga0105238_10034131 Ga0105238_100341313 554
206 3300005578 Ga0068854_100003549 Ga0068854_1000035492 555
207 3300009098 Ga0105245_10000995 Ga0105245_100009957 555
208 3300013297 Ga0157378_10003102 Ga0157378_1000310214 555
209 3300026075 Ga0207708_10000774 Ga0207708_100007741 555
210 3300046616 Ga0495668_0005368 Ga0495668_0005368_3073_4749 555
211 3300053158 Ga0500627_0000584 Ga0500627_0000584_3610_5286 555
212 3300026067 Ga0207678_10082198 Ga0207678_100821982 556
213 3300045976 Ga0466967_0000360 Ga0466967_0000360_18286_20001 556
214 3300005545 Ga0070695_100047737 Ga0070695_1000477372 558
215 3300005366 Ga0070659_100032329 Ga0070659_1000323291 559
216 3300005577 Ga0068857_100008704 Ga0068857_1000087042 559
217 3300025919 Ga0207657_10019127 Ga0207657_100191273 559
218 3300025923 Ga0207681_10038217 Ga0207681_100382172 559
219 3300028380 Ga0268265_10034418 Ga0268265_100344182 559
220 3300005535 Ga0070684_100003551 Ga0070684_1000035518 560
221 3300005616 Ga0068852_100001424 Ga0068852_1000014246 560
222 3300009093 Ga0105240_10008305 Ga0105240_100083053 560
223 3300009093 Ga0105240_10011123 Ga0105240_100111232 560
224 3300013105 Ga0157369_10006355 Ga0157369_100063558 560
225 3300013307 Ga0157372_10003819 Ga0157372_100038194 560
226 3300025913 Ga0207695_10000316 Ga0207695_1000031625 560
227 3300025913 Ga0207695_10092636 Ga0207695_100926362 560
228 3300025913 Ga0207695_10104863 Ga0207695_101048632 560
229 3300026041 Ga0207639_10064622 Ga0207639_100646222 560
230 3300026142 Ga0207698_10000144 Ga0207698_1000014441 560
231 3300027682 Ga0209971_1001426 Ga0209971_10014264 560
232 3300049579 Ga0501043_0039299 Ga0501043_0039299_1082_2821 560
233 3300049586 Ga0501070_0107492 Ga0501070_0107492_456_2195 560
234 iso_pu_bacteria 2906370794 2906373899 560
235 3300005328 Ga0070676_10008665 Ga0070676_100086653 561
236 3300005331 Ga0070670_100002168 Ga0070670_10000216810 561
237 3300005333 Ga0070677_10006483 Ga0070677_100064832 561
238 3300005334 Ga0068869_100015842 Ga0068869_1000158424 561
239 3300005343 Ga0070687_100006553 Ga0070687_1000065536 561
240 3300005347 Ga0070668_100002293 Ga0070668_1000022933 561
241 3300005356 Ga0070674_100014891 Ga0070674_1000148914 561
242 3300005434 Ga0070709_10013525 Ga0070709_100135253 561
243 3300005436 Ga0070713_100124868 Ga0070713_1001248681 561
244 3300005441 Ga0070700_100016261 Ga0070700_1000162614 561
245 3300005456 Ga0070678_100010861 Ga0070678_1000108614 561
246 3300005457 Ga0070662_100010906 Ga0070662_1000109063 561
247 3300005459 Ga0068867_100015107 Ga0068867_1000151073 561
248 3300005459 Ga0068867_100048551 Ga0068867_1000485512 561
249 3300005543 Ga0070672_100001412 Ga0070672_10000141210 561
250 3300005718 Ga0068866_10009802 Ga0068866_100098022 561
251 3300005719 Ga0068861_100003403 Ga0068861_1000034039 561
252 3300005842 Ga0068858_100006624 Ga0068858_1000066245 561
253 3300005843 Ga0068860_100007157 Ga0068860_1000071572 561
254 3300005843 Ga0068860_100044640 Ga0068860_1000446403 561
255 3300006881 Ga0068865_100001761 Ga0068865_10000176111 561
256 3300009177 Ga0105248_10094570 Ga0105248_100945702 561
257 3300009553 Ga0105249_10006383 Ga0105249_100063839 561
258 3300013297 Ga0157378_10000272 Ga0157378_1000027225 561
259 3300013306 Ga0163162_10003915 Ga0163162_100039155 561
260 3300014326 Ga0157380_10011751 Ga0157380_100117514 561
261 3300014968 Ga0157379_10010290 Ga0157379_100102908 561
262 3300025893 Ga0207682_10005627 Ga0207682_100056272 561
263 3300025923 Ga0207681_10000771 Ga0207681_1000077114 561
264 3300025925 Ga0207650_10000560 Ga0207650_1000056018 561
265 3300025926 Ga0207659_10006382 Ga0207659_100063825 561
266 3300025927 Ga0207687_10030809 Ga0207687_100308091 561
267 3300025928 Ga0207700_10067226 Ga0207700_100672262 561
268 3300025933 Ga0207706_10048964 Ga0207706_100489643 561
269 3300025935 Ga0207709_10013935 Ga0207709_100139354 561
270 3300025937 Ga0207669_10008342 Ga0207669_100083423 561
271 3300025940 Ga0207691_10005269 Ga0207691_1000526910 561
272 3300025941 Ga0207711_10012387 Ga0207711_100123875 561
273 3300025942 Ga0207689_10015742 Ga0207689_100157424 561
274 3300025961 Ga0207712_10033856 Ga0207712_100338563 561
275 3300025986 Ga0207658_10000818 Ga0207658_1000081814 561
276 3300026023 Ga0207677_10057314 Ga0207677_100573142 561
277 3300026035 Ga0207703_10026368 Ga0207703_100263683 561
278 3300026075 Ga0207708_10016060 Ga0207708_100160604 561
279 3300026088 Ga0207641_10003358 Ga0207641_1000335810 561
280 3300026089 Ga0207648_10009106 Ga0207648_100091069 561
281 3300028381 Ga0268264_10047533 Ga0268264_100475332 561
282 3300048905 Ga0496102_0005187 Ga0496102_0005187_5979_7694 561
283 3300005328 Ga0070676_10016033 Ga0070676_100160334 562
284 3300005459 Ga0068867_100013463 Ga0068867_1000134632 562
285 3300005539 Ga0068853_100034021 Ga0068853_1000340214 562
286 3300009176 Ga0105242_10089137 Ga0105242_100891372 562
287 3300026035 Ga0207703_10017240 Ga0207703_100172405 562
288 3300045051 Ga0451576_0000231 Ga0451576_0000231_133173_134912 562
289 3300049572 Ga0501036_0012979 Ga0501036_0012979_3163_4896 562
290 3300049575 Ga0501039_0002263 Ga0501039_0002263_1346_3079 562
291 3300049578 Ga0501042_0014377 Ga0501042_0014377_1867_3600 562
292 3300049587 Ga0501071_0000987 Ga0501071_0000987_3197_4930 562
293 3300049588 Ga0501072_0001988 Ga0501072_0001988_8214_9947 562
294 3300049590 Ga0501074_0039808 Ga0501074_0039808_18_1751 562
295 3300049591 Ga0501075_0002462 Ga0501075_0002462_7190_8923 562
296 3300049592 Ga0501076_0000481 Ga0501076_0000481_632_2365 562
297 3300049741 Ga0501079_0025822 Ga0501079_0025822_1068_2801 562
298 3300049742 Ga0501080_0023189 Ga0501080_0023189_696_2429 562
299 3300049743 Ga0501081_0011157 Ga0501081_0011157_4011_5744 562
300 3300054114 Ga0501084_0020192 Ga0501084_0020192_1434_3167 562
301 3300060353 Ga0501082_0001046 Ga0501082_0001046_22491_24224 562
302 3300061734 Ga0530510_0001365 Ga0530510_0001365_1577_3310 562
303 3300005334 Ga0068869_100001825 Ga0068869_1000018253 563
304 3300005338 Ga0068868_100008536 Ga0068868_1000085364 563
305 3300005354 Ga0070675_100010314 Ga0070675_1000103144 563
306 3300005455 Ga0070663_100049380 Ga0070663_1000493802 563
307 3300005457 Ga0070662_100030839 Ga0070662_1000308392 563
308 3300005458 Ga0070681_10054169 Ga0070681_100541692 563
309 3300005530 Ga0070679_100002199 Ga0070679_1000021997 563
310 3300005563 Ga0068855_100033174 Ga0068855_1000331743 563
311 3300005614 Ga0068856_100049501 Ga0068856_1000495012 563
312 3300005616 Ga0068852_100023794 Ga0068852_1000237942 563
313 3300005719 Ga0068861_100002433 Ga0068861_10000243310 563
314 3300006358 Ga0068871_100012320 Ga0068871_1000123203 563
315 3300006847 Ga0075431_100053601 Ga0075431_1000536012 563
316 3300006880 Ga0075429_100042141 Ga0075429_1000421412 563
317 3300013306 Ga0163162_10032033 Ga0163162_100320336 563
318 3300013307 Ga0157372_10018450 Ga0157372_100184502 563
319 3300014745 Ga0157377_10009758 Ga0157377_100097586 563
320 3300014969 Ga0157376_10023530 Ga0157376_100235304 563
321 3300017792 Ga0163161_10097246 Ga0163161_100972461 563
322 3300025297 Ga0209758_1000051 Ga0209758_1000051197 563
323 3300025912 Ga0207707_10047537 Ga0207707_100475372 563
324 3300025919 Ga0207657_10016143 Ga0207657_100161432 563
325 3300025921 Ga0207652_10005535 Ga0207652_100055355 563
326 3300025926 Ga0207659_10033134 Ga0207659_100331342 563
327 3300025941 Ga0207711_10003165 Ga0207711_1000316512 563
328 3300025942 Ga0207689_10000550 Ga0207689_1000055013 563
329 3300026023 Ga0207677_10004108 Ga0207677_100041085 563
330 3300026041 Ga0207639_10080984 Ga0207639_100809842 563
331 3300026067 Ga0207678_10014250 Ga0207678_100142505 563
332 3300026095 Ga0207676_10038263 Ga0207676_100382634 563
333 3300026118 Ga0207675_100000576 Ga0207675_10000057613 563
334 3300031731 Ga0307405_10072248 Ga0307405_100722482 563
335 3300031995 Ga0307409_100002278 Ga0307409_1000022787 563
336 3300035088 Ga0373940_0011049 Ga0373940_0011049_348_2087 563
337 3300048904 Ga0496101_0064709 Ga0496101_0064709_76_1815 563
338 3300048909 Ga0496106_0002960 Ga0496106_0002960_9916_11655 563
339 3300048911 Ga0496108_0043971 Ga0496108_0043971_1583_3325 563
340 3300048913 Ga0496110_0028527 Ga0496110_0028527_505_2247 563
341 3300048916 Ga0496113_0038228 Ga0496113_0038228_1252_2991 563
342 3300048918 Ga0496115_0071229 Ga0496115_0071229_135_1874 563
343 3300050510 nmdc:mga06r32_102693_c1 nmdc:mga06r32_102693_c1_430_2124 563
344 iso_pu_bacteria 2503198000 2503198281 563
345 iso_pu_bacteria 2509276018 2509368353 563
346 iso_pu_bacteria 2510065059 2510314635 563
347 iso_pu_bacteria 2512875024 2512962550 563
348 iso_pu_bacteria 2513237164 2514038619 563
349 iso_pu_bacteria 2687453392 2688595607 563
350 iso_pu_bacteria 2756170246 2756674310 563
351 iso_pu_bacteria 2818991442 2819577402 563
352 iso_pu_bacteria 2844002411 2844003867 563
353 iso_pu_bacteria 2844009547 2844010406 563
354 iso_pu_bacteria 2856320880 2856321918 563
355 iso_pu_bacteria 2856328259 2856331790 563
356 iso_pu_bacteria 2856334872 2856340809 563
357 iso_pu_bacteria 2857367948 2857373608 563
358 iso_pu_bacteria 2869169390 2869170784 563
359 iso_pu_bacteria 2869234852 2869236926 563
360 iso_pu_bacteria 2869242130 2869243357 563
361 iso_pu_bacteria 2869249662 2869251912 563
362 iso_pu_bacteria 2869256925 2869261811 563
363 iso_pu_bacteria 2869264136 2869264864 563
364 iso_pu_bacteria 2869271264 2869278136 563
365 iso_pu_bacteria 2869278585 2869280096 563
366 iso_pu_bacteria 2871435913 2871437151 563
367 iso_pu_bacteria 2871451962 2871458850 563
368 iso_pu_bacteria 2871459585 2871459644 563
369 iso_pu_bacteria 2871466892 2871468257 563
370 iso_pu_bacteria 2874109183 2874109948 563
371 iso_pu_bacteria 2874131515 2874132125 563
372 iso_pu_bacteria 2874139085 2874143352 563
373 iso_pu_bacteria 2874162495 2874162925 563
374 iso_pu_bacteria 2874168670 2874171996 563
375 iso_pu_bacteria 2876386047 2876391393 563
376 iso_pu_bacteria 2876399893 2876404220 563
377 iso_pu_bacteria 2876406927 2876410048 563
378 iso_pu_bacteria 2876420981 2876423796 563
379 iso_pu_bacteria 2878730984 2878736391 563
380 iso_pu_bacteria 2878738818 2878740579 563
381 iso_pu_bacteria 2878774303 2878780848 563
382 iso_pu_bacteria 2878781027 2878786965 563
383 iso_pu_bacteria 2888337043 2888342949 563
384 iso_pu_bacteria 2906363423 2906370376 563
385 iso_pu_bacteria 2906378014 2906382631 563
386 iso_pu_bacteria 2906393657 2906394360 563
387 iso_pu_bacteria 2906401398 2906402781 563
388 iso_pu_bacteria 2906408224 2906413360 563
389 iso_pu_bacteria 2906427513 2906435410 563
390 iso_pu_bacteria 2922151315 2922158354 563
391 iso_pu_bacteria 2922172374 2922177233 563
392 iso_pu_bacteria 2922178524 2922178800 563
393 iso_pu_bacteria 2924718760 2924723145 563
394 iso_pu_bacteria 2924733363 2924736709 563
395 iso_pu_bacteria 2924741084 2924743939 563
396 iso_pu_bacteria 2924748358 2924753892 563
397 iso_pu_bacteria 2924776078 2924778180 563
398 iso_pu_bacteria 2929212328 2929214027 563
399 iso_pu_bacteria 2937822353 2937824315 563
400 iso_pu_bacteria 2937861824 2937868891 563
401 iso_pu_bacteria 2937877337 2937877978 563
402 iso_pu_bacteria 2937972304 2937973965 563
403 iso_pu_bacteria 2937980651 2937986213 563
404 iso_pu_bacteria 2958034702 2958035962 563
405 iso_pu_bacteria 2958041894 2958045268 563
406 iso_pu_bacteria 2958084443 2958085089 563
407 iso_pu_bacteria 2958108152 2958114691 563
408 iso_pu_bacteria 2958122699 2958129380 563
409 iso_pu_bacteria 2958158011 2958158145 563
410 iso_pu_bacteria 2961183825 2961184123 563
411 iso_pu_bacteria 2965025482 2965028598 563
412 iso_pu_bacteria 2965032056 2965038511 563
413 iso_pu_bacteria 2965040258 2965041195 563
414 iso_pu_bacteria 2965089291 2965096496 563
415 iso_pu_bacteria 2968016561 2968017049 563
416 iso_pu_bacteria 2968138860 2968146095 563
417 iso_pu_bacteria 2970469710 2970470206 563
418 iso_pu_bacteria 2970489779 2970493902 563
419 iso_pu_bacteria 2970510686 2970510797 563
420 iso_pu_bacteria 2970532167 2970533105 563
421 iso_pu_bacteria 2970547951 2970548456 563
422 iso_pu_bacteria 2970593180 2970594693 563
423 iso_pu_bacteria 2970619444 2970621067 563
424 iso_pu_bacteria 2970627176 2970631009 563
425 iso_pu_bacteria 2977851361 2977856420 563
426 iso_pu_bacteria 2977872689 2977875355 563
427 iso_pu_bacteria 2977907340 2977913167 563
428 iso_pu_bacteria 2977915119 2977919771 563
429 iso_pu_bacteria 2977935797 2977938531 563
430 iso_pu_bacteria 2977950692 2977955050 563
431 iso_pu_bacteria 2977957713 2977959632 563
432 iso_pu_bacteria 2979764755 2979765492 563
433 iso_pu_bacteria 2979772303 2979773488 563
434 iso_pu_bacteria 2987645492 2987646667 563
435 iso_pu_bacteria 2996348954 2996349007 563
436 iso_pu_bacteria 2996386984 2996388040 563
437 iso_pu_bacteria 3004167301 3004172812 563
438 iso_pu_bacteria 3004195979 3004203186 563
439 iso_pu_bacteria 3004239961 3004245572 563
440 iso_pu_bacteria 3004268573 3004272597 563
441 iso_pu_bacteria 3004275668 3004275719 563
442 iso_pu_bacteria 3004289098 3004292016 563
443 iso_pu_bacteria 649633066 649870174 563
444 iso_pu_bacteria 8004312739 8004313857 563
445 iso_pu_bacteria 8004361976 8004364258 563
446 iso_pu_bacteria 2643221550 2643772709 564
447 iso_pu_bacteria 2643221618 2644106842 564
448 iso_pu_bacteria 2643221623 2644132970 564
449 iso_pu_bacteria 2643221626 2644149352 564
450 iso_pu_bacteria 2643221655 2644309914 564
451 iso_pu_bacteria 2643221659 2644337196 564
452 iso_pu_bacteria 2643221698 2644540491 564
453 iso_pu_bacteria 2643221712 2644616365 564
454 iso_pu_bacteria 2738543024 2739305556 564
455 iso_pu_bacteria 2844163670 2844170988 564
456 iso_pu_bacteria 2910245624 2910248857 564
457 iso_pu_bacteria 2941499720 2941503271 564
458 iso_pu_bacteria 2989349275 2989353544 564
459 iso_pu_bacteria 8002285264 8002289613 564
460 3300005844 Ga0068862_100104493 Ga0068862_1001044932 565
461 3300025938 Ga0207704_10038806 Ga0207704_100388062 565
462 3300025942 Ga0207689_10058301 Ga0207689_100583012 565
463 3300025972 Ga0207668_10067709 Ga0207668_100677092 565
464 3300027312 Ga0209371_1000537 Ga0209371_10005373 565
465 3300030500 Ga0268256_1003531 Ga0268256_10035313 565
466 3300039437 Ga0436365_0827866 Ga0436365_0827866_1760_3505 565
467 3300048925 Ga0496122_0045919 Ga0496122_0045919_537_2282 565
468 3300048926 Ga0496123_0079477 Ga0496123_0079477_131_1876 565
469 iso_pu_bacteria 2857349434 2857353972 565
470 iso_pu_bacteria 2929921140 2929926122 565
471 iso_pu_bacteria 2987636660 2987642616 565
472 iso_pu_bacteria 8003151029 8003151861 565
473 3300005438 Ga0070701_10027034 Ga0070701_100270342 566
474 3300006881 Ga0068865_100036426 Ga0068865_1000364262 566
475 3300014968 Ga0157379_10099197 Ga0157379_100991972 566
476 iso_pu_bacteria 2615840698 2616552906 566
477 iso_pu_bacteria 8005682033 8005683669 566
478 3300002705 JGI25156J39149_1003633 JGI25156J39149_10036334 567
479 3300002741 JGI25157J39369_1001300 JGI25157J39369_10013007 567
480 3300005439 Ga0070711_100010683 Ga0070711_1000106832 567
481 3300005467 Ga0070706_100017407 Ga0070706_1000174073 567
482 3300005471 Ga0070698_100016910 Ga0070698_1000169103 567
483 3300006175 Ga0070712_100000139 Ga0070712_10000013921 567
484 3300009147 Ga0114129_10001007 Ga0114129_1000100729 567
485 3300010375 Ga0105239_10120461 Ga0105239_101204612 567
486 3300015265 Ga0182005_1000234 Ga0182005_100023430 567
487 3300024225 Ga0224572_1000136 Ga0224572_10001362 567
488 3300025250 Ga0209026_1000050 Ga0209026_100005047 567
489 3300025256 Ga0209759_1000229 Ga0209759_100022960 567
490 3300025261 Ga0209233_1002543 Ga0209233_10025435 567
491 3300025284 Ga0209130_1007205 Ga0209130_10072052 567
492 3300025910 Ga0207684_10022962 Ga0207684_100229623 567
493 3300025915 Ga0207693_10002891 Ga0207693_100028918 567
494 3300025916 Ga0207663_10005945 Ga0207663_100059454 567
495 3300028017 Ga0265356_1000046 Ga0265356_100004617 567
496 3300030760 Ga0265762_1000247 Ga0265762_10002472 567
497 3300031251 Ga0265327_10000101 Ga0265327_1000010142 567
498 3300044673 Ga0453683_0039345 Ga0453683_0039345_208_1914 567
499 3300046660 Ga0495625_0009215 Ga0495625_0009215_3600_5312 567
500 3300048924 Ga0496121_0000007 Ga0496121_0000007_158997_160706 567
501 3300048927 Ga0496124_0001442 Ga0496124_0001442_12286_14001 567
502 3300049569 Ga0501032_0031220 Ga0501032_0031220_885_2597 567
503 3300049570 Ga0501033_0040411 Ga0501033_0040411_1266_2978 567
504 3300049571 Ga0501034_0042626 Ga0501034_0042626_2649_4361 567
505 3300049571 Ga0501034_0156859 Ga0501034_0156859_437_2149 567
506 3300049581 Ga0501047_0013273 Ga0501047_0013273_2475_4187 567
507 3300049586 Ga0501070_0048360 Ga0501070_0048360_292_2004 567
508 3300049742 Ga0501080_0093306 Ga0501080_0093306_890_2602 567
509 3300049823 Ga0501044_0043756 Ga0501044_0043756_2500_4212 567
510 3300050507 nmdc:mga05p37_2217_c1 nmdc:mga05p37_2217_c1_12945_14654 567
511 3300053088 Ga0500644_0000080 Ga0500644_0000080_54714_56423 567
512 3300053109 Ga0500569_000719 Ga0500569_000719_732_2441 567
513 3300053148 Ga0500590_035259 Ga0500590_035259_156_1865 567
514 iso_pu_bacteria 2510065057 2510302697 567
515 iso_pu_bacteria 2511231052 2511497748 567
516 iso_pu_bacteria 2513237086 2513584593 567
517 iso_pu_bacteria 2513237091 2513616393 567
518 iso_pu_bacteria 2513237140 2513883860 567
519 iso_pu_bacteria 2513237143 2513902036 567
520 iso_pu_bacteria 2515154107 2515612017 567
521 iso_pu_bacteria 2516653046 2516896601 567
522 iso_pu_bacteria 2524023207 2524452096 567
523 iso_pu_bacteria 2551306084 2551681459 567
524 iso_pu_bacteria 2551306085 2551684694 567
525 iso_pu_bacteria 2551306086 2551695025 567
526 iso_pu_bacteria 2551306087 2551700294 567
527 iso_pu_bacteria 2551306089 2551713051 567
528 iso_pu_bacteria 2551306090 2551718171 567
529 iso_pu_bacteria 2551306090 2551722872 567
530 iso_pu_bacteria 2551306091 2551724555 567
531 iso_pu_bacteria 2551306092 2551733544 567
532 iso_pu_bacteria 2551306093 2551744390 567
533 iso_pu_bacteria 2738541278 2738728148 567
534 iso_pu_bacteria 2751185821 2753462407 567
535 iso_pu_bacteria 2844163670 2844163952 567
536 iso_pu_bacteria 2855825444 2855828567 567
537 iso_pu_bacteria 2855839649 2855843692 567
538 iso_pu_bacteria 2858800743 2858807063 567
539 iso_pu_bacteria 2913295892 2913296173 567
540 iso_pu_bacteria 2915986958 2915988619 567
541 iso_pu_bacteria 2915993759 2915998160 567
542 iso_pu_bacteria 2916000859 2916007327 567
543 iso_pu_bacteria 2916007675 2916011277 567
544 iso_pu_bacteria 2916014648 2916020565 567
545 iso_pu_bacteria 2916021584 2916028097 567
546 iso_pu_bacteria 2916028427 2916032819 567
547 iso_pu_bacteria 2916035215 2916038205 567
548 iso_pu_bacteria 2916041962 2916045025 567
549 iso_pu_bacteria 2916048683 2916051962 567
550 iso_pu_bacteria 2916055098 2916059471 567
551 iso_pu_bacteria 2916068649 2916073299 567
552 iso_pu_bacteria 2916076590 2916082549 567
553 iso_pu_bacteria 2921201388 2921203440 567
554 iso_pu_bacteria 2921208531 2921213261 567
555 iso_pu_bacteria 2921237296 2921240528 567
556 iso_pu_bacteria 2921244191 2921245732 567
557 iso_pu_bacteria 2921257292 2921260043 567
558 iso_pu_bacteria 2921263974 2921268444 567
559 iso_pu_bacteria 2921282425 2921284667 567
560 iso_pu_bacteria 2921289301 2921290729 567
561 iso_pu_bacteria 2921296804 2921297005 567
562 iso_pu_bacteria 2924144063 2924148117 567
563 iso_pu_bacteria 2924150972 2924154766 567
564 iso_pu_bacteria 2924158325 2924163923 567
565 iso_pu_bacteria 2924165586 2924168441 567
566 iso_pu_bacteria 2924172951 2924177182 567
567 iso_pu_bacteria 2924179722 2924182034 567
568 iso_pu_bacteria 2924186466 2924188910 567
569 iso_pu_bacteria 2924193448 2924195760 567
570 iso_pu_bacteria 2924200457 2924202970 567
571 iso_pu_bacteria 2924207177 2924210004 567
572 iso_pu_bacteria 2924214083 2924215609 567
573 iso_pu_bacteria 2924221636 2924228387 567
574 iso_pu_bacteria 2924228884 2924233759 567
575 iso_pu_bacteria 2929921140 2929924068 567
576 iso_pu_bacteria 2936996657 2937001550 567
577 iso_pu_bacteria 2937002841 2937005885 567
578 iso_pu_bacteria 2937009748 2937014280 567
579 iso_pu_bacteria 2937016420 2937021581 567
580 iso_pu_bacteria 2937023124 2937023940 567
581 iso_pu_bacteria 2937042894 2937043375 567
582 iso_pu_bacteria 2937049772 2937054063 567
583 iso_pu_bacteria 2937056579 2937056837 567
584 iso_pu_bacteria 2937063883 2937066102 567
585 iso_pu_bacteria 2937071275 2937075418 567
586 iso_pu_bacteria 2937091812 2937096104 567
587 iso_pu_bacteria 2937098957 2937105180 567
588 iso_pu_bacteria 2937106411 2937108065 567
589 iso_pu_bacteria 2937113482 2937118857 567
590 iso_pu_bacteria 2937119839 2937125800 567
591 iso_pu_bacteria 2937126314 2937131072 567
592 iso_pu_bacteria 2941499720 2941504668 567
593 iso_pu_bacteria 2957382221 2957382985 567
594 iso_pu_bacteria 2957388812 2957391943 567
595 iso_pu_bacteria 2957395598 2957396281 567
596 iso_pu_bacteria 2957402308 2957402963 567
597 iso_pu_bacteria 2957408893 2957410734 567
598 iso_pu_bacteria 2957415311 2957416718 567
599 iso_pu_bacteria 2957422303 2957422831 567
600 iso_pu_bacteria 2957430029 2957435258 567
601 iso_pu_bacteria 2957443900 2957445213 567
602 iso_pu_bacteria 2957450854 2957454880 567
603 iso_pu_bacteria 2957457609 2957458984 567
604 iso_pu_bacteria 2957464669 2957464855 567
605 iso_pu_bacteria 2957471148 2957476860 567
606 iso_pu_bacteria 2957478035 2957482411 567
607 iso_pu_bacteria 2957484790 2957490039 567
608 iso_pu_bacteria 2957491536 2957491720 567
609 iso_pu_bacteria 2957498199 2957501615 567
610 iso_pu_bacteria 2957505466 2957510123 567
611 iso_pu_bacteria 2958137437 2958142626 567
612 iso_pu_bacteria 2960584000 2960584997 567
613 iso_pu_bacteria 2960597568 2960598437 567
614 iso_pu_bacteria 2960603979 2960609507 567
615 iso_pu_bacteria 2960610863 2960614221 567
616 iso_pu_bacteria 2960617483 2960621894 567
617 iso_pu_bacteria 2960624210 2960629140 567
618 iso_pu_bacteria 2960637947 2960640709 567
619 iso_pu_bacteria 2960645483 2960645671 567
620 iso_pu_bacteria 2960652885 2960658129 567
621 iso_pu_bacteria 2960660292 2960661996 567
622 iso_pu_bacteria 2960667422 2960669744 567
623 iso_pu_bacteria 2960674078 2960680350 567
624 iso_pu_bacteria 2960687367 2960690855 567
625 iso_pu_bacteria 2964607997 2964610792 567
626 iso_pu_bacteria 2964615318 2964619313 567
627 iso_pu_bacteria 2964621998 2964624178 567
628 iso_pu_bacteria 2964628898 2964632537 567
629 iso_pu_bacteria 2964636051 2964640645 567
630 iso_pu_bacteria 2964643177 2964644575 567
631 iso_pu_bacteria 2964649959 2964655046 567
632 iso_pu_bacteria 2964656573 2964661686 567
633 iso_pu_bacteria 2964663802 2964666794 567
634 iso_pu_bacteria 2964670856 2964677169 567
635 iso_pu_bacteria 2964678106 2964679749 567
636 iso_pu_bacteria 2964685014 2964686934 567
637 iso_pu_bacteria 2964691889 2964692561 567
638 iso_pu_bacteria 2964698721 2964703249 567
639 iso_pu_bacteria 2964705432 2964709563 567
640 iso_pu_bacteria 2964712639 2964714027 567
641 iso_pu_bacteria 2964719344 2964722533 567
642 iso_pu_bacteria 2967664464 2967668563 567
643 iso_pu_bacteria 2967671571 2967677056 567
644 iso_pu_bacteria 2967678726 2967684728 567
645 iso_pu_bacteria 2967693043 2967697801 567
646 iso_pu_bacteria 2967699805 2967700296 567
647 iso_pu_bacteria 2967706974 2967708692 567
648 iso_pu_bacteria 2967714385 2967721273 567
649 iso_pu_bacteria 2967721400 2967725205 567
650 iso_pu_bacteria 2967735183 2967740681 567
651 iso_pu_bacteria 2967742019 2967745400 567
652 iso_pu_bacteria 2967748971 2967750830 567
653 iso_pu_bacteria 2967755722 2967761659 567
654 iso_pu_bacteria 2967762386 2967766038 567
655 iso_pu_bacteria 2967769361 2967772306 567
656 iso_pu_bacteria 2967775926 2967777748 567
657 iso_pu_bacteria 2970019648 2970023529 567
658 iso_pu_bacteria 2970033650 2970039040 567
659 iso_pu_bacteria 2970040964 2970046523 567
660 iso_pu_bacteria 2970047711 2970053737 567
661 iso_pu_bacteria 2970054988 2970058642 567
662 iso_pu_bacteria 2970061556 2970063581 567
663 iso_pu_bacteria 2970068827 2970071279 567
664 iso_pu_bacteria 2970076120 2970078405 567
665 iso_pu_bacteria 2970082768 2970083962 567
666 iso_pu_bacteria 2970088815 2970094770 567
667 iso_pu_bacteria 2970095765 2970097371 567
668 iso_pu_bacteria 2970102677 2970105818 567
669 iso_pu_bacteria 2970109326 2970114790 567
670 iso_pu_bacteria 2970116247 2970119592 567
671 iso_pu_bacteria 2970129317 2970134954 567
672 iso_pu_bacteria 2970136068 2970136867 567
673 iso_pu_bacteria 2970149975 2970154132 567
674 iso_pu_bacteria 2970156795 2970162930 567
675 iso_pu_bacteria 2970164137 2970164625 567
676 iso_pu_bacteria 2970170962 2970174291 567
677 iso_pu_bacteria 2970177841 2970178774 567
678 iso_pu_bacteria 2970184632 2970189406 567
679 iso_pu_bacteria 2970191845 2970194656 567
680 iso_pu_bacteria 2977516862 2977518818 567
681 iso_pu_bacteria 2977523885 2977526605 567
682 iso_pu_bacteria 2977537788 2977541340 567
683 iso_pu_bacteria 2977551784 2977557698 567
684 iso_pu_bacteria 2977558990 2977559591 567
685 iso_pu_bacteria 2977565890 2977569235 567
686 iso_pu_bacteria 2977572785 2977578778 567
687 iso_pu_bacteria 2977579622 2977584720 567
688 iso_pu_bacteria 648276728 648739893 567
689 iso_pu_bacteria 8003992118 8003996252 567
690 iso_pu_bacteria 8024486573 8024488337 567
691 3300005327 Ga0070658_10034021 Ga0070658_100340213 568
692 3300005327 Ga0070658_10096835 Ga0070658_100968351 568
693 3300005329 Ga0070683_100011555 Ga0070683_1000115554 568
694 3300005336 Ga0070680_100027164 Ga0070680_1000271643 568
695 3300005338 Ga0068868_100003695 Ga0068868_1000036952 568
696 3300005434 Ga0070709_10029392 Ga0070709_100293922 568
697 3300005435 Ga0070714_100000027 Ga0070714_10000002711 568
698 3300005435 Ga0070714_100100823 Ga0070714_1001008231 568
699 3300005436 Ga0070713_100000070 Ga0070713_10000007035 568
700 3300005436 Ga0070713_100025593 Ga0070713_1000255932 568
701 3300005436 Ga0070713_100092697 Ga0070713_1000926972 568
702 3300005437 Ga0070710_10023423 Ga0070710_100234232 568
703 3300005439 Ga0070711_100000078 Ga0070711_10000007827 568
704 3300005439 Ga0070711_100001722 Ga0070711_1000017224 568
705 3300005439 Ga0070711_100008573 Ga0070711_1000085734 568
706 3300005578 Ga0068854_100065239 Ga0068854_1000652392 568
707 3300005842 Ga0068858_100010216 Ga0068858_1000102164 568
708 3300006028 Ga0070717_10001262 Ga0070717_100012626 568
709 3300006028 Ga0070717_10007375 Ga0070717_100073755 568
710 3300006028 Ga0070717_10016703 Ga0070717_100167031 568
711 3300006175 Ga0070712_100000038 Ga0070712_10000003810 568
712 3300006175 Ga0070712_100000292 Ga0070712_1000002927 568
713 3300006237 Ga0097621_100009342 Ga0097621_1000093424 568
714 3300006237 Ga0097621_100011644 Ga0097621_1000116441 568
715 3300006358 Ga0068871_100001519 Ga0068871_1000015197 568
716 3300006871 Ga0075434_100027556 Ga0075434_1000275564 568
717 3300007076 Ga0075435_100030319 Ga0075435_1000303193 568
718 3300007076 Ga0075435_100166843 Ga0075435_1001668431 568
719 3300009093 Ga0105240_10016759 Ga0105240_100167593 568
720 3300009098 Ga0105245_10001343 Ga0105245_100013433 568
721 3300009098 Ga0105245_10016474 Ga0105245_100164742 568
722 3300009177 Ga0105248_10002352 Ga0105248_1000235210 568
723 3300009177 Ga0105248_10016506 Ga0105248_100165065 568
724 3300009177 Ga0105248_10054237 Ga0105248_100542373 568
725 3300009545 Ga0105237_10003834 Ga0105237_1000383414 568
726 3300009545 Ga0105237_10042642 Ga0105237_100426422 568
727 3300009545 Ga0105237_10087386 Ga0105237_100873862 568
728 3300009551 Ga0105238_10035163 Ga0105238_100351633 568
729 3300009553 Ga0105249_10043073 Ga0105249_100430732 568
730 3300010375 Ga0105239_10003467 Ga0105239_1000346714 568
731 3300010375 Ga0105239_10082394 Ga0105239_100823942 568
732 3300010375 Ga0105239_10088886 Ga0105239_100888862 568
733 3300013100 Ga0157373_10047748 Ga0157373_100477482 568
734 3300013105 Ga0157369_10021623 Ga0157369_100216233 568
735 3300013105 Ga0157369_10027624 Ga0157369_100276246 568
736 3300013297 Ga0157378_10000228 Ga0157378_100002288 568
737 3300013297 Ga0157378_10070747 Ga0157378_100707472 568
738 3300013307 Ga0157372_10010774 Ga0157372_100107742 568
739 3300014497 Ga0182008_10006626 Ga0182008_100066262 568
740 3300024227 Ga0228598_1003449 Ga0228598_10034491 568
741 3300025284 Ga0209130_1001489 Ga0209130_100148914 568
742 3300025302 Ga0207426_1000182 Ga0207426_100018243 568
743 3300025898 Ga0207692_10016492 Ga0207692_100164921 568
744 3300025909 Ga0207705_10022270 Ga0207705_100222703 568
745 3300025914 Ga0207671_10004291 Ga0207671_100042916 568
746 3300025915 Ga0207693_10000012 Ga0207693_1000001271 568
747 3300025915 Ga0207693_10000058 Ga0207693_1000005841 568
748 3300025915 Ga0207693_10001160 Ga0207693_100011608 568
749 3300025916 Ga0207663_10000280 Ga0207663_100002808 568
750 3300025916 Ga0207663_10003100 Ga0207663_100031004 568
751 3300025916 Ga0207663_10013299 Ga0207663_100132992 568
752 3300025919 Ga0207657_10003162 Ga0207657_100031625 568
753 3300025924 Ga0207694_10005169 Ga0207694_100051694 568
754 3300025927 Ga0207687_10006970 Ga0207687_100069704 568
755 3300025928 Ga0207700_10003116 Ga0207700_100031166 568
756 3300025929 Ga0207664_10000098 Ga0207664_1000009843 568
757 3300025961 Ga0207712_10026330 Ga0207712_100263302 568
758 3300026023 Ga0207677_10018320 Ga0207677_100183202 568
759 3300026023 Ga0207677_10090940 Ga0207677_100909401 568
760 3300026035 Ga0207703_10010303 Ga0207703_100103034 568
761 3300026078 Ga0207702_10001923 Ga0207702_100019239 568
762 3300028786 Ga0307517_10002048 Ga0307517_1000204815 568
763 3300028800 Ga0265338_10009598 Ga0265338_100095983 568
764 3300028800 Ga0265338_10023109 Ga0265338_100231093 568
765 3300028800 Ga0265338_10025148 Ga0265338_100251485 568
766 3300031241 Ga0265325_10035530 Ga0265325_100355302 568
767 3300031711 Ga0265314_10000503 Ga0265314_1000050310 568
768 3300031712 Ga0265342_10028130 Ga0265342_100281302 568
769 3300031730 Ga0307516_10001770 Ga0307516_1000177028 568
770 3300035113 Ga0373936_0001015 Ga0373936_0001015_2542_4257 568
771 3300035116 Ga0373945_0003061 Ga0373945_0003061_3056_4771 568
772 3300035118 Ga0373954_0005212 Ga0373954_0005212_3851_5569 568
773 3300035120 Ga0373957_0007832 Ga0373957_0007832_77_1792 568
774 3300035170 Ga0373943_0000669 Ga0373943_0000669_7362_9077 568
775 3300035171 Ga0373946_0013112 Ga0373946_0013112_955_2670 568
776 3300035172 Ga0373955_0000118 Ga0373955_0000118_17786_19504 568
777 3300035692 Ga0373935_0011104 Ga0373935_0011104_82_1797 568
778 3300035692 Ga0373935_0024658 Ga0373935_0024658_1928_3643 568
779 3300035724 Ga0373933_0000658 Ga0373933_0000658_817_2535 568
780 3300035724 Ga0373933_0003016 Ga0373933_0003016_6262_7977 568
781 3300035725 Ga0373947_0001632 Ga0373947_0001632_8592_10307 568
782 3300036401 Ga0373937_0000440 Ga0373937_0000440_3497_5215 568
783 3300036401 Ga0373937_0005357 Ga0373937_0005357_1183_2898 568
784 3300036401 Ga0373937_0010310 Ga0373937_0010310_217_1926 568
785 3300037068 Ga0373925_0002387 Ga0373925_0002387_7237_8952 568
786 3300037068 Ga0373925_0041873 Ga0373925_0041873_606_2321 568
787 3300044658 Ga0466972_0000051 Ga0466972_0000051_25714_27423 568
788 3300044658 Ga0466972_0016077 Ga0466972_0016077_461_2176 568
789 3300044765 Ga0466970_0056253 Ga0466970_0056253_149_1858 568
790 3300046459 Ga0495629_0037018 Ga0495629_0037018_641_2356 568
791 3300046472 Ga0495580_0001774 Ga0495580_0001774_2673_4388 568
792 3300046472 Ga0495580_0004783 Ga0495580_0004783_1340_3055 568
793 3300046472 Ga0495580_0008629 Ga0495580_0008629_4339_6054 568
794 3300046472 Ga0495580_0069235 Ga0495580_0069235_447_2162 568
795 3300046473 Ga0495582_0034864 Ga0495582_0034864_551_2266 568
796 3300046531 Ga0495665_0026539 Ga0495665_0026539_466_2181 568
797 3300046543 Ga0495645_0043951 Ga0495645_0043951_154_1869 568
798 3300046679 Ga0495623_0003238 Ga0495623_0003238_3136_4854 568
799 3300046683 Ga0495658_0087543 Ga0495658_0087543_60_1775 568
800 3300046689 Ga0495613_0043426 Ga0495613_0043426_1114_2829 568
801 3300046690 Ga0495624_0081444 Ga0495624_0081444_142_1857 568
802 3300047317 Ga0495604_0002515 Ga0495604_0002515_2831_4549 568
803 3300047319 Ga0495674_0042305 Ga0495674_0042305_507_2222 568
804 3300048088 Ga0495602_0029691 Ga0495602_0029691_3373_5091 568
805 3300048905 Ga0496102_0103176 Ga0496102_0103176_139_1854 568
806 3300048907 Ga0496104_0079247 Ga0496104_0079247_681_2396 568
807 3300048910 Ga0496107_0060605 Ga0496107_0060605_245_1960 568
808 3300048911 Ga0496108_0032985 Ga0496108_0032985_2552_4267 568
809 3300048915 Ga0496112_0101172 Ga0496112_0101172_444_2159 568
810 3300048918 Ga0496115_0016796 Ga0496115_0016796_3625_5340 568
811 3300049588 Ga0501072_0041045 Ga0501072_0041045_1221_2936 568
812 3300049744 Ga0501083_0020789 Ga0501083_0020789_547_2262 568
813 3300050512 nmdc:mga0n895_25131_c1 nmdc:mga0n895_25131_c1_3088_4803 568
814 3300050513 nmdc:mga0rr50_11309_c1 nmdc:mga0rr50_11309_c1_609_2324 568
815 iso_pu_bacteria 2510917022 2511131859 568
816 iso_pu_bacteria 2512047086 2512528781 568
817 iso_pu_bacteria 2512875026 2512969590 568
818 iso_pu_bacteria 2513237089 2513606186 568
819 iso_pu_bacteria 2513237146 2513928180 568
820 iso_pu_bacteria 2513237156 2513985105 568
821 iso_pu_bacteria 2513237160 2514007901 568
822 iso_pu_bacteria 2517487022 2517565532 568
823 iso_pu_bacteria 2524023209 2524458929 568
824 iso_pu_bacteria 2582581299 2585228598 568
825 iso_pu_bacteria 2582581307 2585271420 568
826 iso_pu_bacteria 2582581308 2585279357 568
827 iso_pu_bacteria 2582581315 2585323037 568
828 iso_pu_bacteria 2582581316 2585331151 568
829 iso_pu_bacteria 2585427527 2585531158 568
830 iso_pu_bacteria 2585427530 2585552918 568
831 iso_pu_bacteria 2585427531 2585559163 568
832 iso_pu_bacteria 2585427608 2585898545 568
833 iso_pu_bacteria 2585427609 2585903891 568
834 iso_pu_bacteria 2585428125 2587980991 568
835 iso_pu_bacteria 2599185170 2599416930 568
836 iso_pu_bacteria 2599185352 2600194907 568
837 iso_pu_bacteria 2615840626 2616311100 568
838 iso_pu_bacteria 2615840698 2616554539 568
839 iso_pu_bacteria 2617270742 2617385399 568
840 iso_pu_bacteria 2643221557 2643804134 568
841 iso_pu_bacteria 2643221610 2644065089 568
842 iso_pu_bacteria 2643221634 2644191743 568
843 iso_pu_bacteria 2643221634 2644196301 568
844 iso_pu_bacteria 2643221668 2644376499 568
845 iso_pu_bacteria 2643221675 2644416762 568
846 iso_pu_bacteria 2643221680 2644449802 568
847 iso_pu_bacteria 2643221688 2644494254 568
848 iso_pu_bacteria 2643221723 2644675762 568
849 iso_pu_bacteria 2643221726 2644689934 568
850 iso_pu_bacteria 2667528174 2671111144 568
851 iso_pu_bacteria 2693429784 2694639704 568
852 iso_pu_bacteria 2775507266 2778175716 568
853 iso_pu_bacteria 2791355091 2792620534 568
854 iso_pu_bacteria 2791355092 2792625892 568
855 iso_pu_bacteria 2791355253 2793280054 568
856 iso_pu_bacteria 2802428858 2802716020 568
857 iso_pu_bacteria 2802428859 2802722956 568
858 iso_pu_bacteria 2802428860 2802728913 568
859 iso_pu_bacteria 2802428861 2802735278 568
860 iso_pu_bacteria 2802428862 2802742118 568
861 iso_pu_bacteria 2802428863 2802748565 568
862 iso_pu_bacteria 2818991448 2819609426 568
863 iso_pu_bacteria 2818991453 2819641263 568
864 iso_pu_bacteria 2838029111 2838033309 568
865 iso_pu_bacteria 2838035591 2838041741 568
866 iso_pu_bacteria 2838661181 2838661285 568
867 iso_pu_bacteria 2842298080 2842298281 568
868 iso_pu_bacteria 2842357229 2842360119 568
869 iso_pu_bacteria 2842475841 2842480026 568
870 iso_pu_bacteria 2842482326 2842483784 568
871 iso_pu_bacteria 2842502639 2842505189 568
872 iso_pu_bacteria 2842509118 2842514201 568
873 iso_pu_bacteria 2852387548 2852390565 568
874 iso_pu_bacteria 2888350351 2888351003 568
875 iso_pu_bacteria 2889010040 2889013389 568
876 iso_pu_bacteria 2889016732 2889021892 568
877 iso_pu_bacteria 2915980308 2915983685 568
878 iso_pu_bacteria 2916061851 2916068322 568
879 iso_pu_bacteria 2917554339 2917558062 568
880 iso_pu_bacteria 2919408235 2919410290 568
881 iso_pu_bacteria 2920822456 2920825546 568
882 iso_pu_bacteria 2921250672 2921256924 568
883 iso_pu_bacteria 2937029754 2937035037 568
884 iso_pu_bacteria 2937036028 2937039269 568
885 iso_pu_bacteria 2937078374 2937084319 568
886 iso_pu_bacteria 2937084907 2937090721 568
887 iso_pu_bacteria 2938014810 2938018202 568
888 iso_pu_bacteria 2939669807 2939673027 568
889 iso_pu_bacteria 2957375807 2957381013 568
890 iso_pu_bacteria 2957437181 2957441145 568
891 iso_pu_bacteria 2958100919 2958101111 568
892 iso_pu_bacteria 2958172287 2958173178 568
893 iso_pu_bacteria 2960591022 2960596739 568
894 iso_pu_bacteria 2960631154 2960634405 568
895 iso_pu_bacteria 2960680706 2960683367 568
896 iso_pu_bacteria 2960693952 2960695218 568
897 iso_pu_bacteria 2967686174 2967687940 568
898 iso_pu_bacteria 2967728569 2967732716 568
899 iso_pu_bacteria 2970026789 2970028861 568
900 iso_pu_bacteria 2970122695 2970126642 568
901 iso_pu_bacteria 2970143518 2970148398 568
902 iso_pu_bacteria 2977530762 2977532679 568
903 iso_pu_bacteria 2977544691 2977547953 568
904 iso_pu_bacteria 2977971508 2977975222 568
905 iso_pu_bacteria 2987652177 2987652542 568
906 iso_pu_bacteria 3005416602 3005418889 568
907 iso_pu_bacteria 8003999396 8004004009 568
908 iso_pu_bacteria 8005314921 8005318219 568
909 iso_pu_bacteria 8005484373 8005488903 568
910 iso_pu_bacteria 8005645114 8005645987 568
911 iso_pu_bacteria 8005682033 8005682594 568
912 iso_pu_bacteria 8046767195 8046770536 568
913 iso_pu_bacteria 8057575449 8057576664 568
914 3300002737 JGI25162J39368_1003823 JGI25162J39368_10038233 569
915 3300002738 JGI25154J39366_1000080 JGI25154J39366_100008027 569
916 3300003215 JGI25153J46596_10002621 JGI25153J46596_100026216 569
917 3300003323 rootH1_10001237 rootH1_100012376 569
918 3300003354 JGI25160J50197_1002128 JGI25160J50197_10021285 569
919 3300003354 JGI25160J50197_1005585 JGI25160J50197_10055854 569
920 3300003790 Ga0055528_1000246 Ga0055528_100024614 569
921 3300003791 Ga0055530_10003361 Ga0055530_100033612 569
922 3300003791 Ga0055530_10013503 Ga0055530_100135033 569
923 3300003794 Ga0055531_10000048 Ga0055531_1000004899 569
924 3300004625 Ga0055543_1009724 Ga0055543_10097241 569
925 3300005262 Ga0065165_1000124 Ga0065165_100012463 569
926 3300005327 Ga0070658_10000053 Ga0070658_10000053106 569
927 3300005328 Ga0070676_10000108 Ga0070676_1000010820 569
928 3300005334 Ga0068869_100090464 Ga0068869_1000904641 569
929 3300005356 Ga0070674_100003032 Ga0070674_1000030322 569
930 3300005456 Ga0070678_100064235 Ga0070678_1000642352 569
931 3300005535 Ga0070684_100000495 Ga0070684_10000049515 569
932 3300005548 Ga0070665_100000001 Ga0070665_100000001693 569
933 3300005563 Ga0068855_100000089 Ga0068855_10000008911 569
934 3300005577 Ga0068857_100000416 Ga0068857_1000004166 569
935 3300005578 Ga0068854_100023625 Ga0068854_1000236252 569
936 3300005616 Ga0068852_100052610 Ga0068852_1000526102 569
937 3300005618 Ga0068864_100171718 Ga0068864_1001717181 569
938 3300005843 Ga0068860_100000046 Ga0068860_1000000468 569
939 3300005843 Ga0068860_100029570 Ga0068860_1000295705 569
940 3300005843 Ga0068860_100080415 Ga0068860_1000804152 569
941 3300006195 Ga0075366_10020007 Ga0075366_100200073 569
942 3300006237 Ga0097621_100060361 Ga0097621_1000603612 569
943 3300006881 Ga0068865_100013022 Ga0068865_1000130222 569
944 3300009093 Ga0105240_10000039 Ga0105240_1000003959 569
945 3300009093 Ga0105240_10000074 Ga0105240_10000074113 569
946 3300009093 Ga0105240_10002663 Ga0105240_1000266318 569
947 3300009093 Ga0105240_10032969 Ga0105240_100329694 569
948 3300009093 Ga0105240_10175292 Ga0105240_101752922 569
949 3300009094 Ga0111539_10073997 Ga0111539_100739973 569
950 3300009174 Ga0105241_10003032 Ga0105241_100030327 569
951 3300009545 Ga0105237_10001565 Ga0105237_1000156517 569
952 3300009545 Ga0105237_10003907 Ga0105237_100039071 569
953 3300009545 Ga0105237_10011674 Ga0105237_100116743 569
954 3300009545 Ga0105237_10035862 Ga0105237_100358622 569
955 3300009545 Ga0105237_10091556 Ga0105237_100915563 569
956 3300009551 Ga0105238_10004027 Ga0105238_100040272 569
957 3300010375 Ga0105239_10000048 Ga0105239_1000004870 569
958 3300013102 Ga0157371_10014715 Ga0157371_100147152 569
959 3300013104 Ga0157370_10006375 Ga0157370_1000637512 569
960 3300013306 Ga0163162_10005992 Ga0163162_100059929 569
961 3300013307 Ga0157372_10004228 Ga0157372_100042289 569
962 3300013307 Ga0157372_10067054 Ga0157372_100670542 569
963 3300013307 Ga0157372_10086797 Ga0157372_100867972 569
964 3300014969 Ga0157376_10000721 Ga0157376_1000072115 569
965 3300025246 Ga0209646_1000091 Ga0209646_100009140 569
966 3300025250 Ga0209026_1000497 Ga0209026_10004973 569
967 3300025273 Ga0209673_1000014 Ga0209673_1000014144 569
968 3300025273 Ga0209673_1000018 Ga0209673_100001892 569
969 3300025297 Ga0209758_1003127 Ga0209758_10031275 569
970 3300025298 Ga0209050_1000177 Ga0209050_100017770 569
971 3300025298 Ga0209050_1003437 Ga0209050_10034376 569
972 3300025302 Ga0207426_1000251 Ga0207426_100025115 569
973 3300025304 Ga0209257_1000007 Ga0209257_10000071402 569
974 3300025907 Ga0207645_10002051 Ga0207645_100020517 569
975 3300025913 Ga0207695_10000071 Ga0207695_10000071227 569
976 3300025913 Ga0207695_10002490 Ga0207695_1000249013 569
977 3300025913 Ga0207695_10160233 Ga0207695_101602331 569
978 3300025914 Ga0207671_10001497 Ga0207671_1000149712 569
979 3300025914 Ga0207671_10003026 Ga0207671_1000302612 569
980 3300025914 Ga0207671_10025759 Ga0207671_100257592 569
981 3300025914 Ga0207671_10058017 Ga0207671_100580172 569
982 3300025914 Ga0207671_10062741 Ga0207671_100627412 569
983 3300025919 Ga0207657_10034826 Ga0207657_100348263 569
984 3300025924 Ga0207694_10002468 Ga0207694_100024687 569
985 3300025924 Ga0207694_10048422 Ga0207694_100484223 569
986 3300025926 Ga0207659_10069542 Ga0207659_100695422 569
987 3300025937 Ga0207669_10036801 Ga0207669_100368012 569
988 3300025940 Ga0207691_10010941 Ga0207691_100109413 569
989 3300025940 Ga0207691_10030613 Ga0207691_100306132 569
990 3300025942 Ga0207689_10005369 Ga0207689_100053698 569
991 3300025942 Ga0207689_10065241 Ga0207689_100652412 569
992 3300025949 Ga0207667_10000135 Ga0207667_1000013514 569
993 3300025949 Ga0207667_10000177 Ga0207667_1000017726 569
994 3300025949 Ga0207667_10015326 Ga0207667_100153263 569
995 3300026089 Ga0207648_10015625 Ga0207648_100156255 569
996 3300026089 Ga0207648_10032020 Ga0207648_100320202 569
997 3300026118 Ga0207675_100001526 Ga0207675_10000152612 569
998 3300026118 Ga0207675_100159215 Ga0207675_1001592152 569
999 3300026121 Ga0207683_10002413 Ga0207683_100024138 569
1000 3300026142 Ga0207698_10025890 Ga0207698_100258901 569
1001 3300026142 Ga0207698_10038399 Ga0207698_100383992 569
1002 3300028379 Ga0268266_10000049 Ga0268266_1000004954 569
1003 3300028379 Ga0268266_10045180 Ga0268266_100451802 569
1004 3300028381 Ga0268264_10000041 Ga0268264_10000041319 569
1005 3300028381 Ga0268264_10022094 Ga0268264_100220942 569
1006 3300031730 Ga0307516_10019622 Ga0307516_100196223 569
1007 3300033180 Ga0307510_10000091 Ga0307510_1000009138 569
1008 3300042876 Ga0451577_0005641 Ga0451577_0005641_7625_9337 569
1009 3300044658 Ga0466972_0002650 Ga0466972_0002650_1723_3441 569
1010 3300044712 Ga0453684_0000841 Ga0453684_0000841_49309_51021 569
1011 3300045049 Ga0466959_0043416 Ga0466959_0043416_407_2122 569
1012 3300045051 Ga0451576_0007420 Ga0451576_0007420_1935_3647 569
1013 3300046460 Ga0495638_0000004 Ga0495638_0000004_18851_20563 569
1014 3300046492 Ga0495585_0001026 Ga0495585_0001026_3724_5439 569
1015 3300046507 Ga0495606_0002804 Ga0495606_0002804_5081_6799 569
1016 3300046524 Ga0495648_0004838 Ga0495648_0004838_5422_7140 569
1017 3300046557 Ga0495622_0014803 Ga0495622_0014803_190_1905 569
1018 3300046616 Ga0495668_0000179 Ga0495668_0000179_45260_46975 569
1019 3300046648 Ga0495611_0000844 Ga0495611_0000844_2099_3817 569
1020 3300046660 Ga0495625_0001614 Ga0495625_0001614_14514_16229 569
1021 3300046660 Ga0495625_0061513 Ga0495625_0061513_13_1728 569
1022 3300046683 Ga0495658_0061016 Ga0495658_0061016_99_1814 569
1023 3300046694 Ga0495649_0053860 Ga0495649_0053860_72_1790 569
1024 3300047320 Ga0495672_0009330 Ga0495672_0009330_1001_2716 569
1025 3300047443 Ga0495687_000001 Ga0495687_000001_369216_370934 569
1026 3300047472 Ga0495686_0000004 Ga0495686_0000004_403816_405534 569
1027 3300047472 Ga0495686_0023882 Ga0495686_0023882_395_2110 569
1028 3300049523 Ga0501300_001090 Ga0501300_001090_1462_3249 569
1029 3300049570 Ga0501033_0003857 Ga0501033_0003857_7291_9009 569
1030 3300049572 Ga0501036_0002308 Ga0501036_0002308_5870_7588 569
1031 3300049573 Ga0501037_0003677 Ga0501037_0003677_2875_4593 569
1032 3300049574 Ga0501038_0001672 Ga0501038_0001672_18479_20197 569
1033 3300049575 Ga0501039_0003220 Ga0501039_0003220_3054_4772 569
1034 3300049576 Ga0501040_0001734 Ga0501040_0001734_7417_9135 569
1035 3300049577 Ga0501041_0000591 Ga0501041_0000591_7311_9029 569
1036 3300049579 Ga0501043_0003719 Ga0501043_0003719_5041_6759 569
1037 3300049580 Ga0501046_0000247 Ga0501046_0000247_42322_44040 569
1038 3300049582 Ga0501048_0000787 Ga0501048_0000787_7278_8996 569
1039 3300049584 Ga0501068_0007617 Ga0501068_0007617_3927_5645 569
1040 3300049586 Ga0501070_0004418 Ga0501070_0004418_3289_5007 569
1041 3300049587 Ga0501071_0012893 Ga0501071_0012893_1061_2779 569
1042 3300049588 Ga0501072_0003004 Ga0501072_0003004_3616_5334 569
1043 3300049591 Ga0501075_0000564 Ga0501075_0000564_7384_9102 569
1044 3300049592 Ga0501076_0003134 Ga0501076_0003134_1611_3329 569
1045 3300049593 Ga0501077_0001149 Ga0501077_0001149_1670_3388 569
1046 3300049686 Ga0501257_003399 Ga0501257_003399_1525_3237 569
1047 3300049741 Ga0501079_0000889 Ga0501079_0000889_11396_13114 569
1048 3300049742 Ga0501080_0009919 Ga0501080_0009919_58_1776 569
1049 3300049743 Ga0501081_0000241 Ga0501081_0000241_13657_15375 569
1050 3300049761 Ga0501264_000010 Ga0501264_000010_10022_11734 569
1051 3300049822 Ga0501035_0022127 Ga0501035_0022127_2907_4625 569
1052 3300049823 Ga0501044_0057472 Ga0501044_0057472_1130_2845 569
1053 3300049823 Ga0501044_0125062 Ga0501044_0125062_185_1903 569
1054 3300049824 Ga0501045_0000347 Ga0501045_0000347_7203_8921 569
1055 3300049824 Ga0501045_0019579 Ga0501045_0019579_675_2408 569
1056 3300053130 Ga0500642_0016020 Ga0500642_0016020_935_2653 569
1057 3300053139 Ga0500568_0000880 Ga0500568_0000880_3434_5149 569
1058 3300053139 Ga0500568_0007674 Ga0500568_0007674_2674_4392 569
1059 3300053153 Ga0500616_0000091 Ga0500616_0000091_19089_20801 569
1060 3300054114 Ga0501084_0002318 Ga0501084_0002318_9089_10807 569
1061 3300060353 Ga0501082_0002017 Ga0501082_0002017_7819_9537 569
1062 3300061734 Ga0530510_0001017 Ga0530510_0001017_10704_12422 569
1063 iso_pu_bacteria 2509276022 2509398256 569
1064 iso_pu_bacteria 2643221595 2643986310 569
1065 iso_pu_bacteria 2643221603 2644027219 569
1066 iso_pu_bacteria 2643221627 2644152542 569
1067 iso_pu_bacteria 2643221634 2644191977 569
1068 iso_pu_bacteria 2842775625 2842778572 569
1069 iso_pu_bacteria 2856320880 2856326357 569
1070 iso_pu_bacteria 2869278585 2869284019 569
1071 iso_pu_bacteria 2874139085 2874144638 569
1072 iso_pu_bacteria 2878738818 2878743987 569
1073 iso_pu_bacteria 2888337043 2888342072 569
1074 iso_pu_bacteria 2924718760 2924722172 569
1075 iso_pu_bacteria 2924776078 2924781904 569
1076 iso_pu_bacteria 2937877337 2937884767 569
1077 iso_pu_bacteria 2937972304 2937978040 569
1078 iso_pu_bacteria 2958034702 2958040408 569
1079 iso_pu_bacteria 2958041894 2958055256 569
1080 iso_pu_bacteria 2958064165 2958068253 569
1081 iso_pu_bacteria 2958084443 2958092076 569
1082 iso_pu_bacteria 2958092219 2958094368 569
1083 iso_pu_bacteria 2968016561 2968021966 569
1084 iso_pu_bacteria 2970469710 2970474556 569
1085 iso_pu_bacteria 2970593180 2970598631 569
1086 iso_pu_bacteria 2996348954 2996353965 569
1087 iso_pu_bacteria 3004275668 3004280633 569
1088 3300001989 JGI24739J22299_10001200 JGI24739J22299_100012005 570
1089 3300003316 rootH1_10027701 rootH1_100277011 570
1090 3300003316 rootH1_10078771 rootH1_100787712 570
1091 3300003323 rootH1_10000759 rootH1_1000075922 570
1092 3300003323 rootH1_10019846 rootH1_100198469 570
1093 3300003323 rootH1_10091236 rootH1_100912364 570
1094 3300005335 Ga0070666_10013814 Ga0070666_100138143 570
1095 3300005354 Ga0070675_100010177 Ga0070675_1000101773 570
1096 3300005354 Ga0070675_100061126 Ga0070675_1000611262 570
1097 3300005364 Ga0070673_100003789 Ga0070673_1000037897 570
1098 3300005535 Ga0070684_100052722 Ga0070684_1000527223 570
1099 3300005543 Ga0070672_100001253 Ga0070672_10000125312 570
1100 3300005548 Ga0070665_100000006 Ga0070665_100000006406 570
1101 3300005563 Ga0068855_100021735 Ga0068855_1000217354 570
1102 3300005563 Ga0068855_100041594 Ga0068855_1000415943 570
1103 3300005577 Ga0068857_100035648 Ga0068857_1000356482 570
1104 3300005578 Ga0068854_100014670 Ga0068854_1000146703 570
1105 3300005616 Ga0068852_100001067 Ga0068852_10000106714 570
1106 3300005840 Ga0068870_10025823 Ga0068870_100258233 570
1107 3300005843 Ga0068860_100000005 Ga0068860_100000005325 570
1108 3300005844 Ga0068862_100068195 Ga0068862_1000681953 570
1109 3300005937 Ga0081455_10018606 Ga0081455_100186062 570
1110 3300009093 Ga0105240_10005669 Ga0105240_100056698 570
1111 3300009093 Ga0105240_10021984 Ga0105240_100219845 570
1112 3300009545 Ga0105237_10000555 Ga0105237_1000055523 570
1113 3300009545 Ga0105237_10025875 Ga0105237_100258753 570
1114 3300009551 Ga0105238_10009815 Ga0105238_100098151 570
1115 3300010375 Ga0105239_10000970 Ga0105239_1000097028 570
1116 3300013104 Ga0157370_10111260 Ga0157370_101112601 570
1117 3300013105 Ga0157369_10006060 Ga0157369_100060606 570
1118 3300013296 Ga0157374_10000029 Ga0157374_10000029105 570
1119 3300013306 Ga0163162_10002485 Ga0163162_100024859 570
1120 3300013306 Ga0163162_10060993 Ga0163162_100609933 570
1121 3300013307 Ga0157372_10001117 Ga0157372_100011172 570
1122 3300013308 Ga0157375_10006449 Ga0157375_100064494 570
1123 3300014326 Ga0157380_10001777 Ga0157380_100017778 570
1124 3300014969 Ga0157376_10000288 Ga0157376_1000028817 570
1125 3300025893 Ga0207682_10005238 Ga0207682_100052383 570
1126 3300025907 Ga0207645_10080504 Ga0207645_100805042 570
1127 3300025912 Ga0207707_10128331 Ga0207707_101283312 570
1128 3300025913 Ga0207695_10064512 Ga0207695_100645122 570
1129 3300025914 Ga0207671_10012580 Ga0207671_100125803 570
1130 3300025914 Ga0207671_10021713 Ga0207671_100217132 570
1131 3300025914 Ga0207671_10136495 Ga0207671_101364951 570
1132 3300025924 Ga0207694_10150728 Ga0207694_101507281 570
1133 3300025940 Ga0207691_10001534 Ga0207691_1000153419 570
1134 3300025940 Ga0207691_10007322 Ga0207691_100073223 570
1135 3300025949 Ga0207667_10002602 Ga0207667_100026027 570
1136 3300025949 Ga0207667_10010462 Ga0207667_100104623 570
1137 3300026088 Ga0207641_10061416 Ga0207641_100614163 570
1138 3300026088 Ga0207641_10082299 Ga0207641_100822992 570
1139 3300026089 Ga0207648_10061960 Ga0207648_100619603 570
1140 3300026095 Ga0207676_10082977 Ga0207676_100829772 570
1141 3300026116 Ga0207674_10049085 Ga0207674_100490853 570
1142 3300027312 Ga0209371_1006193 Ga0209371_10061934 570
1143 3300028379 Ga0268266_10000010 Ga0268266_10000010486 570
1144 3300028381 Ga0268264_10000012 Ga0268264_10000012306 570
1145 3300030500 Ga0268256_1001478 Ga0268256_10014783 570
1146 3300031456 Ga0307513_10006796 Ga0307513_1000679612 570
1147 3300031616 Ga0307508_10091929 Ga0307508_100919292 570
1148 3300035695 Ga0373927_0067639 Ga0373927_0067639_426_2147 570
1149 3300041404 Ga0439436_0003081 Ga0439436_0003081_1363_3084 570
1150 3300041512 Ga0451853_3542700 Ga0451853_3542700_1961_3682 570
1151 3300042007 Ga0439449_0019743 Ga0439449_0019743_171_1892 570
1152 3300042014 Ga0439457_004730 Ga0439457_004730_1523_3244 570
1153 3300044658 Ga0466972_0000066 Ga0466972_0000066_46674_48392 570
1154 3300044842 Ga0466957_0016708 Ga0466957_0016708_588_2309 570
1155 3300046460 Ga0495638_0002027 Ga0495638_0002027_8789_10501 570
1156 3300046461 Ga0495641_0035593 Ga0495641_0035593_265_1998 570
1157 3300046524 Ga0495648_0005660 Ga0495648_0005660_5831_7552 570
1158 3300047443 Ga0495687_000009 Ga0495687_000009_292425_294146 570
1159 3300049581 Ga0501047_0010933 Ga0501047_0010933_2758_4479 570
1160 3300049649 Ga0501198_001072 Ga0501198_001072_1452_3170 570
1161 3300049651 Ga0501201_001338 Ga0501201_001338_162_1880 570
1162 3300049669 Ga0501235_000298 Ga0501235_000298_6865_8583 570
1163 3300049705 Ga0501225_0002947 Ga0501225_0002947_2851_4572 570
1164 3300049705 Ga0501225_0003366 Ga0501225_0003366_243_1961 570
1165 3300050493 nmdc:mga0k408_258_c1 nmdc:mga0k408_258_c1_8833_10611 570
1166 3300053086 Ga0500578_0000042 Ga0500578_0000042_55507_57228 570
1167 3300053092 Ga0500583_0000023 Ga0500583_0000023_66827_68548 570
1168 3300053125 Ga0500618_000574 Ga0500618_000574_10513_12234 570
1169 3300053153 Ga0500616_0058341 Ga0500616_0058341_111_1832 570
1170 iso_pu_bacteria 2508501050 2508727222 570
1171 iso_pu_bacteria 2508501114 2509077679 570
1172 iso_pu_bacteria 2643221577 2643896475 570
1173 iso_pu_bacteria 2643221685 2644478769 570
1174 iso_pu_bacteria 2773857925 2774871397 570
1175 iso_pu_bacteria 2818991457 2819660314 570
1176 iso_pu_bacteria 2835312727 2835313881 570
1177 iso_pu_bacteria 2852684882 2852689150 570
1178 iso_pu_bacteria 2882456835 2882460201 570
1179 iso_pu_bacteria 2894232714 2894233984 570
1180 iso_pu_bacteria 2895498888 2895499276 570
1181 iso_pu_bacteria 2895511927 2895512297 570
1182 iso_pu_bacteria 2895522137 2895522307 570
1183 iso_pu_bacteria 2895525241 2895527249 570
1184 iso_pu_bacteria 2919130084 2919130409 570
1185 iso_pu_bacteria 2929195423 2929198583 570
1186 iso_pu_bacteria 2937610967 2937613536 570
1187 iso_pu_bacteria 3007315729 3007318425 570
1188 iso_pu_bacteria 8002745576 8002747549 570
1189 iso_pu_bacteria 8002869464 8002870137 570
1190 iso_pu_bacteria 8021622325 8021624874 570
1191 iso_pu_bacteria 8021626552 8021627855 570
1192 iso_pu_bacteria 8021648035 8021651912 570
1193 3300005327 Ga0070658_10025804 Ga0070658_100258042 571
1194 3300005329 Ga0070683_100038807 Ga0070683_1000388072 571
1195 3300005329 Ga0070683_100119600 Ga0070683_1001196002 571
1196 3300005331 Ga0070670_100044896 Ga0070670_1000448963 571
1197 3300005334 Ga0068869_100030435 Ga0068869_1000304351 571
1198 3300005338 Ga0068868_100083497 Ga0068868_1000834972 571
1199 3300005339 Ga0070660_100046674 Ga0070660_1000466742 571
1200 3300005340 Ga0070689_100127268 Ga0070689_1001272682 571
1201 3300005343 Ga0070687_100059207 Ga0070687_1000592071 571
1202 3300005355 Ga0070671_100002043 Ga0070671_1000020436 571
1203 3300005365 Ga0070688_100046559 Ga0070688_1000465592 571
1204 3300005366 Ga0070659_100012803 Ga0070659_1000128032 571
1205 3300005367 Ga0070667_100000008 Ga0070667_100000008144 571
1206 3300005435 Ga0070714_100107899 Ga0070714_1001078992 571
1207 3300005458 Ga0070681_10002731 Ga0070681_1000273112 571
1208 3300005458 Ga0070681_10009647 Ga0070681_100096477 571
1209 3300005458 Ga0070681_10016790 Ga0070681_100167902 571
1210 3300005530 Ga0070679_100003313 Ga0070679_10000331311 571
1211 3300005539 Ga0068853_100002085 Ga0068853_1000020857 571
1212 3300005539 Ga0068853_100153353 Ga0068853_1001533532 571
1213 3300005543 Ga0070672_100007962 Ga0070672_1000079624 571
1214 3300005563 Ga0068855_100013875 Ga0068855_1000138758 571
1215 3300005563 Ga0068855_100040465 Ga0068855_1000404652 571
1216 3300005563 Ga0068855_100084487 Ga0068855_1000844872 571
1217 3300005564 Ga0070664_100016459 Ga0070664_1000164594 571
1218 3300005564 Ga0070664_100056278 Ga0070664_1000562782 571
1219 3300005577 Ga0068857_100135902 Ga0068857_1001359022 571
1220 3300005578 Ga0068854_100024484 Ga0068854_1000244842 571
1221 3300005614 Ga0068856_100021384 Ga0068856_1000213845 571
1222 3300005616 Ga0068852_100006577 Ga0068852_1000065777 571
1223 3300005616 Ga0068852_100033864 Ga0068852_1000338643 571
1224 3300005616 Ga0068852_100081827 Ga0068852_1000818272 571
1225 3300005719 Ga0068861_100023914 Ga0068861_1000239144 571
1226 3300005719 Ga0068861_100091168 Ga0068861_1000911682 571
1227 3300005834 Ga0068851_10005265 Ga0068851_100052655 571
1228 3300005834 Ga0068851_10007899 Ga0068851_100078995 571
1229 3300005834 Ga0068851_10015229 Ga0068851_100152292 571
1230 3300005834 Ga0068851_10030114 Ga0068851_100301141 571
1231 3300005840 Ga0068870_10000326 Ga0068870_1000032613 571
1232 3300005841 Ga0068863_100016366 Ga0068863_1000163663 571
1233 3300005841 Ga0068863_100181124 Ga0068863_1001811241 571
1234 3300005842 Ga0068858_100043377 Ga0068858_1000433775 571
1235 3300005843 Ga0068860_100063495 Ga0068860_1000634953 571
1236 3300005844 Ga0068862_100118041 Ga0068862_1001180412 571
1237 3300005981 Ga0081538_10008990 Ga0081538_100089908 571
1238 3300006237 Ga0097621_100048005 Ga0097621_1000480052 571
1239 3300006237 Ga0097621_100074801 Ga0097621_1000748013 571
1240 3300007265 Ga0099794_10061540 Ga0099794_100615401 571
1241 3300009093 Ga0105240_10000008 Ga0105240_10000008107 571
1242 3300009093 Ga0105240_10000054 Ga0105240_1000005433 571
1243 3300009545 Ga0105237_10000248 Ga0105237_1000024826 571
1244 3300009545 Ga0105237_10024011 Ga0105237_100240113 571
1245 3300009551 Ga0105238_10024923 Ga0105238_100249232 571
1246 3300009553 Ga0105249_10016022 Ga0105249_100160223 571
1247 3300010375 Ga0105239_10000996 Ga0105239_1000099612 571
1248 3300013104 Ga0157370_10010515 Ga0157370_100105153 571
1249 3300013104 Ga0157370_10010755 Ga0157370_100107552 571
1250 3300013104 Ga0157370_10043870 Ga0157370_100438703 571
1251 3300013104 Ga0157370_10131639 Ga0157370_101316391 571
1252 3300013105 Ga0157369_10094622 Ga0157369_100946222 571
1253 3300013297 Ga0157378_10018182 Ga0157378_100181824 571
1254 3300013306 Ga0163162_10001429 Ga0163162_100014298 571
1255 3300013307 Ga0157372_10034045 Ga0157372_100340453 571
1256 3300013307 Ga0157372_10185966 Ga0157372_101859662 571
1257 3300014326 Ga0157380_10009370 Ga0157380_100093704 571
1258 3300020082 Ga0206353_10810131 Ga0206353_108101312 571
1259 3300025228 Ga0209672_102368 Ga0209672_1023681 571
1260 3300025261 Ga0209233_1002148 Ga0209233_10021485 571
1261 3300025315 Ga0207697_10004556 Ga0207697_100045565 571
1262 3300025893 Ga0207682_10002884 Ga0207682_100028845 571
1263 3300025907 Ga0207645_10001460 Ga0207645_100014605 571
1264 3300025908 Ga0207643_10000186 Ga0207643_1000018620 571
1265 3300025911 Ga0207654_10071771 Ga0207654_100717712 571
1266 3300025912 Ga0207707_10010871 Ga0207707_100108717 571
1267 3300025912 Ga0207707_10022710 Ga0207707_100227105 571
1268 3300025912 Ga0207707_10041539 Ga0207707_100415392 571
1269 3300025913 Ga0207695_10000021 Ga0207695_10000021295 571
1270 3300025913 Ga0207695_10000043 Ga0207695_10000043267 571
1271 3300025913 Ga0207695_10006194 Ga0207695_100061944 571
1272 3300025914 Ga0207671_10000671 Ga0207671_1000067131 571
1273 3300025914 Ga0207671_10066806 Ga0207671_100668062 571
1274 3300025917 Ga0207660_10014532 Ga0207660_100145324 571
1275 3300025917 Ga0207660_10074288 Ga0207660_100742882 571
1276 3300025918 Ga0207662_10034238 Ga0207662_100342381 571
1277 3300025919 Ga0207657_10001149 Ga0207657_1000114921 571
1278 3300025921 Ga0207652_10011118 Ga0207652_100111186 571
1279 3300025925 Ga0207650_10025705 Ga0207650_100257053 571
1280 3300025926 Ga0207659_10019606 Ga0207659_100196063 571
1281 3300025931 Ga0207644_10011258 Ga0207644_100112585 571
1282 3300025931 Ga0207644_10021070 Ga0207644_100210703 571
1283 3300025936 Ga0207670_10079073 Ga0207670_100790731 571
1284 3300025940 Ga0207691_10004954 Ga0207691_100049547 571
1285 3300025942 Ga0207689_10000409 Ga0207689_1000040935 571
1286 3300025944 Ga0207661_10101465 Ga0207661_101014652 571
1287 3300025949 Ga0207667_10026254 Ga0207667_100262542 571
1288 3300025949 Ga0207667_10039797 Ga0207667_100397972 571
1289 3300025949 Ga0207667_10116840 Ga0207667_101168402 571
1290 3300025972 Ga0207668_10111988 Ga0207668_101119882 571
1291 3300025981 Ga0207640_10023258 Ga0207640_100232584 571
1292 3300025986 Ga0207658_10000030 Ga0207658_1000003024 571
1293 3300026035 Ga0207703_10174297 Ga0207703_101742971 571
1294 3300026041 Ga0207639_10056919 Ga0207639_100569192 571
1295 3300026067 Ga0207678_10011277 Ga0207678_100112772 571
1296 3300026095 Ga0207676_10005841 Ga0207676_100058414 571
1297 3300026116 Ga0207674_10000357 Ga0207674_1000035757 571
1298 3300026118 Ga0207675_100000872 Ga0207675_10000087224 571
1299 3300026118 Ga0207675_100080135 Ga0207675_1000801352 571
1300 3300026121 Ga0207683_10003038 Ga0207683_1000303810 571
1301 3300027876 Ga0209974_10003272 Ga0209974_100032721 571
1302 3300028379 Ga0268266_10095979 Ga0268266_100959792 571
1303 3300028556 Ga0265337_1002039 Ga0265337_10020394 571
1304 3300028563 Ga0265319_1003800 Ga0265319_10038002 571
1305 3300028573 Ga0265334_10000665 Ga0265334_100006656 571
1306 3300028577 Ga0265318_10001512 Ga0265318_1000151213 571
1307 3300028666 Ga0265336_10000091 Ga0265336_1000009144 571
1308 3300028800 Ga0265338_10000094 Ga0265338_1000009449 571
1309 3300029957 Ga0265324_10002737 Ga0265324_100027376 571
1310 3300030760 Ga0265762_1000015 Ga0265762_100001511 571
1311 3300031235 Ga0265330_10002898 Ga0265330_100028987 571
1312 3300031247 Ga0265340_10000777 Ga0265340_100007779 571
1313 3300031344 Ga0265316_10026826 Ga0265316_100268262 571
1314 3300031731 Ga0307405_10005296 Ga0307405_100052965 571
1315 3300031852 Ga0307410_10019486 Ga0307410_100194863 571
1316 3300031852 Ga0307410_10051036 Ga0307410_100510362 571
1317 3300031901 Ga0307406_10022045 Ga0307406_100220454 571
1318 3300031995 Ga0307409_100001880 Ga0307409_1000018807 571
1319 3300032002 Ga0307416_100050227 Ga0307416_1000502272 571
1320 3300032005 Ga0307411_10014317 Ga0307411_100143176 571
1321 3300032005 Ga0307411_10024286 Ga0307411_100242863 571
1322 3300044706 Ga0466964_0011561 Ga0466964_0011561_372_2096 571
1323 3300046507 Ga0495606_0006725 Ga0495606_0006725_3525_5249 571
1324 3300046519 Ga0495632_0010918 Ga0495632_0010918_2611_4326 571
1325 3300046648 Ga0495611_0000010 Ga0495611_0000010_31406_33130 571
1326 3300046660 Ga0495625_0034296 Ga0495625_0034296_661_2376 571
1327 3300048903 Ga0496100_0017401 Ga0496100_0017401_1700_3424 571
1328 3300048905 Ga0496102_0012401 Ga0496102_0012401_5538_7262 571
1329 3300048909 Ga0496106_0005704 Ga0496106_0005704_3944_5668 571
1330 3300048910 Ga0496107_0007566 Ga0496107_0007566_1191_2915 571
1331 3300048911 Ga0496108_0005837 Ga0496108_0005837_6498_8222 571
1332 3300048912 Ga0496109_0003008 Ga0496109_0003008_9184_10908 571
1333 3300048913 Ga0496110_0028692 Ga0496110_0028692_2714_4438 571
1334 3300048917 Ga0496114_0058004 Ga0496114_0058004_351_2075 571
1335 3300049583 Ga0501067_0024303 Ga0501067_0024303_1255_2970 571
1336 3300049584 Ga0501068_0002040 Ga0501068_0002040_5664_7379 571
1337 3300049586 Ga0501070_0005410 Ga0501070_0005410_7624_9348 571
1338 3300049586 Ga0501070_0046458 Ga0501070_0046458_1102_2817 571
1339 3300049587 Ga0501071_0001727 Ga0501071_0001727_4041_5756 571
1340 3300049589 Ga0501073_0001384 Ga0501073_0001384_2437_4152 571
1341 3300049589 Ga0501073_0001548 Ga0501073_0001548_7218_8942 571
1342 3300049590 Ga0501074_0001537 Ga0501074_0001537_5560_7284 571
1343 3300049590 Ga0501074_0019172 Ga0501074_0019172_2345_4060 571
1344 3300049591 Ga0501075_0035690 Ga0501075_0035690_1252_2967 571
1345 3300049593 Ga0501077_0005387 Ga0501077_0005387_3304_5019 571
1346 3300049741 Ga0501079_0000033 Ga0501079_0000033_36375_38090 571
1347 3300049742 Ga0501080_0001783 Ga0501080_0001783_15392_17107 571
1348 3300049742 Ga0501080_0007140 Ga0501080_0007140_3166_4890 571
1349 3300049742 Ga0501080_0024728 Ga0501080_0024728_3077_4801 571
1350 3300049744 Ga0501083_0010528 Ga0501083_0010528_2078_3802 571
1351 3300050511 nmdc:mga08y16_54505_c1 nmdc:mga08y16_54505_c1_2124_3848 571
1352 3300054114 Ga0501084_0006383 Ga0501084_0006383_5799_7514 571
1353 3300054114 Ga0501084_0053775 Ga0501084_0053775_1624_3348 571
1354 3300003187 JGI25151J46595_10001193 JGI25151J46595_1000119311 572
1355 3300003771 Ga0055526_1000723 Ga0055526_100072319 572
1356 3300003771 Ga0055526_1010357 Ga0055526_10103573 572
1357 3300003781 Ga0055536_1000219 Ga0055536_10002195 572
1358 3300003781 Ga0055536_1003998 Ga0055536_10039984 572
1359 3300003784 Ga0055534_1001363 Ga0055534_10013633 572
1360 3300005327 Ga0070658_10021249 Ga0070658_100212492 572
1361 3300005340 Ga0070689_100068108 Ga0070689_1000681082 572
1362 3300005355 Ga0070671_100002005 Ga0070671_10000200510 572
1363 3300005366 Ga0070659_100004754 Ga0070659_1000047544 572
1364 3300005457 Ga0070662_100002343 Ga0070662_1000023432 572
1365 3300005466 Ga0070685_10058711 Ga0070685_100587112 572
1366 3300005530 Ga0070679_100128575 Ga0070679_1001285752 572
1367 3300005543 Ga0070672_100110485 Ga0070672_1001104852 572
1368 3300005563 Ga0068855_100159858 Ga0068855_1001598582 572
1369 3300005564 Ga0070664_100003198 Ga0070664_1000031983 572
1370 3300005577 Ga0068857_100019687 Ga0068857_1000196874 572
1371 3300005614 Ga0068856_100003737 Ga0068856_1000037378 572
1372 3300005616 Ga0068852_100009196 Ga0068852_1000091964 572
1373 3300006880 Ga0075429_100140889 Ga0075429_1001408892 572
1374 3300006914 Ga0075436_100016268 Ga0075436_1000162681 572
1375 3300009094 Ga0111539_10000665 Ga0111539_1000066515 572
1376 3300009094 Ga0111539_10008255 Ga0111539_1000825510 572
1377 3300009094 Ga0111539_10023989 Ga0111539_100239895 572
1378 3300009177 Ga0105248_10156373 Ga0105248_101563732 572
1379 3300013102 Ga0157371_10000601 Ga0157371_100006018 572
1380 3300013104 Ga0157370_10007304 Ga0157370_100073047 572
1381 3300014326 Ga0157380_10011071 Ga0157380_100110713 572
1382 3300025291 Ga0209675_1000040 Ga0209675_100004091 572
1383 3300025292 Ga0209676_1000014 Ga0209676_1000014563 572
1384 3300025292 Ga0209676_1000093 Ga0209676_1000093136 572
1385 3300025294 Ga0209025_1000092 Ga0209025_100009291 572
1386 3300025295 Ga0209564_1000159 Ga0209564_100015955 572
1387 3300025295 Ga0209564_1000218 Ga0209564_10002189 572
1388 3300025303 Ga0209051_1002454 Ga0209051_10024547 572
1389 3300025909 Ga0207705_10012043 Ga0207705_100120432 572
1390 3300025919 Ga0207657_10001270 Ga0207657_1000127018 572
1391 3300025919 Ga0207657_10017091 Ga0207657_100170916 572
1392 3300025926 Ga0207659_10091043 Ga0207659_100910432 572
1393 3300025931 Ga0207644_10016472 Ga0207644_100164722 572
1394 3300025931 Ga0207644_10051140 Ga0207644_100511402 572
1395 3300025933 Ga0207706_10000877 Ga0207706_1000087722 572
1396 3300025935 Ga0207709_10042165 Ga0207709_100421652 572
1397 3300025936 Ga0207670_10005467 Ga0207670_100054676 572
1398 3300025940 Ga0207691_10015412 Ga0207691_100154122 572
1399 3300025949 Ga0207667_10007079 Ga0207667_100070798 572
1400 3300025986 Ga0207658_10117742 Ga0207658_101177421 572
1401 3300026067 Ga0207678_10120869 Ga0207678_101208692 572
1402 3300026116 Ga0207674_10009845 Ga0207674_100098458 572
1403 3300026142 Ga0207698_10008141 Ga0207698_100081413 572
1404 3300027907 Ga0207428_10059322 Ga0207428_100593222 572
1405 3300031548 Ga0307408_100000012 Ga0307408_100000012159 572
1406 3300031595 Ga0265313_10004963 Ga0265313_100049632 572
1407 3300031901 Ga0307406_10036211 Ga0307406_100362112 572
1408 3300031903 Ga0307407_10011071 Ga0307407_100110712 572
1409 3300032002 Ga0307416_100031608 Ga0307416_1000316084 572
1410 3300032002 Ga0307416_100050165 Ga0307416_1000501651 572
1411 3300035112 Ga0373932_0000899 Ga0373932_0000899_4419_6146 572
1412 3300035115 Ga0373941_0001232 Ga0373941_0001232_2219_3946 572
1413 3300035207 Ga0373942_0004480 Ga0373942_0004480_379_2106 572
1414 3300035691 Ga0373931_0000240 Ga0373931_0000240_16858_18585 572
1415 3300036712 Ga0316584_0059153 Ga0316584_0059153_116_1891 572
1416 3300037068 Ga0373925_0003223 Ga0373925_0003223_1412_3157 572
1417 3300037418 Ga0395900_0037630 Ga0395900_0037630_1554_3281 572
1418 3300038443 Ga0395901_0111869 Ga0395901_0111869_714_2441 572
1419 3300039437 Ga0436365_1141651 Ga0436365_1141651_519_2246 572
1420 3300039450 Ga0436363_1450588 Ga0436363_1450588_2948_4675 572
1421 3300044658 Ga0466972_0058382 Ga0466972_0058382_31_1764 572
1422 3300046492 Ga0495585_0011525 Ga0495585_0011525_216_1943 572
1423 3300046513 Ga0495616_0003016 Ga0495616_0003016_625_2343 572
1424 3300046543 Ga0495645_0005153 Ga0495645_0005153_4433_6160 572
1425 3300046679 Ga0495623_0007552 Ga0495623_0007552_1580_3307 572
1426 3300048909 Ga0496106_0011577 Ga0496106_0011577_148_1875 572
1427 3300048910 Ga0496107_0003901 Ga0496107_0003901_5062_6789 572
1428 3300049569 Ga0501032_0071255 Ga0501032_0071255_531_2258 572
1429 3300049572 Ga0501036_0023902 Ga0501036_0023902_2339_4066 572
1430 3300049574 Ga0501038_0000362 Ga0501038_0000362_18126_19853 572
1431 3300049575 Ga0501039_0005719 Ga0501039_0005719_3212_4939 572
1432 3300049579 Ga0501043_0007335 Ga0501043_0007335_3814_5541 572
1433 3300049580 Ga0501046_0001124 Ga0501046_0001124_8018_9745 572
1434 3300049581 Ga0501047_0059030 Ga0501047_0059030_657_2384 572
1435 3300049581 Ga0501047_0147768 Ga0501047_0147768_119_1846 572
1436 3300049582 Ga0501048_0098115 Ga0501048_0098115_94_1821 572
1437 3300049585 Ga0501069_0002295 Ga0501069_0002295_5558_7285 572
1438 3300049586 Ga0501070_0001510 Ga0501070_0001510_5689_7416 572
1439 3300049589 Ga0501073_0001695 Ga0501073_0001695_10611_12338 572
1440 3300049590 Ga0501074_0004126 Ga0501074_0004126_3076_4803 572
1441 3300049742 Ga0501080_0000394 Ga0501080_0000394_15479_17206 572
1442 3300049744 Ga0501083_0052137 Ga0501083_0052137_657_2384 572
1443 3300049823 Ga0501044_0003662 Ga0501044_0003662_6896_8623 572
1444 3300050508 nmdc:mga09592_34056_c1 nmdc:mga09592_34056_c1_1077_2804 572
1445 3300050511 nmdc:mga08y16_6181_c1 nmdc:mga08y16_6181_c1_864_2591 572
1446 3300053077 Ga0495601_0009477 Ga0495601_0009477_1647_3374 572
1447 iso_pu_bacteria 2939669807 2939673028 572
1448 3300001990 JGI24737J22298_10001648 JGI24737J22298_100016483 573
1449 3300003214 JGI25165J46597_1000641 JGI25165J46597_100064117 573
1450 3300005329 Ga0070683_100007379 Ga0070683_10000737913 573
1451 3300005331 Ga0070670_100001436 Ga0070670_10000143622 573
1452 3300005335 Ga0070666_10031350 Ga0070666_100313505 573
1453 3300005338 Ga0068868_100000489 Ga0068868_10000048923 573
1454 3300005339 Ga0070660_100009031 Ga0070660_1000090312 573
1455 3300005343 Ga0070687_100072953 Ga0070687_1000729531 573
1456 3300005353 Ga0070669_100019673 Ga0070669_1000196733 573
1457 3300005354 Ga0070675_100000808 Ga0070675_10000080816 573
1458 3300005355 Ga0070671_100000766 Ga0070671_10000076614 573
1459 3300005364 Ga0070673_100000760 Ga0070673_1000007607 573
1460 3300005456 Ga0070678_100150125 Ga0070678_1001501251 573
1461 3300005539 Ga0068853_100078638 Ga0068853_1000786382 573
1462 3300005546 Ga0070696_100004763 Ga0070696_1000047638 573
1463 3300005564 Ga0070664_100000907 Ga0070664_10000090718 573
1464 3300005578 Ga0068854_100007413 Ga0068854_1000074132 573
1465 3300005616 Ga0068852_100001703 Ga0068852_10000170313 573
1466 3300005618 Ga0068864_100004751 Ga0068864_10000475111 573
1467 3300005719 Ga0068861_100055358 Ga0068861_1000553583 573
1468 3300005834 Ga0068851_10005926 Ga0068851_100059263 573
1469 3300005981 Ga0081538_10007018 Ga0081538_100070185 573
1470 3300006237 Ga0097621_100002478 Ga0097621_1000024781 573
1471 3300006358 Ga0068871_100001328 Ga0068871_10000132814 573
1472 3300009551 Ga0105238_10004448 Ga0105238_100044485 573
1473 3300009551 Ga0105238_10015237 Ga0105238_100152375 573
1474 3300010375 Ga0105239_10009015 Ga0105239_100090155 573
1475 3300013296 Ga0157374_10000833 Ga0157374_1000083317 573
1476 3300013297 Ga0157378_10003339 Ga0157378_1000333911 573
1477 3300013308 Ga0157375_10002044 Ga0157375_100020442 573
1478 3300025233 Ga0209437_100064 Ga0209437_10006456 573
1479 3300025261 Ga0209233_1000081 Ga0209233_1000081246 573
1480 3300025297 Ga0209758_1000169 Ga0209758_100016947 573
1481 3300025321 Ga0207656_10009682 Ga0207656_100096823 573
1482 3300025907 Ga0207645_10003092 Ga0207645_100030923 573
1483 3300025914 Ga0207671_10010727 Ga0207671_100107275 573
1484 3300025924 Ga0207694_10002748 Ga0207694_100027485 573
1485 3300025925 Ga0207650_10002377 Ga0207650_1000237713 573
1486 3300025926 Ga0207659_10000451 Ga0207659_1000045115 573
1487 3300025931 Ga0207644_10037618 Ga0207644_100376182 573
1488 3300025933 Ga0207706_10146261 Ga0207706_101462612 573
1489 3300025944 Ga0207661_10011069 Ga0207661_100110692 573
1490 3300025945 Ga0207679_10001204 Ga0207679_1000120411 573
1491 3300025981 Ga0207640_10002318 Ga0207640_1000231813 573
1492 3300025986 Ga0207658_10036460 Ga0207658_100364602 573
1493 3300026023 Ga0207677_10022413 Ga0207677_100224132 573
1494 3300026095 Ga0207676_10009328 Ga0207676_100093283 573
1495 3300026118 Ga0207675_100003993 Ga0207675_1000039936 573
1496 3300026121 Ga0207683_10001016 Ga0207683_1000101610 573
1497 3300026142 Ga0207698_10000786 Ga0207698_1000078610 573
1498 3300028577 Ga0265318_10009367 Ga0265318_100093673 573
1499 3300031250 Ga0265331_10003629 Ga0265331_100036294 573
1500 3300031250 Ga0265331_10011722 Ga0265331_100117225 573
1501 3300031456 Ga0307513_10086444 Ga0307513_100864443 573
1502 3300031507 Ga0307509_10036387 Ga0307509_100363873 573
1503 3300031595 Ga0265313_10003442 Ga0265313_100034428 573
1504 3300031711 Ga0265314_10001520 Ga0265314_1000152012 573
1505 3300031711 Ga0265314_10052896 Ga0265314_100528962 573
1506 3300031712 Ga0265342_10021086 Ga0265342_100210861 573
1507 3300036712 Ga0316584_0005493 Ga0316584_0005493_4586_6316 573
1508 3300037312 Ga0395899_0001647 Ga0395899_0001647_6888_8609 573
1509 3300037312 Ga0395899_0005993 Ga0395899_0005993_7610_9331 573
1510 3300039062 Ga0400483_135128 Ga0400483_135128_1862_3595 573
1511 3300039062 Ga0400483_140637 Ga0400483_140637_181_1914 573
1512 3300039062 Ga0400483_161077 Ga0400483_161077_666_2399 573
1513 3300039062 Ga0400483_254359 Ga0400483_254359_22784_24517 573
1514 3300044765 Ga0466970_0009896 Ga0466970_0009896_659_2380 573
1515 3300045836 Ga0466958_0005665 Ga0466958_0005665_1840_3567 573
1516 3300048907 Ga0496104_0032002 Ga0496104_0032002_35_1765 573
1517 3300048913 Ga0496110_0005614 Ga0496110_0005614_1203_2933 573
1518 3300048914 Ga0496111_0002995 Ga0496111_0002995_6682_8412 573
1519 3300048923 Ga0496120_0004189 Ga0496120_0004189_9776_11503 573
1520 3300048929 Ga0496126_0090035 Ga0496126_0090035_428_2155 573
1521 3300049569 Ga0501032_0005396 Ga0501032_0005396_6594_8327 573
1522 3300049571 Ga0501034_0022923 Ga0501034_0022923_3994_5727 573
1523 3300049574 Ga0501038_0035578 Ga0501038_0035578_1456_3189 573
1524 3300049574 Ga0501038_0039102 Ga0501038_0039102_2041_3771 573
1525 3300049575 Ga0501039_0036966 Ga0501039_0036966_1929_3659 573
1526 3300049577 Ga0501041_0015839 Ga0501041_0015839_876_2606 573
1527 3300049579 Ga0501043_0056907 Ga0501043_0056907_427_2160 573
1528 3300049581 Ga0501047_0007188 Ga0501047_0007188_7005_8738 573
1529 3300049582 Ga0501048_0080704 Ga0501048_0080704_460_2187 573
1530 3300049585 Ga0501069_0049721 Ga0501069_0049721_336_2069 573
1531 3300049586 Ga0501070_0018072 Ga0501070_0018072_3993_5726 573
1532 3300049587 Ga0501071_0046321 Ga0501071_0046321_661_2391 573
1533 3300049591 Ga0501075_0014218 Ga0501075_0014218_292_2022 573
1534 3300049592 Ga0501076_0014132 Ga0501076_0014132_2538_4268 573
1535 3300049744 Ga0501083_0007984 Ga0501083_0007984_240_1973 573
1536 3300049822 Ga0501035_0010083 Ga0501035_0010083_5178_6926 573
1537 3300049823 Ga0501044_0006170 Ga0501044_0006170_9657_11390 573
1538 3300049824 Ga0501045_0011373 Ga0501045_0011373_3155_4882 573
1539 3300050509 nmdc:mga0qj67_46927_c1 nmdc:mga0qj67_46927_c1_769_2499 573
1540 3300050515 nmdc:mga0a205_53348_c1 nmdc:mga0a205_53348_c1_1152_2885 573
1541 3300053092 Ga0500583_0001035 Ga0500583_0001035_1683_3413 573
1542 3300053092 Ga0500583_0012576 Ga0500583_0012576_201_1925 573
1543 3300053139 Ga0500568_0012030 Ga0500568_0012030_1933_3663 573
1544 3300053139 Ga0500568_0020782 Ga0500568_0020782_951_2675 573
1545 3300053153 Ga0500616_0000074 Ga0500616_0000074_86861_88585 573
1546 3300053153 Ga0500616_0000997 Ga0500616_0000997_19954_21684 573
1547 3300059491 Ga0587070_003293 Ga0587070_003293_164_1885 573
1548 3300059645 Ga0587076_000108 Ga0587076_000108_1102_2823 573
1549 3300059645 Ga0587076_000791 Ga0587076_000791_567_2288 573
1550 3300060344 Ga0587071_000307 Ga0587071_000307_1484_3205 573
1551 3300060346 Ga0587111_0000129 Ga0587111_0000129_2926_4647 573
1552 3300060346 Ga0587111_0001272 Ga0587111_0001272_607_2328 573
1553 3300060353 Ga0501082_0071046 Ga0501082_0071046_433_2166 573
1554 iso_pu_bacteria 2751185897 2753763005 573
1555 3300001989 JGI24739J22299_10005441 JGI24739J22299_100054414 574
1556 3300002741 JGI25157J39369_1000256 JGI25157J39369_10002569 574
1557 3300003187 JGI25151J46595_10000586 JGI25151J46595_1000058610 574
1558 3300003752 Ga0055539_1001711 Ga0055539_10017112 574
1559 3300003756 Ga0055533_1002287 Ga0055533_10022872 574
1560 3300003759 Ga0055525_1000043 Ga0055525_100004361 574
1561 3300003760 Ga0055527_1000305 Ga0055527_100030515 574
1562 3300003760 Ga0055527_1000393 Ga0055527_100039316 574
1563 3300003761 Ga0055535_1000652 Ga0055535_100065215 574
1564 3300003761 Ga0055535_1000974 Ga0055535_10009743 574
1565 3300003762 Ga0055542_1000672 Ga0055542_100067215 574
1566 3300003762 Ga0055542_1000970 Ga0055542_10009703 574
1567 3300003763 Ga0055529_1000620 Ga0055529_100062014 574
1568 3300003763 Ga0055529_1000818 Ga0055529_10008183 574
1569 3300003856 Ga0058692_1000017 Ga0058692_1000017185 574
1570 3300005262 Ga0065165_1004243 Ga0065165_10042433 574
1571 3300005289 Ga0065704_10103010 Ga0065704_101030102 574
1572 3300005330 Ga0070690_100048350 Ga0070690_1000483501 574
1573 3300005331 Ga0070670_100097870 Ga0070670_1000978701 574
1574 3300005337 Ga0070682_100012555 Ga0070682_1000125554 574
1575 3300005434 Ga0070709_10008330 Ga0070709_100083306 574
1576 3300005435 Ga0070714_100009506 Ga0070714_1000095066 574
1577 3300005436 Ga0070713_100010524 Ga0070713_1000105247 574
1578 3300005440 Ga0070705_100002145 Ga0070705_1000021457 574
1579 3300005455 Ga0070663_100020181 Ga0070663_1000201811 574
1580 3300005543 Ga0070672_100001924 Ga0070672_1000019246 574
1581 3300005543 Ga0070672_100086476 Ga0070672_1000864762 574
1582 3300005547 Ga0070693_100033350 Ga0070693_1000333501 574
1583 3300005548 Ga0070665_100002302 Ga0070665_1000023022 574
1584 3300005548 Ga0070665_100004515 Ga0070665_1000045155 574
1585 3300005549 Ga0070704_100037227 Ga0070704_1000372272 574
1586 3300005578 Ga0068854_100001302 Ga0068854_1000013026 574
1587 3300005614 Ga0068856_100003470 Ga0068856_1000034702 574
1588 3300005617 Ga0068859_100096264 Ga0068859_1000962642 574
1589 3300005719 Ga0068861_100003919 Ga0068861_1000039198 574
1590 3300005719 Ga0068861_100078681 Ga0068861_1000786812 574
1591 3300005834 Ga0068851_10013951 Ga0068851_100139511 574
1592 3300005840 Ga0068870_10026543 Ga0068870_100265432 574
1593 3300005841 Ga0068863_100019561 Ga0068863_1000195615 574
1594 3300005937 Ga0081455_10015718 Ga0081455_100157182 574
1595 3300005937 Ga0081455_10038479 Ga0081455_100384792 574
1596 3300006237 Ga0097621_100011591 Ga0097621_1000115915 574
1597 3300006914 Ga0075436_100015958 Ga0075436_1000159583 574
1598 3300006931 Ga0097620_100096265 Ga0097620_1000962652 574
1599 3300009093 Ga0105240_10001565 Ga0105240_1000156519 574
1600 3300009148 Ga0105243_10040017 Ga0105243_100400172 574
1601 3300009176 Ga0105242_10015422 Ga0105242_100154222 574
1602 3300009545 Ga0105237_10000010 Ga0105237_10000010161 574
1603 3300009551 Ga0105238_10032996 Ga0105238_100329965 574
1604 3300013105 Ga0157369_10050582 Ga0157369_100505824 574
1605 3300014326 Ga0157380_10062053 Ga0157380_100620532 574
1606 3300021361 Ga0213872_10031734 Ga0213872_100317341 574
1607 3300025226 Ga0209674_100059 Ga0209674_100059168 574
1608 3300025226 Ga0209674_100790 Ga0209674_1007906 574
1609 3300025228 Ga0209672_100004 Ga0209672_100004706 574
1610 3300025228 Ga0209672_100008 Ga0209672_100008610 574
1611 3300025230 Ga0209563_100036 Ga0209563_100036189 574
1612 3300025242 Ga0209258_100003 Ga0209258_100003706 574
1613 3300025242 Ga0209258_100004 Ga0209258_100004580 574
1614 3300025242 Ga0209258_100008 Ga0209258_100008205 574
1615 3300025250 Ga0209026_1000045 Ga0209026_1000045202 574
1616 3300025253 Ga0209677_101303 Ga0209677_1013032 574
1617 3300025254 Ga0209148_1000025 Ga0209148_100002510 574
1618 3300025254 Ga0209148_1000053 Ga0209148_1000053325 574
1619 3300025256 Ga0209759_1000212 Ga0209759_100021271 574
1620 3300025272 Ga0209455_1000004 Ga0209455_1000004706 574
1621 3300025272 Ga0209455_1000007 Ga0209455_1000007325 574
1622 3300025272 Ga0209455_1000405 Ga0209455_10004059 574
1623 3300025294 Ga0209025_1000282 Ga0209025_100028289 574
1624 3300025297 Ga0209758_1000974 Ga0209758_100097421 574
1625 3300025735 Ga0207713_1000393 Ga0207713_100039315 574
1626 3300025893 Ga0207682_10008737 Ga0207682_100087372 574
1627 3300025904 Ga0207647_10012031 Ga0207647_100120316 574
1628 3300025907 Ga0207645_10057360 Ga0207645_100573602 574
1629 3300025913 Ga0207695_10000400 Ga0207695_1000040049 574
1630 3300025914 Ga0207671_10000013 Ga0207671_10000013232 574
1631 3300025918 Ga0207662_10050234 Ga0207662_100502341 574
1632 3300025924 Ga0207694_10015380 Ga0207694_100153805 574
1633 3300025925 Ga0207650_10011897 Ga0207650_100118974 574
1634 3300025925 Ga0207650_10026512 Ga0207650_100265121 574
1635 3300025929 Ga0207664_10003289 Ga0207664_100032895 574
1636 3300025934 Ga0207686_10030493 Ga0207686_100304932 574
1637 3300025940 Ga0207691_10013082 Ga0207691_100130828 574
1638 3300025940 Ga0207691_10015118 Ga0207691_100151182 574
1639 3300025940 Ga0207691_10039099 Ga0207691_100390994 574
1640 3300025949 Ga0207667_10000081 Ga0207667_1000008175 574
1641 3300025981 Ga0207640_10000223 Ga0207640_1000022328 574
1642 3300026035 Ga0207703_10089463 Ga0207703_100894633 574
1643 3300026067 Ga0207678_10034046 Ga0207678_100340462 574
1644 3300026075 Ga0207708_10010414 Ga0207708_100104142 574
1645 3300026078 Ga0207702_10000654 Ga0207702_1000065410 574
1646 3300026088 Ga0207641_10046760 Ga0207641_100467602 574
1647 3300026116 Ga0207674_10000159 Ga0207674_1000015919 574
1648 3300026116 Ga0207674_10119515 Ga0207674_101195152 574
1649 3300026118 Ga0207675_100022740 Ga0207675_1000227405 574
1650 3300026118 Ga0207675_100041926 Ga0207675_1000419261 574
1651 3300027312 Ga0209371_1000044 Ga0209371_1000044240 574
1652 3300028379 Ga0268266_10017537 Ga0268266_100175374 574
1653 3300030500 Ga0268256_1000046 Ga0268256_1000046240 574
1654 3300031456 Ga0307513_10016752 Ga0307513_100167525 574
1655 3300031456 Ga0307513_10025919 Ga0307513_100259191 574
1656 3300031456 Ga0307513_10031051 Ga0307513_100310512 574
1657 3300031507 Ga0307509_10023313 Ga0307509_100233132 574
1658 3300031824 Ga0307413_10036155 Ga0307413_100361552 574
1659 3300031852 Ga0307410_10004936 Ga0307410_100049362 574
1660 3300031903 Ga0307407_10010579 Ga0307407_100105793 574
1661 3300031903 Ga0307407_10037317 Ga0307407_100373172 574
1662 3300031995 Ga0307409_100004509 Ga0307409_1000045092 574
1663 3300031995 Ga0307409_100009088 Ga0307409_1000090882 574
1664 3300032002 Ga0307416_100030348 Ga0307416_1000303484 574
1665 3300032005 Ga0307411_10003510 Ga0307411_100035104 574
1666 3300033180 Ga0307510_10102238 Ga0307510_101022382 574
1667 3300035118 Ga0373954_0000003 Ga0373954_0000003_62460_64193 574
1668 3300035724 Ga0373933_0002250 Ga0373933_0002250_3027_4760 574
1669 3300037312 Ga0395899_0000226 Ga0395899_0000226_28521_30245 574
1670 3300037418 Ga0395900_0000011 Ga0395900_0000011_373126_374850 574
1671 3300037466 Ga0395898_0000029 Ga0395898_0000029_130171_131895 574
1672 3300038443 Ga0395901_0104306 Ga0395901_0104306_941_2665 574
1673 3300041404 Ga0439436_0005279 Ga0439436_0005279_1581_3305 574
1674 3300041413 Ga0439465_0000738 Ga0439465_0000738_1132_2856 574
1675 3300041443 Ga0451789_0328144 Ga0451789_0328144_71_1795 574
1676 3300041459 Ga0451800_0252034 Ga0451800_0252034_1391_3115 574
1677 3300041459 Ga0451800_0551749 Ga0451800_0551749_56_1780 574
1678 3300041462 Ga0451806_025862 Ga0451806_025862_2967_4691 574
1679 3300041463 Ga0451804_0359998 Ga0451804_0359998_326_2050 574
1680 3300041463 Ga0451804_0727978 Ga0451804_0727978_84_1808 574
1681 3300041486 Ga0451807_1729626 Ga0451807_1729626_1391_3115 574
1682 3300041509 Ga0451843_0331670 Ga0451843_0331670_275_1999 574
1683 3300042004 Ga0439445_0006216 Ga0439445_0006216_651_2375 574
1684 3300042007 Ga0439449_0000136 Ga0439449_0000136_17959_19683 574
1685 3300042121 Ga0450919_001002 Ga0450919_001002_1370_3106 574
1686 3300042876 Ga0451577_0000068 Ga0451577_0000068_123650_125374 574
1687 3300042876 Ga0451577_0020693 Ga0451577_0020693_616_2340 574
1688 3300044656 Ga0466969_0004147 Ga0466969_0004147_108_1832 574
1689 3300044673 Ga0453683_0031443 Ga0453683_0031443_383_2107 574
1690 3300044684 Ga0466966_0010972 Ga0466966_0010972_1538_3262 574
1691 3300044693 Ga0466961_0000057 Ga0466961_0000057_37154_38920 574
1692 3300044693 Ga0466961_0000299 Ga0466961_0000299_9162_10886 574
1693 3300044712 Ga0453684_0000126 Ga0453684_0000126_33601_35325 574
1694 3300044765 Ga0466970_0002111 Ga0466970_0002111_3307_5031 574
1695 3300045049 Ga0466959_0000006 Ga0466959_0000006_106090_107814 574
1696 3300045051 Ga0451576_0012737 Ga0451576_0012737_2286_4010 574
1697 3300045836 Ga0466958_0085200 Ga0466958_0085200_207_1931 574
1698 3300046453 Ga0495627_007125 Ga0495627_007125_276_2006 574
1699 3300046457 Ga0495590_0005537 Ga0495590_0005537_505_2229 574
1700 3300046460 Ga0495638_0006731 Ga0495638_0006731_1325_3049 574
1701 3300046460 Ga0495638_0058764 Ga0495638_0058764_436_2160 574
1702 3300046512 Ga0495610_0012871 Ga0495610_0012871_2248_3996 574
1703 3300046513 Ga0495616_0001662 Ga0495616_0001662_6631_8355 574
1704 3300046519 Ga0495632_0032924 Ga0495632_0032924_743_2467 574
1705 3300046660 Ga0495625_0011056 Ga0495625_0011056_2715_4439 574
1706 3300046660 Ga0495625_0034067 Ga0495625_0034067_138_1862 574
1707 3300046665 Ga0495661_0021737 Ga0495661_0021737_1240_3060 574
1708 3300046694 Ga0495649_0001020 Ga0495649_0001020_18351_20168 574
1709 3300046694 Ga0495649_0005526 Ga0495649_0005526_2400_4124 574
1710 3300048924 Ga0496121_0005500 Ga0496121_0005500_11751_13475 574
1711 3300048928 Ga0496125_0000044 Ga0496125_0000044_262021_263745 574
1712 3300049569 Ga0501032_0013929 Ga0501032_0013929_2192_3919 574
1713 3300049571 Ga0501034_0032866 Ga0501034_0032866_3158_4885 574
1714 3300049579 Ga0501043_0049366 Ga0501043_0049366_1470_3197 574
1715 3300049580 Ga0501046_0015436 Ga0501046_0015436_1991_3718 574
1716 3300049587 Ga0501071_0012879 Ga0501071_0012879_2231_3955 574
1717 3300049589 Ga0501073_0000641 Ga0501073_0000641_15452_17176 574
1718 3300049593 Ga0501077_0007486 Ga0501077_0007486_2569_4293 574
1719 3300049742 Ga0501080_0007353 Ga0501080_0007353_3929_5653 574
1720 3300050514 nmdc:mga08x19_34734_c1 nmdc:mga08x19_34734_c1_1136_2869 574
1721 3300053136 Ga0500559_0001354 Ga0500559_0001354_8060_9811 574
1722 3300053161 Ga0500634_0014029 Ga0500634_0014029_1174_2904 574
1723 3300054114 Ga0501084_0002542 Ga0501084_0002542_7417_9141 574
1724 3300060353 Ga0501082_0027798 Ga0501082_0027798_264_1988 574
1725 3300013104 Ga0157370_10035604 Ga0157370_100356043 575
1726 3300047319 Ga0495674_0009625 Ga0495674_0009625_328_2076 575
1727 3300005337 Ga0070682_100006411 Ga0070682_1000064113 576
1728 3300005466 Ga0070685_10019728 Ga0070685_100197282 576
1729 3300009094 Ga0111539_10121013 Ga0111539_101210132 576
1730 3300009176 Ga0105242_10010417 Ga0105242_100104174 576
1731 3300014325 Ga0163163_10124369 Ga0163163_101243692 576
1732 3300025934 Ga0207686_10001460 Ga0207686_100014603 576
1733 3300026088 Ga0207641_10031952 Ga0207641_100319523 576
1734 3300026095 Ga0207676_10099321 Ga0207676_100993212 576
1735 3300045051 Ga0451576_0229500 Ga0451576_0229500_57_1796 576
1736 3300046463 Ga0495653_0060752 Ga0495653_0060752_840_2579 576
1737 3300046511 Ga0495608_0006211 Ga0495608_0006211_2543_4282 576
1738 3300046516 Ga0495628_0002765 Ga0495628_0002765_12408_14147 576
1739 3300046517 Ga0495630_0007543 Ga0495630_0007543_4736_6475 576
1740 3300046533 Ga0495640_0002870 Ga0495640_0002870_8472_10211 576
1741 3300046535 Ga0495586_0000323 Ga0495586_0000323_13720_15459 576
1742 3300046536 Ga0495587_0023217 Ga0495587_0023217_1345_3084 576
1743 3300046642 Ga0495634_0001658 Ga0495634_0001658_13085_14824 576
1744 3300046689 Ga0495613_0009447 Ga0495613_0009447_4049_5788 576
1745 3300046690 Ga0495624_0009244 Ga0495624_0009244_1095_2834 576
1746 3300046809 Ga0495600_0005445 Ga0495600_0005445_1852_3591 576
1747 3300047317 Ga0495604_0005797 Ga0495604_0005797_3636_5375 576
1748 3300047322 Ga0495680_0004648 Ga0495680_0004648_1305_3044 576
1749 3300050511 nmdc:mga08y16_79473_c1 nmdc:mga08y16_79473_c1_751_2490 576
1750 3300005329 Ga0070683_100001109 Ga0070683_10000110910 577
1751 3300005338 Ga0068868_100041896 Ga0068868_1000418962 577
1752 3300005340 Ga0070689_100016986 Ga0070689_1000169862 577
1753 3300005344 Ga0070661_100013472 Ga0070661_1000134722 577
1754 3300005344 Ga0070661_100019540 Ga0070661_1000195401 577
1755 3300005457 Ga0070662_100010712 Ga0070662_1000107123 577
1756 3300005535 Ga0070684_100002631 Ga0070684_1000026313 577
1757 3300005535 Ga0070684_100004494 Ga0070684_1000044943 577
1758 3300005539 Ga0068853_100002841 Ga0068853_1000028414 577
1759 3300005543 Ga0070672_100012236 Ga0070672_1000122362 577
1760 3300005548 Ga0070665_100131384 Ga0070665_1001313842 577
1761 3300005564 Ga0070664_100001767 Ga0070664_1000017679 577
1762 3300005577 Ga0068857_100003091 Ga0068857_1000030914 577
1763 3300005617 Ga0068859_100006240 Ga0068859_1000062405 577
1764 3300005618 Ga0068864_100012119 Ga0068864_1000121191 577
1765 3300006931 Ga0097620_100006240 Ga0097620_1000062404 577
1766 3300009011 Ga0105251_10003501 Ga0105251_100035017 577
1767 3300013102 Ga0157371_10003863 Ga0157371_100038636 577
1768 3300013296 Ga0157374_10000261 Ga0157374_1000026128 577
1769 3300013306 Ga0163162_10004794 Ga0163162_100047949 577
1770 3300013308 Ga0157375_10005063 Ga0157375_100050635 577
1771 3300014325 Ga0163163_10007450 Ga0163163_100074503 577
1772 3300025904 Ga0207647_10058204 Ga0207647_100582042 577
1773 3300025920 Ga0207649_10017722 Ga0207649_100177222 577
1774 3300025920 Ga0207649_10024633 Ga0207649_100246332 577
1775 3300025936 Ga0207670_10009202 Ga0207670_100092023 577
1776 3300025940 Ga0207691_10014958 Ga0207691_100149584 577
1777 3300025942 Ga0207689_10016509 Ga0207689_100165093 577
1778 3300025944 Ga0207661_10002307 Ga0207661_100023075 577
1779 3300025944 Ga0207661_10014005 Ga0207661_100140052 577
1780 3300025945 Ga0207679_10002603 Ga0207679_100026035 577
1781 3300026023 Ga0207677_10036833 Ga0207677_100368332 577
1782 3300026041 Ga0207639_10031212 Ga0207639_100312122 577
1783 3300026095 Ga0207676_10011036 Ga0207676_100110363 577
1784 3300026116 Ga0207674_10002307 Ga0207674_100023075 577
1785 3300028379 Ga0268266_10125486 Ga0268266_101254862 577
1786 3300028381 Ga0268264_10147620 Ga0268264_101476202 577
1787 3300005985 Ga0081539_10029286 Ga0081539_100292862 578
1788 3300009093 Ga0105240_10000283 Ga0105240_1000028349 578
1789 3300009174 Ga0105241_10000542 Ga0105241_100005428 578
1790 3300009551 Ga0105238_10003699 Ga0105238_100036994 578
1791 3300025911 Ga0207654_10019867 Ga0207654_100198673 578
1792 3300025913 Ga0207695_10000684 Ga0207695_1000068426 578
1793 3300025924 Ga0207694_10021256 Ga0207694_100212562 578
1794 iso_pu_bacteria 2738543024 2739306725 578
1795 3300005290 Ga0065712_10015539 Ga0065712_100155392 580
1796 3300005329 Ga0070683_100043783 Ga0070683_1000437832 580
1797 3300005337 Ga0070682_100049077 Ga0070682_1000490772 580
1798 3300005339 Ga0070660_100009871 Ga0070660_1000098715 580
1799 3300026088 Ga0207641_10000013 Ga0207641_10000013189 580
1800 3300046531 Ga0495665_0013184 Ga0495665_0013184_373_2151 584
1801 3300005841 Ga0068863_100080423 Ga0068863_1000804232 585
1802 3300025321 Ga0207656_10010296 Ga0207656_100102962 585
1803 3300026142 Ga0207698_10099257 Ga0207698_100992572 585
1804 iso_pu_bacteria 2643221618 2644105197 585
1805 iso_pu_bacteria 2643221626 2644145727 585
1806 iso_pu_bacteria 2643221655 2644309610 585
1807 iso_pu_bacteria 2643221698 2644543339 585
1808 iso_pu_bacteria 2643221712 2644616134 585
1809 3300005616 Ga0068852_100001789 Ga0068852_10000178910 587
1810 3300025981 Ga0207640_10032095 Ga0207640_100320952 587
1811 3300053153 Ga0500616_0014927 Ga0500616_0014927_1354_3129 590
1812 3300035695 Ga0373927_0000282 Ga0373927_0000282_2201_4090 599
1813 3300009011 Ga0105251_10000219 Ga0105251_1000021910 604
1814 3300048920 Ga0496117_0001420 Ga0496117_0001420_14745_16559 604
1815 3300048921 Ga0496118_0021248 Ga0496118_0021248_1210_3024 604
1816 3300048922 Ga0496119_0002453 Ga0496119_0002453_1215_3029 604
1817 3300048923 Ga0496120_0002147 Ga0496120_0002147_18003_19817 604
1818 3300048925 Ga0496122_0003345 Ga0496122_0003345_1262_3076 604
1819 3300048926 Ga0496123_0002721 Ga0496123_0002721_1220_3034 604
1820 3300048927 Ga0496124_0058331 Ga0496124_0058331_145_1959 604
1821 3300037312 Ga0395899_0002404 Ga0395899_0002404_6077_7897 606
1822 3300039062 Ga0400483_220317 Ga0400483_220317_2977_4863 611
1823 2162886007 SwRhRL2b_contig_295801 SwRhRL2b_0163.00000470 623

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00920

ILVD_EDD

Dehydratase family

95

611

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8epz-assembly1.cif.gz_B crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn 0.9935 58 623
5j83-assembly1.cif.gz_A crystal structure of l-arabinonate dehydratase in apo-form 0.9891 56 623
8epz-assembly1.cif.gz_B crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn 0.9883 58 623
5j83-assembly1.cif.gz_A crystal structure of l-arabinonate dehydratase in apo-form 0.9755 56 623
5oyn-assembly1.cif.gz_D crystal structure of d-xylonate dehydratase in holo-form 0.9744 53 611
ID Description Score Start End Superfamily
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9497 59 422 3.40.50.360
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9202 59 422 3.40.50.360
af_I1M137_1_420_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8483 13 422 3.40.50.1820
af_I1M137_1_420_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8268 13 422 3.40.50.1820
af_Q58672_371_522_3.50.30.80 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like 0.818 426 580 3.50.30.80
ID Description Score Start End GO Terms
AF-A0A5N7K134-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.9986 155 334 GO:0004160
GO:0019752
GO:0046872
GO:0051536
AF-H1S8E2-F1-model_v4 Dihydroxyacid dehydratase/phosphogluconate dehydratase 0.9973 58 434 GO:0016836
GO:0019752
GO:0046872
GO:0051536
AF-A0A3B8LDC1-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.9968 55 292 GO:0004160
GO:0019752
GO:0046872
GO:0051536
AF-A0A2V9VQF8-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.9964 59 198 GO:0004160
GO:0046872
GO:0051536
AF-A0A365VRI8-F1-model_v4 deleted 0.9964 121 301

Feature Viewer

pLDDT pTM Quality
88.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map